(data stored in ACNUC1104 zone)

EMBL: CP000667

ID   CP000667; SV 1; circular; genomic DNA; STD; PRO; 5183331 BP.
XX
AC   CP000667; AATJ01000000-AATJ01000036;
XX
PR   Project:PRJNA16342;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Salinispora tropica CNB-440, complete genome.
XX
KW   .
XX
OS   Salinispora tropica CNB-440
OC   Bacteria; Actinobacteria; Micromonosporales; Micromonosporaceae;
OC   Salinispora.
XX
RN   [1]
RP   1-5183331
RX   DOI; 10.1073/pnas.0901237106.
RX   PUBMED; 19590008.
RA   Eustaquio A.S., McGlinchey R.P., Liu Y., Hazzard C., Beer L.L., Florova G.,
RA   Alhamadsheh M.M., Lechner A., Kale A.J., Kobayashi Y., Reynolds K.A.,
RA   Moore B.S.;
RT   "Biosynthesis of the salinosporamide A polyketide synthase substrate
RT   chloroethylmalonyl-coenzyme A from S-adenosyl-L-methionine";
RL   Proc. Natl. Acad. Sci. U.S.A. 106(30):12295-12300(2009).
XX
RN   [2]
RP   1-5183331
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Sun H., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Jensen P.R., Moore B.S., Udwary D.W., Richardson P.;
RT   ;
RL   Submitted (10-APR-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; e83286716ba75a3e84cbfcdbe64cb5d9.
DR   BioSample; SAMN02598367.
DR   EnsemblGenomes-Gn; EBG00001278503.
DR   EnsemblGenomes-Gn; EBG00001278504.
DR   EnsemblGenomes-Gn; EBG00001278505.
DR   EnsemblGenomes-Gn; EBG00001278506.
DR   EnsemblGenomes-Gn; EBG00001278507.
DR   EnsemblGenomes-Gn; EBG00001278508.
DR   EnsemblGenomes-Gn; EBG00001278509.
DR   EnsemblGenomes-Gn; EBG00001278510.
DR   EnsemblGenomes-Gn; EBG00001278511.
DR   EnsemblGenomes-Gn; EBG00001278512.
DR   EnsemblGenomes-Gn; EBG00001278513.
DR   EnsemblGenomes-Gn; EBG00001278514.
DR   EnsemblGenomes-Gn; EBG00001278515.
DR   EnsemblGenomes-Gn; EBG00001278516.
DR   EnsemblGenomes-Gn; EBG00001278517.
DR   EnsemblGenomes-Gn; EBG00001278518.
DR   EnsemblGenomes-Gn; EBG00001278519.
DR   EnsemblGenomes-Gn; EBG00001278520.
DR   EnsemblGenomes-Gn; EBG00001278521.
DR   EnsemblGenomes-Gn; EBG00001278522.
DR   EnsemblGenomes-Gn; EBG00001278523.
DR   EnsemblGenomes-Gn; EBG00001278524.
DR   EnsemblGenomes-Gn; EBG00001278525.
DR   EnsemblGenomes-Gn; EBG00001278526.
DR   EnsemblGenomes-Gn; EBG00001278527.
DR   EnsemblGenomes-Gn; EBG00001278528.
DR   EnsemblGenomes-Gn; EBG00001278529.
DR   EnsemblGenomes-Gn; EBG00001278530.
DR   EnsemblGenomes-Gn; EBG00001278531.
DR   EnsemblGenomes-Gn; EBG00001278532.
DR   EnsemblGenomes-Gn; EBG00001278533.
DR   EnsemblGenomes-Gn; EBG00001278534.
DR   EnsemblGenomes-Gn; EBG00001278535.
DR   EnsemblGenomes-Gn; EBG00001278536.
DR   EnsemblGenomes-Gn; EBG00001278537.
DR   EnsemblGenomes-Gn; EBG00001278538.
DR   EnsemblGenomes-Gn; EBG00001278539.
DR   EnsemblGenomes-Gn; EBG00001278540.
DR   EnsemblGenomes-Gn; EBG00001278541.
DR   EnsemblGenomes-Gn; EBG00001278542.
DR   EnsemblGenomes-Gn; EBG00001278543.
DR   EnsemblGenomes-Gn; EBG00001278544.
DR   EnsemblGenomes-Gn; EBG00001278545.
DR   EnsemblGenomes-Gn; EBG00001278546.
DR   EnsemblGenomes-Gn; EBG00001278547.
DR   EnsemblGenomes-Gn; EBG00001278548.
DR   EnsemblGenomes-Gn; EBG00001278549.
DR   EnsemblGenomes-Gn; EBG00001278550.
DR   EnsemblGenomes-Gn; EBG00001278551.
DR   EnsemblGenomes-Gn; EBG00001278552.
DR   EnsemblGenomes-Gn; EBG00001278553.
DR   EnsemblGenomes-Gn; EBG00001278554.
DR   EnsemblGenomes-Gn; EBG00001278555.
DR   EnsemblGenomes-Gn; EBG00001278556.
DR   EnsemblGenomes-Gn; EBG00001278557.
DR   EnsemblGenomes-Gn; EBG00001278558.
DR   EnsemblGenomes-Gn; EBG00001278559.
DR   EnsemblGenomes-Gn; EBG00001278560.
DR   EnsemblGenomes-Gn; EBG00001278561.
DR   EnsemblGenomes-Gn; EBG00001278562.
DR   EnsemblGenomes-Gn; EBG00001278563.
DR   EnsemblGenomes-Gn; EBG00001278564.
DR   EnsemblGenomes-Gn; EBG00001278565.
DR   EnsemblGenomes-Gn; EBG00001278566.
DR   EnsemblGenomes-Gn; EBG00001278567.
DR   EnsemblGenomes-Gn; EBG00001278568.
DR   EnsemblGenomes-Gn; EBG00001278569.
DR   EnsemblGenomes-Gn; EBG00001278570.
DR   EnsemblGenomes-Gn; EBG00001278571.
DR   EnsemblGenomes-Gn; EBG00001278572.
DR   EnsemblGenomes-Gn; EBG00001278573.
DR   EnsemblGenomes-Gn; EBG00001278574.
DR   EnsemblGenomes-Gn; EBG00001278575.
DR   EnsemblGenomes-Gn; EBG00001278576.
DR   EnsemblGenomes-Gn; EBG00001278577.
DR   EnsemblGenomes-Gn; EBG00001278578.
DR   EnsemblGenomes-Gn; EBG00001278579.
DR   EnsemblGenomes-Gn; EBG00001278580.
DR   EnsemblGenomes-Gn; EBG00001278581.
DR   EnsemblGenomes-Gn; EBG00001278582.
DR   EnsemblGenomes-Gn; EBG00001278583.
DR   EnsemblGenomes-Gn; EBG00001278584.
DR   EnsemblGenomes-Gn; EBG00001278585.
DR   EnsemblGenomes-Gn; EBG00001278586.
DR   EnsemblGenomes-Gn; EBG00001278587.
DR   EnsemblGenomes-Gn; EBG00001278588.
DR   EnsemblGenomes-Gn; EBG00001278589.
DR   EnsemblGenomes-Gn; EBG00001278590.
DR   EnsemblGenomes-Gn; EBG00001278591.
DR   EnsemblGenomes-Gn; EBG00001278592.
DR   EnsemblGenomes-Gn; EBG00001278593.
DR   EnsemblGenomes-Gn; EBG00001278594.
DR   EnsemblGenomes-Gn; EBG00001278595.
DR   EnsemblGenomes-Gn; EBG00001278596.
DR   EnsemblGenomes-Gn; EBG00001278597.
DR   EnsemblGenomes-Gn; EBG00001278598.
DR   EnsemblGenomes-Gn; EBG00001278599.
DR   EnsemblGenomes-Gn; EBG00001278600.
DR   EnsemblGenomes-Gn; EBG00001278601.
DR   EnsemblGenomes-Gn; EBG00001278602.
DR   EnsemblGenomes-Gn; EBG00001278603.
DR   EnsemblGenomes-Gn; EBG00001278604.
DR   EnsemblGenomes-Gn; EBG00001278605.
DR   EnsemblGenomes-Gn; EBG00001278606.
DR   EnsemblGenomes-Gn; EBG00001278607.
DR   EnsemblGenomes-Gn; EBG00001278608.
DR   EnsemblGenomes-Gn; EBG00001278609.
DR   EnsemblGenomes-Gn; EBG00001278610.
DR   EnsemblGenomes-Gn; EBG00001278611.
DR   EnsemblGenomes-Gn; EBG00001278612.
DR   EnsemblGenomes-Gn; EBG00001278613.
DR   EnsemblGenomes-Gn; Strop_R0001.
DR   EnsemblGenomes-Gn; Strop_R0002.
DR   EnsemblGenomes-Gn; Strop_R0003.
DR   EnsemblGenomes-Gn; Strop_R0004.
DR   EnsemblGenomes-Gn; Strop_R0005.
DR   EnsemblGenomes-Gn; Strop_R0006.
DR   EnsemblGenomes-Gn; Strop_R0007.
DR   EnsemblGenomes-Gn; Strop_R0008.
DR   EnsemblGenomes-Gn; Strop_R0009.
DR   EnsemblGenomes-Gn; Strop_R0010.
DR   EnsemblGenomes-Gn; Strop_R0011.
DR   EnsemblGenomes-Gn; Strop_R0012.
DR   EnsemblGenomes-Gn; Strop_R0013.
DR   EnsemblGenomes-Gn; Strop_R0014.
DR   EnsemblGenomes-Gn; Strop_R0015.
DR   EnsemblGenomes-Gn; Strop_R0016.
DR   EnsemblGenomes-Gn; Strop_R0017.
DR   EnsemblGenomes-Gn; Strop_R0018.
DR   EnsemblGenomes-Gn; Strop_R0019.
DR   EnsemblGenomes-Gn; Strop_R0020.
DR   EnsemblGenomes-Gn; Strop_R0021.
DR   EnsemblGenomes-Gn; Strop_R0022.
DR   EnsemblGenomes-Gn; Strop_R0023.
DR   EnsemblGenomes-Gn; Strop_R0024.
DR   EnsemblGenomes-Gn; Strop_R0025.
DR   EnsemblGenomes-Gn; Strop_R0026.
DR   EnsemblGenomes-Gn; Strop_R0027.
DR   EnsemblGenomes-Gn; Strop_R0028.
DR   EnsemblGenomes-Gn; Strop_R0029.
DR   EnsemblGenomes-Gn; Strop_R0030.
DR   EnsemblGenomes-Gn; Strop_R0031.
DR   EnsemblGenomes-Gn; Strop_R0032.
DR   EnsemblGenomes-Gn; Strop_R0033.
DR   EnsemblGenomes-Gn; Strop_R0034.
DR   EnsemblGenomes-Gn; Strop_R0035.
DR   EnsemblGenomes-Gn; Strop_R0036.
DR   EnsemblGenomes-Gn; Strop_R0038.
DR   EnsemblGenomes-Gn; Strop_R0039.
DR   EnsemblGenomes-Gn; Strop_R0040.
DR   EnsemblGenomes-Gn; Strop_R0041.
DR   EnsemblGenomes-Gn; Strop_R0042.
DR   EnsemblGenomes-Gn; Strop_R0043.
DR   EnsemblGenomes-Gn; Strop_R0044.
DR   EnsemblGenomes-Gn; Strop_R0045.
DR   EnsemblGenomes-Gn; Strop_R0046.
DR   EnsemblGenomes-Gn; Strop_R0047.
DR   EnsemblGenomes-Gn; Strop_R0048.
DR   EnsemblGenomes-Gn; Strop_R0049.
DR   EnsemblGenomes-Gn; Strop_R0050.
DR   EnsemblGenomes-Gn; Strop_R0051.
DR   EnsemblGenomes-Gn; Strop_R0052.
DR   EnsemblGenomes-Gn; Strop_R0053.
DR   EnsemblGenomes-Gn; Strop_R0054.
DR   EnsemblGenomes-Gn; Strop_R0055.
DR   EnsemblGenomes-Gn; Strop_R0056.
DR   EnsemblGenomes-Gn; Strop_R0057.
DR   EnsemblGenomes-Gn; Strop_R0058.
DR   EnsemblGenomes-Gn; Strop_R0059.
DR   EnsemblGenomes-Gn; Strop_R0060.
DR   EnsemblGenomes-Gn; Strop_R0061.
DR   EnsemblGenomes-Tr; EBT00001810312.
DR   EnsemblGenomes-Tr; EBT00001810313.
DR   EnsemblGenomes-Tr; EBT00001810314.
DR   EnsemblGenomes-Tr; EBT00001810315.
DR   EnsemblGenomes-Tr; EBT00001810316.
DR   EnsemblGenomes-Tr; EBT00001810317.
DR   EnsemblGenomes-Tr; EBT00001810318.
DR   EnsemblGenomes-Tr; EBT00001810319.
DR   EnsemblGenomes-Tr; EBT00001810320.
DR   EnsemblGenomes-Tr; EBT00001810321.
DR   EnsemblGenomes-Tr; EBT00001810322.
DR   EnsemblGenomes-Tr; EBT00001810323.
DR   EnsemblGenomes-Tr; EBT00001810324.
DR   EnsemblGenomes-Tr; EBT00001810325.
DR   EnsemblGenomes-Tr; EBT00001810326.
DR   EnsemblGenomes-Tr; EBT00001810327.
DR   EnsemblGenomes-Tr; EBT00001810328.
DR   EnsemblGenomes-Tr; EBT00001810329.
DR   EnsemblGenomes-Tr; EBT00001810330.
DR   EnsemblGenomes-Tr; EBT00001810331.
DR   EnsemblGenomes-Tr; EBT00001810332.
DR   EnsemblGenomes-Tr; EBT00001810333.
DR   EnsemblGenomes-Tr; EBT00001810334.
DR   EnsemblGenomes-Tr; EBT00001810335.
DR   EnsemblGenomes-Tr; EBT00001810336.
DR   EnsemblGenomes-Tr; EBT00001810337.
DR   EnsemblGenomes-Tr; EBT00001810338.
DR   EnsemblGenomes-Tr; EBT00001810339.
DR   EnsemblGenomes-Tr; EBT00001810340.
DR   EnsemblGenomes-Tr; EBT00001810341.
DR   EnsemblGenomes-Tr; EBT00001810342.
DR   EnsemblGenomes-Tr; EBT00001810343.
DR   EnsemblGenomes-Tr; EBT00001810344.
DR   EnsemblGenomes-Tr; EBT00001810345.
DR   EnsemblGenomes-Tr; EBT00001810346.
DR   EnsemblGenomes-Tr; EBT00001810347.
DR   EnsemblGenomes-Tr; EBT00001810348.
DR   EnsemblGenomes-Tr; EBT00001810349.
DR   EnsemblGenomes-Tr; EBT00001810350.
DR   EnsemblGenomes-Tr; EBT00001810351.
DR   EnsemblGenomes-Tr; EBT00001810352.
DR   EnsemblGenomes-Tr; EBT00001810353.
DR   EnsemblGenomes-Tr; EBT00001810354.
DR   EnsemblGenomes-Tr; EBT00001810355.
DR   EnsemblGenomes-Tr; EBT00001810356.
DR   EnsemblGenomes-Tr; EBT00001810357.
DR   EnsemblGenomes-Tr; EBT00001810358.
DR   EnsemblGenomes-Tr; EBT00001810359.
DR   EnsemblGenomes-Tr; EBT00001810360.
DR   EnsemblGenomes-Tr; EBT00001810361.
DR   EnsemblGenomes-Tr; EBT00001810362.
DR   EnsemblGenomes-Tr; EBT00001810363.
DR   EnsemblGenomes-Tr; EBT00001810364.
DR   EnsemblGenomes-Tr; EBT00001810365.
DR   EnsemblGenomes-Tr; EBT00001810366.
DR   EnsemblGenomes-Tr; EBT00001810367.
DR   EnsemblGenomes-Tr; EBT00001810368.
DR   EnsemblGenomes-Tr; EBT00001810369.
DR   EnsemblGenomes-Tr; EBT00001810370.
DR   EnsemblGenomes-Tr; EBT00001810371.
DR   EnsemblGenomes-Tr; EBT00001810372.
DR   EnsemblGenomes-Tr; EBT00001810373.
DR   EnsemblGenomes-Tr; EBT00001810374.
DR   EnsemblGenomes-Tr; EBT00001810375.
DR   EnsemblGenomes-Tr; EBT00001810376.
DR   EnsemblGenomes-Tr; EBT00001810377.
DR   EnsemblGenomes-Tr; EBT00001810378.
DR   EnsemblGenomes-Tr; EBT00001810379.
DR   EnsemblGenomes-Tr; EBT00001810380.
DR   EnsemblGenomes-Tr; EBT00001810381.
DR   EnsemblGenomes-Tr; EBT00001810382.
DR   EnsemblGenomes-Tr; EBT00001810383.
DR   EnsemblGenomes-Tr; EBT00001810384.
DR   EnsemblGenomes-Tr; EBT00001810385.
DR   EnsemblGenomes-Tr; EBT00001810386.
DR   EnsemblGenomes-Tr; EBT00001810387.
DR   EnsemblGenomes-Tr; EBT00001810388.
DR   EnsemblGenomes-Tr; EBT00001810389.
DR   EnsemblGenomes-Tr; EBT00001810390.
DR   EnsemblGenomes-Tr; EBT00001810391.
DR   EnsemblGenomes-Tr; EBT00001810392.
DR   EnsemblGenomes-Tr; EBT00001810393.
DR   EnsemblGenomes-Tr; EBT00001810394.
DR   EnsemblGenomes-Tr; EBT00001810395.
DR   EnsemblGenomes-Tr; EBT00001810396.
DR   EnsemblGenomes-Tr; EBT00001810397.
DR   EnsemblGenomes-Tr; EBT00001810398.
DR   EnsemblGenomes-Tr; EBT00001810399.
DR   EnsemblGenomes-Tr; EBT00001810400.
DR   EnsemblGenomes-Tr; EBT00001810401.
DR   EnsemblGenomes-Tr; EBT00001810402.
DR   EnsemblGenomes-Tr; EBT00001810403.
DR   EnsemblGenomes-Tr; EBT00001810404.
DR   EnsemblGenomes-Tr; EBT00001810405.
DR   EnsemblGenomes-Tr; EBT00001810406.
DR   EnsemblGenomes-Tr; EBT00001810407.
DR   EnsemblGenomes-Tr; EBT00001810408.
DR   EnsemblGenomes-Tr; EBT00001810409.
DR   EnsemblGenomes-Tr; EBT00001810410.
DR   EnsemblGenomes-Tr; EBT00001810411.
DR   EnsemblGenomes-Tr; EBT00001810412.
DR   EnsemblGenomes-Tr; EBT00001810413.
DR   EnsemblGenomes-Tr; EBT00001810414.
DR   EnsemblGenomes-Tr; EBT00001810415.
DR   EnsemblGenomes-Tr; EBT00001810416.
DR   EnsemblGenomes-Tr; EBT00001810417.
DR   EnsemblGenomes-Tr; EBT00001810418.
DR   EnsemblGenomes-Tr; EBT00001810419.
DR   EnsemblGenomes-Tr; EBT00001810420.
DR   EnsemblGenomes-Tr; EBT00001810421.
DR   EnsemblGenomes-Tr; EBT00001810422.
DR   EnsemblGenomes-Tr; Strop_R0001-1.
DR   EnsemblGenomes-Tr; Strop_R0002-1.
DR   EnsemblGenomes-Tr; Strop_R0003-1.
DR   EnsemblGenomes-Tr; Strop_R0004-1.
DR   EnsemblGenomes-Tr; Strop_R0005-1.
DR   EnsemblGenomes-Tr; Strop_R0006-1.
DR   EnsemblGenomes-Tr; Strop_R0007-1.
DR   EnsemblGenomes-Tr; Strop_R0008-1.
DR   EnsemblGenomes-Tr; Strop_R0009-1.
DR   EnsemblGenomes-Tr; Strop_R0010-1.
DR   EnsemblGenomes-Tr; Strop_R0011-1.
DR   EnsemblGenomes-Tr; Strop_R0012-1.
DR   EnsemblGenomes-Tr; Strop_R0013-1.
DR   EnsemblGenomes-Tr; Strop_R0014-1.
DR   EnsemblGenomes-Tr; Strop_R0015-1.
DR   EnsemblGenomes-Tr; Strop_R0016-1.
DR   EnsemblGenomes-Tr; Strop_R0017-1.
DR   EnsemblGenomes-Tr; Strop_R0018-1.
DR   EnsemblGenomes-Tr; Strop_R0019-1.
DR   EnsemblGenomes-Tr; Strop_R0020-1.
DR   EnsemblGenomes-Tr; Strop_R0021-1.
DR   EnsemblGenomes-Tr; Strop_R0022-1.
DR   EnsemblGenomes-Tr; Strop_R0023-1.
DR   EnsemblGenomes-Tr; Strop_R0024-1.
DR   EnsemblGenomes-Tr; Strop_R0025-1.
DR   EnsemblGenomes-Tr; Strop_R0026-1.
DR   EnsemblGenomes-Tr; Strop_R0027-1.
DR   EnsemblGenomes-Tr; Strop_R0028-1.
DR   EnsemblGenomes-Tr; Strop_R0029-1.
DR   EnsemblGenomes-Tr; Strop_R0030-1.
DR   EnsemblGenomes-Tr; Strop_R0031-1.
DR   EnsemblGenomes-Tr; Strop_R0032-1.
DR   EnsemblGenomes-Tr; Strop_R0033-1.
DR   EnsemblGenomes-Tr; Strop_R0034-1.
DR   EnsemblGenomes-Tr; Strop_R0035-1.
DR   EnsemblGenomes-Tr; Strop_R0036-1.
DR   EnsemblGenomes-Tr; Strop_R0038-1.
DR   EnsemblGenomes-Tr; Strop_R0039-1.
DR   EnsemblGenomes-Tr; Strop_R0040-1.
DR   EnsemblGenomes-Tr; Strop_R0041-1.
DR   EnsemblGenomes-Tr; Strop_R0042-1.
DR   EnsemblGenomes-Tr; Strop_R0043-1.
DR   EnsemblGenomes-Tr; Strop_R0044-1.
DR   EnsemblGenomes-Tr; Strop_R0045-1.
DR   EnsemblGenomes-Tr; Strop_R0046-1.
DR   EnsemblGenomes-Tr; Strop_R0047-1.
DR   EnsemblGenomes-Tr; Strop_R0048-1.
DR   EnsemblGenomes-Tr; Strop_R0049-1.
DR   EnsemblGenomes-Tr; Strop_R0050-1.
DR   EnsemblGenomes-Tr; Strop_R0051-1.
DR   EnsemblGenomes-Tr; Strop_R0052-1.
DR   EnsemblGenomes-Tr; Strop_R0053-1.
DR   EnsemblGenomes-Tr; Strop_R0054-1.
DR   EnsemblGenomes-Tr; Strop_R0055-1.
DR   EnsemblGenomes-Tr; Strop_R0056-1.
DR   EnsemblGenomes-Tr; Strop_R0057-1.
DR   EnsemblGenomes-Tr; Strop_R0058-1.
DR   EnsemblGenomes-Tr; Strop_R0059-1.
DR   EnsemblGenomes-Tr; Strop_R0060-1.
DR   EnsemblGenomes-Tr; Strop_R0061-1.
DR   EuropePMC; PMC1965521; 17563368.
DR   EuropePMC; PMC2718359; 19590008.
DR   EuropePMC; PMC2749086; 19474814.
DR   EuropePMC; PMC3086045; 19081934.
DR   EuropePMC; PMC3314556; 22401625.
DR   EuropePMC; PMC3370544; 22492446.
DR   EuropePMC; PMC3811353; 23892741.
DR   EuropePMC; PMC4753101; 26318027.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01325; CRISPR-DR12.
DR   RFAM; RF01372; CRISPR-DR59.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000667.
DR   SILVA-SSU; CP000667.
DR   StrainInfo; 621777; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001585
CC   Source DNA and bacteria available from Paul Jensen
CC   (pjensen@ucsd.edu)
CC   Contacts: Paul Jensen (pjensen@ucsd.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5183331
FT                   /organism="Salinispora tropica CNB-440"
FT                   /strain="CNB-440"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:369723"
FT   gene            625..2388
FT                   /locus_tag="Strop_0001"
FT   CDS_pept        625..2388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52486"
FT                   /db_xref="GOA:A4X0T6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0T6"
FT                   /protein_id="ABP52486.1"
FT                   /translation="MTDTTDLAAVWTATTDELADEIVSAQQRAYLRLTRLRAIVEDTAL
FT                   VSVPDAFTRDVIESRLRPAITEALTRRLGRPIQVAVTVRAPEDAPGRPAGTIYHSAPSP
FT                   ETGALPGDTTDRAAGGGPDDGVDHRFPLIPGQAQPERRTAAPAGSYGEQTTPMSRDSQE
FT                   PLFSSAFAGPPRGERHDVDEQARLGPPVTERPFEAHYRAEGADQHGGRALPRELGTDSG
FT                   PGRVDHRPGGREDRRPPAPADGGGNRLNPKYMFETFVIGSSNRFAHAASVAVAESPAKA
FT                   YNPLFIYGSSGLGKTHLLHAIGHYATTLGNANSVRYVSTEEFTNDFINSLRDDKTSAFQ
FT                   RRYRDVDILLIDDIQFLENRERTQEEFFHTFNTLHNANKQIVITSDRSPKQLATLEDRL
FT                   RTRFEWGLLADIQPPDLETRIAILQKKAAQERLFAPPDVLEFIASRVSNSIRELEGALI
FT                   RVTAFASLTRSSVELSLAEEVLRDFIPDGTGPEITADQIMVATADYFGVSLEDLRGHSR
FT                   SRVLVNARQVAMYLCRELTDLSLPRIGQAFGGRDHTTVMHADRKIRQQMAERRSLYNQI
FT                   AELTNRIKQNT"
FT   gene            complement(2372..2842)
FT                   /locus_tag="Strop_0002"
FT   CDS_pept        complement(2372..2842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52487"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0T7"
FT                   /protein_id="ABP52487.1"
FT                   /translation="MEKPGENPGCHPQAGVTPSLSTVVHRLSTGYPRTSSPGLWIVSRV
FT                   STRVIPRTFNNLSTPGPPSVDNDTVFPKHPQGYPQGYPQPVDNERVDGLVFSTDATELW
FT                   TTSGTSWRRPDTRIRPTTPIRRPSFRSGGVWSTAYATAAPVQRCGVRLRCSA"
FT   gene            3151..4284
FT                   /locus_tag="Strop_0003"
FT   CDS_pept        3151..4284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52488"
FT                   /db_xref="GOA:A4X0T8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0T8"
FT                   /protein_id="ABP52488.1"
FT                   /translation="MKFRVERDALAEAVAWTAKSLPNRPSVPVLAGVLLRVTDGNLQVS
FT                   GFDYEVSSQVTVEVQGDADGATLVSGRLLAEITKALPAKPVDIAAVGAHLELVCGSARF
FT                   TLPTMPVEDYPTLPEMPVSAGTIDAAAFAAAVAQVAVAAGRDETLPMMTGVRLELSGGT
FT                   LAMLATDRYRLALREIEWNPEDPEISLNALVPARTLHDTAKALGPLGGQVTMALSQGAA
FT                   GEGMIGFVGGPRRTTSRLLDGANYPPVRSLFPATQNAQAQVPVSALIEVVKRVALVAER
FT                   TTPVLLSFSDDGLVVEAGGTEEARASEAMEATFSGDPLTIGFNPQYLIDGLSNMGTQFA
FT                   VLSFVDAFKPAVISPVGEDGEVVPGYRYLIMPIRVSR"
FT   gene            4325..5197
FT                   /locus_tag="Strop_0004"
FT   CDS_pept        4325..5197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0004"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52489"
FT                   /db_xref="GOA:A4X0T9"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0T9"
FT                   /protein_id="ABP52489.1"
FT                   /translation="MQLGLVGLGRMGGNMRERLRAAGHEVIGYDNQAELSDVASLAEMA
FT                   KKLDAPRAVWVMVPAAVTDETITKLAEVLDTGDIIVDGGNSRFSDDAPRAERLNERGIG
FT                   YVDAGVSGGVWGRQNGYALMVGGAKEHVDRLMPIFEALKPAGEFGFVHAGPVGAGHYAK
FT                   MVHNGVEYGLMHAYAEGYELLAKSELVTDVPGVFKSWREGTVVRSWLLDLLDRALDEDP
FT                   KLAELSPYTEDTGEGRWTVDEAVRLAVPMNVIAAALFARFASRQDDSPAMKAVAALRQQ
FT                   FGGHAVRKR"
FT   gene            5214..6347
FT                   /locus_tag="Strop_0005"
FT   CDS_pept        5214..6347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0005"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52490"
FT                   /db_xref="GOA:A4X0U0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X0U0"
FT                   /protein_id="ABP52490.1"
FT                   /translation="MYVRRLELVDFRSYERVGVDLEPGANVLVGPNGVGKTNLIEALGY
FT                   VATLDSHRVATDAPLVRMGAAAGIIRCAVVHEGRELLVELEIVPGRANRARLGRSPARR
FT                   ARDVLGALRLVLFAPEDLELVRGDPAQRRRYLDDLLVLRQPRYAGVRTDYERVVRQRNA
FT                   LLRTAYLARKTGGTRGGDLSTLAVWDDHLARHGAELLAGRLDLVAALAPHVNRAYDAVA
FT                   AGAGAAGIAYRSSVELASSTADRADLTAALSDALAAGRTAEIERGTTLVGPHRDELTLT
FT                   LGPLPAKGYASHGESWSFALALRLAGYDLLRADGIEPVLVLDDVFAELDTGRRDRLAEL
FT                   VGDASQLLVTCAVEEDLPARLRGARFVVREGEVQRVG"
FT   gene            6337..6933
FT                   /locus_tag="Strop_0006"
FT   CDS_pept        6337..6933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0006"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52491"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U1"
FT                   /protein_id="ABP52491.1"
FT                   /translation="MSDEVVPAAGPRGGSATGADGSAPAATGGAEEPAGPQLARAVLDA
FT                   AKARRQAAQPQRRSRNGGASGGGRRPRGYSGPGPDPRDPQPLGAVLDRLVKARGWQQPA
FT                   AEATVFGAWERVVGPDVAQHSRPVKLDGGELTVEARSTAWATQLRLLAGSLLQQIAREV
FT                   GHNVVRRLHIHGPAAPSWSRGPRRVRGRGPRDTYG"
FT   gene            complement(6924..7505)
FT                   /locus_tag="Strop_0007"
FT   CDS_pept        complement(6924..7505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52492"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U2"
FT                   /protein_id="ABP52492.1"
FT                   /translation="MGLDNVVVNWPRTGRFYDPVAPAEFVDFGEIVDMPQISAPTAALA
FT                   ELIAKTGTVRATAYTELVDLILGLENVLYATDHSAEDEDPVIDPDGCGWIADGVERFVA
FT                   RHRAVGEAVTFDTVSEVLRALLGDGRLAEQQLRWLDSRLDRLRDESGDPPQWTFTCAEL
FT                   SVLAAFYRRCAERGFAVYAESVAPRRAVQP"
FT   gene            7788..9947
FT                   /locus_tag="Strop_0008"
FT   CDS_pept        7788..9947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0008"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase,
FT                   subunit B domain protein; ATP-binding region, ATPase domain
FT                   protein domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase, type IIA, subunit B, region 2 domain
FT                   protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52493"
FT                   /db_xref="GOA:A4X0U3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U3"
FT                   /protein_id="ABP52493.1"
FT                   /translation="MKPGAGPGPRSSSHIRSSRSRSAGNRGGRRVRPPARMTLRCRSAR
FT                   PTSRPVRRTPRPVVPNGVADARKWPRVAAQDKQEYGAESITVLEGLEAVRKRPGMYIGS
FT                   TGERGLHHLVWEVVDNAVDEALAGHCDTIDVVLLADGGVRVTDNGRGFPVDPHPKLKKP
FT                   GVEVALTVLHAGGKFDGKAYAVSGGLHGVGVSVVNALSTRMAVEIQKDGYVWRQSYTDS
FT                   KPTPLEKGESTDATGSAVSFWPDPRVFETVAFDFQTIYRRLQEMAFLNRGLTIHFLDER
FT                   VDEGDDGKMREVTFCYQGGIADFVRHLNASKTSIHKSVVEFGTEEDGMSVEIAMQWNES
FT                   YGESVYTFANNINTHEGGTHEEGFRSALTSVINRYGAEKRLLKSDEKLSGEDIREGLAA
FT                   IISVKLTNPQFEGQTKTKLGNTPVKSFVQRVCNEWLVDWLDRNPAEAKVIITKASQAAR
FT                   ARVAAQQARKLARRKSLLESGSMPGKLADCQSTDPRECEVFIVEGDSAGGSAKQGRDPR
FT                   TQAILPIRGKILNVEKARIDRVLKNNEVQALITALGTGIHDDFDIEKLRYHKIVLMADA
FT                   DVDGQHIQTLLLTLLFRFMRPLVELGHVYLAAPPLYKIKWNRKGDDAQYAYSDRERDGL
FT                   IALRQQKKPNAKPDDIQRFKGLGEMNYPELWETTMNPATRTLRQVTLDDAATADELFSV
FT                   LMGEDVEARRSFIQRNAKDVRFLDI"
FT   gene            10079..12598
FT                   /locus_tag="Strop_0009"
FT   CDS_pept        10079..12598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0009"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52494"
FT                   /db_xref="GOA:A4X0U4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U4"
FT                   /protein_id="ABP52494.1"
FT                   /translation="MTDTPESTPNEPDVPETAGAVVAHDRIEPVGLEVEMQRSYLDYAM
FT                   SVIVGRALPDVRDGLKPVHRKILYAMFDSGYRPDRGYVKCSRVVGDVMGQFHPHGDSAI
FT                   YDALVRMAQPWALRYPLVDGNGNFGSPGNDPAAAMRYTECKLEPLAMEMLRDIDEDTVD
FT                   LQDNYDGRAKEPTILPSRIPNLLVNGSEGIAVGMATKIPPHNLREIGAAVQWCLEHPEA
FT                   DEASTLEALLGIVKGPDFPTHGLIVGRAGIQDAYRTGRGSIRMRAVVEVEEDKRGRPAL
FT                   VVSELPYQVNPDNLAERIAELIKEGKLAGIADIRDESSGRTGMRLVLVLKRDAVAKVVL
FT                   NNLYKHTQLQETFGANMLALVDGVPRTLNLAQFIRYYVAHQIEVIRRRTAFRLRKAEER
FT                   AHILRGLAKALDALDEVIALIRRSPTVDDARQGLIRLLEIDEIQATAILDMQLRRLAAL
FT                   ERQRILDDLAKLELEIADFKDILAKPERQRRIVSEELGEIVAKWGDDRRTQIIPFDGEV
FT                   SMEDLIAREDIVVTITRTGYAKRTKVDAYRSQRRGGKGVSGASLRQDDIVSHFFVCSTH
FT                   DWILFFTNKGRVYRAKAYELPEASRVAKGQHVANLLAFQPDEQIAQIIEISDYQVAPYL
FT                   VLATKNGVVKKTRLEEFDSNRSGGIIAINLREDDELVGAALVAPEQDLLLVSKNALAIR
FT                   FNATDEALRPMGRATSGVIGMRFSEDDELLAMEVVRHGLDVLVATNGGYAKRTPIEEYP
FT                   VQGRGGKGVLTAKITERRGGLVGAVVIDPDDELFAITSNGGVIRTPVKPVRRTRDRNTM
FT                   GVKLMDLPDGVTIVAIARNADEPDEQD"
FT   gene            12603..13529
FT                   /locus_tag="Strop_0010"
FT   CDS_pept        12603..13529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52495"
FT                   /db_xref="GOA:A4X0U5"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U5"
FT                   /protein_id="ABP52495.1"
FT                   /translation="MTETQAKSGNAGNSANPVDEDGATSGAPAAGRAAVGRATVPADVP
FT                   APKFTRAPGMAPPPDKPAEEPEPGEEPAEATKAETPRTSGAAAETTSAATQPSTSGGAG
FT                   QTSTAAGSTAAALGGANGLPRFGDTGSQPRVTGTARPQPNSAGRPQGGSLPPGISGVAA
FT                   VGAARVGEAVRAARTAVSSAASRGPRRARLNLRRIDPWSVMKFAFAVSVVLFIVVVVAT
FT                   SVLYLALDAMGVFASVNDSLSDLVNAGGGQNTNGFQITARGVILSSALIGLVNVVLFTA
FT                   LATLGAFVYNVCADLVGGVELTLAERD"
FT   gene            13654..13730
FT                   /locus_tag="Strop_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            13654..13730
FT                   /locus_tag="Strop_R0001"
FT                   /product="tRNA-Ile"
FT   gene            13951..14319
FT                   /locus_tag="Strop_0011"
FT   CDS_pept        13951..14319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0011"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52496"
FT                   /db_xref="GOA:A4X0U6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U6"
FT                   /protein_id="ABP52496.1"
FT                   /translation="MLNHLGIQVCDLDASLAFYDAVLAPLDGHRLMEFPEAVGYGSSTP
FT                   DFWLSPLSGAPGGVESHIAFTAPDRAAVQAFHDAAVALGAEVLHAPRVWPEYHPTYFGA
FT                   FVRDPDGNNVEAVCHRPE"
FT   gene            14462..14590
FT                   /locus_tag="Strop_0012"
FT   CDS_pept        14462..14590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52497"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U7"
FT                   /protein_id="ABP52497.1"
FT                   /translation="MFKKLLILVGIVGVAAIVAKRVKETNDERALWHEATTAPDLR"
FT   gene            14629..14704
FT                   /locus_tag="Strop_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            14629..14704
FT                   /locus_tag="Strop_R0002"
FT                   /product="tRNA-Ala"
FT   gene            14928..15371
FT                   /locus_tag="Strop_0013"
FT   CDS_pept        14928..15371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52498"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U8"
FT                   /protein_id="ABP52498.1"
FT                   /translation="MPSCLRSRVSAYVLVLPMAFLPGCGEDAPGRSVEANGVITFGAPD
FT                   ADGGRDAEIIGEPVVGRGQCLAVQTAENQRLVVVWPAGSELKTGGGTTGVEVPGAGTVQ
FT                   VGSSFTASGGYATPPLGDGMPIIPETCASGTEEVAVIDDVRRQ"
FT   sig_peptide     14928..15035
FT                   /locus_tag="Strop_0013"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.757) with cleavage site probability 0.452 at
FT                   residue 36"
FT   gene            15519..16367
FT                   /locus_tag="Strop_0014"
FT   CDS_pept        15519..16367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0014"
FT                   /product="Phenazine biosynthesis PhzC/PhzF protein"
FT                   /note="PFAM: Phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52499"
FT                   /db_xref="GOA:A4X0U9"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0U9"
FT                   /protein_id="ABP52499.1"
FT                   /translation="MVIRAIPGLSGNELWQVRVFVGPDAMGNVTGVVTVGSGTRPDDMA
FT                   AGARLLGYPETAFVRQDAGSVHVTSYSPYERLRLCTQTLLATEHVLRSRRTSGAKLLAG
FT                   TDVGEVPVRRYEDMAYVVLTGERTRVRAAHSRLPLDGVVHDDALVVDTGRSRSYVNLSA
FT                   DTLEAVWLDPAAVLSYCAAEGVSGICLVARLDNAVRLRVFTTSLAGAEDVATGGAAGGL
FT                   PAFLAATGGGSRRPVLVRQGHGTALTRGELHVRPLDGAEVAVGGRVVAVSTGRLDPCRL
FT                   P"
FT   gene            complement(16502..19084)
FT                   /locus_tag="Strop_0015"
FT   CDS_pept        complement(16502..19084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0015"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52500"
FT                   /db_xref="GOA:A4X0V0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X0V0"
FT                   /protein_id="ABP52500.1"
FT                   /translation="MPAKASLEGIEKVWSRVWEQNGTYRFDRSVTRSEVYSVDTPPPTV
FT                   SGALHVGHVFSYTHSDAIARFQRMRGRAVFYPMGWDDNGLPTERRVQNYYGVRCDPSLP
FT                   YDPGYTPPAEPPSRPQPISRRNFVELCRNLTELDEQAFEALWRHLGLSVDWSLTYATID
FT                   DRSRAISQRAFLRNLARGEAYLADAPTLWDVTFRTAVAQAELEDRERQGTYYRLAFHSA
FT                   TGDKIYVETTRPELLPACVALVAHPDDERYQHLLGSTAVSPLFGVPVPIRAHPLAQPDK
FT                   GSGIAMICTFGDLTDVLWWRELALPTRPVMGRDGRLLPEPPPGIVNADAVAAYQTLAGL
FT                   TAFSAKAKVVELLRAAGDLEIAPRPTTQTVKFYEKGDKPLEIITTRQWYVRNGGRDTEL
FT                   RSALVHRGRELTWSPEFMRSRYENWVEGLSGDWVISRQRFFGVPIPVWYPLDDSGEPDY
FT                   AHPILPDDVALPVDPSSDAPTGYQESQRNQPGGFMADPDVMDTWATSSLTPEIAGGWTV
FT                   DDDLFARVFPMDLRPQAHEIIRTWLFATVLRSHQEFNCLPWTTVLLSGWILDPDRKKMS
FT                   KSKGNTVTPMALLEKYGSDAVRYWAVSGRPGTDTAFDTGQMKIGRRLAIKILNATTFVL
FT                   RFGSPTLLAPHMAHVTEPLDRSMLARLASVVDSATTGFTQHDYTRSLECTEQFFWSFCD
FT                   DYLELVKERAYGEPDDRAVRSAHAALALALHTLLRLFAPMLPFVTEEAWSWWQEGSVHR
FT                   AAWPTGQELVGPDVSAEANRSTEASGSGEAGTDLLGLASDVLAAIRRAKSEAKQSMRAP
FT                   VAQLTLRGRASDLAAFALVSRDVRAAGVVREVDTAEADTPLTPEITLG"
FT   gene            19204..20175
FT                   /locus_tag="Strop_0016"
FT   CDS_pept        19204..20175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0016"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52501"
FT                   /db_xref="GOA:A4X0V1"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V1"
FT                   /protein_id="ABP52501.1"
FT                   /translation="MSTPRVLPADRGVAEAAAVLRAGGLVALPTETVYGLGANALDAPA
FT                   VARIFAAKARPSFDPLISHLAEAAELEKLVGTVPAAVAELAERFWPGPLTLIVDRPAVI
FT                   PPIVTSGLETMAVRVPDHAATRGLIAAAGVPVAAPSANRFGQLSPTRAEHVVAGLGAAV
FT                   DVVLDGGPTRCGIESTIVDARGDRPVVLRLGALPVELLQEAVGPVLVRAGSSGQPVAPG
FT                   TLAAHYAPRTRLRLATDTDPADGGVSRQGFLGFRGCPAGDWAAVEVLSSKGDLTEAAAR
FT                   LFDALHRLDGAGVDEILVESVPEVGVGRAINDRLRRAAATWT"
FT   gene            complement(20241..24707)
FT                   /locus_tag="Strop_0017"
FT   CDS_pept        complement(20241..24707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0017"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; E1-E2 ATPase-associated domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52502"
FT                   /db_xref="GOA:A4X0V2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V2"
FT                   /protein_id="ABP52502.1"
FT                   /translation="MIPLGRVAGSVRAPAVPELMGQAARNLGSAAARAARLTGLTRRRV
FT                   WSRYGRHHIEVHGVCQDGGERLARQVEAALERVPGVNWARVNAPSGRVVVAVGSPEPRL
FT                   RDLIVTVARAERISPHEPDPEIPPPHPPEEGPRTPRTLGALASDALGLTISAATRILPF
FT                   TPVPGEVAGLLNAVDLHPRLHALADRGVRADPRADLLFPLAEAVAQGLAGGWTGIVLDG
FT                   IQRVVQWGEARAQLAAWTTAEPRLAGAPGRAAAPVLPTERPCPKPDGPAEKYVIQMLHA
FT                   GAAAAAAATPVAGAKRAAALGLSALPKASGSGREGYAAQLGSLLARRGVVAMDRRALRE
FT                   LDRIDTLVLDATILGSNRGLLTDLAPLGDAELGEVAARAFALFDPDQPAAVQHSAGWGL
FT                   GPLDLLDAPDPGDTSHSDRLRASGGRLLGLAHDGRLVALLRVETEPAPGVDLLPAAARR
FT                   AGLRLVVTDDDPGRYDFADTVLAGGARLPETVRQLQRDGAVVMLLSDDRRALAAADCGL
FT                   GVTTDEELPPWGAHLLVGTDLQVSALVVEAAGVARRMTTQNIRLGLGGAGLGALAALTA
FT                   AREQLPERALASVNGTAALAFAHGVWRAHHLPNPMETPAERTAVPWHLMPVGTVLDELG
FT                   SGFDGLDPVDAGRRRSSRIADGVPTPTLLRAFLDELANPLTPVLAAGAVLSASFGSLVD
FT                   AALVSGVVGGSALVGAVHQRNTERSLAELLSRTAVTARVRRGGTEQQLPAHDLVPGDVI
FT                   ILEAGDAVPADCRVLEATGLEADESSLTGESLPVGKTDQPVAATDIAERRSMLYEGTTV
FT                   AAGHGRGVVVATGTDTEAGRSLSLARQTRPSGGVEARLGGLTDSAIPLALGSAVAVAGA
FT                   GVARGIPLAETASTAANLAVASVPEGLPFLVSAAQLAAARRLAERGALVRNPRTIEALG
FT                   RVDVLCFDKTGTLTEGRLVLSGVGDGARFAAVDQLDEHLRMVLAVALRAAPDADDPEQL
FT                   PEQADRAIRRAARETNTVEQTGAGDWRPAGGLPFEPSRGYHATVGTCGDRLVLSVKGAP
FT                   ETVLPRCRNRRTEAGVVPLDDATRKAVQQELLRHAGAGQRVLALAERVVVEESIADDDV
FT                   QGLTFVGILALADGIRASAAPAVESIRKAGVHTIMITGDHPATAEAIASVISPGDGQRV
FT                   ATANDLADLDDEALAARLVTTDVVARCTPAHKVRIIQALRTCGRTVAMTGDGANDAPAI
FT                   RLADVGIALGQRGTPAARAAADLVVMDDRLETIIATLAEGRAMWSSVRHALSILFGGNL
FT                   GEIAFSIVTAAVDGRSALNGRQLLLVNLLTDLAPALAVAVRPPPPEYSENLLREGPDTS
FT                   LGATLNRELGVRATSTALGATAGWVLSKWVAASPRRAGTVALVSLIGTQLGQTLMAGGT
FT                   TPGVLLSTAGSVGVLVLVVQTPGLSHFFGCTPLGPICWTIATGSAAGAALANGTVARLV
FT                   EQLPAPPRPGVDLHDLLNRLRHWGHGS"
FT   gene            24882..25184
FT                   /locus_tag="Strop_0018"
FT   CDS_pept        24882..25184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52503"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V3"
FT                   /protein_id="ABP52503.1"
FT                   /translation="MENHGGHRRFWEVEMSMLTRDLSGSRDMIRTFTHRVEVPVLGEMA
FT                   IPPPDKLAYYAGVGLLTLLQVIEWPVALVVTAGHVLADQHLSGLAKGLGEALETA"
FT   gene            25315..25509
FT                   /locus_tag="Strop_0019"
FT   CDS_pept        25315..25509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52504"
FT                   /db_xref="GOA:A4X0V4"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V4"
FT                   /protein_id="ABP52504.1"
FT                   /translation="MFTLVTTVILYVGGFVFLYGVIRLAIRHALEEAEVRRVQAQRAEE
FT                   LAAHRDRTLLEGKGYLTGG"
FT   gene            complement(25585..26220)
FT                   /locus_tag="Strop_0020"
FT   CDS_pept        complement(25585..26220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0020"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52505"
FT                   /db_xref="GOA:A4X0V5"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V5"
FT                   /protein_id="ABP52505.1"
FT                   /translation="MEIEVYADLVCPWCYLGKRRLERALASYDGAVTVSYRPFQLDPAP
FT                   VPEPLPLLDALGVKFGGRERARQMADQVTRAAAGDGIDFDFDRALAANTFDAHRLVAWA
FT                   TERDRAAETVEALHRAHFHDGVDIGSRPALATIAGKVGLDAAAAHALLESNGQVAEVHT
FT                   RLAAARELGITSVPTFVLAGRYAVTGAQDSPTLLAALTEARRHVATEV"
FT   gene            complement(26241..26669)
FT                   /locus_tag="Strop_0021"
FT   CDS_pept        complement(26241..26669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0021"
FT                   /product="Fe-S metabolism associated SufE"
FT                   /note="PFAM: Fe-S metabolism associated SufE"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52506"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V6"
FT                   /protein_id="ABP52506.1"
FT                   /translation="MPEMPPRLAEIVDEFTTAPRDIVLELLLEYADAIGPLSSGHPDRA
FT                   EMEQVPECQTALFLRARVTPEGSVEAVFDCPPEAATTRAFAGILAEGLAGARPAQVLAV
FT                   PDDLYQRMGLAQAVSPLRIRGGTAVLARLKRQVREQTG"
FT   gene            complement(26826..27251)
FT                   /locus_tag="Strop_0022"
FT   CDS_pept        complement(26826..27251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0022"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52507"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V7"
FT                   /protein_id="ABP52507.1"
FT                   /translation="MTSFRISDVMTKQVIYLPVETTLDEVARVMKEADIGDVVATDGAT
FT                   LAGVLTDRDIVVRAVAQRRDPARTTIDSIITREVVMIEQNCTTGEAAALMRERGVRRVL
FT                   VCDSERRLVGIVSLGDLALRLDPQSTLGQLSGQVPTP"
FT   gene            27489..28268
FT                   /locus_tag="Strop_0023"
FT   CDS_pept        27489..28268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0023"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52508"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V8"
FT                   /protein_id="ABP52508.1"
FT                   /translation="MEGVVGWRSFVAVGDSFTEGLNDAYPDGGFRGWADLVATRLAVEA
FT                   GPEFRYANLAIRGRLFPRVVDEQVPAALAMQPDLISFAAGGNDMLRRSFDPDDLIARFN
FT                   EVVGRLRAGGADVVLFRFADVMARLPGQRLVAPRVQVLNQAVGDTAERHGAILVDLYED
FT                   DTYLNPMMWSTDRLHLSSAGHRRVAAQVLTALGVSCADEWLLVPERPLPKPWLAARTDD
FT                   LRWATHHLAPWLTRRLTGRSSGDTVTAKRPALTPLTD"
FT   gene            28458..29039
FT                   /locus_tag="Strop_0024"
FT   CDS_pept        28458..29039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0024"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52509"
FT                   /db_xref="GOA:A4X0V9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0V9"
FT                   /protein_id="ABP52509.1"
FT                   /translation="MGSGRRRSRKDEILGIAVGLFAARGYHGVSMDDIGAAAGVTGPAL
FT                   YHHFAGKEAMLVAALIPVSEGLLAGGRERAAAHPDDPRAALESLIEFHVDFALAQPAVI
FT                   ALHLHELDRLPEQPRRRIRRLQRLYVEEWVSVLTASHPGLSDNEARVLAHAAFGLMNST
FT                   PFLGGEVDRQRRAELLRGATLAALLAPTAR"
FT   gene            29166..30503
FT                   /locus_tag="Strop_0025"
FT   CDS_pept        29166..30503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0025"
FT                   /product="Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52510"
FT                   /db_xref="GOA:A4X0W0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W0"
FT                   /protein_id="ABP52510.1"
FT                   /translation="MIESLLVVNRGEIARRIIRTAKLLGVRAVAVHSEADAGLPFVTEA
FT                   DEAVCVGPANPAQSYRNVEAVLAAAKSTGVQAIHPGYGFLSENADFAQAVAASGLLWVG
FT                   PGPDAITAMGDKINARNLMAAAGVPVAPGTTEPAADLTAAVEAASEIGYPVMVKAAAGG
FT                   GGMGMGIANDEAALRTEYDKVRAFAERMFGDGSVLIERYFPRVRHVEVQILGLADGRVV
FT                   ALGERECSVQRRNQKLVEESPSPAVTPELRSRFLAAAVRAGEAVGYRNAGTVECLLDPT
FT                   TGEFFFLEMNTRLQVEHPVTELVYGVDLVEEQLRVAAGLPPTFDPDALTPRGHAIELRV
FT                   NAEDPKRFLPGPGAITTWTEPTGEGVRVDSGYVAGNTVTPFYDSLMAKLIVSGADRAEA
FT                   ISRARAAVAQFQLAGPKNNLPFFAELLDNPEFLSGDYDTGIVSRMR"
FT   gene            30748..31659
FT                   /locus_tag="Strop_0026"
FT   CDS_pept        30748..31659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0026"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52511"
FT                   /db_xref="GOA:A4X0W1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W1"
FT                   /protein_id="ABP52511.1"
FT                   /translation="MPGFVSIREVGPRDGLQNEEPIPTEAKVRLLDALSRTGVGRIEAV
FT                   SFVHPKAIPQMADADEVWRRAEQTEGVRYSALVPNTRGAHRALAAGFTEIEVVVSASDT
FT                   HNRRNVNRSTEESLDDIAELVELLHHAGARAEVIIATSFGCPYEGDIDPVRVAGIVDRV
FT                   VRDGADRVAFGDTTGMATPRRVRELVTAVRDRDAHLPLLLHFHNTRGAALANLLTAIEL
FT                   GVTEFDASVGGLGGCPYAPGASGNLATEEAVHLLHDMGVDTGIDLAALIEVAELAEELV
FT                   GRSLPSGVLRAGPRTRLTALPG"
FT   gene            31857..33389
FT                   /locus_tag="Strop_0027"
FT   CDS_pept        31857..33389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0027"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52512"
FT                   /db_xref="GOA:A4X0W2"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W2"
FT                   /protein_id="ABP52512.1"
FT                   /translation="MTLDGEALEQLRKRARAGGADKYHAANAAKGKLFARERVAFLVDE
FT                   GSFVEDGLYANALAEGLPADGVITGTATIDGRPVCVMANDSTVKAGSWGARTVEKIIRI
FT                   IERAYTTKVPMVYLVDSAGARITDQVDLFPGRRGAGKIFWNQVRASGSIPQVCALFGPS
FT                   AAGGAYIPAFCDVVAMVEGNASMYLGSDRMVEMVTGEQTTLEAMGGARVHCAESGVGHF
FT                   LCRSEADALDVVRRYLSYLPTNWTEQPPAVPAVEAPAKVDLAALVPASERQAFDMRRYA
FT                   KGLLDQGSFFEIQALWAKELTIGFGRLNGEVVGVVGNNSMFKGGVLFVDSADKATRFVQ
FT                   LCDAFNVPLLFLSDVPGFMVGSTVEKQGIIRHGAKMITAISEATVPKICVVVRKAYGAG
FT                   LYAMAGPGFEPDATIALPTAKIAVMGAEAAVNAVYANKIAAIGDESERAAFVAARREEY
FT                   EQDIDIVRLASELVIDAIVEPPELRGELIRRFAAARDKDRHFATRRHGVTPV"
FT   gene            33452..34606
FT                   /locus_tag="Strop_0028"
FT   CDS_pept        33452..34606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0028"
FT                   /product="butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52513"
FT                   /db_xref="GOA:A4X0W3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W3"
FT                   /protein_id="ABP52513.1"
FT                   /translation="MDFRLTEEHEALRTSVRDLAREVVAPVIADHYERHSFPYDVIHQM
FT                   GKMGLFGLPFPEEHGGMGGDYFALCLALEELARIDSSVAITLEAAVSLGAMPIYRFGTD
FT                   EQRARWLPRLLNGRALAAFGLTEPGFGSDAGGTQTRAVLDESTEEWVINGSKAFITNSG
FT                   TDITDLVTVAAVTGTRPDGSKELSTIIVPTGTPGFTVAPGYSKVGWTASDTHELTFDDC
FT                   RVPAGNLLGERGRGFAQFLRILDEGRIAIAALAVGLAQGCVDESVRYAKERHAFGRPIG
FT                   ANQAIQFKIADMELRVHTARLAYYDAAARMLAGEPFKRQAAIAKLHASTIAVDNARDAT
FT                   QIHGGYGFMNEFPVARFWRDAKILEIGEGTSEVQRMIIARELGL"
FT   gene            34731..37298
FT                   /locus_tag="Strop_0029"
FT   CDS_pept        34731..37298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0029"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein;
FT                   Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52514"
FT                   /db_xref="GOA:A4X0W4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W4"
FT                   /protein_id="ABP52514.1"
FT                   /translation="MNPDDDHSRWSGGQMGLPDLLRGHRLTAGLTQAELAGRAGIGVRT
FT                   VRDVERGRSSRPQRTTVELLATALGLVGAARSTFVAAARHVPTPRYPESESLLHVGPDG
FT                   MVRPTTLPPAPELIGRERDVAELVGMLTSEVTARLVSLVGLAGVGKTALALSASHAAAG
FT                   HFPGGVAGVLTGEGTDVAELLAASAAVFGAARLPELATRLAGQPALLLVDAVERAPGTV
FT                   AEAVHQLATVVPSLRVLVTGRHPVGLRGERVRPVAPLDTPSPDRDEAGPVVLARFPAVA
FT                   LFIARLKLVRPNPPTAAELPALARLVRRLGGLPLAIELMAARGRILDLNELLDRYGDRV
FT                   LDLATFSGAAERPGWSAADPGPTQRTPAAVVETLRDAVATSYLLLTLQERAALRRLATF
FT                   GNRWSVKLAEEMLGVGAEPAGTLLVVDPVALLDRLRELGLLSIRGVGPFRFRLLDAVRE
FT                   FAVEQAAGAGELTVARRHHARVMARLVAETAPYLVGADLTAAVHRLDDVGGDISSALAH
FT                   AAVDEPVTALGLAAGLVRWWRFRGRDVAGRQWLRRLLADPRTADVAPVQRAWALLGVAR
FT                   LAAEHGAGAEELPAARAALAALQSAGDVAGELEARTVLGRLFTGTGDHDEARGQAEAVL
FT                   ALATRHGRIRDMTVAQNNLAWHGIRVGDLATARRRLAAADRLAAQCGEQRLRVLAMANL
FT                   AEVTRLEGRYDVAVDQGRRTLAALTALGDPGHHRRVLGTVGLALALDDRVAEAAEVLAE
FT                   LRPGGPAAGLSWMPADGICGLIEGTLALRRGDRELAAEWFAVAAEAGANGQDRRDLVEA
FT                   LVGLAASTADPSVLDRLDEICRVSGIRLLPPEVEALAAVARRP"
FT   gene            complement(37565..38266)
FT                   /locus_tag="Strop_0030"
FT   CDS_pept        complement(37565..38266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0030"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52515"
FT                   /db_xref="GOA:A4X0W5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W5"
FT                   /protein_id="ABP52515.1"
FT                   /translation="MTERFRSAAHCEPFTVRVPNAVGQSRSRTNPPNPVHVHLPHNACS
FT                   VNSILSRYTYSNISLIKYWYDLRVDQSVLNDPRITAVGLLVEAHAGLSARFTAQFEQHG
FT                   LSPVEFEVLTRLVRSPDNRLRMTDLAAQTSLSTSGVTRVVDRMERDGLLTRRACPADRR
FT                   SSFAVATDSGCKRLDAVLPGHLRIIEEWFTGQLDPESLARLLDGLRRVRDAVHPGATAG
FT                   ATDPEPAPDSR"
FT   gene            38287..39765
FT                   /locus_tag="Strop_0031"
FT   CDS_pept        38287..39765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52516"
FT                   /db_xref="GOA:A4X0W6"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W6"
FT                   /protein_id="ABP52516.1"
FT                   /translation="MGRDVTRGAFSREDRVRYRRKVRRCLDVFALMLDDFGFDADRPMT
FT                   GLEIELNLVDSAAEPAMRNEEILADIADPLFQTELGQFNLELNAAPRLIEGTGFTGYEQ
FT                   DLRGSLARADEWAARSDAKILLVGILPTLTEGHLVVDNLSANERYRALNDQIVGARGED
FT                   IELDIRGVERLQTHTDSIAPESACTSLQFHLQVSPDSFADYWNASQAIAAAQVATGANS
FT                   PYLYGRQLWAETRIALFQQATDTRPDELKAQGVRPRVWFGERWITSIFDLFEENVRYFP
FT                   PLLPICEEEDPVEVLHAGGVPKLGELRLHNGTVYRWNRPVYDITEGRPHLRVENRVLPA
FT                   GPTVIDMLANAAFYFGSARGLAEADRPTWSQLPFSSAEENFHSAARRGMDAVVYWPRLG
FT                   EVPVAELVLDVLLPQAATGLDRFGVAPGERDRLLGVIEQRCRTRRNGAVWQAETVWAAE
FT                   RHRKLDRPAALHHMVQRYAELQRSNEPVHTWPVE"
FT   gene            complement(39799..41100)
FT                   /locus_tag="Strop_0032"
FT   CDS_pept        complement(39799..41100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52517"
FT                   /db_xref="GOA:A4X0W7"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W7"
FT                   /protein_id="ABP52517.1"
FT                   /translation="MARRGWAISIMTALGTAAGAGAAALGFGYGLGIINWAPPPDESVA
FT                   VTAWTASLIWATWIAATSTVAGAVCAQHLRRRGAVEHQQAGSDGTISITDATLASPSGP
FT                   DAAAGTTRETAERSRAEPSEPDGALGKLALVGAAGFGALITVLLTAVPARVAVVPGVAA
FT                   PRDVAAGYAALGVLVGLAMAGWALHSRAAATNVMATVGWLWLLAVVAVVDGVVAGRGLR
FT                   TAQLGIWQLSAGGNELWLRDWFYWPGALLSLGSALLIGILVARGTARRPDQLVGATASG
FT                   AAGPLLVAVAYLLAVPELADLAPGQASAHLIAPYAVIIGFGGSALVAALGQRADRRTRT
FT                   ASPRPVEPAAESPQSAESPTDPQSDGSTVATPTTRGRTRGSGSRRPRTAKSEATTAVPA
FT                   QRTVDDAAAEDAGPGSQEPKETDSRRPRSARRTS"
FT   sig_peptide     complement(41032..41100)
FT                   /locus_tag="Strop_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.740 at
FT                   residue 23"
FT   gene            41282..42034
FT                   /locus_tag="Strop_0033"
FT   CDS_pept        41282..42034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0033"
FT                   /product="PASTA domain containing protein"
FT                   /note="PFAM: PASTA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52518"
FT                   /db_xref="GOA:A4X0W8"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W8"
FT                   /protein_id="ABP52518.1"
FT                   /translation="MSSGSEGGRGMSDDRKPAADGPDDETRPLPAEQTGPRPPGDQTVP
FT                   LPPTGGPGPWSGRAGVPPPRPPEYQEATGWYAEPNGRRWWSPIFWGVVVLLLAVFGAGL
FT                   WLALAGDDEQLVPESSPSATTPQASPTRTSATPTSPTRTSATPTSATPTSTEPPTPSVT
FT                   EEPGEVPMPPVVNLPLTTAQAILDEAGLAYRIQFRTSDRPSGTVIGTTPRAGVLVPEGT
FT                   AVVLVVSRSGPSPERSTPTPSPEPTPTS"
FT   gene            complement(42091..42414)
FT                   /locus_tag="Strop_0034"
FT   CDS_pept        complement(42091..42414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52519"
FT                   /db_xref="GOA:A4X0W9"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0W9"
FT                   /protein_id="ABP52519.1"
FT                   /translation="MVNQPAVRRHSFRIAYAFGLLAFIGAATVLTVVLRQPALSTTQLS
FT                   TPVPAPEITVVEENAPASGPTARAPGSHTSEDLRRSLYWSGIFGLTISLAGLGLVGTRR
FT                   RRW"
FT   sig_peptide     complement(42226..42414)
FT                   /locus_tag="Strop_0034"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.343 at
FT                   residue 63"
FT   gene            complement(42518..43129)
FT                   /locus_tag="Strop_0035"
FT   CDS_pept        complement(42518..43129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52520"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X0"
FT                   /protein_id="ABP52520.1"
FT                   /translation="MDGLAAAVGGKRTRPSVCRPNTNSSSIAPIWTDNPSATTDMQLAC
FT                   RTPLMHPVPYGGSRRVLLRSQTVVIPRSATTTPVGGAPPRGRRHMSPDNSRRRHRRPFL
FT                   PGAHVLPRTGDVLHVTRAASVQFLRPIAFRVIRVLDWPTYDGWLWLDGYELNASGDAVS
FT                   RRSIFVQQEGLDQIQAAPQRHPHTVGTQRRPLARTPARVG"
FT   gene            43227..44108
FT                   /locus_tag="Strop_0036"
FT   CDS_pept        43227..44108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0036"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52521"
FT                   /db_xref="GOA:A4X0X1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X1"
FT                   /protein_id="ABP52521.1"
FT                   /translation="MAERRSPTIRRRRLGAELRRQREAAGITIESVAEQLECSASKVSR
FT                   IETGHTTATPRDVRDMLRIYGVVGVESDELVQIAREARQKGWWHPYSTVLVGAYVGLEA
FT                   AASSIRAYEQQVVPGLLETEEYASAMIRAARPDFTTEQVAQRVRVRLGRQSLLTQDDSV
FT                   DLWVVLDEAVVSRPVGGDTVMCGQLKRLLEVAELPNVTLQILPFEVGAHAGMDGTFSIL
FT                   SFPEPSDPDVVYAENATGGLFLEKSDELQKYSFIFDHIRAAAISPEESIAHIAKLAEEP
FT                   LWKWRPRSSPWT"
FT   gene            44078..44299
FT                   /locus_tag="Strop_0037"
FT   CDS_pept        44078..44299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0037"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52522"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X2"
FT                   /protein_id="ABP52522.1"
FT                   /translation="MATKEFPVDLTQGTWFKSSKSGPNCDNCVEVAYVPGAVGVRDSKD
FT                   RSGPALVFSPGGWRSFVTDARGGTFDPR"
FT   gene            44651..44965
FT                   /locus_tag="Strop_0038"
FT   CDS_pept        44651..44965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52523"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X3"
FT                   /protein_id="ABP52523.1"
FT                   /translation="MLTEVVSPDAEAGGRQDGSTPQRTAPPHPLPSLDSDPLTRPGLSA
FT                   EGWSSGPVDSLVDHPLLRGLLMELPPKGSVPPPGWLDRWFEATRAILELLYVQGSGRSR
FT                   "
FT   gene            45230..46789
FT                   /locus_tag="Strop_0039"
FT   CDS_pept        45230..46789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0039"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; Proprotein convertase, P; proteinase inhibitor
FT                   I9, subtilisin propeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52524"
FT                   /db_xref="GOA:A4X0X4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034193"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X4"
FT                   /protein_id="ABP52524.1"
FT                   /translation="MGLSRRSVFVGLATMAMVASATPAMAAEPVGEIRSAGGATAVTDS
FT                   YIVVFKDNVVSRATVETSVDRLVDRHGGQVSRTYSTALRGAELRVDAGAAARIAADPAV
FT                   AYVEQNHRVSITDTQTNPPSWGLDRVDQRDLPLDNSYTYPNTASDVNIYILDTGIRTTH
FT                   QDFGGRATWGTNTADNNDTDCNGHGTHVAGTAAGTAHGIAKEANLVAVKVLDCAGNGTF
FT                   AGVVAGVDWVTANAVQPAVANMSLGGGANSALDNAVSNSIDSGVTYALAAGNSSANACN
FT                   YSPARTPDAITVGSTTSTDGLSWFSNIGTCLDIFAPGSSITAPWITSDTSTNTISGTSM
FT                   ASPHVAGAAALVLSANPSYTPQQIRDELVDNATDGAIGSPGSGSPNKLLYVGDGGTTPP
FT                   PPPPPGCSGTNDTDVAIPDAGSAVTSSITIAGCDRDAAATSTVAVDIPHTWRGDLVIDL
FT                   IAPDGSSYRLKTNNLSDSADNVNETYTVNLSSEAADGTWQLQVRDVYRQDTGYIDTWTL
FT                   TV"
FT   sig_peptide     45230..45310
FT                   /locus_tag="Strop_0039"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(46860..47666)
FT                   /locus_tag="Strop_0040"
FT   CDS_pept        complement(46860..47666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0040"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52525"
FT                   /db_xref="GOA:A4X0X5"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X5"
FT                   /protein_id="ABP52525.1"
FT                   /translation="MTPRCKRNVLGVLVDVTDYATATEAVVTAAHERQPLALTALAVHG
FT                   VMTGVLDPAHNARLNSFDVVTPDGQPVRWALNVLHHAGLSDRVYGPTLTLHVLSRFADE
FT                   GLPVYLYGSTEETLAKLVPALERMFPALKLAGVEPSKFRPVLPGEDVEIADRIRASGAR
FT                   LVLVGLGCPRQEIFTYAMRPLLDMPLMAVGAAFDYHAGLLRQPPPWMQRAGLEWFWRLG
FT                   LEPKRLWRRYVILNPAYLARLAAQKTRLWKAEPPEPATDQPTGFAV"
FT   gene            complement(47663..48736)
FT                   /locus_tag="Strop_0041"
FT   CDS_pept        complement(47663..48736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0041"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52526"
FT                   /db_xref="GOA:A4X0X6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X6"
FT                   /protein_id="ABP52526.1"
FT                   /translation="MSVAFVTGSGGLIGSEAVRHFAGLGLEVVGIDNDMRQEFFGEEAS
FT                   TAWNVRGLTEELGAAYSHHSIDIRDRDALAKLFRRYGRNTAVVIHTAAQPSHDWAVRDP
FT                   FTDFDVNAAGTLNVLQNVREHCIEAPVIHCSTNKVYGNRPNSLPLVELETRWEIEPGHP
FT                   YEQGIREDMSIDACLHSIFGASKVAADVMVQEYGRYFDMRTACFRGGTLTGPAHAATEL
FT                   HGFLGYVMRANMERRKYKIFGYQGKQVRDAIHSSDVVSAFESFFRNPRSAAVYNLGGGR
FT                   HSNTSMREAFALAQQITGQEMNSEYVEANRIGDHKWWIGSNEAFHADYPDWKQVYDVPM
FT                   IMREIYEANVDKWIPQP"
FT   gene            complement(48840..48925)
FT                   /locus_tag="Strop_R0003"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(48840..48925)
FT                   /locus_tag="Strop_R0003"
FT                   /product="tRNA-Leu"
FT   gene            49150..49938
FT                   /locus_tag="Strop_0042"
FT   CDS_pept        49150..49938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0042"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52527"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X7"
FT                   /protein_id="ABP52527.1"
FT                   /translation="MSSGPEEEPVSVLQRFEKRLEGLVEGAFAKVFKGVVHPVEILNAM
FT                   QREAEAHKAILAGGRTLVPNRYVIDLSPYDHSRLAPYAAALAQELAQSQAEFIGEQAWT
FT                   VYGDVIVEIERGEGLDTGMFRVTAEVYTGGEVAPVSGPGYDAGPPAYPAYEQGGGYGQP
FT                   AAQGGGHNVRLVSGDGRTYPLQLGTTVIGRGDQATLRLPDVGISRRHARLDFDGGQVVL
FT                   TDLGSTNGTMVNGQRVSAVALNPGDMIQLGTTTLTFRVDG"
FT   gene            49945..50430
FT                   /locus_tag="Strop_0043"
FT   CDS_pept        49945..50430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0043"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52528"
FT                   /db_xref="GOA:A4X0X8"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X8"
FT                   /protein_id="ABP52528.1"
FT                   /translation="MPELVITVARFGFLILLWIFVFTVVGVIRRDLFAGARSGRLVAAP
FT                   RGVGAVLGQGGKPARAKRGRAAHQLVVTAGQLAGTRITLGEAQITIGRAEDSTLVITDD
FT                   YASARHARLVPRDGQWFVEDLGSTNGTYLDRAKVTGPTPVPLGVPIRIGRTSLELRP"
FT   gene            50427..51875
FT                   /locus_tag="Strop_0044"
FT   CDS_pept        50427..51875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0044"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52529"
FT                   /db_xref="GOA:A4X0X9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X9"
FT                   /protein_id="ABP52529.1"
FT                   /translation="MTLTLRYAAHSDRGLIRDGNQDSVYAGPRLLAVADGMGGMAAGDV
FT                   ASNIVIGAMAPLDEDVPGNALVDALRSAVTNATQQLRETVDANPQLEGMGTTLTAILFS
FT                   GSKLGMVHIGDSRAYLLRASEFAQITKDDTYVQMLVDEGRISAEEASSHPQRSLLTRAL
FT                   DGRDIDAEYSVRQVLTGDRYLICSDGLSGVVSAETIAETMREYADPQQCVERLVQLALR
FT                   GGGPDNITVIIADATDQDIVEATPIVGGAASRDRGMATSADDSTPAARASALSGSPPVT
FT                   PDESTAAADEEPERRRRRPIRLVATSLALIVLLGGALYGGWSYTQRQYYVGATGGGQVA
FT                   VFRGIEGEIAGIDLSAVHSTSSAELDDLTLAAQERVKQGIPAESEADAERRLAELTADT
FT                   PTNPNLKPTCPPSPSPSPSPPVVPSPTAEPGAPTPTTEPSAPPSISATSSTPATGLPTE
FT                   PTLSPDALPAIPPAVDPAACRSPE"
FT   gene            51904..53394
FT                   /locus_tag="Strop_0045"
FT   CDS_pept        51904..53394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0045"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52530"
FT                   /db_xref="GOA:A4X0Y0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y0"
FT                   /protein_id="ABP52530.1"
FT                   /translation="MTVAATSTSPPTNTGGQSGVRLARSRRNAELSLLLLAMVLVAAYG
FT                   AMVEASVLDTVTPSFWIPAAALTAVFLGLHVAIRFLAPFADPALLPAVALLNGLGVGFL
FT                   HRLDLARATPAERAELATFAGTGGRQLAWTLISVALAAGLLAIVRDHRSISRYAYTLGL
FT                   AGIVLVMIPAVLPRSISEINGAKLWIRVGGLSIQPGEFAKLALLAFFAYYLVRKREVLS
FT                   LASRRILGVDLPRGRDLGPVVVVWLISLLVLVFEKDLGTSLLYFGMFVATLYIATERVS
FT                   WLLIGLVLFFGGAYLAYVLGDAIGGPFANFYLRANIWLDPFADPYNDGYQLVQGLLALG
FT                   SGGMFGAGPGAGQPLKLPEVQNDFIFAGLGEEIGLFGLSALLVVYLLIVERGLRAALAV
FT                   HDSFGKLLAGGLAFTLGLQVFVIVGGISGLIPLTGQTTPFLSAGGSSLMANWLLIAILL
FT                   RVSDAARRPVTSGGPPSPRSTGGPPEQLHGAPTEVIRP"
FT   sig_peptide     51904..52056
FT                   /locus_tag="Strop_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.663) with cleavage site probability 0.662 at
FT                   residue 51"
FT   gene            53391..54896
FT                   /locus_tag="Strop_0046"
FT   CDS_pept        53391..54896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0046"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52531"
FT                   /db_xref="GOA:A4X0Y1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y1"
FT                   /protein_id="ABP52531.1"
FT                   /translation="MNAPLRRVGLVVMVLFGLLFANLNWIQAYKADDYRNSDYNGRVQV
FT                   AEYERKRGNIEAGGTALAVSKATDGELEYLRTYPGGEKYAHAIGYKPVNLADTGIEEAE
FT                   NAFLAGTSDQLIGDRLRDLVTGDETAGANVLLTVSQQAQDVAYEQLGENRKGVTKGAAI
FT                   AIDPRTGAVQALVSMPSFNPNPLASHDTDEATAAYNELQQNPDGPLKNRALGEVLPPGS
FT                   TFKIVTAAAALENGVTTETKIPAGPSWTPPTSGEPIGNAAPSICPEAEVTLMNAVTESC
FT                   NTGFAQLGVRLGADTLKEKARQFGFEQDDLTVGRLGEDGEPVAASRTGSMENADGSVDP
FT                   AALAQSSIGQRNVRMTPLQGALIAATVANDGSQMRPYLVSQILGADRTTNYYTAEPSEL
FT                   RQPVSDQVAADLREMMESVVQNGTGRNARISGYTVGGKTGTAQAGPNTPPHGWFIGFAL
FT                   DKDGNPVSAVCVLLEEAGDGGSAEAARIGGQIMRAAIASPGSR"
FT   sig_peptide     53391..53477
FT                   /locus_tag="Strop_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.888 at
FT                   residue 29"
FT   gene            54898..56286
FT                   /locus_tag="Strop_0047"
FT   CDS_pept        54898..56286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0047"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52532"
FT                   /db_xref="GOA:A4X0Y2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y2"
FT                   /protein_id="ABP52532.1"
FT                   /translation="MLSSGVKLGNRYRLDERIASGGMGDVWRGTDEVLGRTVAVKSLLP
FT                   ALLDDPDFAERFRGEARTMATINHPGVVDIYDFGSDQQIAFLVMEYVEGDALSATLNRV
FT                   GRLTSARTMALVAQAADALHAAHLEGIVHRDVKPGNLLVRPNGTLVLTDFGIARSDLVA
FT                   QLTAAGSVLGTASYISPEQATGAVATPSSDVYALGVVAYQCLSGRRPFEGDNPLDIALR
FT                   HVRDTPRALPADIPSQVRAVVERAMAKDPADRWPSAAALAGVTRQLKAQLSQAARSVGQ
FT                   ASPVSAVPGRVSPVSAAPASPAPGRASVVSAVPVAPGRARVPSPATALPPQVSRSPVAP
FT                   QPFHPPAPRPQAGWSPVAAVPPASARPGRPPMSAPPPRPSRFGRGLLILLLAVLVVTCF
FT                   GMVSSVWHEAYTGSSGRPVQSTGMSGELRHDGRDDSDRTSYRQLQLPSTGDDETTTSEG
FT                   RQTR"
FT   gene            56283..58112
FT                   /locus_tag="Strop_0048"
FT   CDS_pept        56283..58112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0048"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52533"
FT                   /db_xref="GOA:A4X0Y3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y3"
FT                   /protein_id="ABP52533.1"
FT                   /translation="MTAQARLLGGRYQVGELIGYGGMAEVHRGRDLRLGRDVAIKMLRA
FT                   DLARDATFQMRFRREAQNAASLNHPAIVAVYDTGEEQAPTGETLPFIVMEFVGGRTLKE
FT                   VLGGEGRFQPRRALEICADMCAALEFSHRHQIIHRDIKPGNVMLTQTGQVKVMDFGIAR
FT                   ALASGATTMTQTSAVIGTAQYLSPEQARGESVDARSDVYAAGCVLFELLCGHPPFVGDS
FT                   PVSVAYQHVREAPPTPSDLNPEVPPAVDAIILKALSKNPLNRYQSAGEMRADLLRAAAG
FT                   RPVMATPVLREEETTQLAPAGAGYPAGAPGPRTQQIPARVGDPRRRRASSWLIATFAAL
FT                   GVLAVVALVVAELMSSPPEEKASVPRVTGLTEAEAIDKIEQANLAAEAGPAIRDNDCNK
FT                   GEVTNQDPSPGEELNPADVVTVFICAGPATVTIPDTLVGSTFDNAKRQLENAGFEVDRE
FT                   EVDDAAPKNTVLGVTPDEGSQAAEGEVVTLTVSKGNIGTVPNVVNSYVDDAERELEDAG
FT                   YEVNIKEGQPVPPGEQGRVTNQNPSPNTPLRKGKTVTITVTVLEEPTDSPTPEPSESPT
FT                   SEPPDEPPDNGGEGGGGGGLPLPTTPPARLPTR"
FT   gene            complement(58209..58859)
FT                   /locus_tag="Strop_0049"
FT   CDS_pept        complement(58209..58859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0049"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52534"
FT                   /db_xref="GOA:A4X0Y4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y4"
FT                   /protein_id="ABP52534.1"
FT                   /translation="MRILVIDNYDSFVFNLVQYLGQLGADCEVRRNDEISVAEVGQANA
FT                   DGVLLSPGPGSPDRAGVCLDVIREYAGVVPLFGVCLGHQALGEAFGATVAQASELLHGK
FT                   TSEVRHQGVGVLAGLPEVFTATRYHSLTLVPQTLPDELEVTGWTGSGVVMAMRHRTLPI
FT                   EGVQFHPESVLTEGGHLMLANWLASCGFPEALERAPALAAEVDARRRTAFSTT"
FT   gene            complement(58865..59155)
FT                   /locus_tag="Strop_0050"
FT   CDS_pept        complement(58865..59155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52535"
FT                   /db_xref="GOA:A4X0Y5"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y5"
FT                   /protein_id="ABP52535.1"
FT                   /translation="MYAWIWRKLPFGLPGKLAGSVLLATATVALLWYVVFPWAEPLLPF
FT                   DDVQVTQETGDPGDPGVPGYPPPGDGPAPTEDGHDLPYDTDENNTPPSSEE"
FT   gene            complement(59160..60725)
FT                   /locus_tag="Strop_0051"
FT   CDS_pept        complement(59160..60725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0051"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase
FT                   C60, sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52536"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y6"
FT                   /protein_id="ABP52536.1"
FT                   /translation="MTRASESWQPDRDDDQTAFLPRLERPWQQPRHESEQPSSPPGPAP
FT                   QPPSQPGALPQSGAPSQPGALPQPGAPSQPPGSTGTPQRPPTQSPWHAAAPASTPPAGS
FT                   AFDAAYPPTPPAADRPLDPPTAAHRNLRPASPPHSSEPAAPSPSPSPVNPRRPAWEGTS
FT                   STADAPTALIPTTPLRTAAPNASPAPNASPARSAGAAPGAGAAPDATPGTSPTADPAAT
FT                   ALIPRVASHTPPALDSTALMGAVPQPPRDADSTADSATPEPAQPRRGERVVKLRPEQSA
FT                   LGYKSVYSELTRPTFRSRLRTGVRAAGEVLITFGIVVLLFAGYEIWGKSVIVNAHQNDL
FT                   SQQLAEAWGPTGDPTVTPSAASSSASAPPTVQGIPIAGLYIPRLDKNWIVVEGVTQKDL
FT                   RYAPGHYPTSALPGQLGNFSIAGHRNRATFWRLDELDDGDVIVAEDRDEWHVYRVTRNH
FT                   VVKPSEVAVVAPVPGEPGAEPTDAMLTLTTCHPKFDNYERLIIHAKLDRTQAKSAGRPA
FT                   ELGG"
FT   gene            complement(60722..61651)
FT                   /locus_tag="Strop_0052"
FT   CDS_pept        complement(60722..61651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0052"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52537"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y7"
FT                   /protein_id="ABP52537.1"
FT                   /translation="MANNVSTASVVRKTRSGHERVFSNTPEGSSERAGTRREEGNPVEY
FT                   TSGAASWRKVLRRVVAALIQRPRQRRLGWPVGVPLIAAAAGLLFTTTATTAGGTTLRED
FT                   RRPQLNQLIQDRHTEVAASEQRAAELRATVEARTNALAGSDGTIQQQQERAAASQEPAG
FT                   FTALTGLGVTVELDDAPRRNDGSLPTGVTNHDLVVHQGDVQAVVNALWAGGAEAMSIMD
FT                   VRVLATSAVRCVGNTLLLHGRVYSPPFKIVAIGDPAALQRALAESEGVRLFRDLANTYK
FT                   LGYKETVSTVSVPAFDGSAALRWATVPE"
FT   gene            61674..61979
FT                   /locus_tag="Strop_0053"
FT   CDS_pept        61674..61979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52538"
FT                   /db_xref="GOA:A4X0Y8"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y8"
FT                   /protein_id="ABP52538.1"
FT                   /translation="MSGRTRSSPPLESVVPKSQVRKKKVYTPPTDVRPTATAATRKPSP
FT                   VWLPATAVTLIVAGIGWLVVYYLSEQEYPVMSWGYWNLAVGFGAMVGSLILLSRWR"
FT   gene            62287..64485
FT                   /locus_tag="Strop_0054"
FT   CDS_pept        62287..64485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0054"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52539"
FT                   /db_xref="GOA:A4X0Y9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y9"
FT                   /protein_id="ABP52539.1"
FT                   /translation="MGSVQIVTTIVAAAITAVAVWLAVRAVMKMVAVIRLGQPDPARFT
FT                   DWATRTKTMLAETAGHTRMLRWSLVGAAHWFVMVGFIVLSLLVLEAYFEVVSPTGGLPL
FT                   IGSWAVYGLVTEALGVFGIASILVLIAIRVRNRPTRPGGRSRFTGSTMWQGYFVEAVIL
FT                   GVLVMGFLIRGFKVATDHFEYPVWATPLSHAVGGLLPDWEAGVSIAAVIKIAISMAWLI
FT                   VISLNVTMGVAWHRFLAFPNIFFKRNPGRPGSGLGALRPMTSNGELLDFEEADPEKDQF
FT                   GVAQVEQFTWKGLLDFSTCTECGRCQSQCPAWNTGKPLSPKLLVLSLRDHAYAKAPYLL
FT                   AGGGKDLTGAEKAADGQLAHVDALALAEAEKPLIGGVEESGVIDPDVLWSCTTCGACVE
FT                   QCPVDIEHVDHIVDMRRYQMLIESSFPSEAGVMLRNLENKGNPWGAPQNTREDWTKGLD
FT                   FEVPRVGEVDDFEYLFWVGCAGAFEDRAKKTTRAVATLLHEAGVSFAILGEGETCSGDP
FT                   ARRIGNEFVFQMLAQQNVETLNEAFDGREKSQRKIVATCPHCFNTLGNEYGQLGGEFEV
FT                   VHHTQLLAHLVATGALTPVQPIDGGVTYHDPCYLGRHNRVFAPPREVLGTAVQGEVTEM
FT                   PRNSERSFCCGAGGARMWMEEKIGKRINVDRVEEAMSTGAATVAVGCPFCSTMLNDGVN
FT                   GKGAGEQVEVVDVASVLLRSVRPEQPQADQKSDERVAG"
FT   gene            64800..65813
FT                   /locus_tag="Strop_0055"
FT   CDS_pept        64800..65813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0055"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52540"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z0"
FT                   /protein_id="ABP52540.1"
FT                   /translation="MATTSPHRQASARSRRPGGLRRAAHGLLAAVAAVAVGLGVLAVPA
FT                   YAEPSVDEIEAAIDKQWREMEPTIAQYNKVRAQLKENRKKSDELAKKIAPLQLESEIAT
FT                   KRIGGLASEYYISGPSRELGALLVSDDPNEISEELALLNRVAAMERKQLEEVLAIRKEY
FT                   DDQKETLDELIAAQDKQESELAARKKQIDAEIKRLKASLPKTTVSTPQCPTVNGVVSAA
FT                   ARTAIRTACAQVGDPYVFGSSGPNSFDCSGLTQYAYKAAGVYLTHYTGAQWNEGKAISR
FT                   SEARPGDLVFFSSPSNLHHVGLYLGNDQMVHAPRTGKPVMVGSINYMPVAGFRRPG"
FT   sig_peptide     64800..64943
FT                   /locus_tag="Strop_0055"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 48"
FT   gene            complement(65961..66539)
FT                   /locus_tag="Strop_0056"
FT   CDS_pept        complement(65961..66539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0056"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52541"
FT                   /db_xref="GOA:A4X0Z1"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X0Z1"
FT                   /protein_id="ABP52541.1"
FT                   /translation="MLLSDRDLAAEIKAGTLALEPFDPALVQPSSIDVRLDKLFRVFNN
FT                   HLYTHIDPSRQQDDLTSAVEVPDGEPFVLHPGEFVLASTLEVISLGDQLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHVTLELSNVANLPIMLWPGMKIGQLCIFRLCSPAEHPYG
FT                   SAVYGSRYQGQRGPTPSRSWQSWRTWPTR"
FT   gene            66617..67150
FT                   /locus_tag="Strop_0057"
FT   CDS_pept        66617..67150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0057"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52542"
FT                   /db_xref="GOA:A4X0Z2"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z2"
FT                   /protein_id="ABP52542.1"
FT                   /translation="MASWSEFAADVPRLADGVRRLLQQYGPGLGYLATVRADGGPRVHP
FT                   VSPVLTEEGLFCFVIDSPKRRDLERDGRYALHSFPAEESDDEAYLAGRARPVTDPARVT
FT                   RLARRHCAIYDIDWRLFEFSIDVAMIAQHDVAGVARPAVQVWLEPGGQSGRPGDPRPAA
FT                   PPAPTVDHQGSAAA"
FT   gene            67524..67597
FT                   /locus_tag="Strop_R0004"
FT                   /note="tRNA-Gly1"
FT   tRNA            67524..67597
FT                   /locus_tag="Strop_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(67688..68875)
FT                   /locus_tag="Strop_0058"
FT   CDS_pept        complement(67688..68875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0058"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52543"
FT                   /db_xref="GOA:A4X0Z3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z3"
FT                   /protein_id="ABP52543.1"
FT                   /translation="MPNKDGHRRYGSVRKLPSGRYQVRHLAPDGTMRPGDQTFARKTEA
FT                   ERYLTLIEAQMARREWIDPNRGKIRLQDYAERWITERPNLRPRTVHLYRWTLGKHITPH
FT                   LGGVPLNRIDTPMVREWRSRLLADGVSLTMAAKAYRLLRAILMTAVKEDELIRINPCRV
FT                   VGADQENAAERPVLTVPQIFALAERMPDRFRALILVTTFGCLRWGEAVALQRQDVDLVA
FT                   GTVRVRQAFVEHRGTGLILGPPKSRAGVRTIALPKAALPMLKQHVSSHVGEAPEAFVFT
FT                   GENGRNLWRGNFNKLVKWPEAVAAVGVPGLHFHDLRHTGNTLASRAPGASLRDIMARMG
FT                   HDSPRAALIYQHANREADQGIADAIDKAVKAARRKPSKRRVKRATEGGGPATEAR"
FT   gene            complement(68878..69135)
FT                   /locus_tag="Strop_0059"
FT   CDS_pept        complement(68878..69135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0059"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52544"
FT                   /db_xref="GOA:A4X0Z4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z4"
FT                   /protein_id="ABP52544.1"
FT                   /translation="MAKRITQNMPALELPAELLTIQEAASRIGMSVRYVRRAVAERQIA
FT                   FHRIGRSIRIDPADLAAFVHAGRVEPMTTESIWHELRSVA"
FT   gene            complement(69373..70479)
FT                   /locus_tag="Strop_0060"
FT   CDS_pept        complement(69373..70479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52545"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z5"
FT                   /protein_id="ABP52545.1"
FT                   /translation="MTPEPNERPNLHVAGPNDAAEVLSAEQARPARIRTSWSAADIMAM
FT                   EFAPPKWAVPGVLSEGVNLLCGPPKVGKSWMSLGLGVDVALGGKAFGTIPVERGPVLYL
FT                   ALEDTARRLQSRLSKVLGQRKAPAGLTLATECPPLPQGGDRAIAAWLDRNPSARMVIID
FT                   VFAKLRGNSAPGSSAYDADYAAVGRAKKVADDYGVAFVLVHHVRKAGSDDFLTEVSGTN
FT                   GLAGAADATLVLKRARNQGDGVLHVTGRDVDENEYALNFDTAAGAWQMLDGPAQDHQVG
FT                   ETRAAILRFLRTTPGSTPKAIATEVGLAYDNVKRTCQRMLADGQLAADTGGRYRVPGVP
FT                   PVPGVPQPTLTSENKGDTTETPTLWPQP"
FT   gene            complement(70484..71194)
FT                   /locus_tag="Strop_0061"
FT   CDS_pept        complement(70484..71194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0061"
FT                   /product="C-5 cytosine-specific DNA methylase"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52546"
FT                   /db_xref="GOA:A4X0Z6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z6"
FT                   /protein_id="ABP52546.1"
FT                   /translation="MNAGPLNVLELFAGIGGLSLGLQRAGLRIVGHVEINPFCRAVLHK
FT                   HWPEVPCHDDVRTAAAWWRSTDRPRVDVVAGGYPCQPESTAGKRRGTDDDRWLWPDMAR
FT                   VIHAIRPRYVVGENVMGHRTRGLRFVLRDLQRLGYTASAGIIRACEMGAPHPRPRLLVL
FT                   AHTDRPGRHPGSGLEPPRTATTRTGRWADEPRLARMAHGLPGAVDRRRALGNAVVPHVA
FT                   EFVGRIILNHHTGR"
FT   gene            complement(71191..72366)
FT                   /locus_tag="Strop_0062"
FT   CDS_pept        complement(71191..72366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52547"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z7"
FT                   /protein_id="ABP52547.1"
FT                   /translation="MTGGHWIGASKALGRFVSVDLPYPHICGRTVAAEDTVSGQPLQVA
FT                   RWEKVRYCAACAHDKHLKAHPFTPDSRRPNPMRDATTLREVALAAALRGWHIFPLRPDD
FT                   KRPAFPDHLADACTGRDPRCRNGHTGWEARATTDPDRIRRGWSETPWGVGIACGPSGLV
FT                   VIDLDVRKPDQDAPPGNPHPAATSGIDVFAALCETAGQPIPDDTYAVTTGRGGSHLYFR
FT                   HPADSPALRNTAGERGNGLGWLVDTRAHGGYVVAAGSTVAGRSYTVARDLPVAELPGWL
FT                   AERLAPAPLPPQRPVVVDLPTGRTGAYLDAAITRQLDHLRRAAEGERNHTLYVSAVAFG
FT                   QLAAGGALPADQAEALLEEAALSIGLSRFETLRTIRSGLTVGARRPRTVAA"
FT   gene            complement(72707..74860)
FT                   /locus_tag="Strop_0063"
FT   CDS_pept        complement(72707..74860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52548"
FT                   /db_xref="GOA:A4X0Z8"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z8"
FT                   /protein_id="ABP52548.1"
FT                   /translation="MTNTTNAPQTPPANQPGATPNPTPTAKPAAARSTPAGWVTYALST
FT                   WHWRHPHPAWGTINAAGATLGTAGIAAAAGVPAPFALIGGALGAAGAVAGGMADDLSGR
FT                   RLLWRAGSWMLPATWMASTIGLDAVWSGPALGTLTAGTAAAATIATAAGRARRRRTVTR
FT                   HQQAARADAATARERVAVAWEARIARVTDVKVTIRAVQAWPTRSGFTLDADLPTGGATW
FT                   RDIARRTEGLATDARLPNGCEVTVEPGDSRGAVLLHVSTVNRLGEDHYLDDYSPLSINN
FT                   PLAIGVHRNGEQALINLRYACGVLVGQTDSGKTNQLQTINTQLIRAVDAIVWHIDLAGG
FT                   GLARPWVTPWAEGRAPAPAVDWVATTAAEAEIMARAAIEILKGRKPAYQQRMRDANDDK
FT                   IPVGPDLPEIVIVVDEIKTVPAHIVAMLTEISDTGRAAGVRTLSCALRATDDYLPVAIK
FT                   EQARIRVGMRVSDEKELNYLYGWKYNIDSEAAPYQGCGFLLAGEPGEAAPMPFKGYRTD
FT                   PGRIDAAAIAAAGWRPDLDPTSAHLADQVAVRGTHAYTDRWTRTLPTLFTEPTTITNPA
FT                   TIPSQPATTTTPDNSSKADISRMFDPIPGDTLDAALHRLTTITARATDTAAGNPVPELL
FT                   TRALDATEAAGGRIHTADLATHLDMDPGDLGTELGRILRDVGVERHNNTGRLRVGDTSK
FT                   PGYLADTLREAVDAYRASTQKAA"
FT   gene            complement(74857..76410)
FT                   /locus_tag="Strop_0064"
FT   CDS_pept        complement(74857..76410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52549"
FT                   /db_xref="GOA:A4X0Z9"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Z9"
FT                   /protein_id="ABP52549.1"
FT                   /translation="MTTTTKPPATTEVEPANTDPPGDSATDPADAEAAAVEAPGDTADP
FT                   PTPEDDPPAEDGEDSPTGFPGGAVLASAADVVAVGGGALVAGAGGAGVMLLAAGGLAAA
FT                   AAAAARRRDERRRREAGRRVAGTARASRRSTGGTPGLTRGRNTSRRNGGGGVGSGRDGA
FT                   GKAGRRRRGADPGHGGAGKSSRRRRPGFGRDGTGKSGQGRRWGLFGRSSPFRRSNKAGD
FT                   TGAGGSKGRSWWGKRSGRNPTTSNSGTRNSNSSRRRGALARGRAWLPKLPALGRPWNRG
FT                   GKPDSGGKRPPSVAGQSWWRGLVSGLRVPAASPPPWARTPPTPAPGSGLSGVAALPRGR
FT                   HAPRPAAASAVSAEDAVRQARQIRKALAGVKDAVKAIEAAASAAGAQGENEGPGPTGPQ
FT                   PLGGTAMGQFPLPAAAAEFRSAASQYTPDDMYEFGLHLAQMPAAMADIAEGLKTMAIRT
FT                   GTERPVNPLVVEALAALYHAQRATITAAETIAPMFRKAHSVDLARQENPRNNEQEWNVR
FT                   "
FT   gene            complement(76407..76607)
FT                   /locus_tag="Strop_0065"
FT   CDS_pept        complement(76407..76607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52550"
FT                   /db_xref="GOA:A4X100"
FT                   /db_xref="UniProtKB/TrEMBL:A4X100"
FT                   /protein_id="ABP52550.1"
FT                   /translation="MHTTTNNTPSRSGAVAAATVIVPVAVFGFGYGLARNAELTAWIAL
FT                   VALIAAAGAGITQALIRVVQR"
FT   sig_peptide     complement(76521..76607)
FT                   /locus_tag="Strop_0065"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.917) with cleavage site probability 0.585 at
FT                   residue 29"
FT   gene            complement(76609..77112)
FT                   /locus_tag="Strop_0066"
FT   CDS_pept        complement(76609..77112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52551"
FT                   /db_xref="GOA:A4X101"
FT                   /db_xref="UniProtKB/TrEMBL:A4X101"
FT                   /protein_id="ABP52551.1"
FT                   /translation="MVPVSEPTPVGDPVDPAWFFARAEFTRGELTRVDGKAATSMAIAG
FT                   AAATLGATALARADLPPVAMAVGVATVFLAGVATALLAVTVRPCLAGGHGLMHYAVSTP
FT                   HQLLAEVADPARTTAEQEARYLVWLARLALRKYRRIRLAVDLLLTALAGTAATAALATL
FT                   TPGG"
FT   gene            complement(77206..78267)
FT                   /locus_tag="Strop_0067"
FT   CDS_pept        complement(77206..78267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52552"
FT                   /db_xref="GOA:A4X102"
FT                   /db_xref="UniProtKB/TrEMBL:A4X102"
FT                   /protein_id="ABP52552.1"
FT                   /translation="MTAPTLDSRAYTHRAGLLVPTSIIGGEGPTDASDDRFAESMVNPE
FT                   PVQPSSPAPAPTGKDAAARVAPPLVKVGRAERRRRQRVEGERAARHARLAGDTARVQRW
FT                   QARAAEARQLRRLLTDPDVRAVRLMRQRARWTAMAWMALLFSMGFTMVNVQRFAAIGSE
FT                   QWSPMWVVAWLVDPAFSVLLVGVLIARGSLAAVGHQMHDTALVRIERVLLAAIAGMNIM
FT                   PTISHRYDSLTEHLFQVALHMAIPALAFGAAVALPLIQAHFARAIEALSDARPDAINLP
FT                   KLAADPTAAVELSANDRTLLTDVRNAITTGVLEPDPTGHAIHRRVMSGRGDKARAYRVA
FT                   GFVNGWRPELATA"
FT   gene            complement(78264..78575)
FT                   /locus_tag="Strop_0068"
FT   CDS_pept        complement(78264..78575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52553"
FT                   /db_xref="UniProtKB/TrEMBL:A4X103"
FT                   /protein_id="ABP52553.1"
FT                   /translation="MAELLLLADPAFIRVHTPDVSLSVAFDSIAELKSWLHLAGLNDPD
FT                   MLIGEHEGTTDDGRPYRSMNAYPTWRGWEFYASAREFTDSGDLDAQTVDGLAALVVAG"
FT   gene            complement(78664..79329)
FT                   /locus_tag="Strop_0069"
FT   CDS_pept        complement(78664..79329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0069"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52554"
FT                   /db_xref="GOA:A4X104"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A4X104"
FT                   /protein_id="ABP52554.1"
FT                   /translation="MNARTYTDPSVLAGIAAGASWADPEMDPTRIDWTARRAAAAIPFP
FT                   LVNGRPVNPAAPTGVRFGRNELGHWGEALAADAIVTASDPDGWRWLLLIERGDGHGWAL
FT                   PGGHVDPGEDPTHAAFRELAEETGLIADPIDPWVKTLPARYVPDPRASDEAWMVTVPVR
FT                   VDLGRGWTVLPDVIGRDDARRAEWLPAVDFDCLCRHLGYHGERLFPAHRGLLAELFAG"
FT   gene            complement(79326..79703)
FT                   /locus_tag="Strop_0070"
FT   CDS_pept        complement(79326..79703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52555"
FT                   /db_xref="UniProtKB/TrEMBL:A4X105"
FT                   /protein_id="ABP52555.1"
FT                   /translation="MMSRTRAAYWDPEGTRYGIPTWWWRGAPSGYATRRQLRAAGLRPG
FT                   GQPVAAQILWRGVGGTRVAHLYRLDLARPKRTATPAQRVAIGKALTARRTCRVCGQVRP
FT                   YYIPLSLGECLDCTNPMEAAA"
FT   gene            complement(79700..79951)
FT                   /locus_tag="Strop_0071"
FT   CDS_pept        complement(79700..79951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52556"
FT                   /db_xref="UniProtKB/TrEMBL:A4X106"
FT                   /protein_id="ABP52556.1"
FT                   /translation="MRKHLVPVATEPTAADLAAIEREWPLIAAELDLLDAEITLLYAED
FT                   RGSPTEFDWRRLRRAEARVTRAAADLPTRDTVVPRRAA"
FT   gene            80381..81247
FT                   /locus_tag="Strop_0072"
FT   CDS_pept        80381..81247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0072"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52557"
FT                   /db_xref="GOA:A4X107"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X107"
FT                   /protein_id="ABP52557.1"
FT                   /translation="MSENLDFLGELDPDDPKQASQQIANKLRAAILTRRLAPGDKLPSQ
FT                   PDLATRYGVARETVKRALDLLRAERLIVSRQGSGAFVRAQTQRAVELRPHIEAAFERPH
FT                   VTIDFAGFSGETLRDALAEALDKVRVGRLAPETIAVRVLISDMTVPMALPARAETQADD
FT                   PVVRERAERITRRAAEGIIDQVTELGDLGLIRSTTVEVRMHRASPLFKLYILNGEEVFY
FT                   GFYPVVERTVSIKGEPMAIYDLMGKDVPLFHYAVTDDDTSHGTQFVEGARQWFDSVWST
FT                   IAYRYDT"
FT   gene            81244..81948
FT                   /locus_tag="Strop_0073"
FT   CDS_pept        81244..81948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0073"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52558"
FT                   /db_xref="GOA:A4X108"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4X108"
FT                   /protein_id="ABP52558.1"
FT                   /translation="MSADLGRLLGEVGAVLLDFDGPVCSIFAGYPAPQVAAELVNVLRR
FT                   RGVDVPPDLASEPDPLEVLRRTGAAGDHGVTRTVEDVLCEAERRAVETAAPTPYGREVI
FT                   VAARQAGMPVAAVSNNSAGAVTAYLTAHRLAEHVSPVVGRAYAEPGRMKPNPEPILQAV
FT                   RSLGELAARCVLIGDSLSDIEGARAAGVAVIGYANRPTKVGDFRLARADAVVTSMGEIA
FT                   AALIDRGSNSAS"
FT   gene            complement(82600..82953)
FT                   /locus_tag="Strop_0074"
FT   CDS_pept        complement(82600..82953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52559"
FT                   /db_xref="GOA:A4X109"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4X109"
FT                   /protein_id="ABP52559.1"
FT                   /translation="MFTGESGRNLWRGNFNKLVKWPEAVAAVGVPGLHFHDLRHTGNTL
FT                   ASRAPGASLRDIMARMGHDSPRAALIYQHANREADQGIADAIDQAVKAAQRKPSKRKPK
FT                   RAAKGNGPAAAAS"
FT   gene            complement(83109..83399)
FT                   /locus_tag="Strop_0075"
FT   CDS_pept        complement(83109..83399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52560"
FT                   /db_xref="UniProtKB/TrEMBL:A4X110"
FT                   /protein_id="ABP52560.1"
FT                   /translation="MTWFTYSPTLGHQVPAKELADLNVQLVGDHRRSRLPRSRERSGVT
FT                   DADDATAIGLQRLAMTIRNGESPPSLRTLIERTSGRQRRADVTLDDDDLAA"
FT   gene            complement(83609..84655)
FT                   /locus_tag="Strop_0076"
FT   CDS_pept        complement(83609..84655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52561"
FT                   /db_xref="GOA:A4X111"
FT                   /db_xref="UniProtKB/TrEMBL:A4X111"
FT                   /protein_id="ABP52561.1"
FT                   /translation="MSGDLDQRLATMLQHQAGGDVDPTPIVRHARHRGRRLRLRRRGLV
FT                   AAGAAAACAALAVVVMVAPLGRTPVAAPVTPIALVLPDAPGQPGAVARPDLVGTDPGVM
FT                   HFVTDALVHGAVSATWTAGRGVESVELRGPNGQARLMLARSTEMLDEQQQTLGSEGRPR
FT                   QHSDVRVEGHPGVAWFDAAGDRQLWFVRWQPADGLWAQLDIYAAGRDEATAAAGRVRFD
FT                   GAQRCVVPFRLQTLPSGGRLLACSVTLGRSEHGVFTSGSLVVGDGSGRWLTVRAQLAPD
FT                   YEAKAGDLVAGPYRARRQGGDVLEMGVGPCVVEAFLEGWGRGYTESDGLTVLGGYQPAH
FT                   DLGRPAMW"
FT   gene            complement(84655..85152)
FT                   /locus_tag="Strop_0077"
FT   CDS_pept        complement(84655..85152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0077"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52562"
FT                   /db_xref="GOA:A4X112"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4X112"
FT                   /protein_id="ABP52562.1"
FT                   /translation="MTFEEYAFARTAALVRLARLLTGDEHRAEDLVQDVLAKAYARWGR
FT                   ISRIDQPEAYVRRMLVNANRSWWRRGSRREICTPAVSDRVGGVDEAAGVVERDTLWRLV
FT                   RALPTRQRTVIVLRYYEDLDDTAIAEIVGCSTGTVRTHARRALQALRKHQEAPTPARTG
FT                   GI"
FT   gene            complement(85513..86937)
FT                   /locus_tag="Strop_0078"
FT   CDS_pept        complement(85513..86937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0078"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52563"
FT                   /db_xref="GOA:A4X113"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4X113"
FT                   /protein_id="ABP52563.1"
FT                   /translation="MTLTQSSGIPDAVAAARGSFERGLTRSLSARRRQLRALGAMLTEN
FT                   ESAFEAALWKDLRKNRAEAQLTEISIVLAEINHALRHLRQWARPTRVPVPLVLMPARAR
FT                   LVPEPLGVVLVIAPWNYPVLLLLSPLVGALAAGNTAVVKPSELAPATSSLIARLVPSYF
FT                   PDGAVQTVEGGVPETTELLAQRFDHIVFTGSGTVGRIVMRAAAEQLTPVTLELGGKSPA
FT                   WFDDSADIAVAARRLAWAKFTNAGQTCIAPDYIMTTPDQVPALVDALGTAIADMWGRDP
FT                   RASCTYGRIVNDRQFDRLVGYLTGVDPAVGGTYDRTERYFSPTVVTLPATDRPAVGPDA
FT                   AHPVLQEEIFGPILPILPVASAEQAVQVINGWDKPLALYVFSSAPGIRRLFEEETSSGA
FT                   VVYNAALIHAAATGLPFGGVGASGMGAYHGSYSWRTFSHLKPVLEKPLKPDSLRLIQPP
FT                   FGKLGTALAQHLMRRA"
FT   gene            complement(87100..87633)
FT                   /locus_tag="Strop_0079"
FT   CDS_pept        complement(87100..87633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52564"
FT                   /db_xref="UniProtKB/TrEMBL:A4X114"
FT                   /protein_id="ABP52564.1"
FT                   /translation="MIKPSTSPGPRPAAPPLDRPITSETKRPLPSILGGVALVAMLALG
FT                   GCAATNASNESEATPSTASPPAAPATTAASAPSVDTPKPADFELTVKLLDKQCFGATGC
FT                   NVEFRISHVSYTGPSLDPSATYEVSYEFKGLADTQLGTFELSGDGTYSIEKFQFGETKE
FT                   SAEVTAVVTAVDKI"
FT   sig_peptide     complement(87442..87633)
FT                   /locus_tag="Strop_0079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.882) with cleavage site probability 0.316 at
FT                   residue 64"
FT   gene            complement(87657..88007)
FT                   /locus_tag="Strop_0080"
FT   CDS_pept        complement(87657..88007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52565"
FT                   /db_xref="UniProtKB/TrEMBL:A4X115"
FT                   /protein_id="ABP52565.1"
FT                   /translation="MDPHHVSKAWRALGRMHPDRALWERCDALLNTGGVLTADTTGSSS
FT                   SHSGIDTHENPVSSTTHLRCHHVDRCCGQSLPHTGDVPGRRGQELLQLLVIHDVLHKAQ
FT                   ANHDETRWTVVC"
FT   gene            88254..89795
FT                   /locus_tag="Strop_0081"
FT   CDS_pept        88254..89795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0081"
FT                   /product="guanine deaminase"
FT                   /EC_number="3.5.4.3"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52566"
FT                   /db_xref="GOA:A4X116"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4X116"
FT                   /protein_id="ABP52566.1"
FT                   /translation="MPLTRRSLTQFMAAGIGGGLLTAGPGVRAGHDLGDRHPDRNGAGF
FT                   RGPRMYRGWILYVVDTPPSGADDTEADQQRWLRQYRDGVLVVSTDGHIADVGNYHEVAP
FT                   RYPDIPCRDYRGMLIMPGFIDSHVHYVQTQIIASYGRTLLEWLNEFAFPVEEQFSAPQA
FT                   AAAVADIFLRYLFQNGTTTSVTFAATYPVSASALFEAASAYDMRIITGKTWMDRNAPPQ
FT                   LLDTPESAYRDSRELIRRWHGKGRNLYAITPRFAITSTFEQLRLAGILHAEYPSTYIHT
FT                   HLSETRAELALVRELFPGFRDYLAVYEAAGLVTERSVLAHGVYLSGSELSRVSAARSTI
FT                   AHCPTSNLFLASGLYDLQRANRRGVQTSIGTDVGGGTSFSLLRTLDETYKSQHLQGYPV
FT                   NAFEMLYLCTLGAARHLHLAGKVGSLDIGHEADFVVIDYLAQGIQRTRMEYLRSTGGWT
FT                   TESMLFGLEITGDDRNVAATYVMGRPVYASRLHRGSHVLPPSRASGVLPEGLVDT"
FT   sig_peptide     88254..88343
FT                   /locus_tag="Strop_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.745 at
FT                   residue 30"
FT   gene            complement(90293..90871)
FT                   /locus_tag="Strop_0082"
FT   CDS_pept        complement(90293..90871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0082"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52567"
FT                   /db_xref="GOA:A4X117"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4X117"
FT                   /protein_id="ABP52567.1"
FT                   /translation="MSAPVTVREATAADWPAVTDIVNHYIATTTLNLHTEARTLQDWTA
FT                   DWTRYRERYPWLVATDDDRVVGVAYAGPWKARNAYDWCAEVTGYVSTDMRGRRVGHALY
FT                   RSLLAVLDAQGFRSQIAVIGLPNDPSAGFHESFGFRHVGTLAGVGFKNGTWLDVGFWQR
FT                   SAGDTSQAPDPLLPCADVLKEVLDAVGRE"
FT   gene            complement(91285..92154)
FT                   /locus_tag="Strop_0083"
FT   CDS_pept        complement(91285..92154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0083"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52568"
FT                   /db_xref="GOA:A4X118"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4X118"
FT                   /protein_id="ABP52568.1"
FT                   /translation="MYVTAPDRTGEVQLSDGRLLGWAEWGPPEGTPVLFSPGAATSRWL
FT                   GFGADVIDRLGVRLVSVERPGLGASTPLPGRTFADFVADIRQFTTIRGLGRPAMVGNSQ
FT                   GAPFALACAEEDVTAALAIVSGADEVAAPEFASVLPAELRKLVDWTVRDAAEAERFFAG
FT                   YSADSLLDFVLGGSPECDLEVYREPGFADAYRRALNEAFAQGAAGYARDTVLAMSPWSI
FT                   DLNKIFVPVDVWYGELDQSHSPDNGSLLATRIPGAQHHLVPAIGGAVLWTHAEPILSTL
FT                   LTRANIQS"
FT   gene            92818..93297
FT                   /locus_tag="Strop_0084"
FT   CDS_pept        92818..93297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0084"
FT                   /product="Acetyltransferase, GNAT family"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52569"
FT                   /db_xref="GOA:A4X119"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4X119"
FT                   /protein_id="ABP52569.1"
FT                   /translation="MGQVVKLRDMRQDEYDVYSDQQLREYVEAQTGLVSTEAARRKALR
FT                   DREQFLPHGLATERHRLLVAENSGGEVVGAVWLGLDDPRSKSAEMAWIFDIRVDPAHRR
FT                   LGYGAAILSAVEELAREAGALRLGLNVFGHNAPAIALYERSGYEMTTQQMAKPLR"
FT   gene            93366..94256
FT                   /locus_tag="Strop_0085"
FT   CDS_pept        93366..94256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0085"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52570"
FT                   /db_xref="GOA:A4X120"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A4X120"
FT                   /protein_id="ABP52570.1"
FT                   /translation="MIMRIGIVILPDQRWAESERRWRQVDEWGFDHAWTYDHLGWRDLV
FT                   DGPWFDSMTTLTAAAATTRRIRLGTLVASPNFRHPAAFARQVTALDDVSGGRALLGLGA
FT                   GGIGFDAAVLGGETLPPRQRVDRFTEFVELLDLVLREDGTTWRGDWFTAVDARNNPGCV
FT                   QTPRVPFVVAANGPRSMRLAIRYGQGWVTTGPTTDDLEVWWEGVADLTARLDKSLASVG
FT                   REPGSLDRHLLLDSAPVFSLRSADFFAEQVGRAAALGFTDVITHWPRASSWYAGEEAVL
FT                   VDVASRLPELRRLTD"
FT   gene            complement(94348..94908)
FT                   /locus_tag="Strop_0086"
FT   CDS_pept        complement(94348..94908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0086"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52571"
FT                   /db_xref="GOA:A4X121"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4X121"
FT                   /protein_id="ABP52571.1"
FT                   /translation="MPPELRGRLAELIRWIDPGPGATHLVSDISGWWRDPAVLASLGPA
FT                   LVTPFQQSRPTVVISPAVTGYLLGPLAATALGIGFVAAHKPGDGRLPPGTLTWAQGPPD
FT                   YRGRQLDLAVRDRNLEAGDRVLVVDDWVSTGAQVRALYEICAARHATPVGTATVVADCP
FT                   PEVAAELRIQSLLTGADLTPLTP"
FT   gene            95005..95730
FT                   /locus_tag="Strop_0087"
FT   CDS_pept        95005..95730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0087"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52572"
FT                   /db_xref="GOA:A4X122"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A4X122"
FT                   /protein_id="ABP52572.1"
FT                   /translation="MITLTSDVLRSLRSDPVCSVDERTGPVAGRHARTRRVSPTGVAAT
FT                   AAIGVVLAIGGTVGTVRLTSGNESDRSVTVAPTTVDSPATAPTTAPATPSASPSVSPSS
FT                   SARSAPAASPTPARNTQVPSRSKPRSTTPQPTATKSTSPAPTVMETGSCGASYYSEGQL
FT                   TASGESFDPSAMTAAHKTLPFDTMVRVTNPVTSTSVTVRINDRGPFITGRCIDLSQAAF
FT                   AVIAPLSAGHVEVRYEVLG"
FT   gene            95829..96956
FT                   /locus_tag="Strop_0088"
FT   CDS_pept        95829..96956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0088"
FT                   /product="Stage II sporulation E family protein"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52573"
FT                   /db_xref="GOA:A4X123"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A4X123"
FT                   /protein_id="ABP52573.1"
FT                   /translation="MLSLVRTQLSQLGRGPLSPGSRAGLGAAFALLAFVSALEYADGRA
FT                   ANYIALLVAAPFVAAALASWRVVLGVGVTAVVLGVGFALADGVGSLPSAVAVAGIALGA
FT                   ALAATTASIRQRQTERIAELSRLATVAQQAVLRPLGPQVGSLAVAARYISSTATAEIGG
FT                   DLYEALDTPYGVRMIIGDVRGKGLEAVRLASIVLGSYRHVAYERADLRAVVADLDRAVA
FT                   RSVGDEDFVTAALVEERGGTLTIVNCGHPAPLLLRRGAVVALEPPAPAPPLGFMPAVRA
FT                   RVERLEPGDRLLLFTDGLGEARRDGEFFPTTGRAWRLLGHGTVADGLASLEAALVEWVY
FT                   DRLDDDIALVLMEYTGTRSGGSVAVPSWEVGTAEG"
FT   sig_peptide     95829..95954
FT                   /locus_tag="Strop_0088"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.768) with cleavage site probability 0.521 at
FT                   residue 42"
FT   gene            97039..98892
FT                   /locus_tag="Strop_0089"
FT   CDS_pept        97039..98892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0089"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52574"
FT                   /db_xref="GOA:A4X124"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X124"
FT                   /protein_id="ABP52574.1"
FT                   /translation="MTHYKSNLRDLEFNLFEVFGADRAFSQAPYTELDVDTARSFLAEV
FT                   DRLTREDLAASYTDSDRNPPVFDPATHTAPLPESFKKSYRRFMDAEFWRLDLPEALGGS
FT                   NAPRALWWSLAELVLGSNAPVWMYASGPSFAHVLHVEGTERQRKWAKLFIDQGWGSTMV
FT                   LTEADAGSDVGAGRARAIPQPDGSWHIEGVKRFITSGEHDLSDNIVHYVLARPVGVEGV
FT                   GGPGTKGLSLFVVPKYHFNEETGELGERNGVFATNVEHKMGLKVSNTCELTFGEHGVPA
FT                   QGWLLGEKHDGIRQMFMIIEYARMMVGTKAIATLSTGYLNALEYAKSRVQGADLTQMTD
FT                   KSAPRVTITHHPDVRRSLLLQKSYAEGLRALVCYTAGWQDKVAIAEAAGDEKAVELAKR
FT                   VNDLLLPLVKGVGSERAYELLGHESLQTFGGSGFLQDYPLEQYVRDAKIDTLYEGTTAI
FT                   QSLDLIFRKVVRDNGKALMAVAGEIQEFISAEGGNGQLKDERQALGRALGEIQSILGVL
FT                   TGWLGEAQGGETRALYKVGLSSRRFLLAIGDLVVGWLLQRQADVALTALAGDASTDRDF
FT                   YTGKVAAARFFAREVLPRIGADRRIIENVDLSVMDLPEEAF"
FT   gene            99117..99386
FT                   /locus_tag="Strop_0090"
FT   CDS_pept        99117..99386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52575"
FT                   /db_xref="GOA:A4X125"
FT                   /db_xref="UniProtKB/TrEMBL:A4X125"
FT                   /protein_id="ABP52575.1"
FT                   /translation="MGIGSGIFLIALGAILTFAIRANVWWVDLRAVGWVFILAGLAVLL
FT                   TTVWFWQDRRKRARTLIVEENRLSHPTAMMPPPPDPPPPTAPPS"
FT   gene            complement(99421..99957)
FT                   /locus_tag="Strop_0091"
FT   CDS_pept        complement(99421..99957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0091"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52576"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4X126"
FT                   /protein_id="ABP52576.1"
FT                   /translation="MTDAYAQNRTLVLLRHAKAEPNGDQPDVDRPLTARGRADAAAAGA
FT                   WLAHHRFLPDVVICSSARRTRETWHGVTMGMTGAPPEGGSAGPAPDVHYTDDAYEAHPA
FT                   DLLTLVRRVNPAVRTVLLIAHNPGVTQLSALLDSEQTDRDPQRTSEAVVHRTTAEWAGL
FT                   GRRDTVIAAEHTARG"
FT   gene            complement(100075..101013)
FT                   /locus_tag="Strop_0092"
FT   CDS_pept        complement(100075..101013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0092"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52577"
FT                   /db_xref="GOA:A4X127"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X127"
FT                   /protein_id="ABP52577.1"
FT                   /translation="MYTVVVLALPDVIAFDLATPIETFGRVRLPDGRPGYRVLVAGPDD
FT                   VVDAGPVRLAVSEQLDALDRADLVVVPGRNDPLRPSPPSVLTALRAAATNGTRVASICV
FT                   GAFTLAEAGLLDNMRATTHWLAAEHLARKHPSIQVDPDVLYIDNGSILTSAGAASGLDL
FT                   CLHVIHTDYGAAVAADAARLAVAPLHRSGGQAQYILRNRPPLRTSTLEPVLAWIEANAH
FT                   RALTLADLAAAASMSARTLTRRFAVETRQSPMQWVAGVRIRHAQELLETTDYTIDRVAN
FT                   HTGFTTTSNFRAQFQEVVGTTPGAYRRTFRL"
FT   gene            101108..101827
FT                   /locus_tag="Strop_0093"
FT   CDS_pept        101108..101827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0093"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52578"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X128"
FT                   /protein_id="ABP52578.1"
FT                   /translation="MHLHVKGLPMPTLRAQFVLFDGFDLLDVIAPLEVLSAGSAALGGV
FT                   LECVLVSESGRDSIPSGAAGLSLPASAALEPEAPGYVIVPGASGPVDGDPDAGELTVPA
FT                   LLGRFAGSPTMALVARALAAPQVTVVAVCGGGLALAMAGLLEGRTATTHHLGIDSLESI
FT                   GVNAVRARVVDDGDLVTGGGVLSGVDVALYLLERDFGCAAARAVEDLFEFERRGTTWKA
FT                   PAGSLPRAPVVGQRVQA"
FT   gene            101824..102300
FT                   /locus_tag="Strop_0094"
FT   CDS_pept        101824..102300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52579"
FT                   /db_xref="GOA:A4X129"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:A4X129"
FT                   /protein_id="ABP52579.1"
FT                   /translation="MSAFLLSVHVLAAILTIGPVAVTASMFPRFARLALDKPTDPRRGA
FT                   VVRVLHRITRNYAVIGALVPVFGLATGASIGVLGDAWLIVSIVLTAGAGAMLIAVVLPG
FT                   QRRTLRCLDVGAEPEDLARVAPRLGMHAGFFNLLWAIVVVLMIYRPGSTTGVGL"
FT   gene            102297..102578
FT                   /locus_tag="Strop_0095"
FT   CDS_pept        102297..102578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52580"
FT                   /db_xref="GOA:A4X130"
FT                   /db_xref="UniProtKB/TrEMBL:A4X130"
FT                   /protein_id="ABP52580.1"
FT                   /translation="MSPRHLLRVTGSVELATLALMLLNIVTVHTPAVSRILGPVHGLAY
FT                   ALTVLAAALVMRRRHRVWLIALVPGVGGLLAARVAAPEPFATVSDVDL"
FT   gene            complement(102658..103335)
FT                   /locus_tag="Strop_0096"
FT   CDS_pept        complement(102658..103335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0096"
FT                   /product="channel protein, hemolysin III family"
FT                   /note="TIGRFAM: channel protein, hemolysin III family;
FT                   PFAM: Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52581"
FT                   /db_xref="GOA:A4X131"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="InterPro:IPR005744"
FT                   /db_xref="UniProtKB/TrEMBL:A4X131"
FT                   /protein_id="ABP52581.1"
FT                   /translation="MTTSAPSRLKPTDLGKPRMRGWLHTYAFFVAVAGGIVLCSIAAAR
FT                   TGWSPLVSTLIYSLTVCGLFGTSGLYHRRVWSERGFQVMRRMDHSMIFVFIAGTYTPFC
FT                   VLLLEPRPATIMLSLVWGGALGGVALKLIWPHAPRWVSAPLYLALGWVAVAMLPDILHA
FT                   GGVTALVLLIVGGAIYSIGAVSYALRRPNPWPTVFGHHEFFHACTLVAAICHHIAIYFA
FT                   LFA"
FT   sig_peptide     complement(103201..103335)
FT                   /locus_tag="Strop_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.739) with cleavage site probability 0.621 at
FT                   residue 45"
FT   gene            103387..104163
FT                   /locus_tag="Strop_0097"
FT   CDS_pept        103387..104163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0097"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52582"
FT                   /db_xref="GOA:A4X132"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4X132"
FT                   /protein_id="ABP52582.1"
FT                   /translation="MNSRRAGGRPAAPEGVFGSRPVPASGLFRKDGGMRIRPVGAHALL
FT                   LDCSDADQVEAWRAELWRRREEGDLDAVEIIPAAGTVLLDGLADPAHTTALLSAWNPPP
FT                   SAAATSAWNPPPSAAATSAAATSTGSGGTGAVEVPVRYDGTDLPTVAGYWDVAVPTVVR
FT                   RLIATEFRVAFCGFAPGFAYLTGLPAGLAVPRLSTPRPRVPAGSVALAGPYAGIYPTAS
FT                   PGGWLLVGHTDLPLFDVHADPPARLTPGTRVRLVPA"
FT   gene            104160..105098
FT                   /locus_tag="Strop_0098"
FT   CDS_pept        104160..105098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0098"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52583"
FT                   /db_xref="GOA:A4X133"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A4X133"
FT                   /protein_id="ABP52583.1"
FT                   /translation="MTDGPRMTGSRPVGPTLPSVVESGSGGVGGVVEVLRAGLLTTVQD
FT                   LGRPGWAHLGVPRSGALDPGALRLANRLVGNPESAAGLEITLSGCELRFRRATTVAVTG
FT                   ADAPVHVGDRPGDVGRPLAVPAGAAVWVGPPRTGLRSWLAVAGGIAVEPVLGSRATDTL
FT                   SGLGPPPLHDGDRLPVGAPAGPPAPVDVTTTVPAPDEVRLALRLGPRDDWFVPPALDRL
FT                   LGTAYTLTPVSNRVGARLSGAALPRAVSGELPSEGLVLGAVQVPADGQPLVFLADHPTT
FT                   GGYPVVGVVVDVTPLAQARPGTTVRFYGSQR"
FT   gene            105082..105849
FT                   /locus_tag="Strop_0099"
FT   CDS_pept        105082..105849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0099"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52584"
FT                   /db_xref="GOA:A4X134"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4X134"
FT                   /protein_id="ABP52584.1"
FT                   /translation="MDLNADLGEGLGVWRLGDDAALLDLVTSANVACGFHAGDAVTMRR
FT                   VCAGAAERGVMVGAQVSYRDLVGFGRRHIAYEFAELRDEVIYQLGALDGFCRVAGTRVR
FT                   YLKPHGALYHAVTYDESQAAAVVAAVAEYDDQLALLCPSGSVLSQLANGAGLRAVSEGF
FT                   ADRGYQPNGRLVPRGAPNALVADPEQMAQQALRMATEQAVVAVDGTVIPCPVQSICLHG
FT                   DTPGAVRCAELIRAVLVDAGIPLAPFTGRGGRA"
FT   gene            complement(105874..107712)
FT                   /locus_tag="Strop_0100"
FT   CDS_pept        complement(105874..107712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0100"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; NHL repeat containing protein;
FT                   Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52585"
FT                   /db_xref="GOA:A4X135"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4X135"
FT                   /protein_id="ABP52585.1"
FT                   /translation="MATAPRVRAPELKGRRWLNTGGRHLDLADLRGRITVLDFWTFCCI
FT                   NCLHVLDELRPIEQKYADVLVVIGVHSPKFEHEKDPDALADAVERYGVHHPVLDDPELN
FT                   MWQQYAARAWPTLAVIDPEGYVVATMAGEGHAEGLVRLVDDLIATHEAKGTLRRGDGPY
FT                   VPPAEPETTLRFPGKSVVLDNGNLLVSDSARHSLAELAPDGETLLRRIGTGARGRADGT
FT                   ATAATFAEPQGLCLLPAQVSRLVGYDLVVADTVNHLLRGVRLATGEVVTVAGTGRQWRS
FT                   TVDDHAHDALSVDLSSPWDLAWYDDRLVIAMAGIHQLWWFDPVKRTTGMYAGSTVEARK
FT                   DGPLAEAWLAQPSGLSVSADGSRLWVADSETSAVRYVENGILTTAVGQGLFEFGHVDGP
FT                   AAQALLQHPLGVCALPDGSVLIADTYNGAVRRYDPESDSVGTVADGLAEPSDLLLTPDG
FT                   GVLVVESAAHRLTRLAPGALTAAGASTVNGPRHRTERKPTELRAGAVTLEVIFTPAPGQ
FT                   KLDDSYGPSTRLVVSASPPELLLSGAGTSTELSRELVISDSVPEGVLQVTAQAATCDAD
FT                   VAHAACHLTRQDWGVPIWVVDDAADRLPLVLRGMDA"
FT   gene            complement(107799..108125)
FT                   /locus_tag="Strop_0101"
FT   CDS_pept        complement(107799..108125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52586"
FT                   /db_xref="UniProtKB/TrEMBL:A4X136"
FT                   /protein_id="ABP52586.1"
FT                   /translation="MNPHHLPQPRLGPHPEHPRHRAGSQPPHTPLRPLWACRACGHPWP
FT                   CAEARLLLKAEYETRQPSLSIYLAGLLYEAMHDLYHLNPHDGPHPRDLFDRFVAWGPFR
FT                   RSGG"
FT   gene            108532..109299
FT                   /locus_tag="Strop_0102"
FT   CDS_pept        108532..109299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52587"
FT                   /db_xref="GOA:A4X137"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X137"
FT                   /protein_id="ABP52587.1"
FT                   /translation="MNEALRLAMNEAGHTAQTLAERVGVDRKTTTRWLVKDHIPHPAHR
FT                   TAAADALGVDKEDIWPDTSRRRNPVWFRPWQEFEREATSLRSYQSVVLPGLLQTEAYAR
FT                   AVLSSGGMRGRTEVDRLLATRLSRQAILTKEDPPQFVAVVDEVALRRPVGGRETMRQQA
FT                   HALLAACEAPHVRMHVVPLTVGAYAGLNGPFVIGTGPDHRMAVYLDSQLEGEMVSTPND
FT                   VAAILAAWENVRGEALSHWQSVDLLREVAESWT"
FT   gene            109290..109481
FT                   /locus_tag="Strop_0103"
FT   CDS_pept        109290..109481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0103"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52588"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4X138"
FT                   /protein_id="ABP52588.1"
FT                   /translation="MDLTGARWRTSSRSSGNGGDCVEVADNLPGVVGVRDSKDPTGPVL
FT                   VFGPASWGAFVAQLPGRD"
FT   gene            109619..111118
FT                   /locus_tag="Strop_0104"
FT   CDS_pept        109619..111118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0104"
FT                   /product="Eco57I restriction endonuclease"
FT                   /note="PFAM: Eco57I restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52589"
FT                   /db_xref="GOA:A4X139"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X139"
FT                   /protein_id="ABP52589.1"
FT                   /translation="MASDLLTRAEQNRATALAGLDPKSQDSLGQFFTPARAAVLLASMP
FT                   QLPDAGQIRVLDPGAGSGMLSAALVARVLNDRSNLAVHVVAVERDETLLPQLRDTLDAC
FT                   ATAGSGRVTYELVTDDFITASTGTRPDERLGGFDLVIQNPPYGKLAASAPARAAVRETQ
FT                   VDAPNLYAAFLALGAAALRPNGQLVAITPRSFCNGPYFGAFRAYLLRQISLDRVHIFES
FT                   RSTVFADTGVLQENVIFSGTRGGGRDTVLLSASNGHEDKSTERRVRYSEVVHASDPHQF
FT                   IRIASKDEDTEVAERMLSLPDTLASLGITASTGRVVDFRSRDSLLYQAVTEAAPLVYPG
FT                   NLRQGLVTWPRELRKPQWFRPASERDAKLLLPEGWYCVIKRFSAKEERRRIVAAVWSPD
FT                   QTPGPVAFENHLNVLHLNGTGLDREIAFGLSMWLNSSLVEKFFRSFSGHTQVNATDLRT
FT                   MRFPDAGSLHHLGLVSPHPLSGQEEIDMTVEKVISKIDVVA"
FT   gene            111115..112059
FT                   /locus_tag="Strop_0105"
FT   CDS_pept        111115..112059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0105"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.4"
FT                   /note="PFAM: BsuBIPstI restriction endonuclease domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52590"
FT                   /db_xref="GOA:A4X140"
FT                   /db_xref="InterPro:IPR009528"
FT                   /db_xref="InterPro:IPR041454"
FT                   /db_xref="InterPro:IPR041962"
FT                   /db_xref="InterPro:IPR041963"
FT                   /db_xref="UniProtKB/TrEMBL:A4X140"
FT                   /protein_id="ABP52590.1"
FT                   /translation="MSVVRKIEEASQILTALGMDAERSNERSAQTLLALLHLKSDDTWA
FT                   DSANPMLGTRAIMDWIRDEYGRSYAANTRETIRRFTLHQFADAFLIQQNPDQPTRPVNS
FT                   PKWNYQVTSEALTVVKAFGTPDFDSVLSEYLTRKPGLKAQYATARARNRIPVTLPGGKP
FT                   FTLSPGGQNVLIKQVVEEFCPQFTPGAEVLYVGDADAKWALFEAERLAEFGVSIDQHGK
FT                   MPDLVVYLPDKDWIVLVEAASSHGPVDAKRHGELAALFKGATPGLVYISCFPDRREMRK
FT                   YLHRIAWETEVWCAEDPTHLIHFNGERFLGPYS"
FT   gene            complement(112208..115009)
FT                   /locus_tag="Strop_0106"
FT   CDS_pept        complement(112208..115009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52591"
FT                   /db_xref="GOA:A4X141"
FT                   /db_xref="UniProtKB/TrEMBL:A4X141"
FT                   /protein_id="ABP52591.1"
FT                   /translation="MRPHEHDRSIPQPSRRQPPRPRHRERAALRQFTGGPRRDPHHRAA
FT                   SDVLTRPRLFSPPHRRPAGSAGRAFGIPRRAHVNRRPYRADTGISPSPAARYGGVRSSL
FT                   ADAAGRFRIEPNRNRPATRSSGPMLPKPRFRRTGYGAESGRGAVRRRRLPCRAPASAAE
FT                   ADGGGARMTSEGTHHPGQQPEEASPGAGGPTPYGDRPAKQDNGYAAGQPDLGWAPPPPA
FT                   HPTPAGPAWATDAPPAPAWGTAQPPEPSPAPASAGWAPPRSTEPAWTQQQPPPVVRATA
FT                   QVPQPAPSQPMPDAPVSGRPEPTSEWHAGAGQPDPAPSGGWAPEAVAWAPGSPAVATSN
FT                   EGGWHPGEPSSHAGTAPPGERPAQPWVPTPRSAGDGLNMPSVKPWAPEEAWGNAERSAA
FT                   AGQEPGSPGEPPVYQPTPGPGISPANAVPLPPQEQRVPGASLAAGAPVDFAAPPPPAAA
FT                   PPPPAAAPPPPVDFAAPPPPAAAPPPPAAAPPPPVDFGAPPLGAQEPARFEPGYGADQH
FT                   GWPPPAGPVEAPAPPAVPAPRSSPESAELPVPPAVSGGVSASAAVPLASRVTPPADQAQ
FT                   VPPTPAPQPRVYGRPAPPEPAEPEGYQADPQRFGPEGPPEHGRDTELGTNRGFGPDNGF
FT                   SPEGGLRPDGGVVPESGFGVDGGFGRGNEERPPSPTGYAPVVPAPAAPFPPSIPTFADA
FT                   PASDRPVNGTRPHPGEERPADRFGEPATGAANVNSTTAFPPQPESAIPPPAPSWDQAQP
FT                   PTQAWNQAQPPTQAWNQAQPPAPSWDQAQPPTPSWDQAQPSTPSWDQNGPAGSDPEQNR
FT                   FDAFQPIAEPAADAPIPKVRNGRVLAAVLVAAVLILAIPLGLLLLAGKLSRDDAAPVFD
FT                   PAVGSCVEQAGESAVAVDCGDAEAHTVVSKVNTKEECTDTTQPTVTLSGSGGNRVLCLE
FT                   KTN"
FT   gene            complement(115228..116691)
FT                   /locus_tag="Strop_0107"
FT   CDS_pept        complement(115228..116691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0107"
FT                   /product="catalytic domain of components of various
FT                   dehydrogenase complexes"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; catalytic domain of components of various
FT                   dehydrogenase complexes; E3 binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52592"
FT                   /db_xref="GOA:A4X142"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A4X142"
FT                   /protein_id="ABP52592.1"
FT                   /translation="MSRVKEFNLPDLGEGLTEGEILSWLVKVGDTIELNQPIVEVETAK
FT                   AAVEIPAKWAGRVQSIFHAEGATVEVGTPIIAIDTDPTAGPLATPEPTGGTAKASSAAA
FT                   SAAVEAPRGSTESGQNGDATSGGRTPVLVGYGPRTTAAKRRPRKGTAPAAPAAPARPTP
FT                   VPAQPTPVPVATGPTPGSGRSGPAGGTPVLAKPPVRKLAKDLGVDLSTVTGSGPLGSIS
FT                   REDVRQAASATPTTAEPLAAAVPVGSTTANVGAHREQRIPVKGVRKLTAENMSRSAFTA
FT                   PHVTEFLTVDMTRAMKALDRLRQRREWRDVRVSPLLLVAKAVLLAVRRHPMVNSTWAGD
FT                   EIVVKDYVNLGIAAATERGLIVPNVKDAGRLTLRELADSLTDLVQTAKAGKTSPGDMSG
FT                   GTLTITNVGVFGVDTGTPILPPGESAILAFGAVRKMPWVHKGKVRPRQVTTLGLSFDHR
FT                   IIDGELGSRFLRDIGDFLADPEAALLAWT"
FT   gene            complement(116697..117686)
FT                   /locus_tag="Strop_0108"
FT   CDS_pept        complement(116697..117686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0108"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52593"
FT                   /db_xref="GOA:A4X143"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A4X143"
FT                   /protein_id="ABP52593.1"
FT                   /translation="MATETLTLGKALNAGMRKALESDPKVVIMGEDVGKLGGVFRITDG
FT                   LQKDFGDQRVIDTPLAESGIIGTAIGLAIRGYRPVCEIQFDGFVYPAYDQIVSQVAKMH
FT                   YRSRGKLKIPMVIRIPFGGGIGAVEHHSESPEAYFSHTAGLKVATCANPQDAYVMIQQA
FT                   IASDDPIVFLEPKRRYWEKGPVEIDQPLPEAYPLQAARVARPGTDATLIAYGPMVRTCL
FT                   DAATAAAEDGRELEVIDLRTLAPLDLGLVYESVRRTGRAVVVHEAPSNIGLGAEVAARI
FT                   TEECFYSLESPVLRVTGFDIPYPASRVEEEYLPDLDRVLDAVDRTFGW"
FT   gene            complement(117686..118861)
FT                   /locus_tag="Strop_0109"
FT   CDS_pept        complement(117686..118861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0109"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase, E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52594"
FT                   /db_xref="GOA:A4X144"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A4X144"
FT                   /protein_id="ABP52594.1"
FT                   /translation="MAKGDPGVNTRGRRAVPRSRKGATGDPELVQLLTPEGERIESVTG
FT                   PDGTEYRVDFTDEEYRGFYRDLVLVRKLDAEATALQRQGELGLWASLLGQEAAQVGSGR
FT                   ALRTQDMAFPTYREHGVLYCRGIDPIMPLGLFRGVDQGGWDPNEFKFNMYTIVIGAQAL
FT                   HATGYAMGITMDGKTGTDEGEAVIAYFGDGATSQGDVNEAFVWASVFNAPMVFFCQNNQ
FT                   YAISEPLERQTRIPLYRRAAGFGFPGLRVDGNDVLATYAVTRHALDNARHGQGPSLIEA
FT                   YTYRMGAHTTSDDPTRYRIASEVEAWQAKDPIARMKTFLEKQKIADDGFFAEVDEQAKR
FT                   ESVHLRERVLEMPNPEPSSMFDHVYPNGSPLVDQQRAQFNQYLESFEGSAH"
FT   gene            119237..119755
FT                   /locus_tag="Strop_0110"
FT   CDS_pept        119237..119755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52595"
FT                   /db_xref="UniProtKB/TrEMBL:A4X145"
FT                   /protein_id="ABP52595.1"
FT                   /translation="MACRHAALFGLRNVTGSGWRYCLRHGCPVRSLPSAEDDEEGGVPE
FT                   SGDAAGPPRRSSRCGPGATAARHRSASGYRRVVGAHRAPGGARPSRGYLLTVALLVGTA
FT                   SMPLLAAAGAGSATRPPSADHSSPPSSAPAVSPPPSLSSASVSPSSPEPSPSLTPSSPR
FT                   ASSPAPAWS"
FT   gene            119985..120362
FT                   /locus_tag="Strop_0111"
FT   CDS_pept        119985..120362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0111"
FT                   /product="protein of unknown function DUF805"
FT                   /note="PFAM: protein of unknown function DUF805"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52596"
FT                   /db_xref="GOA:A4X146"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A4X146"
FT                   /protein_id="ABP52596.1"
FT                   /translation="MLFVDAIRSVLTQYAGFSGRARRSEYWWFYLFITIVNIVFGCLSG
FT                   VAEAAVFIGLIVSLALLLPTIAVSVRRLHDTNRSGWFMLLGLIPIVGGIILLIFFTQDS
FT                   KPGPNRFGPNPKDPAASGLVA"
FT   gene            complement(120504..121724)
FT                   /locus_tag="Strop_0112"
FT   CDS_pept        complement(120504..121724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52597"
FT                   /db_xref="UniProtKB/TrEMBL:A4X147"
FT                   /protein_id="ABP52597.1"
FT                   /translation="MGTAQTPYDAVLHAARDVAELDNALDAERLGAALLGSVYAVAETR
FT                   RDDAVRAFVSDFLAATSRRRAAAATTIRSVFAALVPDAAGADRVRPAAAAPAWSGQLGR
FT                   VHLTGCWAYGDVFGDQTSYLATFAYDDPTGGPEHALVALVDHNIGITKDIFVGGPPARV
FT                   LDQIRQMCAEDELTWFRDEAPAAMHTEVSRHLAITDELSELPGEGSLATDRALVGARLA
FT                   LLPTSRAAGDQRAEPLTAAERTDLVRRFLAAPEATQFGLDSLDDDQLASLHFCLGLLLD
FT                   HTATFTDPDPLRWSPTVAGLFLLDWVHRRAVLDMDDAALLPRVLRGWAAYAGRKRGLSA
FT                   AAAARVDAAVDEMVPEFARLYSTGERRSPATAAVAQLLADGVDPDDPAALDAWIEENRH
FT                   HLTDEGS"
FT   gene            122017..123858
FT                   /locus_tag="Strop_0113"
FT   CDS_pept        122017..123858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0113"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52598"
FT                   /db_xref="GOA:A4X148"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X148"
FT                   /protein_id="ABP52598.1"
FT                   /translation="MARAVGIDLGTTNSCVSVLEGGEPTVIANAEGSRTTPSIVAFARN
FT                   GEVLVGEVAKRQAVTNPDRTIRSVKREIGTDWFVDIDDKKYTPQEISARTLMKLKRDAE
FT                   AYLGEQITDAVITVPAYFNDGQRQATKEAGEIAGFNVLRIVNEPTAAALAYGLDKGSKE
FT                   QTVLVFDLGGGTFDVSLLELAEGVIEVKSTSGDNLLGGDDWDQRIIDHLVKTFNGEHGI
FT                   DLAQDKMAMQRLKEAAEKAKIELSAAATSNINLPYITAGAAGPLHLDVTITRAEFQRMT
FT                   QDLLDRCKGPFEQAVKDAGIKVGDVEHVILVGGSTRMPAVTELVKQLTGRDPNKGVNPD
FT                   EVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKLIERNTTIPTKRSEVFT
FT                   TADDNQPSVLIQVFQGEREIAAYNKKLGTFELTGLPPAPRGMPQIEVTFDIDANGIVNV
FT                   HAKDTGTGKEQKMTVTAGSSLPKEDIERMRRDAEEHAEEDKQRREEAETRNVAEALQWQ
FT                   TEKFLAESGDKLPTESRDQINEALGELRSALGGQDIEKIKSAHAQLAQVSQQAGSQLYT
FT                   QQQGEQAGATGDQAGAQAGGPDDVVDAEIVDEDKGKK"
FT   gene            123902..124699
FT                   /locus_tag="Strop_0114"
FT   CDS_pept        123902..124699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0114"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52599"
FT                   /db_xref="GOA:A4X149"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A4X149"
FT                   /protein_id="ABP52599.1"
FT                   /translation="MTDKPRATDPDATGSVPGGSASAGEAGAEPRVVIRDNRKISNAAG
FT                   ASSDAAGTGSDSGSDAADADAAAADAGSDVPAAGLVEEADVVVDEIQAETTEGSPVSPP
FT                   VVDAPAEPVDAATATSLGAELEALRADLDERTRDLQRVTAEYANYRKRVDRDRALVTEQ
FT                   ATGSVLAALLPILDDLDRAREHGDLVGPFGSVAEQLTTALGKFGLTPFGAEGDPFDPTQ
FT                   HEAVTHQTSAEVTEPTCVQVMRRGYLVGERLLRPALVGVAEPE"
FT   gene            124781..125953
FT                   /locus_tag="Strop_0115"
FT   CDS_pept        124781..125953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0115"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52600"
FT                   /db_xref="GOA:A4X150"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A4X150"
FT                   /protein_id="ABP52600.1"
FT                   /translation="MSSKDWIEKDFYAALGVGKAASADEIKKAYRQLARESHPDRNPGD
FT                   AKAEERFKAASEAYTVLGDDAKRREYDEMRSLFGSGAFRRNARGAGQSGGAPFDVGDLF
FT                   GGAAGGDRRFSGAGFQDLFGSIFPGGGGTASRGPARGRDVETEVALDFGDAIRGVTLPL
FT                   TLRTPGVCDTCHGDGAKPGTQPRACPTCRGAGVTTRNQGSFSFSEPCSDCQGVGTVVDE
FT                   KCPECQGTGGVTKNRTLNVRFPAGVADGQRIRLAGRGEPGARGGPAGDLFIQVKVSPDD
FT                   LFGRAGDDLTLTVPITFAEAVLGTDLRVPTFDGAVTLRVPPGTPSGRVLRARGKGVVRT
FT                   AGRAGDLLVTLEVTVPAKLSEEARAALETFVAQTPPAAREHLDARVRRGS"
FT   gene            125997..126437
FT                   /locus_tag="Strop_0116"
FT   CDS_pept        125997..126437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0116"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52601"
FT                   /db_xref="GOA:A4X151"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A4X151"
FT                   /protein_id="ABP52601.1"
FT                   /translation="MADNFVGADDPAYEAKVLMISVAARMAGMHPQTLRQYDRLGLVQP
FT                   GRATGGGRRYSVRDVVLLREVQRLSQDDGINLAGVKRIIGLERLLEQAEQRVARLEVEL
FT                   EAAYRRIAELEAVARFPGSDLMPASRTSTALVVWRPRRNPER"
FT   gene            126540..126734
FT                   /locus_tag="Strop_0117"
FT   CDS_pept        126540..126734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52602"
FT                   /db_xref="UniProtKB/TrEMBL:A4X152"
FT                   /protein_id="ABP52602.1"
FT                   /translation="MAESAKSLAQQAEDRLEQVAEAVRKRFDELTEGRFSDQIKDGRFA
FT                   DPGDSGADQGHPANQHQRR"
FT   gene            complement(126877..127308)
FT                   /locus_tag="Strop_0118"
FT   CDS_pept        complement(126877..127308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52603"
FT                   /db_xref="UniProtKB/TrEMBL:A4X153"
FT                   /protein_id="ABP52603.1"
FT                   /translation="MSAQDSTFHGFANPVDPSPAELRAWAYHPDSVPLTSMPQDWDLLV
FT                   SGNRLVATLFDLAMDPACPARRFALHCLYIYAADGIRTTFRAHPKRRFWKLVERAERDG
FT                   DDPMRAWAHNSRVLLAQPDVFVYRDWCEGGLVREHRRLP"
FT   gene            complement(127487..128692)
FT                   /locus_tag="Strop_0119"
FT   CDS_pept        complement(127487..128692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0119"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52604"
FT                   /db_xref="GOA:A4X154"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4X154"
FT                   /protein_id="ABP52604.1"
FT                   /translation="MHDTTTLLIEVGALLFLLGLLGRLSRRIGLSPIPLYLLAGLLFGH
FT                   GGVFGFKASEEFFAIGAEIGVILLLVMLGLEYSASELVGNLRAAAPAGLIDGLLNALPG
FT                   AAFALLLGWDWVAAIVLAGITWISSSGVVAKVLSDLGRLGNRETPVVLSVLVIEDLAMA
FT                   FYLPLLTAVLAGAGLVAGGAALAVAVATVLIVLVAAIRYGRTISNIMSARDPEALLLGV
FT                   LGLTLLVAGVAAKLQVSAAVGAFLVGIAISGPVAHHATELLTPLRDLFAAVFFLFFGLV
FT                   TDPRDIPPVLLPALALAVVTMATKTLTGYLAARRAGIAEPGRWRTGLTLVPRGEFSIVI
FT                   AGLAVAAGSVDPQLAALATAYVLITVIVGPTLARVPDLDWFKGWLRQRAAKQQAHPMPV
FT                   GD"
FT   gene            complement(128698..129288)
FT                   /locus_tag="Strop_0120"
FT   CDS_pept        complement(128698..129288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0120"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52605"
FT                   /db_xref="GOA:A4X155"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4X155"
FT                   /protein_id="ABP52605.1"
FT                   /translation="MSHPFGGISTALAPHPTRSSRPSARGSLVHVRVRVEQTALPGIGV
FT                   RHDLMTESGRRLGVVSHRNGRRDLVLYDPDDPDACQADIPLTDDEAEALADILGASLLL
FT                   GQLSGLREQAAGLLTEQVAIPAASAYVGRKLGDTKARTRTGASIVAVLRHGEVIVSPEP
FT                   SFRFAAGDVVVVVGTRQGLDGVTAILADGDPDG"
FT   gene            129372..131963
FT                   /locus_tag="Strop_0121"
FT   CDS_pept        129372..131963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0121"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52606"
FT                   /db_xref="GOA:A4X156"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A4X156"
FT                   /protein_id="ABP52606.1"
FT                   /translation="MNTERLTTKSREAITGAVTLAGQRGHATVEPWHLLLSLLDTEGST
FT                   TVGLLRATGADPDDLRRAAERAVAALPVARGSSVAEPTLAREFVNAIGAAEQIARPLGD
FT                   EYTSTEHLLAGLAQVGGAVSAALRTAGVTEEALVASFPTVRGGDRRVTSADPEQTYQAL
FT                   AKYGVDLTASARDGRIDPVIGRDTEIRRVIQVLSRRTKNNPVLIGEPGVGKTAIVEGLA
FT                   QRIVAGDVPESLRDKKLVSLDLGAMVAGASYRGQFEERLKSVLEEIKNSDGQVITFLDE
FT                   LHTVVGAGKGEGSMDAGNMLKPMLARGELRMVGATTLDEYREHIESDPALERRFQPVLV
FT                   GEPTLADTVGILRGLKERYEVHHGVRITDGALVAAATLSDRYITDRFLPDKAIDLVDES
FT                   ASRLRMEIDSRPVEVDEIERAVRRLEIEEMALAKEADAASAERLERLCKELADKREQLT
FT                   ALSERWQTEKRHITRLSTAKEDLERLSGEAERAERDGELERAAELRYGRIPALQADLTQ
FT                   AAEELTRLQADGAMLKEEVGADDIAAVVASWTGIPAGRLLEGETAKLLRMEESLGEQVV
FT                   GQARAVGAVADAVRRARAGIADPDRPTGSFLFLGPTGVGKTELAKALAGFLFDDERAMV
FT                   RIDMSEYGEKHSVARLVGAPPGYVGYEEGGQLTEAVRRRPYSVILLDEVEKAHPDVFDL
FT                   LLQVLDDGRLTDGQGRTVDFRNAILILTSNLGSSMVGDLTVPEEQRREGVLAVVRSHFK
FT                   PEFLNRLDDTVVFAALRGEDLRAIVDIQLDRMRRRLADRRLGLEITEPARQWLAEHGYD
FT                   PVYGARPLRRLVQTAIGDQLAKALLAGRIRDGDTVRVGLADSEDALTVTAT"
FT   gene            132049..133014
FT                   /locus_tag="Strop_0122"
FT   CDS_pept        132049..133014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52607"
FT                   /db_xref="GOA:A4X157"
FT                   /db_xref="UniProtKB/TrEMBL:A4X157"
FT                   /protein_id="ABP52607.1"
FT                   /translation="MVLLQRIRQQAVGSAVARWFARCEVLVRGAGDGLAVRELLRYPDV
FT                   RRITVGASYRRACCPRSYGVGANEGRRLVANPQQPVRVRPGVVTISSYLLIFYAVLTAI
FT                   AVVVGLATLGTLQDVYQESFAGTDAEGAEGFVVLVAVATSLVSLLFAVGLVVLALLNNR
FT                   GKNTPRIITWVVGGIALCCAGVGLAFSAAGSAVDGEGSGDVVSQEEINRRLEEALPSWY
FT                   EPVTNLITVLGAIALLVALILLALPKSNEFFRKPQQQWEPPVPGAVYPGTPGGPAYPMT
FT                   PGQPGYPQADPSSGSSGQSGSPGQSGSSGHSGSSDPGGER"
FT   gene            133124..133729
FT                   /locus_tag="Strop_0123"
FT   CDS_pept        133124..133729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52608"
FT                   /db_xref="GOA:A4X158"
FT                   /db_xref="UniProtKB/TrEMBL:A4X158"
FT                   /protein_id="ABP52608.1"
FT                   /translation="MSYPEPARRPAAVTAAVVLLALMAVVAVAYAVAGLFVLFGTVDAF
FT                   RLAAAGSAASSDEVDAMVLLVSVWTVAGVVASLLAGVLLAALAGVVRTGRSGARVATWV
FT                   VAGLGVLAGCCGLTVLSGMRVFPMRLGDEDRSTVELLAQLSEAYPDWWIPLGAGLSVGQ
FT                   VLGYFVVALLLALPTAATWFRQPRPSLHVPYPPPHPPR"
FT   sig_peptide     133124..133219
FT                   /locus_tag="Strop_0123"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.679 at
FT                   residue 32"
FT   gene            133737..134546
FT                   /locus_tag="Strop_0124"
FT   CDS_pept        133737..134546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0124"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52609"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X159"
FT                   /protein_id="ABP52609.1"
FT                   /translation="MPNDQPTTGRRALITGATAGIGAEFARQLAAEGWHLVLVARDAAR
FT                   LAETAAELTSQHSREVETISADLSTDDGCAEVERRLTTGSPVSLLVNNAGISLNTPFLR
FT                   SSPDDEARLLRLNVHAVMRLTLAAVQSMTERRSGAVINVSSVSGFGPVMPGSTYPPSKA
FT                   WVTSFSESVGLSVREFGVQVMALCPGYTRTEFHDRAGIDRSKTPAWMWLRAEDVVAEAL
FT                   RDLRKGKLVSVPVWKYKLLVAAMRHAPRRLVEAFSQDTRGQVSRAER"
FT   gene            134691..135230
FT                   /locus_tag="Strop_0125"
FT   CDS_pept        134691..135230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0125"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52610"
FT                   /db_xref="GOA:A4X160"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4X160"
FT                   /protein_id="ABP52610.1"
FT                   /translation="MGDHDDLRKFITDLAVVHGRVVLSSGRAADWYVDLRRVTLHHEAA
FT                   PLVGRVLRELTADWAYDAVGGLTLGADPIALSMLHATTGADRPLDAFVVRKAGKAHGLQ
FT                   RRIEGPDVAGRRVLAVEDTSTTGQSVLTAVEALREAGAEVMGVAVIVDRGAGAAVRAAG
FT                   LPYRAAYTLADLGLVA"
FT   gene            135288..135665
FT                   /locus_tag="Strop_0126"
FT   CDS_pept        135288..135665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0126"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52611"
FT                   /db_xref="GOA:A4X161"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X161"
FT                   /protein_id="ABP52611.1"
FT                   /translation="MEYVGTALAEMTMPQISPLAGEPIERADAERLAGVLKALADPARL
FT                   RLLSLIQSAPEGEACVCDLTAPLGLSQPTVSHHLRILTEAGLLEREKRGVWAYYRLVPT
FT                   AIATIADLLTPPRKRASKKAR"
FT   gene            complement(135831..136544)
FT                   /locus_tag="Strop_0127"
FT   CDS_pept        complement(135831..136544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0127"
FT                   /product="Uncharacterized membrane-associated protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52612"
FT                   /db_xref="GOA:A4X162"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A4X162"
FT                   /protein_id="ABP52612.1"
FT                   /translation="MSTPTTTLALGPDWLDPEVLISTFGLLGILVIVFAESGLLIGFFL
FT                   PGDSLLFTAGLLTADGKYITWPLWLVCLLITLSAIAGDQVGYAFGRKVGPALFRRPNSK
FT                   LFKQENLLKSHDFFEKYGARSVVLARFVPIVRTFTPIVAGVSRMNYRTFVIYNVIGAIL
FT                   WGTGVTVLGYFLGQIPFVKANIELILIAIVGLSVVPIVVELLRARLAARRGTTAAERAA
FT                   AEEAIRETREHYGKY"
FT   gene            complement(136796..138352)
FT                   /locus_tag="Strop_0128"
FT   CDS_pept        complement(136796..138352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0128"
FT                   /product="LPXTG-motif cell wall anchor domain"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52613"
FT                   /db_xref="GOA:A4X163"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="UniProtKB/TrEMBL:A4X163"
FT                   /protein_id="ABP52613.1"
FT                   /translation="MLKHPTRRWLAGIGLAGALVATATPASAAETDITLDVYFDNVTLA
FT                   AGSAGKDRASIISASAPVTLHDLTAQYDFSDLAGKVDVSSESLGNDCTTPEPHVLRCVN
FT                   PFPDTIEDSRGAYRVLLVPTAAAANGDEGVLKVSISAQGFSPVTHDATVRIGAGVDLVA
FT                   GAEHEFSVAPGETFTEPLTVSNAGEVTADGAVAFFDHDYGIRADQRYSNCNYDGDHLVF
FT                   CRFDEKLTPGASYSAPLTHTLGSDTYAPSFVHGNVYWQTPAEFEAYEARLHRMGISLGE
FT                   PGTGGKLTLTEQNRIQSARGAQADPDPSNNWSYLDISATGSNGTDLEAIGTEVSGEKAA
FT                   EVQARIGFRNNGPATLDYTRPGSSVTYLNVDVPEGTTAVKVPDLCSPLLGDEFGDRGEA
FT                   GAANYRCYVSSFSKVGEQQTFDFTLRIDEVIADAAGAVKVNVPCRCEGGFYDDIEPAND
FT                   EAAILVNATGGGGGGGNGEDPSLPITGSSTTLVAGLGGLLLATGAAGFLVTRRRRNNFV
FT                   A"
FT   sig_peptide     complement(138266..138352)
FT                   /locus_tag="Strop_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 29"
FT   gene            complement(138537..138749)
FT                   /locus_tag="Strop_0129"
FT   CDS_pept        complement(138537..138749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52614"
FT                   /db_xref="UniProtKB/TrEMBL:A4X164"
FT                   /protein_id="ABP52614.1"
FT                   /translation="MGLPDEDFAPGEHLMPDERDPEAEPADAVEQATAADPGEVEAEPH
FT                   RGLEVNGWDAAEQARVVGNDEDDYR"
FT   gene            139113..140135
FT                   /locus_tag="Strop_0130"
FT   CDS_pept        139113..140135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0130"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="TIGRFAM: ketose-bisphosphate aldolase;
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52615"
FT                   /db_xref="GOA:A4X165"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4X165"
FT                   /protein_id="ABP52615.1"
FT                   /translation="MPIASPEAYAEMLDRAKEGRFAYPAINVTSSQTLNAALKGFADAE
FT                   SDGIIQVSTGGAEYLSGPSVKDMVTGAVAFAAYAHEVAKKYPVNIALHTDHCPKDKLDK
FT                   FVRPLMTISQERVRAGQEPLFQSHMWDGSAVPVAENLTIAEELLAQAAKGKIVLEIEVG
FT                   VVGGEEDGVENAINEKLYTTVDDGLAMVEALGLGEKGRYMAALTFGNVHGVYKPGNVKL
FT                   RPEVLNQIQAAVGAKYGKDKPLSLVFHGGSGSLLSEIRESLDYGVVKMNIDTDTQYCFT
FT                   RPVADHMFSNYDGVLKVDGEVGNKKKYDPRVWGKAAEAGMAARIVEACEDLRSTGTRMK
FT                   "
FT   gene            140250..140741
FT                   /locus_tag="Strop_0131"
FT   CDS_pept        140250..140741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52616"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:A4X166"
FT                   /protein_id="ABP52616.1"
FT                   /translation="MVRPGRSTRSRIAEGSGLNGAMQNLLPEPPATLLPAYDEADSAIA
FT                   AAEESGADEDFAAVAARFPTFSAAWAALAVRAFAADQVVQAYAYARTGYHRGLDQLRRS
FT                   GWKGHGPVPWSHEPNQGFLRCLWVLSRAADAIGEADEAARCAQFLRDCDPAAADALASD
FT                   "
FT   gene            complement(140810..142411)
FT                   /locus_tag="Strop_0132"
FT   CDS_pept        complement(140810..142411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0132"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52617"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X167"
FT                   /protein_id="ABP52617.1"
FT                   /translation="MVDENADRSYASGQQPASERDIEPLWPAAEADSASWSPASDDQGQ
FT                   PPTPPGPTPVPAAWASAPSDAARAWAPRPDSDLRGAVADVPTPHAPSVVPTPSVNLDQP
FT                   FSLDPTGPAPGTSTGGRPTGETSAGSGPVDDRAAWEGRGGTTTESPWVAPPQRPAPEDT
FT                   VSDPGSTGGDRRAGRAALPTPYPTIAGPPPPGPPPAGPPPGPYPPPAHGSAVPPVAGWT
FT                   PTAQPPPTAEDFARRRQLRPSDPMATMGVRAMANRMGLRLPPGRHEQEMRRDIEMVRRN
FT                   FGGLRQVTVVNPKGGAGKTVAILLLAMTFGQKRGGYVLAWDNNETQGTLGMRAQQDFHA
FT                   RTVRDLLRDLNQFHGSHGRVGDLSQYVRAQGEGMFDVLASDESATGGGMLTAAAFAEIR
FT                   EVVSRFYKLIFVDTGNNVRAQNWQAAIDATDQLVVTMSARNDSAETAARMLDHLEQSGR
FT                   QRLVRQAVTVVSMPPSRKEIDLPAIQAHFAARTRAVLLAPYERLVDSGEPLRYGALSSA
FT                   ARDAWLKIAAAVAEGL"
FT   gene            142474..144897
FT                   /locus_tag="Strop_0133"
FT   CDS_pept        142474..144897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0133"
FT                   /product="Adenylosuccinate synthase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52618"
FT                   /db_xref="GOA:A4X168"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:A4X168"
FT                   /protein_id="ABP52618.1"
FT                   /translation="MGARGRPDRPRARLGPPGPFTVQLALGAVVEERDRPLPGHHGHCP
FT                   TTGATNLQAYPAATPPGRGENRDGHRDLDQTVARVRVGEQSHVGQPGVPAGVADGAGQQ
FT                   RVVTGGEERVVDLDPTSPVQRPAPLVGRAEQRAVQRYRAAVVAQQVEPAGRALQHRRRH
FT                   RRRVAGQPELRCQISGLAATAGRVERQHADRWQVRHRPVGRQFRRAAARRWGVPSDEAT
FT                   EDGAQLCIAGGADDQSGAGAGIGPAEAVRPGRAIQTAQDLVDLLLGAGGHQVDPRAPGG
FT                   ERVRAGQYRYAGGLAAFGRRLAAGLVGVAAAGAVAAAGARGVPFRAEREQHHVVHGSQP
FT                   PASAREPLPAAPSLLVSLTPRARRPVAAWHPSLLEAKKMPAIVLLGAQWGDEGKGKVTD
FT                   LLGERVDHVVRYSGGNNAGHTVITPDGQKYALHLMPSGALSPNAKIVIGNGVVVDPKVL
FT                   LAEIDGLAERGVDVSRLRISGDAHLIMPHHRALDRVVERYLGSSRIGTTGRGIGPAYGD
FT                   KVARMGIRVQDLLDPGILRKKLELALREKNQMLFKVYNRKAIDVEATVEEYLGYAERLR
FT                   PYIAETRALLWDALDRGDTVLLEGAQATMLDMDHGTYPFVTSSNPTAGGACVGAGIPPT
FT                   AITKVIAVSKAYATRVGAGPFPTELFDDNGQHLRKIGHEYGTTTGRERRCGWFDAVVAQ
FT                   YACRLNGVTDLVVTKLDVLTGLPKVPICVGYEINGKRLDEMPMTQTDFHHATPIYEELD
FT                   GWWEDITAARTEAELPAAARRYIARIEELCRTRVSVVGVGPGREENVVYHPLLP"
FT   gene            144964..146214
FT                   /locus_tag="Strop_0134"
FT   CDS_pept        144964..146214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0134"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52619"
FT                   /db_xref="GOA:A4X169"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A4X169"
FT                   /protein_id="ABP52619.1"
FT                   /translation="MRVLLIGSGGREHALALGLSADPSVEVLFAAPGNPGIGTVAVMRD
FT                   VVFTDPAAVAALAVECDADLVVVGPETPLVAGVADAVRAEGIPVFGPSAEAARLEGSKA
FT                   FAKDVMTAARVPTARAYACADTESVGKALDDFGAPYVVKNDGLAAGKGVVVTEDRAAAE
FT                   EHARECGQVVIEEYLAGPEVSLFVVTDGEAAVPLLPAQDFKRVGDGDTGPNTGGMGAYA
FT                   PLPWAPPGLVDEVMRDIVHPTLAELRRRGTPFAGLLYVGLAITATGPRVIEFNARFGDP
FT                   ETQVVLALLETPLAGLLHAAATGELAAHPPLRWRAGAAVTVVVAAQGYPAKPRTGDVIL
FT                   GAERTGIVHAGTVRRAADGALLSAGGRVLSVTATGSDLAAGRDAAYELVRGIELADSHH
FT                   RTDIAAAAVEGRITIPR"
FT   gene            complement(146253..147590)
FT                   /locus_tag="Strop_0135"
FT   CDS_pept        complement(146253..147590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0135"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52620"
FT                   /db_xref="GOA:A4X170"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X170"
FT                   /protein_id="ABP52620.1"
FT                   /translation="MIFAMTRTEHRRRTPLLLVEAATLLSATGNGVAVVALPWLVLERT
FT                   GSATAAGVVAAASGLPLLLSSLFSGTVVDLLGRRRTALVSDALSAVSVAAIPLVDTLVE
FT                   LNLGWIVALAVLGAVFDPAGMTARETLLPAAAQAAGWRIERANGVHEAIFGLAFLIGPG
FT                   VGGLLIATVGPEATFWVTAAGFALSVLLVAAVRLPGAGRPDRPPNGLWRGTQEGLGFVW
FT                   RDPLLRTLSLITMALVALYLPFEGVLLPAWFVAEGEPARLGAVLMAMSAGAVAGALGSS
FT                   VAGRFVRRRSLMAAALVVTGLALLGLALLPPYPGMLAFAGLVGLAYGPVNPLANYAMQT
FT                   RTPERLRGRVVGVMTSFAYAAGPAGYLLAGPLVEWLGLATAFLVLAGALLVAVLIAAPL
FT                   PVLAALDEPPRYPPAPPGGTTGRSEGPVPLGEQWLPAAHRDPPASR"
FT   sig_peptide     complement(147420..147590)
FT                   /locus_tag="Strop_0135"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.650) with cleavage site probability 0.203 at
FT                   residue 57"
FT   gene            complement(147749..148963)
FT                   /locus_tag="Strop_0136"
FT   CDS_pept        complement(147749..148963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0136"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52621"
FT                   /db_xref="GOA:A4X171"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X171"
FT                   /protein_id="ABP52621.1"
FT                   /translation="MAEFSLDLTEEQRDLRDWVHGFASEVVRPAAAEWDAREETPWPII
FT                   QEAAKVGLYGFEFLATCWGDPSGLSLPVACEELFWGDSGIGLSIFGTGLAVAAIYGTGT
FT                   PEQLMEWVPQCFGDLDSPAVAAFCTSEPEAGSDVGAMRTRAVYDEAADEWVLSGQKSYA
FT                   TNGGIAGVHVVTASVDPELGSRGQAAFVVPPGTPGLAATRKLRKLGLRASHTADVFLDD
FT                   VRVPGRCLLGGKDALDERLARARSGKRAASQAAMRTFELSRPTVGAQALGVARAAYEYA
FT                   LDYAKERVQFGRPIIENQAVAFALADMKMEIDAARLLVWRASWMGRNNRAFTAGEGSMS
FT                   KLKASEVAVSATEKAVQLLGGAGFLRDHPVERWYRDAKIYTIFEGTSEIQRLVVARAIS
FT                   GVQIR"
FT   gene            complement(148966..149418)
FT                   /locus_tag="Strop_0137"
FT   CDS_pept        complement(148966..149418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0137"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52622"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A4X172"
FT                   /protein_id="ABP52622.1"
FT                   /translation="MTDFDPAKFANVGPKEFAQLVKSTPDDKITEMMSGDLRGKVLDEV
FT                   FGRMPQLFRADRAGSTNTVIHWNITGGPDGGTDTYEVVIADGACTVNQTSQHDPKLSLT
FT                   LGPVEFLKTVSGGANPVMMFMSGKLKAKGDLGLAANIANLFDIPKA"
FT   gene            149485..150141
FT                   /locus_tag="Strop_0138"
FT   CDS_pept        149485..150141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0138"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52623"
FT                   /db_xref="GOA:A4X173"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A4X173"
FT                   /protein_id="ABP52623.1"
FT                   /translation="MSSTPTFRRLPRAVREQQMLDAAVKVFSRRGYHGASMDEIADDAG
FT                   ISKPMVYAYLGTKEELFVACLHREGNRMTQAVTSAVAPDLSADERLWRSLRAFLGFVGA
FT                   HRDGWAVLYRQARGEQPFAGEIAAMRRRIVEVVTELLDHTLRAEGREAAEVELEVAAYA
FT                   LVGATESVADWLVDHPEADPEQTATRMMNVAWVGAAQLLAGTSWRPPIRRGEAPS"
FT   gene            complement(150162..150779)
FT                   /locus_tag="Strop_0139"
FT   CDS_pept        complement(150162..150779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0139"
FT                   /product="Uncharacterized membrane-associated protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52624"
FT                   /db_xref="GOA:A4X174"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4X174"
FT                   /protein_id="ABP52624.1"
FT                   /translation="MESALDLLRQLITSPLVYLLLFALTAVDAVLPMVPAETAVITAAV
FT                   LVGGDTPQLAGIWAAATLGAMAGDHAAYVIGRGGGARRLARFPAESRRRASSEWARRAL
FT                   HRRGGLVLTTARYVPGGRTAVTLTMGAVRYPLRSFLLFDAIGAASWALYSVLLGYFGGL
FT                   AFQQDPLRGVLAGLALSLGVTGLLELARRLRQRSRRRAAARR"
FT   sig_peptide     complement(150663..150779)
FT                   /locus_tag="Strop_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.670) with cleavage site probability 0.327 at
FT                   residue 39"
FT   gene            complement(150848..151741)
FT                   /locus_tag="Strop_0140"
FT   CDS_pept        complement(150848..151741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0140"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52625"
FT                   /db_xref="GOA:A4X175"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X175"
FT                   /protein_id="ABP52625.1"
FT                   /translation="MAGPQEPSDAGQVSRSRVQLAVLPTVGALYRRALLGALPGSGSRR
FT                   AEQPPTVELGVDGVPIDRGRLAAYDRVCGFRLTDRLPATFPHVMGFPLALRLMTAPDFP
FT                   IPLAGVVHVGNRITVHRPIDAAETLDFVAYATNLRPHDRGRQIDVVLVGRVGGEEVWRG
FT                   VSTYLGREQTPGGGERANRGDPPPAPHAWARWRLERQVGTAYAQVSGDHNPIHTSRLGA
FT                   RLFGFRRPIAHGMWSKARCLAALEPRLPDAYTVDVAFKLPVPLPGTVAFGSTSAGDFAL
FT                   HDTRDRPHLVGTFRER"
FT   gene            complement(151741..153096)
FT                   /locus_tag="Strop_0141"
FT   CDS_pept        complement(151741..153096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0141"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52626"
FT                   /db_xref="GOA:A4X176"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X176"
FT                   /protein_id="ABP52626.1"
FT                   /translation="MTDRYASFVQSGVGRGLVKRLGLPDPPQLRRYRSGDPLIPGPVLL
FT                   GAAPGGRLAGGIGKLLTAAGVELRDATDVTPGTRLGAFVYDATGITDSTALRQLYDCLH
FT                   PHARSVLPSGRVIVLGTPPTECSTPRQATAQRALEGLTRSIGKEFGRGVTAQLVHVTDA
FT                   DNPGTATSLEATLRFLLSGRSAYVSGQVIQIGAGQAALPTDWDRPLDGQVVLVTGAARG
FT                   IGAALARVLARDGAQVVALDVPAAGDELATVANDIGATAVQLDLTAPDAPARLADHLSA
FT                   RHGRVDVVVHNAGITRDRTLGRMDVDRWDQVIDVNLSSQERINDLLLERELIPTGGRIV
FT                   SVSSIAGIAGNRGQTNYATSKAGVIGLVESLAPVLTERGISINAVAPGFIETRLTARIP
FT                   LVLREAGRRMNSLAQGGLPVDVAETISWLAWPATGAVSGNVVRVCGQSLLGA"
FT   gene            153150..154442
FT                   /locus_tag="Strop_0142"
FT   CDS_pept        153150..154442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0142"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52627"
FT                   /db_xref="GOA:A4X177"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A4X177"
FT                   /protein_id="ABP52627.1"
FT                   /translation="MQNIRRVAVIGGNRIPFARSNSRYAEASNADLLGAALDGLVARYG
FT                   LAGQRVGEVVAGAVLKHSRDFNLTREVVLGSKLDPHTPAYDIQQACGTGLEAAILVANK
FT                   IALGQLEVGIAGGVDTTSDAPLAVNEQMRRTLLKLNSARTLGERLRTATRLRPSHPFRP
FT                   ELPRNAEPRTGLSMGEHAARTALTWQVDRQAQDELALRSHHRLAAAYERGFFDDLMTPY
FT                   LGLTRDQNLRPDTSLEKLGGLRPVFGTKGPDAEQATMTAGNSSPLTDGASTVLLASEEW
FT                   ARAHNLPVQAWFTWSQTAAVDFVPGEEGLLMAPAYAVPQLLARAGLTLQDFDYYEIHEA
FT                   FAAQVLATLAAWESPEFCQDRLGLDAPLGAIDPERINVNGSSLAAGHPFAATGGRIVAT
FT                   LAKLLDERGGGRGLISICAAGGQGVTAILER"
FT   gene            complement(154472..154981)
FT                   /locus_tag="Strop_0143"
FT   CDS_pept        complement(154472..154981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52628"
FT                   /db_xref="UniProtKB/TrEMBL:A4X178"
FT                   /protein_id="ABP52628.1"
FT                   /translation="MASGAAAHLRLAPPPRGHLVTAGLPFGVGSVVQLAEQHYCYGLGT
FT                   LTLRIVEVGRRVRRTDGLWIHMRGVQLGSPPRQRRVLARLDAIQTQPVPIPVTHIPVRP
FT                   GWDCAGCGAAWPCPDRRRRLLDRYAGNPAALGIYLSTQMTAAVPDLRHLPPEELYERFL
FT                   GWLRLA"
FT   gene            155490..156032
FT                   /locus_tag="Strop_0144"
FT   CDS_pept        155490..156032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0144"
FT                   /product="UbiC transcription regulator-associated domain
FT                   protein"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52629"
FT                   /db_xref="GOA:A4X179"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A4X179"
FT                   /protein_id="ABP52629.1"
FT                   /translation="MGGSDWLSVSMPYVQPDATHAGDVWAADAAGQGRSGTQRILAVGE
FT                   VVAAAEVAAALRVAPGDPVTVRRRLMLLDDEPVELTDSYYPVAIARGTALAEQRKIRGG
FT                   AVRLLAEVGYRPRRVREDVYTRLPEPAERRLLGLADHEWALGLTRVLSTQDDVPVEVSV
FT                   MTMVPWGRRLRYELAID"
FT   gene            156051..156764
FT                   /locus_tag="Strop_0145"
FT   CDS_pept        156051..156764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0145"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52630"
FT                   /db_xref="GOA:A4X180"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X180"
FT                   /protein_id="ABP52630.1"
FT                   /translation="MASGSDSRPRHEQVAADLRSRIMSGELPPGSALPSIPTLVRQYSA
FT                   ATATVQRALGALKAEGSVYSEVGKGVYVRPRRPLVVEASAYLAPTSDGYAYRLRSVAEV
FT                   VPPAEVARELEIGADERAVLRHRLLVCGDEPVELSWSYYPAAIASGTELAERRKIPGGA
FT                   PRALADLGYPQRHTRDRVCARMPTTEEVEALDLPPYVPVLRQLRVIRSVDARPVEVSIL
FT                   VKGSHRHELHYDQRG"
FT   gene            156964..158682
FT                   /locus_tag="Strop_0146"
FT   CDS_pept        156964..158682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0146"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52631"
FT                   /db_xref="GOA:A4X181"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:A4X181"
FT                   /protein_id="ABP52631.1"
FT                   /translation="MDLETLLADRLAPAFSAVAGERVDPAVRRSQHADYQCDAALSLAR
FT                   RLGRRPRDIAAEVLGQVELADLCSAVTVSGPGFINLTVADSALGTLLSTAAADTRLGIA
FT                   RSAATDTVVVDYSAPNVAKEMHVGHLRSTVIGDAAVRLLEWRGHQVIKANHLGDWGTPF
FT                   GMLIEHLLDLGESEAADELSVGDLDSFYKAARATFDTDDGFRERARRRVVALQRGDELT
FT                   LRLWRQLVAESEKYFLTVYDQLGVLLTEQDFCGESYYNDRLAPVTDELDRLGLLRESGD
FT                   AACVFPAGFAGRDGQPLPIIVRKRDGGYGYGATDLAAIRHRTQCLGATRLLYVVGLPQR
FT                   QHFELVYAVARQAGWLRSPARAEHLGFGSILGSDGKMLRSRTGDSIKLVGLLDEAVTRA
FT                   AELARQKNPDLSATEVADVARAVGIGAIKYADLSTDRNKDYVFDWQRMLSLDGNTAPYL
FT                   QYAHARIRSIFRRAEIEQFIPAPITIRHQAEHALALELAGFGAVVANVEQTLQFHRLAG
FT                   YLHTLATTFSGFYEACPVLRAEDAVRDSRLALCDLTARVLRQGLYLLGIATPDRM"
FT   gene            158771..160195
FT                   /locus_tag="Strop_0147"
FT   CDS_pept        158771..160195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0147"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52632"
FT                   /db_xref="GOA:A4X182"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:A4X182"
FT                   /protein_id="ABP52632.1"
FT                   /translation="MTTIPNVLANRYASPELVTLWSPEEKIRMERRLWLAVLIAQRDLG
FT                   VDVPDGVVEAYQRVLDQVDLASIAQRERVTRHDVKARIEEFSALAGHEHVHKGMTSRDL
FT                   TENVEQLQVRASLELIRDRVVATLARLSQLAVEHSGLVLTGRSHNVAAQATTLGKRFAS
FT                   AAEELLIAYERLDDLIGRYPLRGIKGPVGTAADQLDLLDGDAGKVAELERRVAEHLGFG
FT                   RVLDSVGQVYPRSLDFDVLSALAQVAAGPSSLATTIRLMVGQELATEGFQPGQVGSSAM
FT                   PHKMNTRSSERVNGFAVIIRGYLSMVGELAGDQWNEGDVSCSVVRRVALPDAFFAADGL
FT                   FQTFLTVLDEFGAYPAVVNRELERFLPFLATTKILVAAVRRGVGREVAHEVIKEHAVAV
FT                   ALAMREKGATENDLFDRLAADDRLTLTRADIADLVADRTAFVGAAPAQVHAVVERVAEV
FT                   LDRHPAAATYAPPPIL"
FT   gene            complement(160272..160838)
FT                   /locus_tag="Strop_0148"
FT   CDS_pept        complement(160272..160838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0148"
FT                   /product="protein of unknown function DUF74"
FT                   /note="PFAM: protein of unknown function DUF74"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52633"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:A4X183"
FT                   /protein_id="ABP52633.1"
FT                   /translation="MAGHVPTVRAALFFTIRSGEQGPRSAPASADSIGTVLVVTTDQLP
FT                   GYEVRQILGEVVSSMARTRNPYREGVKNLRGGAYDPMAPDNLTRWRADSVARLGEEARR
FT                   LGANAVIGMRFDSRDCGEMWMEICAYGTAVIVVPRVPDVMPPDQPLVAAETANEPRIAP
FT                   EPSGIGEPATAPDLRSAAETPTPEV"
FT   gene            complement(160862..161545)
FT                   /locus_tag="Strop_0149"
FT   CDS_pept        complement(160862..161545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0149"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52634"
FT                   /db_xref="GOA:A4X184"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4X184"
FT                   /protein_id="ABP52634.1"
FT                   /translation="MRIRSLVAVLATAVAGVLGASSGAVANPGPTPLIIGGGYVSSAPW
FT                   AAAVFSNGSFTCSGTIIAPEWVLTARHCVGGSMSVRVGSVYRSSGGTTRSVTAAYGRYD
FT                   LALMRLSSSVNTSYVTLANSNPPIGSTNSIYGWGMTCYSGCSASSQLKTANVRVTSNNA
FT                   SDAYGGQAIQTNRINGNAWRGDSGGPQFYNGRQVGVASLANGVNLQIYGSVAYNRSWIT
FT                   SISGV"
FT   sig_peptide     complement(161465..161545)
FT                   /locus_tag="Strop_0149"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.902 at
FT                   residue 27"
FT   gene            161742..162200
FT                   /locus_tag="Strop_0150"
FT   CDS_pept        161742..162200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0150"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52635"
FT                   /db_xref="GOA:A4X185"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A4X185"
FT                   /protein_id="ABP52635.1"
FT                   /translation="MRWVATKPHRERNRNASVLVSRLNCDGDRPNHVRPVRPARYLPGR
FT                   LAALAPSGSAPNCVHSQECPVPRVVVDVMLKPEILDPQGQAVANALPRLGVTDVASVRI
FT                   GRRIEIEFTGEPDLNRTREIADKLLANPVIEDFTIRLAEDGETVDAQP"
FT   gene            162197..162877
FT                   /locus_tag="Strop_0151"
FT   CDS_pept        162197..162877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0151"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52636"
FT                   /db_xref="GOA:A4X186"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X186"
FT                   /protein_id="ABP52636.1"
FT                   /translation="MTARVGVVTFPGSLDDGDAARAVRLAGAEPVRLWHADPQLHGVDA
FT                   VVLPGGFSYGDYLRCGAIARFAAVMAPIVDAARAGLPVLGICNGFQILCEAHLLPGALT
FT                   RNQHLHFRNRDQVLRIESAGTAWTNAFQPGQEVLIPVKNGEGCYVADAATLDQLEAEGR
FT                   VVARYVGNPNGSQRDIAAITNSAGNVVGIMPHPEHAVEELTGPSLDGLGFFTSALKHLV
FT                   GTAA"
FT   gene            162945..165419
FT                   /locus_tag="Strop_0152"
FT   CDS_pept        162945..165419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0152"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52637"
FT                   /db_xref="GOA:A4X187"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A4X187"
FT                   /protein_id="ABP52637.1"
FT                   /translation="MTTQDPVRDTSDAAAAGPTAAPDRGAAVTGWAGGVDTVPHAGESP
FT                   DELQPYVDLGLRDDEYQRIRQLLGRRPTQAELAMYSIMWSEHCSYKSSKVHLRQFGEKA
FT                   PSSDRLLAGIGENAGVVRVSDELAVTFKVESHNHPSFVEPYQGAATGVGGIVRDILAMG
FT                   ARPVAVMDPLRFGAADHPDTARVLPGVVAGVGGYGNRLGLPNIGGEVVFDPCYQGNPLV
FT                   NALCVGVLPIDRLQNKAAAGDGNVVVLMGAKTGRDGIGGVSVLASATFDESSEQRRPSV
FT                   QVGDPFIEKLLIEACLELYDEQLVVGIQDLGGAGLTCALAETAAAAGTGMRVWLERVPL
FT                   REPSMEPHEILASESQERMLLVVEPEKLEAVLKTAEKWGVIATAIGEVTPRAADGQPGR
FT                   LVVTWRDHLVVDVPPGSLADDGPVYNRPMREPADLILLQADRAETLPRPSDPEALRETV
FT                   LRMIASPNLADKTWVTEQYDRYVLGNTVLAQPEDSGVIRIDERSGVGIALSVDGNGRYA
FT                   RLDPYHGAKLALAEAYRNVAVTGAKPIAVTDCLNFGSPEDPGVMWQFAEAVRGIADGCS
FT                   ELDIPVTGGNVSFYNQTGAAAIHPTPVVGVLGVLDDVADRVPMGFVPRDGGHDQIYLLG
FT                   ETHVELSGSEWAWATHEHLGGVPPRVDLDRERAIADLMAVAARGGHLSSAHDLSDGGLA
FT                   QGLVESCLRQGVGARVTLPEQFTGGSMPFVFLFSESAGRVLVSVPRGHEKAFTALAAEH
FT                   GVPCELIGVTDPAAGALEVHGQFRLSLAELRAAHSATLPRLFGGAELATSPVDTATPAS
FT                   SEPQPGGPSEQA"
FT   gene            complement(165584..167938)
FT                   /locus_tag="Strop_0153"
FT   CDS_pept        complement(165584..167938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52638"
FT                   /db_xref="GOA:A4X188"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A4X188"
FT                   /protein_id="ABP52638.1"
FT                   /translation="MPGARDTLHCAVGWHPHLHRSTGYPLREHGQQGTDRRPEYRTIGD
FT                   TPFIERRQRRHDCSGSSVRRGHSGTIRRARGCSHTGPGSRRSDWTRHSSPRRIRTVMIP
FT                   GPATAGHVGFQWKAVDVSTHRRAWKQRAGVVVALLVGALLTVPATPASAALGVNNVSAS
FT                   PSRIEAGGTTTVSYSIEISDDKPADVTVTSSNGKLTCVDGCSRSGVNQSQDFQASFQLA
FT                   SDTTNGQATITVTAVDSDGEKSRTTRVTLVAKPEPEPQPSQAQTVKSVSGEVVNQSTGS
FT                   AVPGALVVLRDSRNNKFDTITDNGGNFRFTGSTQNPITPGRLDIGASMDGSTATKTLNA
FT                   SAGQSVSGQRISLRIQEEPTASPSPSTSIDAAPTVGVDEETEEPIEAAVDVPVAEASDE
FT                   GSGGTGSLLIILLGGLLVAAGVGTMVLLWLRRKENDDEDEAGVNPSGAATGAVPVARGG
FT                   YGGADDQTRIVNPTAAAPTMVGGDPSLADAPTMMHSPVVDDVPPDPYGAPPQPYGASAG
FT                   QSSWTDSGYGATPPASGGGYGGSDYGTSSPAGTGYPPSSGGPYGHEERYDEMTGRYQAD
FT                   ATQYPAPADPYPTGRYQQDAGYGQAEPAYGRGAEPTSGYDQQGGYDGHGYDQRGGYNQQ
FT                   AGYSQDTPAQYGGYDQHGGYNQQAGYGQDTPAQYGGYGQQAGYSQDTPAQYGGYDQHGG
FT                   YNQQAGYGQDTPAQYAGYGQQAGYGQELPTQRGGYDQQAGYSQDTPAQYGGYDDRGYGQ
FT                   GGYGDPTQTDRARSDAPPPDRGGRRLDWLDD"
FT   gene            168245..169825
FT                   /locus_tag="Strop_0154"
FT   CDS_pept        168245..169825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0154"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase, class-II;
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52639"
FT                   /db_xref="GOA:A4X189"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A4X189"
FT                   /protein_id="ABP52639.1"
FT                   /translation="MPRGDGRLSHDLDPQRPGPQDACGVFGVWAPGEEVANLTYFGLYA
FT                   LQHRGQEAAGIAVSDGTGVVVYKDLGLVAQVFDEPTLASLRGHVAIGHARYSTTGGSTW
FT                   ENAQPTIRSTASGTTIALAHNGNLVNSAELYREAGERALAGDGATSDTSLVTMLLASRP
FT                   DLSVEAAALEVLPQLQGAFSFVFMDESTLYAARDQYGVRPLVLGRLERGWVVASETAAL
FT                   DIVGASVVREVEPGELIAIDEDGLRSARFAAPEPKGCLFEYVYVARPDATIAGRNVHAA
FT                   RVQIGRQLAREHEVEADLVIPVPESGTPAAIGYAAESGITFGAGLMKNPYVGRTFIQPS
FT                   QTLRQLGIRLKLNPLRENVRGKRLVVVDDSIVRGNTQRAIVRMLREAGALEVHVRISSP
FT                   PVAWPCFYGIDFATRAELLANGLDNEGVRRSIGADTLGYVSLSGLIAATEQPKSRLCRA
FT                   CFDGEYPIELPADSLIGKHVLEGVGRRVTAESSEPHAIPFVAAHSGYDAFSSARVPRPD
FT                   PEEPTTHIR"
FT   gene            169887..171041
FT                   /locus_tag="Strop_0155"
FT   CDS_pept        169887..171041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0155"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52640"
FT                   /db_xref="GOA:A4X190"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A4X190"
FT                   /protein_id="ABP52640.1"
FT                   /translation="MTHVSERSGAGSSQTGAGGDRQPWTTATGRPVRKRSASYLDAGVS
FT                   IEAGDRAVELLKSKVKQTRRPEVMGDLGGFAGLFRLDTKKYKSPILASSTDGVGTKLVI
FT                   AQQLDIHDTVGIDLVAMVVDDLVACGAEPLFLLDYIATGEVVPDRVAEIGAGIADGCRY
FT                   AGCALLGGETAEHPGVLRPDEYDISATGVGVVEESGILSSERVEVGDVVIAMRASGLHS
FT                   NGFSLVRHVLLGAGRMRLDVVIEDFGRQRTLGEELLTPTKIYAQDCLKLIAEAEVRVFA
FT                   HVTGGGIPGNLVRVLPEHVDAVVNRATWKPQPIFDLVQSKGRIEAPEMEATFNMGVGMF
FT                   AIVSAEDADRALATLTGRGVDAWQAGEIIEGTGNVQLVGQHTRG"
FT   gene            171178..172311
FT                   /locus_tag="Strop_0156"
FT   CDS_pept        171178..172311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0156"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52641"
FT                   /db_xref="GOA:A4X191"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4X191"
FT                   /protein_id="ABP52641.1"
FT                   /translation="MAVRGRSTAGMRGLAAVPAYVVMQPTTLCNLDCVYCYLPLRHADR
FT                   RMPVGVAKAVAASVNPWARAGRFSVVWHGGEPLAAGQELLGALIAPFGPEVEHHVQTNA
FT                   TLIDDAWCRFFAEHQIRVSVSVDGPRERNVDRVTRGGRPAYAHIMRGVEALRRHGLPFS
FT                   ALAVVGRPELGLARELYDFFLDLGPDVVGVNIEETEGVNTRANCHDAAAVTAFWSELVA
FT                   AWRRNPRIHLREVEWSLRYAAAVLDGVEDQVLPRRLDPIPTVGHDGSVTVLSPELAGFT
FT                   NPRYGDFSSGNVLVTSLAEILAEAAATPWVGEFLAGVEACRASCSYFGFCGGGHAANRY
FT                   FEQGRFDGTETEHCRNSKIRLLEGVLEHAREHRSPAT"
FT   gene            172280..172516
FT                   /locus_tag="Strop_0157"
FT   CDS_pept        172280..172516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52642"
FT                   /db_xref="UniProtKB/TrEMBL:A4X192"
FT                   /protein_id="ABP52642.1"
FT                   /translation="MPENTGPRQPERTAGAVSDDVVDRIRVAGADLTTLLREAEAARHL
FT                   RAEAAGDGTSSAVCAWNHFENIPTFYNWNNRPR"
FT   gene            complement(172731..172946)
FT                   /locus_tag="Strop_0158"
FT   CDS_pept        complement(172731..172946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52643"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:A4X193"
FT                   /protein_id="ABP52643.1"
FT                   /translation="MGRGRAKAKQTKVARELKYHSPNTDLAALQRELGGSHKSDHDFDD
FT                   DYKEYVDDDDEDHVDDDPDNRARPNR"
FT   gene            complement(173238..174320)
FT                   /locus_tag="Strop_0159"
FT   CDS_pept        complement(173238..174320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0159"
FT                   /product="valine dehydrogenase (NAD)"
FT                   /EC_number="1.4.1.-"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, C terminal;
FT                   Glu/Leu/Phe/Val dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52644"
FT                   /db_xref="GOA:A4X194"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR016211"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X194"
FT                   /protein_id="ABP52644.1"
FT                   /translation="MGVFATTDAPASVGHEQVVFCQDKQSGLRAIIGIYSTALGPALGG
FT                   TRFYPYASEEAALADVLDLSRGMAYKNALAGLDLGGGKAVIWGDPEQLKSETLLRAYGR
FT                   FVATLGGRYYTACDVGTYVADMDVIARETRFVTGRSREHGGAGDSSILTAWGVFQGMRA
FT                   AAEHAWGTSTLRGRRVGVAGLGKVGKHLVGHLLDDGAEVVATDVNPRALAWARTTHPQV
FT                   TLLDDASALAASDIDVYAPCALGGTLNDHTVPALRATVVAGAANNQLAHPGIEKLLADR
FT                   GILYAPDYVVNAGGVIQVADEIEGFNFDRAKLRATKIYDTTREILGLADAEGVPPAVAA
FT                   DRLAERRMAEVGRLRTVLLP"
FT   gene            174389..175378
FT                   /locus_tag="Strop_0160"
FT   CDS_pept        174389..175378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52645"
FT                   /db_xref="UniProtKB/TrEMBL:A4X195"
FT                   /protein_id="ABP52645.1"
FT                   /translation="MPLSLVSADIVSVVTDVCVRTAGPAARRLPGVHAKLCHQGFASDS
FT                   WEDRAVPSLFAAYLRVYEPLTAFDRSRQAYWRRYVEQGRAVAPVEGPGRQLTSVIEALG
FT                   AGWTRLPDLPDEAYVLEADDTLLVCPWNLRIRVAEAALNARDGVPPVLADAFVPPVLAG
FT                   KAKAVVDDWRSGARVLEHGVPRVHEQIATWGVPLRWFVLFEPAERHQVTEPGRRALRYR
FT                   TEISKARRRSSRALAVLRKSVGAAPITEAVEEAARWLEEFHPRSVVELDYGGLVSLLSD
FT                   ETLAADDSPELVAAGLAGLSRGEAEEASSAYDKLVARWRAVQLLERCN"
FT   gene            175631..175840
FT                   /locus_tag="Strop_0161"
FT   CDS_pept        175631..175840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0161"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52646"
FT                   /db_xref="GOA:A4X196"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4X196"
FT                   /protein_id="ABP52646.1"
FT                   /translation="MASRTHEPEPLLTPAEVASMFRVDPKTVTRWAKAGKLSAIRTLGG
FT                   HRRYRESEVRALLQGQIPQQRQGD"
FT   gene            complement(175963..176445)
FT                   /locus_tag="Strop_0162"
FT   CDS_pept        complement(175963..176445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52647"
FT                   /db_xref="GOA:A4X197"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:A4X197"
FT                   /protein_id="ABP52647.1"
FT                   /translation="MDTAGAVPRPGLRYTARRRAHCPVSRPRSRILGGVTTLDRLATEK
FT                   YILLTTFRKDGRAVPTPVWAVRDGDALAVWTVTGSGKVKRIRRSGDVTVAPCDVRGRPH
FT                   GPAVPGHAALADSAGTRRVRGLIKEKYRVLGRLTLLGSRLRRGEQGTVGIRVTLKG"
FT   gene            176579..177436
FT                   /locus_tag="Strop_0163"
FT   CDS_pept        176579..177436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0163"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52648"
FT                   /db_xref="GOA:A4X198"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X198"
FT                   /protein_id="ABP52648.1"
FT                   /translation="MGDRWVVVGAGTMGLGIAYVAAGAGHDVDLVEVDPARGEAAAVRL
FT                   GELWDRAVGRGRITVEQAGANRSRVTLRGSLTEVGASPDVVVEAVPERVDLKRSVLRDA
FT                   ENLNPALLASNTSSISIAQLAEGLTRPERFLGLHFFNPVWAMTLLEVVVGPGTAPESTD
FT                   AAIALAARLGKDPVVVRDLPGFATSRLGVTLGLEAIRMVADKVAEPADIDKAMMLGYRH
FT                   PVGPLELTDLVGLDVRLDIARTLAAAYGERFAPPPLLVEMVAAGHLGKKSGQGFYRWEN
FT                   GVKA"
FT   gene            177412..178176
FT                   /locus_tag="Strop_0164"
FT   CDS_pept        177412..178176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0164"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52649"
FT                   /db_xref="GOA:A4X199"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4X199"
FT                   /protein_id="ABP52649.1"
FT                   /translation="MGERGEGVTGLRIDEQADRVVAMLDRPEKRNAIDVDLVQALHELC
FT                   AELEARPRLLLLTGGAEGIFAGGADIGQLRERDRLDALAAINSAVFTRIRALPMPTVVA
FT                   VDGPALGGGAELAYACDLRVCTSRAFFGQPEVRLGILAGAGATHRLPALVGEARAKELL
FT                   FTGRRVDAAEALRIGLVNQVVTEPAELLPAAHALLDEVAKGSALALRLTKLAVDAPAAA
FT                   HPHLDLVSQAVLFEDEEKHRRMTDFLERRSRS"
FT   gene            complement(178292..179626)
FT                   /locus_tag="Strop_0165"
FT   CDS_pept        complement(178292..179626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0165"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52650"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A0"
FT                   /protein_id="ABP52650.1"
FT                   /translation="MLISRAARAATLAACATFLLASSACGTDESDQVTASPVRLYGTDG
FT                   TMLNSFPTELGDRADLVDGMKGTTPLTPLPEDFKDRLRSIDPDLTSFVYAAETYDAVLI
FT                   SALAAQLAGTTDPAAVAEQIVGITNGGQRCETAVTCLALARDRQDIEYRSVSITRGGFT
FT                   AAGEPSTASYATLHFDGKQINDAKTEFLGAGFESTASNSPPPDAARAGRNGKAPLVLGG
FT                   LLPQTGDLALSNPPLAAGAALAIQEINAAGGVLGAPVTWIDGDDGTNPTVAKATVARHA
FT                   AAGVHVIIGAGASGISRAVLPDVVRAGLVLFSPSNTDASLTELDDEGRYFRTAPPDSLQ
FT                   GRALADVILRDGPQQIAIVARQDSYGEGLQNIVQSELERAGVDPDRLKLITYQPPEGTD
FT                   VAAVDFASGVREIKESGADAVLIIGFSESAELIRALADAGVPLHH"
FT   sig_peptide     complement(179552..179626)
FT                   /locus_tag="Strop_0165"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.562 at
FT                   residue 25"
FT   gene            complement(179773..180279)
FT                   /locus_tag="Strop_0166"
FT   CDS_pept        complement(179773..180279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0166"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52651"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A1"
FT                   /protein_id="ABP52651.1"
FT                   /translation="MVDPFDVRQDFARFSLRSSLLVPASTQQAFAVFTGAIADWWVTEY
FT                   TWSGPDLLTTLGMEPRTGGMLYEIGPHGFRNDWGRVLAWTPPHRLVFTWQIGADRVPAP
FT                   DPARASEVEALFRPDRSGQTRVEVEHRHFDRHGPAAEGYRQALTAGWSELLARYASVVA
FT                   KRVVG"
FT   gene            180519..180980
FT                   /locus_tag="Strop_0167"
FT   CDS_pept        180519..180980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52652"
FT                   /db_xref="GOA:A4X1A2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A2"
FT                   /protein_id="ABP52652.1"
FT                   /translation="MDPEAGRRYAEEVGVVLARMGTTPAFGKLLGWLLICDPPRQTTAQ
FT                   LCEAMGLSKASVSTGMRVLEQSGMVRRVPSQGRGHAYEMHPDAFARAIDPTDRMRVFID
FT                   LMQRGIDLVGDAAAPEASRLRHTRDFYTFMVERTPALMEEFRRQARKGS"
FT   gene            180983..182266
FT                   /locus_tag="Strop_0168"
FT   CDS_pept        180983..182266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0168"
FT                   /product="Sterol 3-beta-glucosyltransferase"
FT                   /EC_number="2.4.1.173"
FT                   /note="PFAM: glycosyl transferase, family 28"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52653"
FT                   /db_xref="GOA:A4X1A3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A3"
FT                   /protein_id="ABP52653.1"
FT                   /translation="MRILVITVGSRGDVQPYVALGKGLQSAGHDVTLATCARFRSFVTD
FT                   QGLAYGQLSDDILQLLDSAAGRAAMEDTTGVLGAVRTNIRLARQANPINRRLLADAWAT
FT                   ARQAKPDLVVYHPKVLAGPHIAEKLGVPVVLALPVPVSVPTGDFPLVGLPELPLGRWYN
FT                   RLTYRLAGAGYRMYDGMVNTFRRDTLGLAKTSGAALTTRLPDGRPIPVLHGISEHVLPR
FT                   PADWPGHAHLTGYWFLDDAARWQPPAGLVDFIEAGDPPVYVGFGSMAGRDPHRLTRLVG
FT                   EALRRAGVRGIVATGWGGLAETEPSDTIWHLTQAPHDWLFPRMSAVVHHGGAGTTAAAL
FT                   RAGKPSVICPFLLDQFVWGRQVFALGVGSAPIPQRKLTPQRLATAIRTVTTNADIRAAA
FT                   LKLGRSLAAEDGVANAVARIDTLLRPAG"
FT   gene            182587..183477
FT                   /locus_tag="Strop_0169"
FT   CDS_pept        182587..183477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52654"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A4"
FT                   /protein_id="ABP52654.1"
FT                   /translation="MGPEFAPGVKGVKALTDESGKANFSGIYNQETPCAYYANLRRLKY
FT                   EIPQHGATVFNQLIDAQPWGDGYRPTVLDVCCSYGIVGVLTKTDLELDDVYTYYQGAGD
FT                   DGRTVDQVRRAENEFLGQRARPAAPHVIGLDVAENAARHGVAVGALDDAFVENLEATTP
FT                   SSELAKKMSEVDLITTTGGIGYVTERTFERLLTCTEAPPWVAAFCLRTYDYEPISEVLA
FT                   QYGLVTEKADQAVRQRRFIDDTEREWAMAELAARGVDPADMESEGYLYADFYLSRPQED
FT                   ATGKPLADLVTIPAN"
FT   gene            complement(183716..184564)
FT                   /locus_tag="Strop_0170"
FT   CDS_pept        complement(183716..184564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0170"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52655"
FT                   /db_xref="GOA:A4X1A5"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A5"
FT                   /protein_id="ABP52655.1"
FT                   /translation="MGGGTTQNRLGPSGQRPSTRASTSTDPPAQYSLKKILGIWAAVTL
FT                   PMGLGYWVITPAVADGPYDTVVLATVTLAAGLVWQFVLAMLILRREEGSVGLSAMARRL
FT                   WLQVPRDPVSGRPRKRLLWLLAPLGIAFVLNMLYVAPVIQNLQQHLLPGPAPLPFQKAE
FT                   TLFSAEVASQMEGAWWFFALFLTLSVFNVFLGEEFIFRGILLPRMQGVFGSADWLANGV
FT                   LFGLYHVHQPWTAGGIMLTSGLIMSLPVRRYRSMWLSVIPHSIQTVIVFGMLLGLMRGT
FT                   A"
FT   gene            185047..185970
FT                   /locus_tag="Strop_0171"
FT   CDS_pept        185047..185970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0171"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52656"
FT                   /db_xref="GOA:A4X1A6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A6"
FT                   /protein_id="ABP52656.1"
FT                   /translation="MGAGHDHGQQAARAGEKHRGRLWAAFGLLLTFMVVEAVAAVMTGS
FT                   LALLSDAGHMFTDVLGMGMALAAITAASKASRAGQRTFGLYRMEVLAALANAVLLFGVA
FT                   SYVVVEAVRRFGQPPEVLARPMVVVAVAGLLANVVAFFLLRAGSRESLNVRGAYLEVLG
FT                   DLFTSVGVIIAAVVITLTDWWYADPLIAVVVGLFILPRAYQLGRAALRVLVQAAPVHLD
FT                   ISVVRAAMLGVDGVADVHDLHVWTLTSGMEVASAHLALERDADFAAVLATSQRLLRDRF
FT                   AVEHATLQAEPAEPANADDVCHGSGW"
FT   gene            186208..188163
FT                   /locus_tag="Strop_0172"
FT   CDS_pept        186208..188163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0172"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52657"
FT                   /db_xref="GOA:A4X1A7"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A7"
FT                   /protein_id="ABP52657.1"
FT                   /translation="MAAAVGAALLWWGGGAVVQTPPGFPDPGPTTAWLLPASRLGMQVS
FT                   AVATVGLLLAAVVLSPRDEGRRLSPVGYRRMRAAAGAAGVWAAASAVAVCYTMVDLFGL
FT                   PAAQVLSLRGVLNFATTVSLGQALALSGVLALAAAVVAATSLRPGGALTALLLALGALV
FT                   PPVFTGHAAASGDHQLAVSGLLLHVLPVTIWAGGLLALAVTSRGTTADLARAVRRFSPL
FT                   AAGCLAAVGLSGLLSAAVRLPSVADVLGTRYGQVILIKAAALVAIAVVGLAHRRRALPA
FT                   LAAGRRGPFLRVAVVETLLFAAAIGTSVALSRTPAPVGTETEDVATALLGFPMPPPMTI
FT                   DTLATAWLPEPLIMAAVFAAAGFYTAAVWRLRRRGDSWPVSRTALWLVGCALIIVATSS
FT                   GLARYGPLLFSIHMIQHLLLMMLAPILLALGGPITLALRALAPSTDPRWPGPREWLQVA
FT                   LHSRLSRTLTNPVVALVIYVASLYMMYFTGLYELALRSHAAHLAMVGHFLGAGYLFFWV
FT                   VIGVDHAPRRIPYPLKLILVLISMVLHAFLGVTLMQSTTLIAETWWITLDRPWGPAPLE
FT                   DQRTAGGIAWSFGELPTVVVLIALMRQWMKADEREARRRDRAADRAEAEGREDAELAAY
FT                   NRMLAGLAERDRQVRR"
FT   gene            188371..189030
FT                   /locus_tag="Strop_0173"
FT   CDS_pept        188371..189030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0173"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52658"
FT                   /db_xref="GOA:A4X1A8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A8"
FT                   /protein_id="ABP52658.1"
FT                   /translation="MTRNTRLTLAAVVALILVMVGVLAMNRRDAIPSAKTTGGAVEPAV
FT                   LVREDSHRLTSAPDGRVTLVEFLDFECGPCAAAYPTVKEILADYEGQITFVVRYFPISS
FT                   HPNAELAARAAESAANQDRFAEMYQLLFENQNAWSRQDEPQTEVFLGYARTLGLDIDRF
FT                   QRDLDDPATAARVAKDRTDGEAVGVQGTPTFFLNGEPLSDLRKDDLTTMIDAALAG"
FT   sig_peptide     188371..188463
FT                   /locus_tag="Strop_0173"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.762 at
FT                   residue 31"
FT   gene            189027..189659
FT                   /locus_tag="Strop_0174"
FT   CDS_pept        189027..189659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0174"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: Vitamin K epoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52659"
FT                   /db_xref="GOA:A4X1A9"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1A9"
FT                   /protein_id="ABP52659.1"
FT                   /translation="MTTTANRPVTTPAERHFLAAVTAWVLTIGGAVGLLAAAALTVEKI
FT                   NLLADPGYVPTCSINPILSCGSVMNTPQAAVFGFPNPLLGIAGFAVVTTLGVTLLATGH
FT                   LPRWMWLGLQGGVTFGVVFVHWLIYQSLYVIGALCPYCMVVWAVTIPIFLYTTLQTLRD
FT                   NTTALPRALRRVTERVARYHSLVLVVWAAFVVVVILHRFWDYWSTLG"
FT   sig_peptide     189027..189143
FT                   /locus_tag="Strop_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.952) with cleavage site probability 0.622 at
FT                   residue 39"
FT   gene            complement(189826..191241)
FT                   /locus_tag="Strop_0175"
FT   CDS_pept        complement(189826..191241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0175"
FT                   /product="Nitrate/nitrite transporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52660"
FT                   /db_xref="GOA:A4X1B0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B0"
FT                   /protein_id="ABP52660.1"
FT                   /translation="MNTTSSSRRAGRAGNGEWLESWNPEDTDSWDKGLAWRTLWISTFT
FT                   LTLCFTSWFLASAIAPKLTNLGFDLSTSQLYWLTAMPGLAGGLMRLIWMVLPPIMGTRK
FT                   MVTLTTVLLLLPVVGWGIFVQDPTTPFWVLLSLSFLSGIGGGAFSGFMPSTSYFFPRRL
FT                   QGTALGVQAGIGNFGVSLVQLLTPWVIGFSLIGFLGSSRPMATAPGEPPKDVWYQNAAY
FT                   IYIPFIIVGAVLAWTMLRSVPVKANIRQQFDIFRNVDTWWMTLLYIMTFGTFAGLSAQF
FT                   GLLMKNLYGAGNPDIVQGTGAAAQLLVDGYSVPDPVKFVFLGPLVGAAARVVFSPLTDK
FT                   FGGARWTLISGIGIVVSIGFTLTALRPDTSSAAALDAGFDRFLWGMLAIFLFSGIGNAS
FT                   TFKQMPMIFERRQAGGVIGWTAAIAAFGPFFFGIGLTIMSPSAFYLVGLAFAVLCVVVT
FT                   WQRYARPGAPKPS"
FT   gene            complement(191238..192656)
FT                   /locus_tag="Strop_0176"
FT   CDS_pept        complement(191238..192656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0176"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52661"
FT                   /db_xref="GOA:A4X1B1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B1"
FT                   /protein_id="ABP52661.1"
FT                   /translation="MYVKPAPDDSTPDETATEQNSRNDRGRTRVLTLSTIGFTVMFAVW
FT                   LMFGILGKPISEEFGLSEVQLSWIIAAAVLNGSLWRLPAGIVADRVGGRRVMTAMLLLT
FT                   AVASFLVSRADSYAMLLVLAFLVGFAGNSFTAGIAWNSAWQPREKQGFALGLFGAGNVG
FT                   ASVTKFIGPPLIAGTAGATYLGVVEGGWRLVPVVYAVLLLALAAATWFITPRQDRVPSH
FT                   GTPLRTQLEPLKQLRVWRFSLYYVAVFGAYVALAAWLPTYYMNNYDVSLQTAAYLTALY
FT                   IFPASLLRPVGGSLSDRLGARRVMYWTFGLMLLSTGILMMPPGHIVVDHPDGTQTTHLA
FT                   YQLGIVPFTLLVVLLGCAMGIGKAAVYKHIPEYFPRQVGAVGGLVGMLGGLGGFFLPPL
FT                   FAYTKAWTGLPSSTFLVLFVLTVICAVWMHLTVVRMLHGESPQLATHFEKPEPADQPAA
FT                   PASAATRASKEAHV"
FT   gene            192982..196680
FT                   /locus_tag="Strop_0177"
FT   CDS_pept        192982..196680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0177"
FT                   /product="respiratory nitrate reductase alpha subunit
FT                   apoprotein"
FT                   /note="TIGRFAM: nitrate reductase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52662"
FT                   /db_xref="GOA:A4X1B2"
FT                   /db_xref="InterPro:IPR006468"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR037943"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B2"
FT                   /protein_id="ABP52662.1"
FT                   /translation="MSAHRPPEVHDPATDQVPGAAPLLAARRFLRRELVGDHGRTLHQI
FT                   ADGDWDRFYRDQWRYDRVVRSTHGVNCTGSCSWNVFVKDGLITWEHQATDYPTTGPDSP
FT                   DYEPRGCPRGASFSWYEYSPSRVRHPYVRGVLAEMFRDGLARLGDPVSAWADIVENPLK
FT                   ARAYKTQRGRGGFVRASWDEVTTMVAAAHVYTTKTYGPDRVVGFSPIPAMSMASFAAGT
FT                   RYHALLGGTLLSFYDWYADLPIASPQIWGDQTDVPEAGDWWNATYLMMWGSNIPVTRTP
FT                   DAHFLAEARYRGTKVVAVSPDYADNVKFADDWLAPHPGTDGALAMAMGHVVLTEFFRDR
FT                   TVDYFTDYVRRFTDLPFLVTLRPTAGGRWATDRFLTAADLGQEDGAHKTVLVDEHTGEL
FT                   VVPNGSLGFRYGEAGQGRWNLDLGEVFPALGLLDRSDEAIEVELARFDVGETEGGSTIS
FT                   RGVPVMRVGEQLVTSVYDLVLAQYGVRRGDLPGQWPTGYDDPESPNTPAWQERITGVPA
FT                   AVATRIGREFARNAERSQGRSLIVLGAGANQWFHSDMTYRALISLVTLTGCQGVNGGGW
FT                   AHYVGQEKARPITGQQHMSFGLDWQRPMRHQASTPFWYLHTDQWRYERVPVDELSSPLG
FT                   TGRFAGMAFADTVAAAQRMGWSPGHPSFNRNPLDLTDEAAAAGVTVQEHIVAELKAGRL
FT                   RSVAEDPDDPANFPRCLTLWRANLLGSSGKGNEYFLRHLLGIDSTATASECDPEHRPRD
FT                   LVWRDEAPTGKLDLLTAIDFRMTNTGLHADVVLPTATWYEKHDISTTDMHPFVHAFSPA
FT                   VEPPADAHSDYDTFLALADRFSELAAGHLGVRRDVLAAPLQHDTPDELAMPSGRVRDWK
FT                   AGECEPIPGATMPKLIEIERDYSQIGAKMRAVGPLLDRLGTSTKALTVDVTVELAYLRE
FT                   RNGVVPDGPFAGRPSLATADRMCEAILALSGTTNGRVAAAGFAALEKRTGQPFADLIAG
FT                   HENDQITYADTQRAPQSVFTSPEWSGSEKGGRRYSPFTLNVERLKPWHTITGRQHFFVE
FT                   HDWVAELGEQLPGFRPPLNMARHFGAPGELVDGGVTVRFLTPHAKWTIHSMYHDNELML
FT                   ALSRGGPVIWMSVPDAAKVGVRDNDWVEAHNRNGVIVARAVVSHRMPEGTVFQYHSPER
FT                   TINVPKAEKSGRRGGYHNSLTRLLVKPTHLAGGHAQLTYAFNYYGPIGSQRDEITVIRR
FT                   RDQEVEY"
FT   gene            196680..198299
FT                   /locus_tag="Strop_0178"
FT   CDS_pept        196680..198299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0178"
FT                   /product="respiratory nitrate reductase beta subunit"
FT                   /note="TIGRFAM: nitrate reductase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52663"
FT                   /db_xref="GOA:A4X1B3"
FT                   /db_xref="InterPro:IPR006547"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR029263"
FT                   /db_xref="InterPro:IPR038262"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B3"
FT                   /protein_id="ABP52663.1"
FT                   /translation="MRIRAQVAMVMNLDKCIGCHTCSVTCKQTWTNRDGTEYVWFNNVE
FT                   TKPGIGYPKHYEDQDRWHGGWQLDEKGRLKLRSGGRMKRLSRLFVNPDLPSIDDYYEPA
FT                   TFDKDILANAPAGLKDTPVQQPRSALTGEPMALTWGANWEDSLGGAHEHGTGDPNIARM
FT                   PAEAAARVKFEFEKTFLFHLPRICEHCLNPACVSACPSGAMYKREEDGIVLVDQDRCRG
FT                   WRMCVSACPYKKVYVNHTTGKAEKCTLCFPRIEAGQPTICSETCVGRLRYLGIVFYDED
FT                   AVLAAASVTDEHDLLDAQRAVFLDPTDPAVRDAARAAGMPQEWLDAAERSPVWRLISEY
FT                   KVALPLHPEYRTLPMVWYVPPLSPVLDAVGEAGRDDTDADDVFHTIRELRIPVEYLAEL
FT                   FTAGDVEATAGVLMKLAAMRSYMRARTLDGTVADDLLDGIGMTADQVEAMYRLLAIAKY
FT                   DERYVIPAAHSKDAAALEAQATAHPDCALDCEGGPGMTTQAGAESFHLVDGEQVRPGRP
FT                   GLFSRRADGRRGFTINPLRGRA"
FT   gene            198296..198967
FT                   /locus_tag="Strop_0179"
FT   CDS_pept        198296..198967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0179"
FT                   /product="respiratory nitrate reductase chaperone NarJ"
FT                   /note="TIGRFAM: nitrate reductase molybdenum cofactor
FT                   assembly chaperone; PFAM: Nitrate reductase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52664"
FT                   /db_xref="GOA:A4X1B4"
FT                   /db_xref="InterPro:IPR003765"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B4"
FT                   /protein_id="ABP52664.1"
FT                   /translation="MTAATDRARIFELVSLLLTYPDDELLGAGAELRGAAARIGAQEAR
FT                   ERIDGFLDWLLDNTPIDVQQHFVQTFDLRRRSGLYLTYYLHGDTRKRGMALLVLKQRYR
FT                   AHGLRLADGELPDLLPVVLEYAAMVGPGEGEAPLRQHRQGIELLRAALTDCGTPYRLLL
FT                   DVICAVLPALTDADRAAIAALAVDGPPVETVGLESLGEGPDLHAAALAPYSACSPSEAS
FT                   R"
FT   gene            198964..199707
FT                   /locus_tag="Strop_0180"
FT   CDS_pept        198964..199707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0180"
FT                   /product="respiratory nitrate reductase gamma subunit"
FT                   /note="TIGRFAM: respiratory nitrate reductase, gamma
FT                   subunit; PFAM: Nitrate reductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52665"
FT                   /db_xref="GOA:A4X1B5"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B5"
FT                   /protein_id="ABP52665.1"
FT                   /translation="MTNLVWIVLPYLCLAVFVAGHVWRWRHDQFGWTTHTSQVLENRIL
FT                   RLGSPLFHLGALGVVAGHAMGLVVPASVTEKLGLSEHAYHLIAVWGGTVTGLMLTVGLV
FT                   LLIIRRMVNGRVRRVTTRMDKVLYAALAGMVALGMVATVGVNLLGGGYDYRETIAVWFR
FT                   GIFWFQPDPALMSGAPLVYQLHAIGGFLFLALWPFTRLVHVWSAPLAYLWRPYVVYRAR
FT                   RGPAPSPTASPNQVRDAAREPSARR"
FT   gene            199855..200187
FT                   /locus_tag="Strop_0181"
FT   CDS_pept        199855..200187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0181"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52666"
FT                   /db_xref="GOA:A4X1B6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B6"
FT                   /protein_id="ABP52666.1"
FT                   /translation="MQQQYLPDIYVKFLERFPEIAEAQGALARTVRERNSFDDRTDRLI
FT                   KLAVAVGAEAEGAVRSNVRKALQHGATVDEVRAVALAAITTCGFPTAIAALGWIDSVVL
FT                   APPDDA"
FT   gene            complement(200237..201217)
FT                   /locus_tag="Strop_0182"
FT   CDS_pept        complement(200237..201217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0182"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52667"
FT                   /db_xref="GOA:A4X1B7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B7"
FT                   /protein_id="ABP52667.1"
FT                   /translation="MAGEAADNGRTVDRMRRNVAPTSRHIGVTGRGVPIFGFGYVPGIA
FT                   PVSVARHCRGEPVVDVGSIGAHTHDFLVLSYAHLAHGTVHIDERTWTVSDGDLFVIAPG
FT                   QVMSAGDPFEEATTDGWTVWFPADVVRPGMPGAYSSWRTHPLLFPFAQGANRAQRLPVP
FT                   PVDRADLVERFAALDAELRARRDGHQEAALAHLTLLLVTVARLSTGLADHLRCADEPLL
FT                   AAVFEAIEERYHQPISLADIAADLALTAGYLTTVVRRKTGRTVTQWIAQRRMQQARLLL
FT                   AETDLAVGAISRRVGYPDTSYFSKRFRARHGVTPTQWRATSPPTG"
FT   gene            201264..201935
FT                   /locus_tag="Strop_0183"
FT   CDS_pept        201264..201935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0183"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52668"
FT                   /db_xref="GOA:A4X1B8"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B8"
FT                   /protein_id="ABP52668.1"
FT                   /translation="MTGHHNFHSENRGYLPAMGKQWLLPLYDPFARYIGIRRVHEKLLD
FT                   RANIRPGQRILEIGCGTGDLLRTLKQRHSDVEVLGIDPDLSALRRARRKAARSKLQIQY
FT                   ERAFADDLPLSDDSVDRVLSSFMLHHLAVAEWAPVFREVRRVLRPGGELHLADIDGSHP
FT                   GQDGGHPHRFGQTEESLPELVLAALADAGLSGARENGYGRARLGRYVFYRADAECGGRS
FT                   D"
FT   gene            202585..204093
FT                   /locus_tag="Strop_R0005"
FT   rRNA            202585..204093
FT                   /locus_tag="Strop_R0005"
FT                   /product="16S ribosomal RNA"
FT   gene            204506..207613
FT                   /locus_tag="Strop_R0006"
FT   rRNA            204506..207613
FT                   /locus_tag="Strop_R0006"
FT                   /product="23S ribosomal RNA"
FT   gene            207700..207815
FT                   /locus_tag="Strop_R0007"
FT   rRNA            207700..207815
FT                   /locus_tag="Strop_R0007"
FT                   /product="5S ribosomal RNA"
FT   gene            208244..209260
FT                   /locus_tag="Strop_0184"
FT   CDS_pept        208244..209260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0184"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52669"
FT                   /db_xref="GOA:A4X1B9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1B9"
FT                   /protein_id="ABP52669.1"
FT                   /translation="MRAIMLYGAWDVQVEDVPDPVLEEPTDAIVRVLQASIGGTDLYLY
FT                   HTMPRTGPGTPMGREFLGVVEELGSEVRGMKKGDLVVAPFTYQDNTCDFCREGLQTSCR
FT                   HGGFFNTAQAELIRVPQATGTLITLPVGEDSALLPSLLTLADAYSTGYYAAKQANVNPD
FT                   TTVTVIGDGAVGLLAVLSASRLGAKRIILKVRHETRTELGNEFGATAVVAEHGADGVAR
FT                   VRELTDGDGTHVVLEAVGYRESFDQALGMVRPGGVISRVGVQYDEAEIGWGVFGRNITL
FT                   TGGPAPVQAIVDELLPGILDGAVEPGKVFDHTVGLDEVPDGYQAMSRREVLKVLIRP"
FT   gene            209436..210458
FT                   /locus_tag="Strop_0185"
FT   CDS_pept        209436..210458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0185"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52670"
FT                   /db_xref="GOA:A4X1C0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C0"
FT                   /protein_id="ABP52670.1"
FT                   /translation="MRATVLHGPGDIRLEQRPDPTITAPTDAVVRIAASCVCGSDLWPY
FT                   RGIESISQPIPMGHEYVGVVDAVGSDVRKIKPGQFVVGSFFASDNTCEICRAGYQSSCL
FT                   QREYMGNLGAQAELLRVPLADGTLVATPEVPDEDLIPSLLMASDVLGTGWFGAASADIR
FT                   PGKSVVVVGDGAVGLFAVLAARRFGAERIIVMSRHADRQKLALAHGATEVVTERGDDGV
FT                   ARIRDLTDGLGVHSAVEAVGTQESMLQAIRSTRPSGHVGFVGAPHGVTLSGHELFYSHV
FT                   HLHGGPAPVRRFLPELIDLIFSRSIDPSKIVDLTLPLDQVAEAYSAMHERRAVKAVLLP
FT                   "
FT   gene            complement(210543..212369)
FT                   /locus_tag="Strop_0186"
FT   CDS_pept        complement(210543..212369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0186"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52671"
FT                   /db_xref="GOA:A4X1C1"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C1"
FT                   /protein_id="ABP52671.1"
FT                   /translation="MTVTLYGDKVPPADDRPTVQVTAVQWPVEEAEKPTKRGGKWSFPP
FT                   GGKWSRRTWLLAAGVTTAVLASAVGIGAYAYAGDVPRGTTVLGTELSGYSQAAAVEELR
FT                   AAVERQAAELNAPLPVVVGDNTAELVPAEVGLRVDVEATVAAAMQVEAHVFERLVGSRT
FT                   VPPVVTVDVDQLDAALKKVLGDDGRTMTMPAITWSGLTPKATHPKPSLELDPERSAQAV
FT                   REGWLSGEPVTVPLAQIHPVTTAEEVDQMVAELARPAVAAPVTLTTDQGSMSIPPAAIA
FT                   KSLVFTADDAGALSAKVDVEKLRTALGDDLAKVEVTPKNARMTLTDGKPKIIESRDGKK
FT                   LDTSSLGEALLAVLPQSDDRRVTGTLTTAKPELTTEKLAGLGIREQVSTFTTQFSGGLS
FT                   SPRSQNIITAAKDVDNTLVLPGETFSLNGHTGDRNYAKGYKDAPVILNGKLVPGVGGGV
FT                   SQFTTTLFNATYYAGLEDVEHKPHSYYFSRYPAVIESTIFYPELDFKFRNNTEYGLLID
FT                   TSYTSNKITVSIWSTKIWDKVKTEYGPRKNITKPKTVHLEPGPNCIAASGSDGFSQSAY
FT                   RVFYKDGKEVKREKFSWRYAAEPRFICGPKPS"
FT   gene            212467..213462
FT                   /locus_tag="Strop_0187"
FT   CDS_pept        212467..213462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0187"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52672"
FT                   /db_xref="GOA:A4X1C2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C2"
FT                   /protein_id="ABP52672.1"
FT                   /translation="MSPPPILACRCWRATVGSMREDDVALAYGGGWVDRAGALRADPDR
FT                   LATLLGAVDTRVLPLWQDRCLVNGTAPVRLSGEAAARAHVAARETVFLGFAAGRAVFAV
FT                   DLSELAEDAALAAVGATRVVDVRGLVGPLSPAEAAIQAYARGLLHWHRQQRYCGTCGGS
FT                   TSVQDAGHARRCADPTCARLYFPRIEPAIIVLVETAGSPGRCLLARHAGAAEGAFSTLA
FT                   GFVEVGETLEDAVRREVAEEAGVVVTDVAYQGSQAWPFPAGLMVGFRATAVSDEIRVDG
FT                   VELLEARWFTRAELRQRAAVGHPLGRLDSIGHHLLSSWLAEDEAAASAPR"
FT   gene            complement(213448..214719)
FT                   /locus_tag="Strop_0188"
FT   CDS_pept        complement(213448..214719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52673"
FT                   /db_xref="GOA:A4X1C3"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C3"
FT                   /protein_id="ABP52673.1"
FT                   /translation="MIRRTDDVDGSGTPSPSTGARALGTAGLAVTAAGLLANGLAYLVP
FT                   VLAARQLGSADLSALATTLGLIAIASVPGFGLQLAVAVHHAKHGHTQTRRAALLTAALC
FT                   ASALILASPLLVTSLRLPAEALVLSAITTAAIVLSCRTLGELQGGQRFVRLAIGMGLLA
FT                   TGRYGGVLVGLLLDAGLTGSLLLGAGTAALTPVGLAALARPAAPAAPATAPPLDAGQIL
FT                   TGCAAMLAMLVVSYVDLFLARQLLPADDSGGYAVGTVLTKGALWAPQVATVLALPRLAR
FT                   DDRFSRAVALAVTAGCGVLLILGSTFAGTLAFHLVGGPDYTHLGPFAPLFAAVGALYAV
FT                   VFVLLNAAVATGVRWPAAPLWVGSALLTTVALWTTPRTVSGLLWLALGAAVVTTLAMTL
FT                   RTWMSTPARVDRLVPAPRRASAGS"
FT   gene            complement(214716..219023)
FT                   /locus_tag="Strop_0189"
FT   CDS_pept        complement(214716..219023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52674"
FT                   /db_xref="GOA:A4X1C4"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C4"
FT                   /protein_id="ABP52674.1"
FT                   /translation="MRAEVTSDAGARPRRARRLDRGFRHLAICVVLTALAFQQAPGLIV
FT                   PDTKVDLNVNPAGWLLRSLHLWDPTGAFGQLQNQAYGYLWPMGPFFLVGSELGLQPWVI
FT                   QRLWWALLFCVAYLGVVRLAGSLGIGSPTGRMIAGVAFALSPRILTQLGWSSVESWPSA
FT                   VAPWVLIPLIGLARGAPLRRAVAGSALAVACAGGVNATAVFAVVPLALLWLATLAPIGR
FT                   RISAIAAWCGAVALATAWWLVPLLILGRYSPPFLDYIETAQSTTSVTDAVTTLRGASYW
FT                   VAYLASPVEQAIPGGARLANELPLILATLAVAALGVLGLSRRGMPHRRFLVTGLMLGAA
FT                   MVGLGHVSDLPNLLAGPQQQFLDGIGAPLRNTHKFDVLLRLPLTLGLAHLVSLVVKAAR
FT                   TAPAARHKKAVARAWITTGVTMAAVAAVASPAIIGGIATPGSAREVPPYWQDAADWLDA
FT                   NTGPGRVLVVPGARRPAYDWGSTTDEIAQPLLESSWAVRNSIPFTPPTTIRLLDAIEAT
FT                   LSSGAGSAGLADLLARSGVSHVLFRADLDHGRSDTTRPAVVRQALQRSPGLTRVTTFGP
FT                   IRGGPEAVDDIPDQGLDVPGRALEVYQVNRRVEPVVAYDRKDVATVVGGPESLLDLAAA
FT                   GLLSPAPTVLAGDADTDDLSGPVAMTDGLRRREVSFGRSQDNASHTHTADETLAPSAPA
FT                   HDYLPDWAENWSTVAQFEGINSIRTSTARSQVSIPGGNRSEHQPYAAMDGDPTTSWQSA
FT                   PYSRGDRQWIEVGLENPTNITTVELSFDLTADVVPTTVTVTAGYESRTVESFGDRMIFE
FT                   LEGIHATQRIRISIDDTFTLRPFGSGVVGISEISIPGVQTSRTLRLPDAPATEQPPAVV
FT                   VSADPRTPACFMVDGKPRCSTNAIRGSEDGRTIDRTLTLPAAGTYDPQLWAQPMDGSAL
FT                   HAALDQAVTDAQALGLAPEVSASSTGVPHPSRRPGAVLDGDPATSWSPAISDDAPILRL
FT                   TWFKPQVISGLRFAVDPAVAATRLGSVRVIANDGIRGGLLRDDGVLMLDPPARTNEITI
FT                   QFLDPPSATSIDPYGLRLPEPLPIAVGEITVLPGAPTSPADLDTPLTLGCGSGPTLTIG
FT                   EETVTTALRGTVRDLLELREVPAELCGTDTELPLGAAEHRLVAAASQFATPTRVALVPQ
FT                   QRTDVMTPSALDVTAWEATERRVQVAEHAVERVLAVRENTNRGWQATLAGEPLRPVVVD
FT                   GWQQGWLLPAGAAGEVVLRFTPDGPYQVALLTGGALLLGVTLLALLPERRGSAPARPAR
FT                   RARRRATRSLPLLAVGAIALILLGGLVGGVLVAAGVLLALPGSLRMPRSAAPHWVRLVP
FT                   RFVESWLPAALVLLAGWTYLEATQRHTAALPQLLMVLALGCLWLSTCLRHRPVHRAPPH
FT                   PAKPPSAADVPRQSGGGVAGATSWRDSDPSGFV"
FT   gene            219236..221071
FT                   /locus_tag="Strop_0190"
FT   CDS_pept        219236..221071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52675"
FT                   /db_xref="GOA:A4X1C5"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C5"
FT                   /protein_id="ABP52675.1"
FT                   /translation="MPAEPKAFARRFRLDRVGAVAVALIVVSVAWRAGLAARGWFSQDE
FT                   FVLAAQALDARLDADFLLQTVNDSLMPGGLLTAWLMVRLAGFASWPWVLMLAVGQAAVG
FT                   VAVYRLLRDLLRPGWGLLVPLALFLFSPLTLEVSSLWLVGLLVLPMQLALVLAVRAQVR
FT                   YVRTGRLGHLATVALWLLFGLLFDPKALLIAPLLFLLTVFLFSDGSPWRSLVTVVRRHW
FT                   RGWLLLTLLSGAYLAFYLTRPARALDQLTSPGQAFTFLGDLVGATVVPGLLGGPWRWTY
FT                   AGDGPPLVDPYPVAMWLSWLVLATLVVVTVRRRRSAVRAWLLLACYVGLVAALFAVTHV
FT                   GGVLGPMVGTVPRFVADVVPVAAICVGVALFGLRDDGERARYAARPLPGVPRALGSITV
FT                   GRVVTIAVLVAVGTGAVWSTVRFGENWSTKHGREYLTTAQAELAAAPADTVFLDAVVPD
FT                   RVVAGYFWPDNRQSHFFRPAERRPEFVEVAELPVTFDEEGRIRPVRIEGVTVLPGPVPD
FT                   CGHRVESGQTTQIPLETRVEQWPHVVEFGYLSSGDATATMRLGEATREITVRRGLNQLY
FT                   FPLPGAGETIEVTLSTPDVALCTKLITVGRVVPAS"
FT   gene            221072..222823
FT                   /locus_tag="Strop_0191"
FT   CDS_pept        221072..222823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52676"
FT                   /db_xref="GOA:A4X1C6"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C6"
FT                   /protein_id="ABP52676.1"
FT                   /translation="MVDRPADRARVVRDRLLLYTVATAVTAVVLAPLAAPGYVLLYDMV
FT                   FVPRQPLTWDLVAPVQGLPRAVPMDAVVSVLTQLVPGWVVQRIALGGAVLLAAVGAGRL
FT                   VPTERPGVRLLAAVGYAWTPYLAERLLIGQWGLLVGYAALPWLVRAVLELRSGRAGAVA
FT                   RVLLAAAPAAITPTGGLIAFGVVSLLAPQRGRWRGSTVAVAGVALLNAPWVTAALVTDA
FT                   GGSSDPAGVAAFAARGENWAGPLAALAGTGGIWSAQATPASRALPLVPLVTLVLLALAG
FT                   FGFGLLRRRIPRDASARLLVLAGGGFLLAALGAVPGTADVLRWAVAQLPGAGLLRDGQK
FT                   FLAPYALLLVVCVALGAERVAARMERRNREVAGVVLVGVLLLPVAAMPDLAFGGVGRLW
FT                   PVSYPADWRVVAARLAADPGGEVLALPLSGYRAYPWNSGRIVLDPAPRYLPAVVLIDDT
FT                   LRVGDVAVTGENTRLREIRQVLGAGRPVAETGVRWVLVQQHRADQVDPVTLAGLEVVHQ
FT                   GTYLVLYRNPAVPPSPVVVSPARWAVAVALVVAIVVVVAAFLRRYAGGLLRGNLRSEVQ
FT                   TLEDWHA"
FT   gene            222816..223010
FT                   /locus_tag="Strop_0192"
FT   CDS_pept        222816..223010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52677"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C7"
FT                   /protein_id="ABP52677.1"
FT                   /translation="MRKALTLVVTGLVAAMLGILSVGGLAAATTATEEEAAVKAQELIE
FT                   KAKQANERDPYAPEIYGSR"
FT   sig_peptide     222816..222899
FT                   /locus_tag="Strop_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.581 at
FT                   residue 28"
FT   gene            complement(222995..224191)
FT                   /locus_tag="Strop_0193"
FT   CDS_pept        complement(222995..224191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0193"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52678"
FT                   /db_xref="GOA:A4X1C8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C8"
FT                   /protein_id="ABP52678.1"
FT                   /translation="MERFPATAGHVLFLNWRDTRNPEGGGSEVYVERIAAELVARGFRV
FT                   TLFCAAHRRGRPEEVNDDGVRLIRRGGRHTVYLWAALCYLAGALGFGPLSRRHGPRPKV
FT                   LVDVCNGLPFMTPLWARRPIIKLIHHIHREQWCVVLPPWAARFGWWVESSFAIRAYRRC
FT                   HHVTVSEATRQELVQLGVPAGQVSVVHNGTPPLPHTDAERAPSPLLVTLNRLVPHKRVE
FT                   VALRAVATLADELPQLRLVVAGQGWWEGRLREVANDLGITGRVEFRGFVTEEEKATLLA
FT                   SAWVALTPSLKEGWGLTIVEAGSAGTPTVAFRSAGGVGEAVVDGQTGLLADDIDDYVAK
FT                   VRSLLHNAELRHQLGAAAREHAANFTWPAAGSHFAAVLESVESPRHPDSRGAPSYLLP"
FT   gene            complement(224272..225483)
FT                   /locus_tag="Strop_0194"
FT   CDS_pept        complement(224272..225483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0194"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52679"
FT                   /db_xref="GOA:A4X1C9"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1C9"
FT                   /protein_id="ABP52679.1"
FT                   /translation="MSAPATPSSSHPPTTVRLPALDALRAIGSVAVVAHHVGFHTGVSL
FT                   NSQWGTWLARMDVGVAIFFVLSGFLLFRPWASSVAAGRPRPGVRRYFWRRALRILPAYW
FT                   LTVSVCLIVLPQNRPASAGDWLRHLTFTQIYQPDQLRAGLGQTWSLATEVVFYLVLPLV
FT                   AVLAVGRTWRPVRTLVIAAGGTLMTAGWLILMGFGVIDTAVHTMWLPSYAAWFCGGMVL
FT                   AVAHVALQTGTGPAALRVLDDLAAAPVACWSAAAGLLAIATTPIAGPLDLAEPTAAEFA
FT                   VKLTLYLAVGILIMIPVAFGERKTRVHQAFGSASARWLGLVSYGLFLWHPLVIEMIYLV
FT                   GDRPLFTGDLLETFALTMAGGLAFAAASYYGIERPIQSLGDRRRSRPTTPRAGDRATAV
FT                   NSPH"
FT   gene            225598..226650
FT                   /locus_tag="Strop_0195"
FT   CDS_pept        225598..226650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52680"
FT                   /db_xref="GOA:A4X1D0"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D0"
FT                   /protein_id="ABP52680.1"
FT                   /translation="MKLRVSAALFGLGVLLLVFAVGLPLYVAPAISKLPYDLKPTTLVA
FT                   EANNARFLQITADSETVTVEVPRATLRSTIEVLPQPGDTKDRLPDQLKGDAVIWDVYQT
FT                   VVRSDTQDPITMYSTQLALYRVSAEAAPWDDQWLKQDDSDETPRGNVSYSGLIYKFPFG
FT                   AEKKDYPVFDRDLKEAIPATFVGTETVEGVEVYRYEQRIENRVLDTPEESLQVLLSTFA
FT                   PGSTTGEIVYSNTRTYWVDPVTGAWVDVREQQRKELRPDVGSTTVLLDADFNYTDDTVN
FT                   NSVESVKTNRLKIGLARLWGPIAAGVLGLIALAVGLRLFLQTGGAAGRHAAAAPAAGGP
FT                   ATGKEDQDSS"
FT   sig_peptide     225598..225660
FT                   /locus_tag="Strop_0195"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.526 at
FT                   residue 21"
FT   gene            complement(226809..228479)
FT                   /locus_tag="Strop_0196"
FT   CDS_pept        complement(226809..228479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0196"
FT                   /product="protein of unknown function DUF885"
FT                   /note="PFAM: protein of unknown function DUF885"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52681"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D1"
FT                   /protein_id="ABP52681.1"
FT                   /translation="MGRIDDIANRYVAEWAALSPTGATYVGITGHDDRLDDLSPDGYAA
FT                   RADLNRRVLADLDGVEPQSPAEQTAKDAMQERLSLELARYAAGEVGRGVNVITSGLHEL
FT                   RSVFDLMPTDGEEAQANIAARLGHFAEALGQYQTTLREAAAAGQSSARAQLLEVAKQCD
FT                   TWVDPDGDNFFHGLVERLGAGGALDAELRRGAATATAATAEFGRFLRTELAPQGRAKQA
FT                   AGREHYELASQYFLGARVDLDETYAWGFEELARLETEMRAVATRIVGPGATVDEAVAAL
FT                   DADGTRTIRGKEAFRDWMQELADKAISELHGTHFDIPEQVHQIECCLAPTSDGAIYYTG
FT                   PSEDFSRPGRMWWAVPQGIDDFSTWREVTTVYHEGVPGHHLQVAQTVLRAETLNRWQRL
FT                   LCWVSGHGEGWALYAERLMEELGYLEDPGDRLGMLDGQALRAARVIVDIGMHLELEIPA
FT                   DNPFGFHPGERWTPELGWEFMRAHCRVSDEVLRFELNRYLGWPGQAPSYKVGERIWLQA
FT                   RADAKARRGAEFDLREFHRQALDLGSLGLDPLRRALARI"
FT   gene            228612..229682
FT                   /locus_tag="Strop_0197"
FT   CDS_pept        228612..229682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0197"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52682"
FT                   /db_xref="GOA:A4X1D2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D2"
FT                   /protein_id="ABP52682.1"
FT                   /translation="MPGYLALAAIWGSSFLFIKIGVRELHPLHLTLYRVGAGALTLLIL
FT                   LVALRDRLPREPRVWAHLVVTGGIGVALPFTLFGYGGERVESMLSGIWNATTPLVVLPM
FT                   AVLVFRTERITAARAVGLGLGFLGVLVVLGVWQGAGGSHFVGQLMCFGAAACYGVVIPY
FT                   QKKFVAGRSYSGLALSAAQLLMALALLTIVTPFVAGVPPMPTALSGSVLASMVALGALG
FT                   TGLAFLIHFRNIRVAGASTAATVTYVIPVFAVLAGALVLDERLTWHQPVGAVVVLLGVA
FT                   VTQGLIGPRRRPRAVALPTSAAGTSASAAGVPATADQELLPAHATSRSAGQALTTRSAG
FT                   TPQRAARSQPNRCQSS"
FT   gene            complement(229562..230632)
FT                   /locus_tag="Strop_0198"
FT   CDS_pept        complement(229562..230632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0198"
FT                   /product="PHP C-terminal domain protein"
FT                   /note="PFAM: PHP C-terminal domain protein; SMART:
FT                   phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52683"
FT                   /db_xref="GOA:A4X1D3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR017078"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D3"
FT                   /protein_id="ABP52683.1"
FT                   /translation="MTARDPIADLRRIAFLLERANEATYRVRAFRSAAKAVAALPTAEV
FT                   AELARIGKLTGLSGVGEVTARCVAESLAGEEPVYLRRLAATEGTDLDAEATALRAALRG
FT                   DCHIHSDWSDGGSSIEEMALTAVELGHEYLVLTDHSPRLKVARGLTADRLRRQLEQVAR
FT                   LNEALPTGFRILTGIEVDILADGSLDQDEELLAQLDVVVGSVHSGLSDERGRMTRRMLT
FT                   AIGNPHLDILGHCTGRMVSTRPAGVTGPGDRGHRRRARGESDFDADAVFAACAQRGVAV
FT                   EINSRPERQDPPKRLIRRALEAGCQFAINTDAHAPGQLDWQRFGCERAARCGVPADRVV
FT                   NAWPAERLVAWAGSSS"
FT   gene            complement(230664..231404)
FT                   /locus_tag="Strop_0199"
FT   CDS_pept        complement(230664..231404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0199"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52684"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D4"
FT                   /protein_id="ABP52684.1"
FT                   /translation="MPAPLTGRRPGYPLLLLLAAMLAASCATTRPGVDTGTASRPAATD
FT                   PATAPSASSTPTAATAPPSASGTSPGTPPAEVRHVFPVRASNAAYHPTHSIYPATDIFA
FT                   DCGVPVVAVTDGSVLEVSRVDRFDRGGPLGPFNGGLSVAVLGDDGVRYYGSHLTEVAAG
FT                   LDPGVRVAAGQQLGTVGRTGNANNVCHLHFGISPPCPGKDGWWIRRGVVWPAPYLDAWR
FT                   RGINRSPAVEVADWQRRHGCPKES"
FT   sig_peptide     complement(231228..231404)
FT                   /locus_tag="Strop_0199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.165 at
FT                   residue 59"
FT   gene            231462..231824
FT                   /locus_tag="Strop_0200"
FT   CDS_pept        231462..231824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52685"
FT                   /db_xref="GOA:A4X1D5"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D5"
FT                   /protein_id="ABP52685.1"
FT                   /translation="MTDPYDGARPRNPSGLFPAGAPARPTYREPHPIHGAAVVLGGGVA
FT                   TMWLLLFGLLGAGVRGYAWWTVLAGGLAWLVALLLVRHGDRGVATGVAIVVGGGWSIAA
FT                   AVVANRWMASGDWPLW"
FT   gene            232139..232663
FT                   /locus_tag="Strop_0201"
FT   CDS_pept        232139..232663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52686"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D6"
FT                   /protein_id="ABP52686.1"
FT                   /translation="MSYFAAAVVRDESGWTAAEVNLRGAVDVDGVADRLRDVDPGADLS
FT                   LLFVEAEDEYLVILRLDEGEDLRVFGSDSAYAEETQLGALLVGDLKASVTGLDETEEPR
FT                   AAGGDPESEQPAADPEADPVGDADLLADLGVSGTKLVALCGHEGMLPADVTTEACMVLG
FT                   CADEVEELREV"
FT   gene            232734..233195
FT                   /locus_tag="Strop_0202"
FT   CDS_pept        232734..233195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0202"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52687"
FT                   /db_xref="GOA:A4X1D7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D7"
FT                   /protein_id="ABP52687.1"
FT                   /translation="MRRALEVAVTGAETTITAADDIPVPAADDIPVGALLLGPDGAELA
FT                   TGRNERELTGDPTAHAEVLALRRAAGRLGRWRLDGCTLVVTLEPCTMCAGALVLARVST
FT                   VVFGAWEPKTGAAGSLWDVLRDRRLNHRPEVYGGVLETETAAVLRAFFR"
FT   gene            complement(233303..234010)
FT                   /locus_tag="Strop_0203"
FT   CDS_pept        complement(233303..234010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0203"
FT                   /product="purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="TIGRFAM: purine nucleoside phosphorylase; PFAM:
FT                   purine or other phosphorylase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52688"
FT                   /db_xref="GOA:A4X1D8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D8"
FT                   /protein_id="ABP52688.1"
FT                   /translation="MSTHIGAKPGEIAERVLMPGDPLRAKWIAETYLEGAQCYSTVRGM
FT                   LGFTGRWNGVEVSIQGSGMGMPSASIYAHELINEYGVRSLIRVGSCGALTEDLQLRDVV
FT                   AAIGSSTDSNMNRVRFDGLIDYAPVADFGLLRTSVEVAEQRGVTMRVGPVLAADAFYTD
FT                   RPDLYDSLANYGVLAVEMESAALYTIAARFRARALTILTVSDHIRTGEKVTSQEREQTF
FT                   SQMVEIALDTIIA"
FT   gene            234086..234172
FT                   /locus_tag="Strop_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            234086..234172
FT                   /locus_tag="Strop_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(234505..235521)
FT                   /locus_tag="Strop_0204"
FT   CDS_pept        complement(234505..235521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0204"
FT                   /product="O-methyltransferase, family 2"
FT                   /note="PFAM: O-methyltransferase, family 2;
FT                   Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52689"
FT                   /db_xref="GOA:A4X1D9"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031725"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1D9"
FT                   /protein_id="ABP52689.1"
FT                   /translation="MITPTPLMQLVAGVWGFKTLAVGIEFGLFTRLAGGRAITVTEAAA
FT                   EFGMDERPADLLLAASASLGLLEKAGAGYRNSELAEQFLVEGRPYYFGAQIRYSDLRTY
FT                   LPWHRIGEALRSNRPLTWDPQQQQSMFDTNDPKMVAEFWDAMFSTSRFTAHALADAYDF
FT                   GAHHRLLDVGGGAGAFPIELCQRLPQLRATILDLPHVCARAEERIADADLTGRIGTVAG
FT                   DFLADPTLPDGHDVILLSMIMHDWDEATNRALLARCHAALPSGGAIVISELLLNEERTG
FT                   PPEAALMGMNMLVETEGGKNYSGAEYAIWLDDAGFVDARVVAFDAPGANGAVVARRP"
FT   gene            235592..235999
FT                   /locus_tag="Strop_0205"
FT   CDS_pept        235592..235999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0205"
FT                   /product="protein of unknown function DUF307"
FT                   /note="PFAM: protein of unknown function DUF307"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52690"
FT                   /db_xref="GOA:A4X1E0"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E0"
FT                   /protein_id="ABP52690.1"
FT                   /translation="MADVRHPGSMIRLVLNVLWLIFGGGIVLAFGYFVAALICFVLVVT
FT                   IPFGVASLRLASYSLWPFGRTLVTKPGAGVASGLANVLWVLLAGWWLALSHLVAGVSLC
FT                   ITIIGIPFGIANFKLVPAAFWPLGQEVIEVR"
FT   gene            complement(235983..236594)
FT                   /locus_tag="Strop_0206"
FT   CDS_pept        complement(235983..236594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52691"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E1"
FT                   /protein_id="ABP52691.1"
FT                   /translation="MSYQLSAIIADAGLLHRETRGLDHAVLGNLRQDFALLPVTSQLVE
FT                   ELTGTLPDYAVEEPSLEQPFTLVLSTALTETLAHWSRRGPVAYVEAEFAGGVGHQAAAV
FT                   WLGGQRSWGPHVDSMFDGSRGQWPINAALVEVGVEPGQWVDLFAELGLHVERNTAGWLA
FT                   HGRRGLGVDYWDELVEEWERREAESSQPPEPGGFRFSGPR"
FT   gene            complement(236756..237049)
FT                   /locus_tag="Strop_0207"
FT   CDS_pept        complement(236756..237049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52692"
FT                   /db_xref="GOA:A4X1E2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E2"
FT                   /protein_id="ABP52692.1"
FT                   /translation="MLAVTAQLWAAILVIVITSGSFAVLNVTVVSLRQRLVPRDLLGRT
FT                   IAAGRTLSFSAAAAGALLGGVLTATIGIEAPFIFSALIAAMATTAWWLASRP"
FT   gene            complement(237091..237960)
FT                   /locus_tag="Strop_0208"
FT   CDS_pept        complement(237091..237960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52693"
FT                   /db_xref="GOA:A4X1E3"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E3"
FT                   /protein_id="ABP52693.1"
FT                   /translation="MPFMVTSSVPLGRPFWTFWSAATLANVGDGIRLAAFPLLAASLTA
FT                   NPVGVAAVTAAQALPWLVTGLLAGSLADRRGARTLLAQADLARVVVLGVLVVAVATGWA
FT                   SLPLVLLASFLLGIGETVRDTAAQTALPGLVPERLLERANGKLVAGEIVGNEFVGPPVG
FT                   AALFVAGAALPFAANGASLALAVMLLLTLPISVAARPPQGTPKQASPGVVAGLRWLARH
FT                   RVLRTLALVTAAVAAADSAWFAILVLYAESRLSVGATGFGILLAAGALGGLLGSSVVDR
FT                   LVAGTGTA"
FT   gene            complement(238018..238929)
FT                   /locus_tag="Strop_0209"
FT   CDS_pept        complement(238018..238929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0209"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52694"
FT                   /db_xref="GOA:A4X1E4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E4"
FT                   /protein_id="ABP52694.1"
FT                   /translation="MTPGDNEITAQLVRDLVRDQHPDLAEHPIRLGARGWDNQLWRLGD
FT                   DLAVRLPWATVSADALLHKEHAWVPTLAPRLPLPIPIPQRLGVPSKRFPRSWLITTWVP
FT                   GTPADRAPVTRAFDAARSLATFLTALHQPAPNEAPVSRDRGGLLVDQTEQFAEALSAAT
FT                   ERGLIDEPAAVRAVWHDAVAAPPWTGPPLWLHADLHPANVLTADGTLCGVIDFGDLCAG
FT                   DPAYDLAAAWLLLPDGIDHVHEAYEPAPDPATLRRARGWATARALHGILIGDNGVHGRP
FT                   GGKPSWGPPAHTALRRLTATVR"
FT   gene            complement(239041..240423)
FT                   /locus_tag="Strop_0210"
FT   CDS_pept        complement(239041..240423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52695"
FT                   /db_xref="GOA:A4X1E5"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E5"
FT                   /protein_id="ABP52695.1"
FT                   /translation="MSHQEQPDTDRSGGGRAKSRWWAVGVTGLALTTAGVAAAAPAANA
FT                   VERTRTTVADRLFTDEHRDKRDGGKPDDKSKGDPGKTGKKSPGTPVSCDADALIAAITL
FT                   SNARGGGVLDLAGNCTYLLTASIDDAGLPAISSPITLNGGEHTTIERAAAVDQFRILNV
FT                   EAGGHLTLNHLTVTGGQTTDPGADGAGILVAAGGSLTTNHSTITRNIAGAGSGGGIANS
FT                   GTARIRSSKVSHNTAATTGGGILNSGLLEVSKAGIHANTALNGAGVASSETVRIEHSSI
FT                   SKNRAQVAFGGLLIDSGTAVVADSSVTHNIATGVVGGIIASVGTQVTIRSTTIADNVSL
FT                   TTISGGLGVDSNASVVVTDSIIKNNSAGTNGGGIYTISELVLRNTKIFGNQAGSQGGGI
FT                   YNEPLGTLTLFASKVTKNIAATDGGGIYNEAGGTVNLNTATGTVVVKNRPNNCVDVPGC
FT                   AG"
FT   sig_peptide     complement(240286..240423)
FT                   /locus_tag="Strop_0210"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.767) with cleavage site probability 0.633 at
FT                   residue 46"
FT   gene            complement(240617..241417)
FT                   /locus_tag="Strop_0211"
FT   CDS_pept        complement(240617..241417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0211"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52696"
FT                   /db_xref="GOA:A4X1E6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E6"
FT                   /protein_id="ABP52696.1"
FT                   /translation="MRRGREGLPRQRGYVTLLKGDRCESEQTGDMTDGVEPQPQYDGFA
FT                   DEFLDHARDSLYNAHYDRPTCLRLLGEVAGRTVLDVACGPGLYAEELVARGARVIGLDQ
FT                   SPRMVHLCRERVPSGVFHVHDLAERLHWLPDESVDLVLFALALEYVDDRRSTLRELRRV
FT                   LRPDGALVLSRLHPTGDWLRHGGSYFDERIVEETWSRGWQLRHWLLPLERTCEELHEAG
FT                   FLIERLLEPQPTAEAALVDQARYERLLREPIGFLAIRALPAPVR"
FT   gene            241433..241852
FT                   /locus_tag="Strop_0212"
FT   CDS_pept        241433..241852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52697"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E7"
FT                   /protein_id="ABP52697.1"
FT                   /translation="MPNRLSRRHQRQDGPARWHPRQRRSYPRQRGVLALTGAGILSRYC
FT                   RLWSGHRSLEHPVSDQKGPLVSISVNLDDVLDKAYESSALADLATAPVAALAGVSEADG
FT                   EALQKAFNIKTIADLAGNKYVRAAQAIVELSRISK"
FT   gene            complement(241999..242083)
FT                   /locus_tag="Strop_R0009"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(241999..242083)
FT                   /locus_tag="Strop_R0009"
FT                   /product="tRNA-Ser"
FT   gene            242420..244846
FT                   /locus_tag="Strop_0213"
FT   CDS_pept        242420..244846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0213"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52698"
FT                   /db_xref="GOA:A4X1E8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E8"
FT                   /protein_id="ABP52698.1"
FT                   /translation="MALALYRKYRPRTFAEVIGQEHVTEPLSQALRGGRLNHAYLFSGP
FT                   RGCGKTSSARILARSLNCEHGPTPEPCGTCASCRALATDGAGSIDVIEIDAASHGGVDD
FT                   ARELREKAFFAPAQSRFKIYVIDEAHMVSSAGFNALLKLVEEPPEYVKFIFATTEPEKV
FT                   LGTIKSRTHHYPFRLIPPKVLRPYLEQLCQAEGVQVEPAVFPLVVRAGGGSARDSLSVL
FT                   DQLIAGAGPEGVIYARAAALLGVTDSALIDEMCDALAAGDGAAAYATVDRIVGAGHDPR
FT                   RFAADLLERLRDLIILQRVPDAAPKGLVDGPDDQIERMTAQAQRLGPGTLSRCADIVHD
FT                   GLVEMRGATAPRLLLELICARLLLPRIDDSTGGLLQRLETLERRHTHAGADVPPAVPTP
FT                   ATGSSPAAAVPPAVPTPATGSSPAPAVPTPAAGAPPAPAVGSPPRPVGTAVSASMDGPA
FT                   VSDGPRRASPRPAVMPDPATPEPPRPGTTGQGPLDAAAVRRRWPEVVGLVGRKSKKAAA
FT                   WAREATVHEVDGQTLVLAFRYPFHAQALANEPDLLIESLHEELGERWQIRCEVAGERVG
FT                   GPAAGPRAAGPARPATAPARPDPAVAPAAPPRSSAGDGAVDGMAPRSAGSADEQEWPEP
FT                   ARPGGAAPPEPAAGTAEEWPATARPGGAGVDATAAAAAGPGGSTTGGGRASGAGVAPAA
FT                   SAVSRPPVTSGARASSAIAAARAAAAGGAQRSAASPRRTAEPDWAGEPPYDPDYDGVPR
FT                   GGAAPAVVHEGFDPGDEPLDEVIDERTARQSSEEQAVRLLREAFGAERIDEVKSR"
FT   gene            244878..245255
FT                   /locus_tag="Strop_0214"
FT   CDS_pept        244878..245255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0214"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52699"
FT                   /db_xref="GOA:A4X1E9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1E9"
FT                   /protein_id="ABP52699.1"
FT                   /translation="MSVRSKSSGKSKEPFVRPGGQPNMQQMLKQAQKMQQQIAKAQAEL
FT                   AEAELTGAAGGGLVTATVAGTGELKSVAIDPKAVDPEDVETLEDLVVAAVRNAAEAARE
FT                   LTDQKMGPVAGGMGGLGLPGF"
FT   gene            245263..245856
FT                   /locus_tag="Strop_0215"
FT   CDS_pept        245263..245856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0215"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: RecR
FT                   protein; TOPRIM domain protein; SMART: Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52700"
FT                   /db_xref="GOA:A4X1F0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F0"
FT                   /protein_id="ABP52700.1"
FT                   /translation="MYEGAIQDLIDELGRLPGVGPKSAQRIAFHVLSADPADVNRLAGA
FT                   LRKVKELVRFCTSCYNVAESEQCRICRDPRRTDEVLCVVEEPKDVVAIERTGEFRGRYH
FT                   VLGGAINPLEGIGPDNLRVRELLTRLGGGAVRELILATDPNTEGEATATYLALMVKPMG
FT                   IAVTRLASGLPVGGDLEYADEITLGRAFEGRRTV"
FT   gene            246131..247792
FT                   /locus_tag="Strop_0216"
FT   CDS_pept        246131..247792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0216"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52701"
FT                   /db_xref="GOA:A4X1F1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F1"
FT                   /protein_id="ABP52701.1"
FT                   /translation="MRASRPKVAVAAVAVAALAVAGCAESDREDSGGSNNDTLVFGVAG
FT                   DPKVLDPSFASDGESLRVARQVFETLVRPEEGGTKVSPGLAESWTPDEAGTTWTFKLRS
FT                   GVKFHDGTDFDAEAVCVNFNRWYNATGLMQSPDVTAYWQDVMGGFAQNEDEGLSESLFK
FT                   SCTAKDATTVDLTFTRVSSKIPAALMLPSFSIHSPTALEQYDASNVGGTATDVQYPEYA
FT                   TAHPTGTGPFKFKSWDIANKSLTIERNDDYWGEKAKLKTLIFRTIPDENARKQALSSGD
FT                   IQGYDLVGPADVEPLKGEGFNVLTRPAFNILYLGMNQQGNPKLADLKVRQAIAHAINRQ
FT                   ALVDSKLPPGAKVATNFFPDTVEGWNGDVTTYDYDVDKAKQLLAEADATDLTLRFHYPT
FT                   EVTRPYMPNPKDLFELVSADLQAAGITVEPIPLKWSPDYLNATTSGSEHDLHFLGWTGD
FT                   YGDAYNFIGTFFDRQKDEWGFDNPALFEQFQDADSTADMASRVEKYKGLNKTIMDFLPG
FT                   VPISHSPPAIVFGKDVTGIKASPLTDERFAKAEFTS"
FT   sig_peptide     246131..246205
FT                   /locus_tag="Strop_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.582 at
FT                   residue 25"
FT   gene            247867..248871
FT                   /locus_tag="Strop_0217"
FT   CDS_pept        247867..248871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0217"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52702"
FT                   /db_xref="GOA:A4X1F2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F2"
FT                   /protein_id="ABP52702.1"
FT                   /translation="MFRFIVRRLLQLIPTLFGLSLLLFIWVRRLPGGPEDAILGERGTP
FT                   EMRAAIRRSMGLDEPILVQYGRFVQRLLRLDLGTSSSTKRPVVEEFLERFPGTVELTIT
FT                   ALVIAIGVGIPLGYLAARRRGRLLDHLSVGGSLVGICVPIFFLAYVLKAIFSENLGWFP
FT                   SSGRQDPTLDATRVTNFFVLDGLMTREWDAAMDALWHLVLPGLALASIPLAIIVRITRA
FT                   SVLEVLNEDFVRTAEAKGLTERTVRGRHVLRNSLLPVVTSIGLLTGGLLSGAVLTETVF
FT                   AFSGIGAFIYEAIGQRDYPVLLGFIMIISVVYVLVNLLVDLSYSLIDPRVRVR"
FT   sig_peptide     247867..247980
FT                   /locus_tag="Strop_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.778) with cleavage site probability 0.533 at
FT                   residue 38"
FT   gene            248868..249830
FT                   /locus_tag="Strop_0218"
FT   CDS_pept        248868..249830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0218"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52703"
FT                   /db_xref="GOA:A4X1F3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F3"
FT                   /protein_id="ABP52703.1"
FT                   /translation="MTITGKKERLDRLAELVNRDDERGVSLWQEAFRRLRRNPAAIIGA
FT                   IILAIFVLVALIGPFFVPYEPKDTIGIREGLVKSGQGIIPGASAEHWFGYDHQGRDVFS
FT                   RMIVGARQTLLVGVVATLIGLAVGALIGGVAGAAAGLGGRWGRAVDNVLMRVIDMMLAL
FT                   PSLLLAVSIAALLGASLQTVMIAVGMVSVPVFARLLRVSMIAQANSDYVLAATSLGVRK
FT                   PKIALTHILPNSLAPVIVQATLTLATAIIEAAALSFLGLGNPDTAQPEWGVMLADAQPY
FT                   LGIRPALAIFPAVAIIITALGFTLLGEAMREALDPKLRK"
FT   gene            249898..250956
FT                   /locus_tag="Strop_0219"
FT   CDS_pept        249898..250956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0219"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52704"
FT                   /db_xref="GOA:A4X1F4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F4"
FT                   /protein_id="ABP52704.1"
FT                   /translation="MALLDVDDLSVTFARRGQRTVHAVDGVSFSVDAGEVVGLVGESGC
FT                   GKSVTSLALMGLLPRQPGTRIGGKAVFDGTDLLGLDDRARRDIRGRDVAMIFQDPLSSL
FT                   NPVIPIGLQVTEVLARHRGLTGAAAREEAVGLLDRVGIPDPDRRLKEYPHQLSGGMRQR
FT                   ALIAMAVACRPRLLIADEPTTALDVTIQAQILELLKELVQESGTALVMITHDLGVVAGM
FT                   CDSINVLYAGRVVETARRRPLFRTPRHPYTAGLLGSVPRLDSGRGEPLNPIPGSVRDVL
FT                   SWSEGCAFAPRCSRRVDACLDETPPLVRTHDGRSYRCVDPVPLPGVVPAQAGRSGQPGA
FT                   PSPERNEEETRD"
FT   gene            250949..252064
FT                   /locus_tag="Strop_0220"
FT   CDS_pept        250949..252064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0220"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52705"
FT                   /db_xref="GOA:A4X1F5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F5"
FT                   /protein_id="ABP52705.1"
FT                   /translation="MTDNDVLVEVRDLKVHFPIKRGVLFDRTIGHVKAVDGVDLRIPRG
FT                   QTYGLVGESGCGKSTLGRALLQLTTPTGGEVVFDGVELTTLPPARLRAMRRRMQMIFQD
FT                   PMSSLDPRQNVESILTEGLQTHGIGGNRDERRAIIGEALDKVGLPRWALSRYPHEFSGG
FT                   QRQRIGIARAVVLGPELIVADEPVSALDVSIQAQVVNLLDELQESLGLTYLVIAHDLAV
FT                   VRHISDTVGVMYLGALVEEAPSDRLYTEPLHPYTRALMSAVPVPDPDVEDRRERILLAG
FT                   DLPSPANPPAGCRFHTRCPWAQPTRCTDERPVLRDIGGSRVACHWAERIASGELRPHNA
FT                   GARVARASSGGETPEPVSIPAPTGKADSADA"
FT   gene            complement(252120..252581)
FT                   /locus_tag="Strop_0221"
FT   CDS_pept        complement(252120..252581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52706"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F6"
FT                   /protein_id="ABP52706.1"
FT                   /translation="MTSTGTGPTPNRPPGADDSATASTSDPAPGSAGMTADGAASAAVP
FT                   GAGMSAETTGAPAGATPGSGMRADGGSRVRTAEIVPGPGGVMTDEVGVITGELTLRTEY
FT                   LDGQVALRVQYREADEWYVVTGGRATLPDPAGLDAVHAIAVALLDRPDG"
FT   gene            complement(252578..253327)
FT                   /locus_tag="Strop_0222"
FT   CDS_pept        complement(252578..253327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52707"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F7"
FT                   /protein_id="ABP52707.1"
FT                   /translation="MPKSAPTRSRSGYETPKPPSQILCGAARNRQAKEVSLRTRSAPLL
FT                   ATALALGLAGCVPATTPDPTPTSAGGNAMEKLAELTVASAGSMKGYSRDRFPHWRGTGK
FT                   NCDVRDTVLARDGESIKLSGCNVVGGRWESVYDGLVLTDPSEVDVDHMVPLANAWRSGA
FT                   DGWTDTKRGDFANDTRLPHLFAVSRTANRSKGDQDPSQWRPANRSYWCRYAESWVTVKH
FT                   HWQLSVHTDEKTALADMLAGCTGASRP"
FT   gene            253327..254829
FT                   /locus_tag="Strop_0223"
FT   CDS_pept        253327..254829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0223"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52708"
FT                   /db_xref="GOA:A4X1F8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F8"
FT                   /protein_id="ABP52708.1"
FT                   /translation="MTPPSLRLGTPAGAGTLLAAVLASGMVFLDGTVVNVALPRLGDEL
FT                   DATVSDLQWTVNGYLLMLAAFVLLGGALGDRFGRRRVFLLGVVWFTVASVLCGLAQDTG
FT                   QLIAARLLQGAGAALLTPGSLSVLQASFHPDDRGRAIGAWAGFSGVSTALGPFVGGWLI
FT                   DEFSWRWIFFLNVPLAALVVLAALRWVPESRDESVSRTRTEGAGRRRFDVLGTVLGAVA
FT                   LAGITFALIDAPARGATSRVVLLAAAAGVLGSVAFVLVERHRGETAMLPTGLFTSRLFS
FT                   VLNVFTVVIYAALSGFTFFVAVFLQNVAGWSALGTGVALLPVTVLLLVGSPVAGDLATR
FT                   IGPRLPLTVGPVVSAIGLLLLREVGAEASYWRDVLPGVFLFGLGLAMVVAPLTASVLAA
FT                   VEDRFAGVASGFNNAASRAGGLLAVAALPLLVGLSGTEYERPDELTAAYRGALAWCAAL
FT                   LLMGAVLAVVFVRRPRRAPPPSQPCQSLPAATGPEKGAETTS"
FT   sig_peptide     253327..253398
FT                   /locus_tag="Strop_0223"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.759) with cleavage site probability 0.366 at
FT                   residue 24"
FT   gene            complement(254897..256651)
FT                   /locus_tag="Strop_0224"
FT   CDS_pept        complement(254897..256651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0224"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52709"
FT                   /db_xref="GOA:A4X1F9"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1F9"
FT                   /protein_id="ABP52709.1"
FT                   /translation="MAHPAVTPDAETNPIARQRPSRMPYHRYQPYQRQFHTDLPDRSWP
FT                   TRHVEAAPRWCAVDLRDGNQALIDPMSPERKRRMFQLLVQLGYKEIEVGFPSASQSDYD
FT                   FVRQLIEQDLIPDDVTIQVLTQCREHLIDRTFAALRGAKRAIVHFYNSTSTLQRQVVFG
FT                   LDRDGITDIATTGARLCQKYAEIHTPDTDIHYEYSPESYTGTELDYAVEVCTKVIEVLD
FT                   PTPDHRLIVNLPATVEMAMPNVYADSIEWMHRHLPRRDSLVLSLHPHNDRGTGVAAAEL
FT                   GLLAGADRIEGCLFGNGERTGNVDLVTLGLNLFSQGIDPMIDFSNIDEVKRAVEYCNQL
FT                   PVHERHPYAGDLVYTAFSGSHQDAINKGFDALAASAETAGVPVEQHPWAVPYLPIDPKD
FT                   LGRTYEAVIRVNSQSGKGGVAYIMKTEHQLDLPRRLQIEFSGVVQQVTDDNGGEVDPQT
FT                   MWEIFAGQYLLDHQANPAVTLTDYTIGTVDGKVEFEALVGHGGGQHAVTAIGNGPVDAY
FT                   VNALQSLGINVRVLDYHEHALSSGGDAQAAAYVESKVDGRTVWGVGVDANIVTATIRAV
FT                   TSAVNRAH"
FT   gene            complement(256817..257419)
FT                   /locus_tag="Strop_0225"
FT   CDS_pept        complement(256817..257419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0225"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52710"
FT                   /db_xref="GOA:A4X1G0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G0"
FT                   /protein_id="ABP52710.1"
FT                   /translation="MTDLTPLIAFRWSPRSFDPDADLGPTEVDLLLEAARWAPSAANRQ
FT                   PWRFALGHRDDETWKRIMVNLPERDQRWAGRASLLLLAAHLAPATEPAEETAYDLGHAV
FT                   AQLTTQATALGLHTRQLHELDRTGLATELELPADLRPATVVAIGRLGDPLNLPADLIEA
FT                   ETGLRRRRPVADLLLVSPAATPISQYGRSFPDPVHAT"
FT   gene            257654..258919
FT                   /locus_tag="Strop_0226"
FT   CDS_pept        257654..258919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0226"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52711"
FT                   /db_xref="GOA:A4X1G1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G1"
FT                   /protein_id="ABP52711.1"
FT                   /translation="MALVVQKYGGSSVDNAERIKRVAERIVAARKAGDDVVVVVSAMGD
FT                   TTDELTDLANQVSPLPPGRELDMLLTAGERISMALLAMAIHNLGYEARSFTGSQAGVIT
FT                   TSVHGRARIIDVTPGRLKGALDEGAVVIVAGFQGVSQDTKDVTTLGRGGSDTTAVALAA
FT                   ALNADVCEIYSDVDGVFSADPRIVPDARHIRQITYEEMLELAACGAKILHLRSVEYARR
FT                   AGLPVHVRSSYSTNTGTMVTGSMEDLPVEQALITGVAHDRSEAKITIVGVPDEPGAAAW
FT                   IFDTVAGAEINIDMIVQNVSTEGTGRTDISFTLPKTDGPTAMAALSKIQDSVKFKGLLY
FT                   DDHVGKVSLIGAGMRSHPGVAAGFFAALGQAGVNIEMISTSEIRVSVVCRDTDLDDAVR
FT                   AIHDAFELGGDTEAVVYAGTGR"
FT   gene            258923..259984
FT                   /locus_tag="Strop_0227"
FT   CDS_pept        258923..259984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0227"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding; Semialdehyde
FT                   dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52712"
FT                   /db_xref="GOA:A4X1G2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G2"
FT                   /protein_id="ABP52712.1"
FT                   /translation="MASQPTLAVVGATGAVGTVLCELLTGRRNVWGEIRLVASARSVGQ
FT                   TVRCRGEELTVQALTPEVFDGVDVAMFDAPDAVSAQWVPTAVDQGAIVVDNTAVFRAER
FT                   DVPLVVPEINPEQVRNRPRGIVANATCTTLAMIVAVAPLHREYGLRELVLSSYQAVSDV
FT                   GQAGVDTLHRQLVKVVGDRGLGSRPGDVRQAVGDDLGPFPAPLALNVVPWAGVPSDGGW
FT                   SSEEVTLRNDSRKILDLPDLKVTATCVRVPVVTGHSVAVHAVFGTEVDAEGAREVLRNA
FT                   PGVILVDEPAAGEFPMPIDAVGTDPSWVGRLRRALDDPRALDFFVTGDNLRKGAALNAA
FT                   QIAELLASELTQR"
FT   gene            complement(259989..261416)
FT                   /locus_tag="Strop_0228"
FT   CDS_pept        complement(259989..261416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0228"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52713"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G3"
FT                   /protein_id="ABP52713.1"
FT                   /translation="MRVDHERIIRDGTARLSMASTVAEACQWTVTALAPSTPATISVLL
FT                   EVHDRLRCIAATGSWQVFSTVPPATGVVGRVHTTGHAAVITDLGADPNRLPVRPDATSE
FT                   VCVPVPGSTGRPVGVLDLLWSQPADLMAWRDTAERLAERLGARIVALGGPPAETRSEKL
FT                   LRHAAALAAAGTEQELRHAASTAARDVSTLSTAVLVLPGHHGPQLCAPTTVPDELEARV
FT                   RATLSAAGPEALARMVDLAHRYGAGYTLGETEQSATDDHAPLARAGVRTLVAVPVNSGG
FT                   DAGLLLVADARRLRPDPTTVNLLELLAGQAGSALDRLETVARLRERASSDPLTGLRHTG
FT                   PFGERIAAAAPGRTALLAIDVDGFKTVNDTYGHQAGDRLLVRLARALEGALRQGDELYR
FT                   TGGDEFVAVIEVNRPDEAVRVAERLTAAARRIGRTISVGVALPHPDEPADHALHRADQA
FT                   LYRVKREGRDGVRLAAA"
FT   gene            261690..263393
FT                   /locus_tag="Strop_0229"
FT   CDS_pept        261690..263393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0229"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: metallophosphoesterase; 5'-Nucleotidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52714"
FT                   /db_xref="GOA:A4X1G4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G4"
FT                   /protein_id="ABP52714.1"
FT                   /translation="MSIPGMRRAAIGLTAFAVTAFGAVATAPNEADAGPKPVDVTLLAL
FT                   NDFHGHLEPPGGSSGTIEDQPAGGVEYLATHLAELRKASKKKNTVTVAAGDLIGASPLL
FT                   SAAFHDEPTIEALSQAGLDYASVGNHEFDEGSDELLRIQHGGCHPVDGCADGTPYQGAD
FT                   FQYLSANAFVDETGQPLLPPYAIHRVQGVKIGFIGMTLEGTPDIVSPDGVAGLTFADEA
FT                   QTANRYARELRRKGVETIVVLLHEGGNQAGAGGINDCVDFTGPVVDIVNRMDRSIDVVV
FT                   SGHTHQAYNCEVNNKLVTSASSYGRLITDIDLKIDRRTGDVLRATAQNLVVTRDVAEDP
FT                   DQTALIDHYQTVLGPVAGREVGETTEAITRTQETLFDTVRGESPLGNLIADAQHWATEG
FT                   DQNAVAAFMNPGGVRADLDAGPVTYEEAFTAQPFSNNLVTLDLTGEQLYCLLEQQFVTE
FT                   RVLYPSATVRYVVDPAGGTAPADDPCAGTRVVRGSLTFADVPVETDATYRVTVNNFLAG
FT                   GGDGFSVLTDGTNPATGQIDLDALVAYLTATSPVSAPATDRIRTTGESAR"
FT   sig_peptide     261690..261791
FT                   /locus_tag="Strop_0229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 34"
FT   gene            complement(263470..265695)
FT                   /locus_tag="Strop_0230"
FT   CDS_pept        complement(263470..265695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0230"
FT                   /product="helicase, RecD/TraA family"
FT                   /note="TIGRFAM: helicase, RecD/TraA family; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52715"
FT                   /db_xref="GOA:A4X1G5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G5"
FT                   /protein_id="ABP52715.1"
FT                   /translation="MADVTAAPRPALATLDAVLERLTYVNEESGYTVARVATDRGSDLL
FT                   TVVGALLGAQPGESLRLHGRWSSHPKYGRQFEVDSYTTVLPATIQGIQRYLGSGLVKGI
FT                   GPVFAERIVAHFGLETLRIIEEEPARLVEVPGLGPKRTAKITAAWEEQQAIKEVMVFLQ
FT                   GVGVSTSLAVRIYKQYGDTSTDVVTKEPYRLAADVWGIGFKTADTIAQSVGIPHDSPQR
FT                   VMAGLQYTLSEATDNGHCYLPEPELIADATKILDVPADLVTRCLDDLVAEEGVVRESLP
FT                   GGDAEPVRAVYLVPFHRAERSLATSLLRLLDDGTDRLPHFAGVDWAKALTWLKARTGND
FT                   LAPEQEQAVRLALTSKVAVLTGGPGCGKSFTVRSIVELAAAKRAKVTLVAPTGRAAKRL
FT                   SELTGHPAATVHRLLQLRPGGDASYDRDNPLDVDLLVVDEASMLDLILANKLVKAVPPG
FT                   AHLLLVGDVDQLPSVGAGEVLRDLLAAPAIPRVRLTQIFRQAAQSGVVTNAHRINAGRP
FT                   PLLQGLPDFFLFACDDTEATAERTVDVACSRIPAKFRLDPRRDVQVLTPMHRGPAGSGA
FT                   LNTLLQQRLTPHREGQPERRAGGRVFRIGDKVTQIRNNYDKGEAGVFNGTLGIVTQLST
FT                   EEQTLTVRTDEDESIDYDFDELDELAHAYAMTIHRSQGSEYPAVVIPLTTSAWMMLQRN
FT                   LLYTAVTRAKQLVVLVGSRRALAAAVRTVGAGRRHTALNHRLAAATP"
FT   gene            complement(265739..266038)
FT                   /locus_tag="Strop_0231"
FT   CDS_pept        complement(265739..266038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52716"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="InterPro:IPR037079"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G6"
FT                   /protein_id="ABP52716.1"
FT                   /translation="MIITFEAELWSWTARRADSWTFVSLPTDVSEEIRELPGPPRRGFG
FT                   SLRVRVTVGDSTWATSIFPDKERSCYVLPVKRSIREAEAIEAGDVTTVRLELLD"
FT   gene            266097..267104
FT                   /locus_tag="Strop_0232"
FT   CDS_pept        266097..267104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0232"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; Sigma-70,
FT                   region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52717"
FT                   /db_xref="GOA:A4X1G7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G7"
FT                   /protein_id="ABP52717.1"
FT                   /translation="MRAPTRGGVVVLAGPRGYCRVMPLSSHEVELFEHSRARLEAIAYR
FT                   LLGSATDAEDAVQDTFLRWQAADRSHVQTPEAWLTKVLTNLCLNQLTSARARRETYVGM
FT                   WLPEPVLAGDRMLGPVDTVERRESVSMAVLALMERLSANERVVYVLREAFGYSHGEIAE
FT                   ILDLTESNCQQIYRRAKQHIITSRVRTEADASSTRKIVEEFLVAATSGKIQRLVELLAD
FT                   DATSIGDGGGKIPARTTPIIGALTVARFLRGLFKPTEARRDLIGGRPAVYASTVNGGPA
FT                   VVFVVGDQVVGVMALHVTSTGISSIHTQVNPDKLARITRLWAGSEHGEPLLEAW"
FT   gene            267186..268373
FT                   /locus_tag="Strop_0233"
FT   CDS_pept        267186..268373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0233"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52718"
FT                   /db_xref="GOA:A4X1G8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G8"
FT                   /protein_id="ABP52718.1"
FT                   /translation="MKHRIVVLGAGYAGATAAGRLARRLHPDGTEITVVNADAEFVERV
FT                   RMHQLATGQRLSPRQLRDIYAGTGVRLRLARVTAVDVDQKIVTLVDEHGVDEIAYDTLV
FT                   YALGSTAADHGVPGVAEHAHDVAGKQSALRLRDRLAGLVAGENILVVGGGLTGLEVATE
FT                   IAEARSDLTVALATRGGLGDWLDAGARRHLRRVVDRLGIAVHEHTDISRVEATSAITGD
FT                   GRTVPAQVTVWTTGLAVHPIAAATTLELAETGQVIVDATMRTISHPDVYAVGDAAIADG
FT                   PGGKPLRMSCASGIPMGWQAADAIAARLTDREVPKVSLRYFNQCISLGRRDGLIQFVTA
FT                   DDQAKTSFITGKVAARYKEAVCKGAAWSIVHPTMLLPTRRRHTTTIQKERRAATA"
FT   gene            complement(268480..268776)
FT                   /locus_tag="Strop_0234"
FT   CDS_pept        complement(268480..268776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0234"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52719"
FT                   /db_xref="GOA:A4X1G9"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1G9"
FT                   /protein_id="ABP52719.1"
FT                   /translation="MSIVKINAIDIVEGHGDEFVERFSARPGKIEHADGFEGFQVLRPT
FT                   DDRTTWLVVTKWRDTEAYDAWYATRPHRAPESVTYANTWELWSFDVLTAADPA"
FT   gene            complement(268773..269156)
FT                   /locus_tag="Strop_0235"
FT   CDS_pept        complement(268773..269156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52720"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H0"
FT                   /protein_id="ABP52720.1"
FT                   /translation="MPTTPMKSLHELGQELVTRAHEASSGRAAATLNADHRSLKQLVLA
FT                   LRAGSALSEHENPGQATLQLLSGTATVSTAEMTWHGSAGDYLVIPDRKHDLRAVSDAVV
FT                   MLTFVKDANRPEPPAAADLRSDT"
FT   gene            complement(269156..269812)
FT                   /locus_tag="Strop_0236"
FT   CDS_pept        complement(269156..269812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0236"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52721"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H1"
FT                   /protein_id="ABP52721.1"
FT                   /translation="MYIWLVTSRRTTLRQALHRATGAMTAQQVADDVGWPVETTRLHLE
FT                   ELVGAQLAERVPGAPRGRGRPPMTYRATVGMDTAGPTQYRLLAGLLARTLREQPNGRAL
FT                   ARDAGRAWASEQPTEAIDGAPLSRAATALTSRFEAHEFAPTSTVTGDRADITLWHCPFL
FT                   DLIADHGDVICSLHDGMVDGITRAAAGTSVTAQLTAFPRPDSCRITLTRRTRRKD"
FT   gene            269916..271202
FT                   /locus_tag="Strop_0237"
FT   CDS_pept        269916..271202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0237"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; Amino
FT                   acid transporter, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52722"
FT                   /db_xref="GOA:A4X1H2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H2"
FT                   /protein_id="ABP52722.1"
FT                   /translation="MEQLVRRLGVTDAVVIGLGAMLGAGVFVVFAPAAAAAGGNGLLLA
FT                   LALAGLVAFCNATSSARLAAHYPESGGTYVYGRERLGPFAGFLAGWGFVVGKTASCAAM
FT                   ALTVGAYLWPGRARLVAVVAIAAVTAVNLRGVGKTAQATKALVGVVLGVLSLVVVVGLA
FT                   GFASERIGDSGSVGGVVFSDGGGAGIHGVLTAAGLLFFAFAGYARIATLGEEVREPERT
FT                   IPRAVPLALGVVLAIYLVLAVITLGVLGPDRLAASAAPLADVVTTVGLPGLAWVVRAGA
FT                   AVAVTGVLLSLLAGVGRTLLAMARRRDVPAGLATVHRAHQVPYRAELVVAVVVAAVVLV
FT                   GDVRGAIGFSSCTVLVYYAITNASALTLGRDPGRRLPVRLLAVLGLAGCVTLAVSLPLA
FT                   SVAAGFGVLAVGAGWYALRRRYIDRSGGR"
FT   sig_peptide     269916..270026
FT                   /locus_tag="Strop_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.958 at
FT                   residue 37"
FT   gene            complement(271253..272422)
FT                   /locus_tag="Strop_0238"
FT   CDS_pept        complement(271253..272422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0238"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52723"
FT                   /db_xref="GOA:A4X1H3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H3"
FT                   /protein_id="ABP52723.1"
FT                   /translation="MAVYSAQQLHGLRIIVTGGGTGGHTYPALTTIRTLRARLAETGAE
FT                   PDILWVGVEQGLEARIARQEGLPFRAITTGKLRRSPNRQELWRNITDAFRIPIGVLQAM
FT                   ATVLRVRPHVVLSTGGYVSVPIGVAAWLARRPLVMHEQTLNLGLANRILALVASRVLLS
FT                   HTSSLANLSKRTQARAVVTGNPVRPDMLTGDPIAGRAAYGLEPHLPLVFVTGGAQGAVQ
FT                   VNQMVAEVLPDVLQRCQVLHQCGEYDLVRMRQVAAQLPTHLQARYRVVDYIHGQLPDVL
FT                   AAADIVVARSGAGTVAELTALGRPAILIPLVPTSGDEQRQTARYLAEAGAVRMLTGGDA
FT                   TGAALRAELLTLLDDAPYRHALAEAARRHGRPDAAAAAVTELIDAARRG"
FT   gene            272669..273139
FT                   /locus_tag="Strop_0239"
FT   CDS_pept        272669..273139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52724"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H4"
FT                   /protein_id="ABP52724.1"
FT                   /translation="MQTFLPYPDFLASAASLDQRRLGKQRVEAIQVLRGLTRPGYGWRH
FT                   HPAVKMWAGYEEALTRYGLDVCAVWCEPGRADTCAATLVTDFAAARGVRTVRTQAELAD
FT                   AGELPPWLGRDDLHLSHRSSLLRKDPEHYRPQFGDIPIDLDYVWPRSDRAPG"
FT   gene            273234..274031
FT                   /locus_tag="Strop_0240"
FT   CDS_pept        273234..274031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0240"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52725"
FT                   /db_xref="GOA:A4X1H5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H5"
FT                   /protein_id="ABP52725.1"
FT                   /translation="MAVADAELLVEVAGPVATVVIHNPARRNAMTPAMWRRLPGVLDQL
FT                   EADPAVRALVLTGADGTFCAGADLGDLDELLDAGDASIAVTAEERLAAFAKPTIAAIRG
FT                   ACVGGGCQLAVACDLRLAADDARFGVPPARLGLVYPAPTTRRLARLVGPSTAKALLFTA
FT                   ELIDSGRALRVGLVDEVLPATALSARVGEVTAAVTVRSRLSVMAAKEIVDERADDDRIA
FT                   WWHGQVRTSGEAREGVAAANERRPARFPWSPPEARPGEAVGAG"
FT   gene            complement(274055..275581)
FT                   /locus_tag="Strop_0241"
FT   CDS_pept        complement(274055..275581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0241"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52726"
FT                   /db_xref="GOA:A4X1H6"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H6"
FT                   /protein_id="ABP52726.1"
FT                   /translation="MALSQMVGRLLGVREHVVDPGGGGAPRLPHPAPTVVVGGGIAGMS
FT                   AAVVLAERGVPVTVLEAAPTVGGRLGAWPEASPDGTRINEHGFHAFFRQYYNWRNILRR
FT                   ADPTLGFLRQIPRYPVLSTQWPTEEFGKLPPAAPANLLTLLLRSPSLRLRDLRAMNRDA
FT                   ALPLLSYDPIQTYAEFDDTTADALLTSLQLPDRARAMLFEVFSHSFFNHEAEMSAAEMI
FT                   AQFHFYLLGNPEGLAFDCPAEDYATSIWQPLTRHIEQHGGRVVTEAAATGLHRDAAGWE
FT                   VVSTAGAYEARHVVLAVDPPALAALVAASPILAEAAPDLVARMPAFGRPGPPYAVARYW
FT                   CTGDVDPGRAVFNGVSRQPTLDSVTLYHRLERESHRWAELNGGSVVELHAYACEPDVPA
FT                   EELAERMWTELTALWPEAGRLRIRELRARVEAQAPAFPPGSHAGRPGVRTDADRLYLAG
FT                   DGIHADLPSALMERSAVTGILAANHILRDEGGATEPVHSIRPRGLLARGH"
FT   gene            275688..277694
FT                   /locus_tag="Strop_0242"
FT   CDS_pept        275688..277694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0242"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52727"
FT                   /db_xref="GOA:A4X1H7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H7"
FT                   /protein_id="ABP52727.1"
FT                   /translation="MRHMTGPFDRAWWTGRRLRGNSDPWAHYVVCGHDALAYWVVRSLL
FT                   ATEPQLARIRITLVVPERQRTDSPDGRDLDGIEVIRADRLDEVTFRDARLDRAEGLALL
FT                   HQDDVGNMHAALCAQEVQPRLRLVVRMFNTSLANGVRQIFPDSAVLSDAAMAAPAFVAA
FT                   ALGEVAPAHFRHGGRTLYVARRVDLRDEDIVCPVADIRDPREVRVLPADETSADVVLAE
FT                   AAGTPPGTEVAARRLRRARRWRRPVTMLLRAVRGFATRRIGLAVLVLLAVIVVLGGLYA
FT                   STAEVSWGEALYLTLVTALSGQDPDAAKPLGEQVLQVVLNLSGLALIPLVTAVVVDGLV
FT                   NARLALHSGRPLTDRSGHVVVVGLGNIGTRVTAQLRDFGVEVVAIDKNADARGAELARR
FT                   LGVPLVVGDASTEETLRAASVGTCQALVVVSTDDGVNLRAALTARSFNDDVQVVLRLFD
FT                   GHFAERVQRSFGIGVSRSVSYLAAPSFAGALLDRAVIATISVGRHALLVTEVPVAAGSS
FT                   LDGQPLATVDRTGSVRLLAHARSGQRYEWELDRRLVIMAGDRLTVVARRAGLNALLREA
FT                   GPLNPEVPASPDGSSPEPASTPAGSPPVGSSPETASLPQPASPPVGSSPEAPSSPEVAS
FT                   PSEGSSAPAGPPLPRLPEGEVGGSVDQRPVSSE"
FT   gene            complement(277670..278461)
FT                   /locus_tag="Strop_0243"
FT   CDS_pept        complement(277670..278461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0243"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52728"
FT                   /db_xref="GOA:A4X1H8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H8"
FT                   /protein_id="ABP52728.1"
FT                   /translation="MAEMRQATTRWRAVRLRPVRPAGWWFDGLLLAGLVALTAALAAGH
FT                   LFGLDRAVADWSDAHRPATAYGIAWTLNYLGQGGPLALVAIGIGVLLAVRLRSARPLLP
FT                   PVAGVALIYLIVGALKVSTARPAPSASVREPFLAPEQTLPLFQHELPLEFTRSYPSGHV
FT                   VNTIVWYGVIVLLLARLLETYGRTLPPRMATAVRVVPPLVVLTTTTYLGWHWLTDSIAG
FT                   LLLGLLLDRVLHRVPWDDVPLPERVDQGRRGLIPYSEETGR"
FT   gene            278504..279769
FT                   /locus_tag="Strop_0244"
FT   CDS_pept        278504..279769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52729"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025111"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1H9"
FT                   /protein_id="ABP52729.1"
FT                   /translation="MPNHAGRRSGGGGRKLGSVRITSALVDPALLDLPWSTPLVEWPAQ
FT                   HLVALPQGISRHVVRFVRLGGYVYAVKETGERVAEREYDLLRALERIDFPTVEAVAIVA
FT                   DRQTEAGEPLDPVLITRHLQFSLPYRALFSHTLRPETMQRLLDALAALLVRMHLTGFFW
FT                   GDCSLSNTLFRRDAGAFAAYLVDAETGVLHRSLSNGQRGEDLEIARVNIFGEALDLQAA
FT                   GLLHESIDPAVVCEEVVQRYERLWHEITYEQQIEREARHDIEGRIRALNELGFDVAEIA
FT                   VSTIDDGRYLVRPKVVDAGYHTRRLLRLTGLDAEENQARRLLNDLDAYRAESDLIDEQQ
FT                   AAHRWLTEVFEPVVRAVPAHLRRKLEPQEIFAQIIEHKWLLSQRAGRDVGMAPAVQSYL
FT                   GDVLVHRPDEQAVLGVEIPPAG"
FT   gene            complement(279811..280920)
FT                   /locus_tag="Strop_0245"
FT   CDS_pept        complement(279811..280920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0245"
FT                   /product="N-acetylglucosamine 6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52730"
FT                   /db_xref="GOA:A4X1I0"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I0"
FT                   /protein_id="ABP52730.1"
FT                   /translation="MTVRVTGRVVTPAGVIRQGCVEINNEQITAVAEYPSGRDGHWILP
FT                   GFVDIHNHGGGGHTFTTGDADEARAAAGFHLRHGTTTLLASLVSSPFELMRAATIAYRP
FT                   LVAEGVLAGIHFEGPYLSVARCGAQNPAYLRDPSTEELTELLELGHGTIRMITLAPERA
FT                   GATAAVKLLTAHGVVAAVGHTDATYEQTQAAIAAGASVATHLFNAMRPVHHREPGPVIA
FT                   LLEAPSVVCELIADGVHLHDGVLAFATATAGAERTALITDAMAAAGQPDGEYELGGQTV
FT                   TVTTGVARLAGDGAVAGSTLTMDAALRHAVATGVAIPEAARMMATTPARAIGLGDRVGA
FT                   LQAGLRADLVVLDDDLNVVRVMRAGTWLD"
FT   gene            complement(280917..281882)
FT                   /locus_tag="Strop_0246"
FT   CDS_pept        complement(280917..281882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0246"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52731"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I1"
FT                   /protein_id="ABP52731.1"
FT                   /translation="MSSGAPGAPNGTPDRHQVVVAIDVGGSRMKCALVHRDGTVARIEH
FT                   HPTQTARGPAAVVDTILDIAEALADTARHEGLAPVAFGLAVPGVIDEAAGVAIWSSNLG
FT                   FREVPLRTLATARLGMPAVLGHDVRVGGVAEARLGAGRADRHVLFVAIGTGIAAAHVVD
FT                   GTAAAGAHGAAGELGHVLVRPGGPRCGCGRAGCLEAIASAAAVARRYAELTDSTPGLSA
FT                   AEVVAHATAGDPLAQQVWTEAVEALADGLAIGQTLFDVETVVLGGGLARAGAQLLDPLR
FT                   AALHDRMTFHREPRLVPAALGAEAGCLGAALLALDSLEKR"
FT   gene            complement(281879..282808)
FT                   /locus_tag="Strop_0247"
FT   CDS_pept        complement(281879..282808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0247"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52732"
FT                   /db_xref="GOA:A4X1I2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I2"
FT                   /protein_id="ABP52732.1"
FT                   /translation="MSYVDMEIASQPDCWRTAARLANSVADRLPRPGERVAVVGCGTSW
FT                   FMAMAYAARREHAGHGETDAFQASEFPTNRRYDRLIAITRSGTTTEVTDLLAALRGVLP
FT                   TTVLVGDPAAPAADLADGTVPLAFADERAVVQTRFATTALALLRAHLGDNVAALSADAE
FT                   VAVRAPLPIEPAQIEQVTFLGRGWTVGLAHEAALKCREAATFWAEAYPAMDYRHGPISV
FT                   AAPGRLVWAFGELPDGLAEDVAATGAAFVHSRTHGCRSVIGNWAAGRTPLDPMADLILA
FT                   QRFAVTLATSRGLDPDAPRHLARSVVLA"
FT   gene            282993..283778
FT                   /locus_tag="Strop_0248"
FT   CDS_pept        282993..283778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0248"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52733"
FT                   /db_xref="GOA:A4X1I3"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I3"
FT                   /protein_id="ABP52733.1"
FT                   /translation="MDRYARWNALLEMLTDSGRVSVEGAAERLAVSQATIRRDFDQLAQ
FT                   QQMITRTRGGAVANGVSYDLPLRYKSAKHSAEKQRIGAAAAALVSPGTVVGLNGGTTST
FT                   EVARALAVRPDLNTSAEGAQLTVVTNALNIANELLVRSRMKVVVAGGVVRPKSFELVGP
FT                   LGGALLREVTLDVALLGVDAVDPQLGAAAHHEGEAAMNSLMVARAKRVVVIADSSKLGG
FT                   HAFARICPVDRMETLVTDSGAAPEVVAAFRAADVQVVCA"
FT   gene            283896..284906
FT                   /locus_tag="Strop_0249"
FT   CDS_pept        283896..284906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0249"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52734"
FT                   /db_xref="GOA:A4X1I4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I4"
FT                   /protein_id="ABP52734.1"
FT                   /translation="MTAVLEIEGLQKTYRSRSRRRGTRNALDGFDMWVEAGQVHGFLGP
FT                   NGSGKTTTLRTLLGLIRPDGGRMRLLGHEVPADLSTVAGQVGAVVESPQFFPHFTARDM
FT                   LSLLATAGEVRSHRVDEVLELVGLRDRSRERVKTYSLGMKQRLAVASALLKEPRLLILD
FT                   EPANGLDPGGIREMRSLVRNLAESGTTVLLSSHILAEIQLICDSVTIISLGRRVAFGPV
FT                   EKVLAAHSASAVRVRLERVADLPEASEALTRAGFRVTREPDHLMLTGVEEAAMVTRLLA
FT                   GHGLYVSELVWVDADLESVFLELTATVPAPGQSRQVDQSVRPAAVGPSSTGGWGA"
FT   gene            284903..285916
FT                   /locus_tag="Strop_0250"
FT   CDS_pept        284903..285916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52735"
FT                   /db_xref="GOA:A4X1I5"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I5"
FT                   /protein_id="ABP52735.1"
FT                   /translation="MSLYRAELRRLVLRRLTRWVTVLGLVVLATVAVGVFLSNQKIDDA
FT                   AWAKAEVTAEQHWQQQVRSTEQFRAECEQAAIRGEQVGSFPSDCSEITPPPRDAVSADL
FT                   FLASTFDFRESFGQTLTALAATLALVGFVVGSSFVGAEWNTGGMMTMLLWRPKRVTVLL
FT                   TKLAALLTGLLALAVSTTVLWFGSFWLIGTTRGTTEGMTTGAWQSFALTGLRGVVLALV
FT                   VAALGFGLASLGRHTAMALGGVIGVTVVGQFGLAVLLRLTGATFVEAWLLPTYLFAWMN
FT                   KEVILNDWTVCQYNAFGLCEPATLTLTWQHSFGLLAAGLVLILGGACWAMRRRDIS"
FT   sig_peptide     284903..285049
FT                   /locus_tag="Strop_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.972 at
FT                   residue 49"
FT   gene            286063..286500
FT                   /locus_tag="Strop_0251"
FT   CDS_pept        286063..286500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52736"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I6"
FT                   /protein_id="ABP52736.1"
FT                   /translation="MPPDTAPTAAESSGDGRSGDGRGRSVVPPPRSAPEAEAVASADRE
FT                   PDVAGADGGAPSAVAAPGEAVGSPTGLTGRERDILDFEQQWWRHPGAKEQAIRDRFGCT
FT                   ATRYYQLLNALLDNPAALAAEPLLVGRLRRLRSARAHGRRR"
FT   gene            complement(286531..286746)
FT                   /locus_tag="Strop_0252"
FT   CDS_pept        complement(286531..286746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52737"
FT                   /db_xref="GOA:A4X1I7"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I7"
FT                   /protein_id="ABP52737.1"
FT                   /translation="MLQRLHETGFRAEHAYLAGFVSIGLSFGSWFLSKHLERAGMARAD
FT                   RWGIFIGEWAPTFFAIGNGLRMHEKR"
FT   gene            286964..287473
FT                   /locus_tag="Strop_0253"
FT   CDS_pept        286964..287473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0253"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52738"
FT                   /db_xref="GOA:A4X1I8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I8"
FT                   /protein_id="ABP52738.1"
FT                   /translation="MASDVRLEPVSERNLESLLSVAAAEADPTDVMPPVEAPAGWSHAR
FT                   REAFREFHRASFAGLPGPTRTRMYAVLAAGEVVGVIRMTRCDEPEVVETGLWLGRSARG
FT                   RGIGSAALRELLNRAAAVGMRRVVAATTPDNRGALSVLTTCGARLRETDGQVHAELSLD
FT                   ATPPAR"
FT   gene            complement(287525..289777)
FT                   /locus_tag="Strop_0254"
FT   CDS_pept        complement(287525..289777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0254"
FT                   /product="Microtubule-severing ATPase"
FT                   /EC_number="3.6.4.3"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52739"
FT                   /db_xref="GOA:A4X1I9"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1I9"
FT                   /protein_id="ABP52739.1"
FT                   /translation="MGGSELILTASRQPAALDARRGIVRLHPEVLTALGIRPGDPVRLA
FT                   GRRVTAALAAESEPEAIPGLLYADDLTLGNLGLRDGGEVTVGPTPVTAATRVVLTGAPQ
FT                   VVSAVSPELLRLALLGKVVTTGDDVSLLPQEVLPQEVLSDTALRGLLTAARQSLANRVG
FT                   YAWTSALLTVTAATPASATLVTMETTVGWEHGPATHDQATPRAPSAAGDPRQPRAAGAR
FT                   DAEPAGTTDPVTPTVEELPGLRAQAEDLTELLDLGFHHGAVLRRLGTTVALGVLLDGPA
FT                   GSGKSALVRAVAAQVGARVRPVWGPELAALTNSAAAERLRAAAAAVRTDGPAVLLVTDV
FT                   EALAPAAAPGPVTTVFRQVVAETVAAGAAVVCTTSRLDAVDPALRTPDLLSLRVSIPLP
FT                   DAALRQEQLEVLTRQVSLAEDVRLDEVAARTPGFVAADLAALIREAGVRAALRQKTVER
FT                   PSMTMADLDAALAVVRPTTMTASTLELASVTLDDVGDLTEVKQTLTESVLWPLTYPGTF
FT                   ARLGVQPPRGVLLYGPPGCGKTYLVTALAGSGRANVLSVKGAELLSKWVGESERAVREL
FT                   FRRAREAAPTLVFLDEVDALAPVRGQATDGGTADRVVAALLTELDGVESLRNVVVVGAT
FT                   NRPDLVDPALLRPGRMERLVYVPPPDEAGRAEILRAASRTVPLAPEVDLGALAGDLDGF
FT                   SAADCAALVREAVLAAMRESLAAATVTTAHVAVARARVRPSLDPAQVAWLAAYAAQ"
FT   gene            289971..290606
FT                   /locus_tag="Strop_0255"
FT   CDS_pept        289971..290606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0255"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: thiopurine S-methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52740"
FT                   /db_xref="GOA:A4X1J0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J0"
FT                   /protein_id="ABP52740.1"
FT                   /translation="MTDFDAFFNVDYWDQRYSETGQVWSGEPNPVLVAEVAPLAPGTAL
FT                   EVGCGEGADAMWLAGQGWQVTGVDFSAQALSRAAERVPASLAERLRWQRADIRDWQPDD
FT                   GPRYDLVSTSFLHFSGALRRRVFATLATRVAPDGHLLIVGHHPSDLDTAMPRPPEPDLF
FT                   YTADELAQALPARDWEVRTRAARPRDATTPDGTPVTIHDTVLTARRVQ"
FT   gene            290727..293573
FT                   /locus_tag="Strop_0256"
FT   CDS_pept        290727..293573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0256"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: alpha/beta hydrolase fold; peptidase S15; ABC
FT                   transporter related; X-Pro dipeptidyl-peptidase C-terminal
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52741"
FT                   /db_xref="GOA:A4X1J1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J1"
FT                   /protein_id="ABP52741.1"
FT                   /translation="MRSPSPAAWVRRVLPTRRRALAAAVVVVLLAAGVVAGTLRPSEPD
FT                   LRTEAALVTVRSGPTGDEPVELDTTLYLPPAATADAPVPAVLLGHGFGGTKESVRADAE
FT                   EFADRGYAVLTWTARGFGRSGGQIHLDHPDYEVRDAQRLLDWLAARPEVVTDAAGDPRV
FT                   GVVGGSYGGALALLLAAQDQRVDAIVPMITWNDLARSFLPENSGEGPEQGVFKKGWAGL
FT                   FFGSGGNAGPASVGGSGPAGGLAPGGGSVPGGSLPENAATAAGAIDPSCGRFAADVCAA
FT                   YLRIATTGRADPDAVALLRRSSPAGKLDRIEAPTLLVQGAADTLFPLSEADANARGIAA
FT                   TGTPVQVAWFTGGHDGGDGPKTDSDRVRNLTVRWLDHYVKGEGAAPADDFTFSRIAGFD
FT                   ALDRGLVASGFRATGYPGLTGTDQRPVSVSGPAQSIANPPAGNPAAISSVPFAGDLSSL
FT                   LDGVAGDIPGQHARFESAPLPAAVDVVGAPTVSIRAASPTGTAVLFVKLYDVDAGGSAT
FT                   LPNGLVAPIRLEGLPAAVEDAEPVTVTLPAIVRRIEAGHRLRVVVATSDQAYATPVEPA
FT                   VYSVALASEAVTLPTVASEPIPTDAVVWRWVLVGLLAAIVVGLVVVVAVLRHRHRRRES
FT                   RVHPTYAGVPLAVRDLRKEYADGFVAVSNVDFEVHHGQVVGLLGPNGAGKTTTLRVLMG
FT                   LTQPTAGEVYVFGHRLVPGAPVLSRIGALVEGPGFLPHLSGLDNLKAYWRATGRPWADA
FT                   HFDEALEIAGLGTSVHRKVRTYSHGMRQRLAIAQAMLGLPELLVLDEPTDGLDPPQIAE
FT                   MRRVLLRYATGGRAVLVSSHLLAEVEQTCTHAVVVNKGQIVASGPVEEIVGESPSVLIE
FT                   VTDPVAAREVLDRLTGVSVLPDGDGQLVVDTNGTARSEVVAELVRAGIGVDRVVPRRRL
FT                   EDAFLALVGDNSRGSGDR"
FT   sig_peptide     290727..290879
FT                   /locus_tag="Strop_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.528 at
FT                   residue 51"
FT   gene            293573..294472
FT                   /locus_tag="Strop_0257"
FT   CDS_pept        293573..294472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52742"
FT                   /db_xref="GOA:A4X1J2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J2"
FT                   /protein_id="ABP52742.1"
FT                   /translation="MARTTVEPGTGDSGGTPSGAAAGYRPFATLPFGAEFRRQASRRRT
FT                   QLALGFLVLLPLIILIAFQFGSDDDDNGRGEFGSLVEFATSGGLNFTLFTLFVSASFLL
FT                   VVVVALFCGDTVASEASWGSLRYLLAVPVPRARLLAVKLLVALTYSGMALLLLAGTALL
FT                   LGTVRYGWEPLRSTVAAELEPGEGLLRLLAVLGYLAVVLLVVAGLAVLLSVSTDAALGA
FT                   VGGAVLLWILSSILDQITALGVLRTFLPTHYSTAWLGLLSTPIQTDDVVRGAISAISYA
FT                   TLFWGLAFWRFTRKDIVS"
FT   gene            complement(294503..294862)
FT                   /locus_tag="Strop_0258"
FT   CDS_pept        complement(294503..294862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52743"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J3"
FT                   /protein_id="ABP52743.1"
FT                   /translation="MPGSGRYATRGRAGRPRPPRRRPRPNPYRKDVTTMIHRARRLFSS
FT                   QVRAATFARRRWRGLDPEQVYAYLDRVADELERLTREATTARAEGELIRQALRQWQSRH
FT                   AGCQHATTPNSRWHR"
FT   gene            295198..295434
FT                   /locus_tag="Strop_0259"
FT   CDS_pept        295198..295434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0259"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   Helix-turn-helix, type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52744"
FT                   /db_xref="GOA:A4X1J4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J4"
FT                   /protein_id="ABP52744.1"
FT                   /translation="MPHAVPLWRVIRDDLRARIKAGILKPGDKLPSTRELADQYETSPV
FT                   TVRKAVDILIESGELLGRQGMGVFVAIPPASDR"
FT   gene            complement(295932..296684)
FT                   /locus_tag="Strop_0260"
FT   CDS_pept        complement(295932..296684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0260"
FT                   /product="LPXTG-motif cell wall anchor domain"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain; PFAM:
FT                   surface protein from Gram-positive cocci, anchor region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52745"
FT                   /db_xref="GOA:A4X1J5"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J5"
FT                   /protein_id="ABP52745.1"
FT                   /translation="MRWKILAGALMALAFVIPATPAAAQVASPGLDESCQTVERKVYKD
FT                   IRELVTIDPDTAEYVKVRRLANQILSAANKHSFVATPPELQTAMSGSQDDLRAFLKTRI
FT                   EERWLTDLRIKIGKAMAADPDHTNVYEAAQEVLNTSSMDAHLAFLNDGLYAARELDCAA
FT                   QPTPTPSATATATPTPSTTVTASPTTPATDTPTPTPSTSLGTASGEGGGLPLTGANTAT
FT                   VAGIGGALLLLGGAGYLIGRRRRTRFLT"
FT   sig_peptide     complement(296610..296684)
FT                   /locus_tag="Strop_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.962 at
FT                   residue 25"
FT   gene            complement(296813..297613)
FT                   /locus_tag="Strop_0261"
FT   CDS_pept        complement(296813..297613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0261"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52746"
FT                   /db_xref="GOA:A4X1J6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J6"
FT                   /protein_id="ABP52746.1"
FT                   /translation="MFSRRTGDTRRPRCRTPPRGGAGAVTYRAGMQASPSDLTGRARLR
FT                   EAALRLFAERGFAATSARAVAAEAGLSPALVMHHFGSKEGLRAAVDEEVLARLGTALRE
FT                   LDPSGTDLMMSLGEVSARMFGADPVLRGYLRRVLQEDSPASAALFGRLLEGARAELERL
FT                   IATESGHTDADLEWAPFQMLCLIVGPLLLEPVMQPNLDRPMFDVQVLARRSVANQRLLR
FT                   LGLFGADPATAGDATDDLRAGAPDSATATRRAQPTVITDNEIPH"
FT   gene            297634..298833
FT                   /locus_tag="Strop_0262"
FT   CDS_pept        297634..298833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0262"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52747"
FT                   /db_xref="GOA:A4X1J7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J7"
FT                   /protein_id="ABP52747.1"
FT                   /translation="MASVIDERPAPRAQHLHYLDNLRIVMILMVVIHHAAQAYGPADWW
FT                   YVKGDQHAPVLVTLSAVGGAFRMSLLFFVAAFFVPRAADHRGDWGFLRGRLKRLGIPFL
FT                   VGSATIIPTLMYVYYREYRGYPSISFPRYYLDVFLGFGPRPAGWSGPIWPDLQFGHLWF
FT                   IQNLLAFSALYLLFHWLGGLLRRARPITTPARLIRIPDNRSLVIFTLTLAAVVFLVRIW
FT                   YPLDQWVPLFEFIQAEPARLAQYVAFFTAGVIAYRRDWLARLPRSTGYTWLAIGVALTA
FT                   VLLWTGTDTQLFAPGGASWASAYWSVTETFLCVGLSLGLLTLFRDAFAGHNRLTRAMAA
FT                   SSYTIYIIHLPIVVALQFAFARAGLPTLATFAAVATLGMVISVAVAVTVRRLPGLRTVL
FT                   "
FT   gene            299263..300549
FT                   /locus_tag="Strop_0263"
FT   CDS_pept        299263..300549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0263"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52748"
FT                   /db_xref="GOA:A4X1J8"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J8"
FT                   /protein_id="ABP52748.1"
FT                   /translation="MTSALAPSGIDPATSPARALACRACSARYPLIAQHACYECFGPLE
FT                   VDHDPTALATVTREQIEAGPRNIWRYAPLLPVGQDPATRVTLDPGFTPLVAAPRLAAEV
FT                   GLTAPLWVKDDSANPTHSFKDRVVSVALTAARSLGFTRFACASTGNLANSVAAHAARAG
FT                   APSVVFIPSDLEQGKVVTTAVYGGDLVAIDGSYDDVNRLCGELVETDEFEDTAFVNVNV
FT                   RPYYAEGSKTLGYEVAEQLGWRIPAQVVIPMASGELLTKVDKAFAELVEIGLVEAPAGG
FT                   WRVFGAQSAGCSPIAAALHADSDTINPVKPTGIAKSLNIGDPAAGPYALESVRRTGGWM
FT                   AAADDDEIRAGIRLLARTAGVFAETAGGVTVAVLRKLVESGRLDPTAETVIFNTGEGLK
FT                   TLDAVADQAGPSHRIKASLRAARDAGLMG"
FT   gene            300770..301786
FT                   /locus_tag="Strop_0264"
FT   CDS_pept        300770..301786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0264"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52749"
FT                   /db_xref="GOA:A4X1J9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1J9"
FT                   /protein_id="ABP52749.1"
FT                   /translation="MAQAADMGITITPFGPADDQAIDAAVRIEAAAAAVDLPDFPLFCP
FT                   QRLIGSVRHPMPGDAPVHLLAHLDGEAVGVLKLELPQLDNTENAAIELTVHPAARRRGV
FT                   GRALFDRATELAREHRRKRLTALTPDTAPAGTAFAQMLGADSVLADVRRRLDIDRLDPA
FT                   ALARLQAEAQGRAAGYQVVLWRGHTPEEDLADIAYLEGRLVADAPMGDLAWEPERYDAE
FT                   RVRAAEIALDARGRRQYHTGIRHQASGRLVAWTVLDVAATVDWHALQQITIVDPEHRGH
FT                   RLGLLAKLENLRYLRDHEPAVRVINTFNAAANDHMITINEQLGFRVADRWTNWQLTI"
FT   gene            301827..303512
FT                   /locus_tag="Strop_0265"
FT   CDS_pept        301827..303512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0265"
FT                   /product="phenylacetic acid degradation protein paaN"
FT                   /note="TIGRFAM: phenylacetic acid degradation protein paaN;
FT                   PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52750"
FT                   /db_xref="GOA:A4X1K0"
FT                   /db_xref="InterPro:IPR011975"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K0"
FT                   /protein_id="ABP52750.1"
FT                   /translation="MMADMTETPHPLYDRHADTLDRALTAISQRGYWSAYPESPSPRVY
FT                   GETAAGDGKVAFEAYLGRDFPLDQVGDGSTVRTEASPFGVDLGVGYPHATADHLTTAAS
FT                   TALPSWRDAGPQARAGVCLEILDRLHRNVFELANAVQFTSGQAFVMAFQAGGAHALDRA
FT                   LEALAYAYAEMTRHPGTAGWEKAAGKGDPLRMTKTFHVVPRGVALVIGCNTFPTWNSYP
FT                   GLFASLVTGNPVIVKPHPRAVLPLAVTVRYARQVLAEAGFDPNLVQLAPEAPGEKLAST
FT                   LAQHPAVRIVDFTGSSEYGDWLEANARQAQVYTEKAGLNAVVIDSTDDFGGMCRNLGFT
FT                   LTLYSGQMCTTSQNILIPRDGIETDQGHKSFAEVATGIATAVSKLTADPARGVELTGAI
FT                   VNDGVLERLDEVTKVGESVLESRTVTHPAFPGAVVRTPTIVRLNADDTATYTREWFGPI
FT                   SFVIGTDSTGHSLELLRATVGEKGALTAAVYSTDDAVLDAAETAAVEVGVHLSANLTGG
FT                   VFVNQSAAFSDFHGSGANAAANAALTDGAYVANRFRIVQSRRHV"
FT   gene            complement(303658..304497)
FT                   /locus_tag="Strop_0266"
FT   CDS_pept        complement(303658..304497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0266"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52751"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K1"
FT                   /protein_id="ABP52751.1"
FT                   /translation="MTVPNSNPATEDQQRTESSTIDNGVPHSARIYDYWLGGKDNFAAD
FT                   RAVAEALISAIPTLRSMAAENRRFVHRVARYLVGQAGVRQFIDVGTGIPTSPNLHEVAQ
FT                   QIAPATRVVYVDNDPIVLAHARALMISTEQGRSEYIHADLREPELVVNHRKLREVLDLD
FT                   QPVALTIIATLMLLEDSDDPWGTIRVLMDALPSGSYVAITHPTGDFNPEAVKTAVAAAV
FT                   DSGMTLVPRSRDEVARFFEGWELVEPGIVPVAAWQPDDGEPTDPHAAYYWAGVARKP"
FT   gene            complement(304641..305186)
FT                   /locus_tag="Strop_0267"
FT   CDS_pept        complement(304641..305186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0267"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52752"
FT                   /db_xref="GOA:A4X1K2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K2"
FT                   /protein_id="ABP52752.1"
FT                   /translation="MTSGPGEPDPGPVSTRRARVRRIQPADAARMRALRLEMLADAPLA
FT                   FLETVADAAARPHADYAARIAYTSAGSATAQFVADPGGRLVGHAGGTAAPDEPGLTVVH
FT                   AVYITPSWRGSGLLPDLIDAVAGWSRACGRPELMLEVVVGNEGAYRAYRRLGFLDTGLR
FT                   LPHPTIPTLTELQMRRPA"
FT   gene            305397..305600
FT                   /locus_tag="Strop_0268"
FT   CDS_pept        305397..305600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0268"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52753"
FT                   /db_xref="GOA:A4X1K3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K3"
FT                   /protein_id="ABP52753.1"
FT                   /translation="MAQGTVKWFNAEKGYGFIAVDGGQDVFVHFSAIEMDGYKALDDGQ
FT                   RVEFEIAQGQKGPQAERVRVVA"
FT   gene            306170..307792
FT                   /locus_tag="Strop_0269"
FT   CDS_pept        306170..307792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0269"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52754"
FT                   /db_xref="GOA:A4X1K4"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X1K4"
FT                   /protein_id="ABP52754.1"
FT                   /translation="MAKMIAFDEEARRGLERGMNQLADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQAMVREGLR
FT                   NVAAGANPMALKRGIETAVASVSEELLKLAKDVETKEQIASTASISAGDPSVGEIIAEA
FT                   MDKVGKEGVITVEESNTFGLELELTEGMRFDKGYISAYFMTDPERMEAVFDDPYILIVN
FT                   SKISSVKDLLPILEKIMQSGKPLLIIAEDIEGEALATLVVNKVRGTFKSVAVKAPGFGD
FT                   RRKAMLGDIAILTGGQVISEEVGLKLDAVSLDMVGRARKVVVTKDETTIVDGAGDAEQI
FT                   QGRVNQIRAEIDKSDSDYDREKLQERLAKLAGGVAVIKVGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVPGGGVALVQAGKTAFDKLDLTGDEATGAQIVKIALDGPLRQIAVNAGL
FT                   EGGVVVEHVRGIEAGHGLNAATGGYVDLMAAGIIDPAKVTRSALQNASSIAALFLTTEA
FT                   VVADKPEKTPAAPAGPGGGEMDF"
FT   gene            complement(308140..309069)
FT                   /locus_tag="Strop_0270"
FT   CDS_pept        complement(308140..309069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0270"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52755"
FT                   /db_xref="GOA:A4X1K5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K5"
FT                   /protein_id="ABP52755.1"
FT                   /translation="MDLKITELTPEQLPTVIELCGRSLDLPDDATEAAAIVETLWPRAV
FT                   ASRPVVPLGAYRDDRLIGVLLGSVSAPSSPAAHVDLVAVEPAHRRQGVARALVSRAEQR
FT                   LAGLGAQEVLLAGNPPYYAWPGIDVRYTPAICAAEALGYARDSTAWNMTADLSSDESPA
FT                   LRTTVPAEQRLADQGVTVRRAEPADLPVLTAFASGIFDGTWAVEVAESIGRDRAGCHLA
FT                   ERDGNVLGFAAWGSSRPGWFGPMGTAPAAAGSGIGGVLLRRCLADQRAAGITRAQIGWV
FT                   GPVRFYSGSAGAWIERVFFGYRRSLRDQ"
FT   gene            complement(309210..311633)
FT                   /locus_tag="Strop_0271"
FT   CDS_pept        complement(309210..311633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0271"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52756"
FT                   /db_xref="GOA:A4X1K6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR033857"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K6"
FT                   /protein_id="ABP52756.1"
FT                   /translation="MQPGPWRAHPLPSPANPPRASPAPVVAAVFVGLWIVGLTVITQLG
FT                   GWLTDQLLLVIGVDRLVWLWPVTTVAVVTLAGLPTLLLALLPRSRVVRAVGQLWLVGLL
FT                   VFGALSLPRALPPVQHEAYLATLAGTAGLATLLIHRLVAHRIAPTGPEGESDRHRRRAP
FT                   RPASVTLLGLAGGLALLLPWVWVGALGGLLETLLAVLAATAVGGLAAALLPAAFWPHRT
FT                   ADTPPRPVRLVLVGGLVAGVVLLLLGAGVGQSGAQLPLLLTLPPAGFALAALAVAARRT
FT                   ATGVGAAAAGLVGLNVFGPLAWTDPEEVSLVLADPRDVPFWVAVAAGVGFTIAVLLAIG
FT                   YGVTLVRRPAARPSRTVAGMVAATLLVTTAAVAVGAGQPGLHGERLLVVLREQADLSGV
FT                   PAATGRAGRDRRAAEVYRRLVETAERTQAGLRRELRRFRLDHTPYYLVNAIEVDGGPLV
FT                   RAWLAGRPEVDRVLVNQRVRPLPAPAPVVPGDAPPPRGAEWNIRLIRADRVWSELGITG
FT                   TGVTVGSSDSGVDGNHPALGAGFRGGDDSWFDPWNATSAPRDRNGHGTHTLGSAVGRDG
FT                   VGVAPGATWTGCVNLDRNLGNPALYLDCLQFMLAPFPSGGDPFHDGRPQRAPEIITNSW
FT                   SCPPLEGCDLGALQPAVAALAAAGILVVFAAGNSGPRCRSIEDSPTADPEVLTVGAVDR
FT                   QRRVTDFSARGPVPGDGAKPDLVAPGGDVLSALPGGGYGVFSGTSMATPQVAGVAALMW
FT                   AANPALIGDLPRTRQILTETATAVRVSGDRCGDEAHVAGAGLVDAYAAVRAAQG"
FT   gene            311670..313589
FT                   /locus_tag="Strop_0272"
FT   CDS_pept        311670..313589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0272"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52757"
FT                   /db_xref="GOA:A4X1K7"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K7"
FT                   /protein_id="ABP52757.1"
FT                   /translation="MSSDSSSVGAGTECSGFRGCSDRDGEGYRGGVRDPNVSRATASQL
FT                   SPQRRAADLRSLAVEHFDVLIIGGGVTGAGAALDAASRGLKVALVEARDYAAGTSSRSS
FT                   KLIHGGLRYLEQLEFGLVHEALTERGLLATRLAPHLVRPVPFLVPLLGGGLRDLPARTL
FT                   RRSYYGAGVAAYDAFAGVFGGGRGMPLHRHLTREGARRTFPSLKAEGLAGAIRYYDGQV
FT                   DDARLVVTLARTAASLGATVVTSARAVGLIRQAREVTGVRVRDLEAPADSPGAEFEVRA
FT                   RTVIAATGVWSDDMSRMLDDVGLRPRVRVRASKGVHLVVPRSAITGETGLILRTATSVL
FT                   FVIPWGGHWIVGTTDTDWRLDRSHPAASARDIEYLLAQVNTVLDRPLTTADIEGVYAGL
FT                   RPLLAGEADSTSKLSREHAVIEPMLGLLLVAGGKYTTYRVMAADVVDRAAYRLGAARRS
FT                   RTADLPLLGADGYAAMWRDRADLARRHGVPVGVVEHLLERYGSLTLELLALIDADPLLG
FT                   SPLAGAPEYLAAEVTYATRAEGALHLEDVLDRRTRISIETAHRGLESAEHTAELMGAVL
FT                   GWDADARAREVAHYRARVAAERNSQLMPDDATADTARLGAPDVRGFAADRGEDDSVESA
FT                   APSP"
FT   gene            complement(313682..315076)
FT                   /locus_tag="Strop_0273"
FT   CDS_pept        complement(313682..315076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0273"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52758"
FT                   /db_xref="GOA:A4X1K8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K8"
FT                   /protein_id="ABP52758.1"
FT                   /translation="MGPLLDELRAALGDDAVLTDPDLLRAHQRDEADLCAAGTPLVVTR
FT                   PRDTAQVAAVVRAAARHGAPVVPQGARTGLAGAANAVDGAVVISTSALTTILEIDPVSR
FT                   IAVVQPGVVNAALGAAVAEHGLWYPPDPVSWESSTIGGNVATNAGGMCCVKYGVTTEYV
FT                   LGLEVVLASGEVLRTGRRTVKGVAGYDLTRLFVGSEGTLGVLTEVTVALRPAPAESLTM
FT                   VAVFPGTSAAGAAVAEIAAQGLSPSLLELLDQTHLRAIEAYQPMGLRRDAAALLLAAVD
FT                   TGAHAADDLAALAAVCTAAGADEVYAATDAAEAAALLQARRLAHPAMERFAADTYPDGN
FT                   GGLVIDDVAVPRGSLAAMLDGVARIAAECDVPIGVVGHAGDGNLHPNIVVDRADPASLD
FT                   RGRRAFDEIMRLGLELGGTCTGEHGVGLLKREWLAEEVGPVGIRVHQAIKAALDPTGLF
FT                   NPGKVL"
FT   gene            315328..316527
FT                   /locus_tag="Strop_0274"
FT   CDS_pept        315328..316527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0274"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52759"
FT                   /db_xref="GOA:A4X1K9"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1K9"
FT                   /protein_id="ABP52759.1"
FT                   /translation="MDIDGARIAATVQRLRHRGHATLQDRLHRVRATLVLSVQAGLAAG
FT                   ISWLVAHELLGSPQPVFAPISAVGTLAVSVGQRFRRTVELIVGVAVGVAVGDLLIFLLG
FT                   TGPWQLSLVVTSAILLTVFAGGSVAILIQAAATAVLIVTLSPAGHNLEIPRFLDALIGG
FT                   SAALLVTALLLPLNPVRVLNRAARPALDLLADQLDEAADGLRERERDKVQHSLEQLRDH
FT                   KEEVASFDEAIQGAKETATLSPARWHRRNELTHYAEAADPIERAIRNASTLIRRAITLI
FT                   EDAEPIPEPMPASMGHLAESVRLLRHEFAVGEEPERARERSLRAVSEAAQAYTEGVGFS
FT                   GSVVVAQVRTIASDLLVASGVSQEEANRLVREAFGDLKQKKHVESEQPERKSEPPSNGG
FT                   "
FT   gene            complement(316552..317796)
FT                   /locus_tag="Strop_0275"
FT   CDS_pept        complement(316552..317796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0275"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52760"
FT                   /db_xref="GOA:A4X1L0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L0"
FT                   /protein_id="ABP52760.1"
FT                   /translation="MTCALAPSPTVAGPLNVLGVPDQINLDYAASAPCAQAAADAVTAL
FT                   LPWYASVHRGAGALSQHCTLAYERARQTVGDFFGARPDDHVIFTRNTTDALNLLARALP
FT                   AGTTVVTFGGEHHANLLPWPRGPVRLPMPEHPAGAVRALDAALGELRRGADREPPVLVT
FT                   VTGASNVTGERWPLAELAQVARRHRARIAVDAAQLAPHAPVDIRALDVDYLAVSGHKLY
FT                   APFGAGVLIGRGDWLDAAPPYLAGGGATSHVGVATHDIRWAAGPGRHEAGTPNLLGAVA
FT                   LAAVCDALASADRAALHDAEQRLLDRLREGLAELPDAVELHAFGPAAPRVGIVSFVLAG
FT                   RDSAEVAAHLARRHRIGVRDGLFCAHPFARRLLTEASARSGRRDLPATALRASIGLGST
FT                   REQVDHLLAALAALD"
FT   gene            317984..319492
FT                   /locus_tag="Strop_0276"
FT   CDS_pept        317984..319492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0276"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52761"
FT                   /db_xref="GOA:A4X1L1"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L1"
FT                   /protein_id="ABP52761.1"
FT                   /translation="MWPAGQAGGDYADGMAETPPGAPPPSPTTAVPAAAPQMPSRRRNW
FT                   RRFLVLAGVILLIAACAVFMLWTLGESLGAEALLIGVFAAVLPVPVLVACFLWLDRYEP
FT                   EPLRYLVFCFAWGAFVATAVSLTVNTFAANRFEAAGLPTALTAVLVAPFIEELTKALGP
FT                   ILLLIFRRREISGITDALVYCGLSAIGFAMVENILYLGGIGYRTGVEEYGPATGTQQVI
FT                   AIFIFRILLFGFAHPLFTSMTAVGLGIAARSADRRVRVLAPAAGLLLAMMLHGAWNLLP
FT                   TLTQATGQLLIQLYGLIGVMVPIFFGMVALAVWLRSWEGRLTERTLPDYVRSGWLTPPE
FT                   VAALSSLGRRHAARVWAKRVGGDQGRKAMRGYQFAATRLALLRDGMRRGLDDRPAERER
FT                   AVAEERYLLELMSGYRAFFVGRDPRAPAGVWDGHRYHLRFPDGSQRAVAAPEEPVVPIP
FT                   VVLAPPSPPAFPPGYPPPPGYPPPPGHPPPGWYGPPTSGRPGQF"
FT   gene            complement(319543..319710)
FT                   /locus_tag="Strop_0277"
FT   CDS_pept        complement(319543..319710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52762"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L2"
FT                   /protein_id="ABP52762.1"
FT                   /translation="MPVLLKKLLFWGFIAFLIYFMAFRPEGAAEMVKAIGGVLMAMAQG
FT                   LGDFLTSLMT"
FT   sig_peptide     complement(319606..319710)
FT                   /locus_tag="Strop_0277"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.967) with cleavage site probability 0.878 at
FT                   residue 35"
FT   gene            complement(319798..320136)
FT                   /locus_tag="Strop_0278"
FT   CDS_pept        complement(319798..320136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0278"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52763"
FT                   /db_xref="GOA:A4X1L3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L3"
FT                   /protein_id="ABP52763.1"
FT                   /translation="MTNDEHLDSGLPIRLLHDRVLVRMEGSEGERRSTAGIVIPATAAV
FT                   GKRLAWAAAVAVGPNVRSIVSGDRVLFDPDDRSEVELHGRGYVLLRERDVHAVAAERVE
FT                   PDSTGLYL"
FT   gene            320315..321586
FT                   /locus_tag="Strop_0279"
FT   CDS_pept        320315..321586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0279"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52764"
FT                   /db_xref="GOA:A4X1L4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L4"
FT                   /protein_id="ABP52764.1"
FT                   /translation="MRERLRHAYQSVRSRRRSAGLRAGTPATASPASPRPAPAPPPPPA
FT                   VGTKTSAPLHSSTTSRDDADVPHALRVGAAWSWRLLAIGIVAWALLRVMGQVRIVIIPL
FT                   AIALLLSALLAPAVGWLLRARFPRSLATAVVLVGGLAAVIGTLTLVVNEFIQGLPVLGE
FT                   KSSQGVRQIQNWLRSGPLRLEDEQLDRYINDVEGWLNENIDGLTSGALSTAATVAEVLT
FT                   GTILVLFATFFFLRDGNRIWRFLVRLMPVNARWKVDDAGRASWQTLGAYVRATVLVACI
FT                   DALGIGIFLVIFEIPFALPLAALVFLASFIPIIGATLSGGVAVLVALVDSGPITALIIL
FT                   GVVIGVQQLEGHVLQPLIMGRAVAIHPLAVIVGIAAGVVLAGVTGALIAVPLIAVLNTA
FT                   VRRLAARTVPETPSDAVVVASRAP"
FT   sig_peptide     320315..320461
FT                   /locus_tag="Strop_0279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.388 at
FT                   residue 49"
FT   gene            complement(321637..323688)
FT                   /locus_tag="Strop_0280"
FT   CDS_pept        complement(321637..323688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0280"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52765"
FT                   /db_xref="GOA:A4X1L5"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L5"
FT                   /protein_id="ABP52765.1"
FT                   /translation="MTPPRAATDSASPQSRTGSRRSGGGVTGADLLAAAVNAVPGGAAR
FT                   PGQQEMTTAIETAVAAREHLLVQAGTGTGKSLAYLAPALTVDGPVVVSTATLALQSQLV
FT                   DHDLPRLADAVEPLLGRRPTFAVLKGRHHYLCLARLDNATEEEPGDTLFDSPKPGGTAW
FT                   LGEAGRLGRQVQRLRDWAEKTDTGDRDELDPGVDEQAWRLVSMPARECVGTARCPFGAE
FT                   CFADASRARAREADVVVTNHSLLAVDMLAGRHIVPPHQLLIVDEAHELADRVSSAAQAE
FT                   LVPESIDRSTRQARPLLRPETAEALTAAGDALAVGLAEAPAGRLTTGLPTPLQEACTLL
FT                   DAATRAALDSIGEVKADDPDPVRKQQAKAVLDELSGTAQRLLEEADHDVAWVERNDATG
FT                   RRALVVAPLSVSGTLATHLYEERTVVATSATLTLGGRFDTVARALGLEVPAATTEAPVT
FT                   SGPDWQSLDVGSPFDYARQGILYVAAHLPRPSASGLPDAAGAELLELVEALGGRTLGLF
FT                   SSRRAAQQAAELLRERTDLPVLLQGEQALPLLVRRFREEQASCLFGVMSLWQGVDVPGD
FT                   ACQLVVVDRLPFPRPDEPLAAARAAAVDATGGSGFAAVSVPIAAVRLAQGVGRLIRATD
FT                   DRGVVAVLDSRLENARGYGPFLRRSLPPFWYTTRPDVARGALERLAKA"
FT   gene            323826..324332
FT                   /locus_tag="Strop_0281"
FT   CDS_pept        323826..324332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0281"
FT                   /product="protein of unknown function DUF402"
FT                   /note="PFAM: protein of unknown function DUF402"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52766"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L6"
FT                   /protein_id="ABP52766.1"
FT                   /translation="MPSDVVRVIYRKYDGSAHRDYPARRLAEDDLGVWLGVPLGTPSVY
FT                   HGRPSVEQIPFVLLVPHHGWWTGMFNPPPRTSEVYCDIASPAHWENDDTVHLFDLDLDV
FT                   VRRRGSGLVELLDEDEFAEHRKRFGYPDEVVTEAHAAAHWLFAALGDGTEPFATSYRKW
FT                   LALVV"
FT   gene            324515..325363
FT                   /locus_tag="Strop_0282"
FT   CDS_pept        324515..325363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0282"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52767"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L7"
FT                   /protein_id="ABP52767.1"
FT                   /translation="MFGIGARGYPPAGSVPGRNGGSTPIKVNRALIESEREWASGGPVH
FT                   SAFWRHLAFPLRSPREVAATPHRHDEVRPVKFSFRPNEGAFYELFTRAAQNLVRGTELL
FT                   NELALPGVEVQSVSERLTEVEHDSDQITHELYKKINSTFITPFDREDIYRLGSLLDDVM
FT                   DHLEAVGNLLYLYGLTELPSLPREMHELVNVLDQQARLTAEAMPRLRSMRDLEDYWIEC
FT                   NRLENDGDQAYRMLLVRLFSGEYDALTVLKMKEVADELEAACDAFEHVANTVETIAVKE
FT                   S"
FT   gene            325367..326371
FT                   /locus_tag="Strop_0283"
FT   CDS_pept        325367..326371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0283"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52768"
FT                   /db_xref="GOA:A4X1L8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L8"
FT                   /protein_id="ABP52768.1"
FT                   /translation="MTPELVAVLAVIAVALVFDYTNGFHDAANAIATSISTRALTPRVA
FT                   LAMAAVGNFIGAHFGAEVAKTVGSGLVKLPTGTPSLAIVFAGVVGAIVWNLITWYFGLP
FT                   SSSSHALIGGLVGATVAASGAVLWMGIGQKVVLPMVLSPMVGLLLGYLVMLAVQWIFRR
FT                   GHPGKLNRGFRWAQSASAAAMSIGHGMQDAAKTIGIVVLALFVGGFQDDPTYIPEWAFW
FT                   TSAAVLAAGTYAGGWRIIRTLGRKIIDLRPPEGFAAETVASSVLYFNALVLGAPISTTH
FT                   TITSAIMGVGVTKRLSAVRWGVAGNIVGAWILTFPAAGSIGALTYFLVRPLFS"
FT   sig_peptide     325367..325459
FT                   /locus_tag="Strop_0283"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.677) with cleavage site probability 0.623 at
FT                   residue 31"
FT   gene            326424..327314
FT                   /locus_tag="Strop_0284"
FT   CDS_pept        326424..327314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0284"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52769"
FT                   /db_xref="GOA:A4X1L9"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1L9"
FT                   /protein_id="ABP52769.1"
FT                   /translation="MTSDGDGFPAPSALVEHARRFREQGGTPAVPRVAATVLLLRPADD
FT                   VAGAGSGMDRPNGLSAPPSARPYGFEAYLIRRVAAMAFGGVYAFPGGGVDPSDSTAHVD
FT                   WAGPTPAQWGARLGLAPTSAQAVVCAAAREVFEEVGVLLAGPDADTVVGDVSGADWETA
FT                   RVALERREVGFADLLAQRGLTLRSDLLLPWSRWITPEFEPRRFDTYFFVARLPVGQRTR
FT                   DVSGEADRTLWISPADACAGELTMLPPTLVTLGQVAACRDLAGVVAAAATRDAASPVTP
FT                   RLEDSGAGPPRFLLR"
FT   gene            327477..328121
FT                   /locus_tag="Strop_0285"
FT   CDS_pept        327477..328121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0285"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52770"
FT                   /db_xref="GOA:A4X1M0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M0"
FT                   /protein_id="ABP52770.1"
FT                   /translation="MVRSGYDEQLDRLTGALAVMSREAAAAIRGAGTALLDVNREAAEQ
FT                   VVRNDAVLDQLRWDIEAAVPELLARQQPVASDLRLVLCAIRIAADLERMGDLAVHIAKV
FT                   VQMRYPVMVVPPPAAVVVTEMAEAAARIAEKASTVLTTRDPLTAMQIGLDDDEVDTAQS
FT                   RLLSLLLASWQYGVESAIDLALVGRYYERYADHAVNVARQVVYLVTGTIRL"
FT   gene            328389..329336
FT                   /locus_tag="Strop_0286"
FT   CDS_pept        328389..329336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0286"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52771"
FT                   /db_xref="GOA:A4X1M1"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M1"
FT                   /protein_id="ABP52771.1"
FT                   /translation="MLSRRILAGTALAALALTGCSSNNNEDADGGEKLSGEVKVNGSST
FT                   VAPLSEAAATFYREVQSGVNVSVGTSGTGGGFERFCKGETDISDASRPIKDSEIEACEA
FT                   AGIQYKELIVANDALTVVVSKDNDWADCLTVDQLKAIWEPNSQITSWNQVDPSFPDEPL
FT                   KLFGPGTDSGTFDYFTDEINGEEGASRTDYTASENDNVVVQGVAGTKGGLGYFGFTYFE
FT                   ENADKLKALKVDGGSGCVEPSLKTAQENTYQPLSRPLFIYVSDSGVKKEQVADFVTFYI
FT                   ERIDDIVTEAQYVPLTEEQKSTLQAEFDALKAAA"
FT   sig_peptide     328389..328475
FT                   /locus_tag="Strop_0286"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.790 at
FT                   residue 29"
FT   gene            329338..330285
FT                   /locus_tag="Strop_0287"
FT   CDS_pept        329338..330285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0287"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52772"
FT                   /db_xref="GOA:A4X1M2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M2"
FT                   /protein_id="ABP52772.1"
FT                   /translation="MAISTSNAGSAAGSALRRGRRRPVDSTVKVLLVAAALVSVATTIG
FT                   IVIALVQPTIGFFQQVSIVEFVTGTSWTPTFAQKAYGVLPLVAATLTVTGVALAIAVPL
FT                   GLGSAIYLSEYANPRTRKVLKPIIELLAGVPTVVYGFVALFALNPLLQKWWPTDNGPAF
FT                   QNLLIAGIAMGIMIVPTIASISEDSMAAVPRSLREGAYALASTKMQVSTRVVVPAAMSG
FT                   IVAAVVLGISRAVGETMIVTIAGGLTSDRIVLNPLEGAATMTAFIANISSGDIPVGSLD
FT                   YDSVFAVGALLFLITFALNAVSIRMVRRFREVYE"
FT   gene            330282..331202
FT                   /locus_tag="Strop_0288"
FT   CDS_pept        330282..331202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0288"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52773"
FT                   /db_xref="GOA:A4X1M3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M3"
FT                   /protein_id="ABP52773.1"
FT                   /translation="MSTPTITTETRPDSSASGNALTQRRSRPGEVAFRLAMQACLLIAF
FT                   GVLAALLTWVLVKGWNRLDSRLWTEMPTGLVSRLDSAGVQSALVGTLWIISLVAVICLP
FT                   IGILSAIYLEEYADNTRWYNRLLELNIQNLAGVPSIIFGILGLGIIARALGLGFTVITA
FT                   AIVLSLLVLPVVIIATREAIRAVPQSIRHASYALGATKWQTVSRQVLPSAVPGIATGSI
FT                   LALSRAIGEAAPLIVLGAVTFITFNPDGLDSGYTALPIQIYTFITRSQSEYTELAAGAI
FT                   VLLLAIVLAMNSIAIFVRNRFEKRW"
FT   gene            331264..332130
FT                   /locus_tag="Strop_0289"
FT   CDS_pept        331264..332130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0289"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: phosphate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52774"
FT                   /db_xref="GOA:A4X1M4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M4"
FT                   /protein_id="ABP52774.1"
FT                   /translation="MNPTDTTNRPGVSIAGVGAQSTGTPKSDAADPVMELSGVSVYYGA
FT                   YEAVRDTSMPIQEKQITAMIGPSGCGKSTILRSLNRMNDLIPGARVSGSVTYHGQDLYV
FT                   KDVDPIEVRRRIGMVFQKPNPFPKSIYDNVAYGPRVTGMKVSSMDDLVEKALRDAALWD
FT                   EVKDKLKTSGLALSGGQQQRLCIARTIAVRPEIILMDEPCSALDPIATAKIEDLMSELS
FT                   NDYTIVIVTHNMQQAARVSHYTAFFTAEVDERQERHGRLVEFSQTGKLFTNPADKRTED
FT                   YITGRFG"
FT   gene            332148..332903
FT                   /locus_tag="Strop_0290"
FT   CDS_pept        332148..332903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0290"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52775"
FT                   /db_xref="GOA:A4X1M5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M5"
FT                   /protein_id="ABP52775.1"
FT                   /translation="MNSVVENTKGDYRTEGRFLLFVVDEDKVAGPELVTELSALRVQGR
FT                   YFPHAAEALLAAGALQPDAAVVSAGLTTMASTELVRLLVGQAGIPTLVGVGDDDGSVAV
FT                   GALRAGATACVRRPYRVDEVVPILRGIRPETAGSLDPPVELGGLRMEPATYEVTLHGRP
FT                   VSLPLKEFRLLYFFMTHADRTVSREQLLSAVWDGSTGESSNTLTVHIKRLRKRLEAEGE
FT                   PQPLIITVRGLGYRFTPPEQMEPSSTTPL"
FT   gene            complement(333066..333989)
FT                   /locus_tag="Strop_0291"
FT   CDS_pept        complement(333066..333989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0291"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52776"
FT                   /db_xref="GOA:A4X1M6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017813"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X1M6"
FT                   /protein_id="ABP52776.1"
FT                   /translation="MNSTEPDSDRVTRTDRLNAPEIADVQALARAAGDADGADPFDEHT
FT                   LLRLRDPHAPTHHLTARTANGTLTGYAHLDITNPTSGTGVELAVHPAYRRRGTGRALAR
FT                   SVRAAVTGPLRAWAHGDHPSAAALAVDLDYRRARVLWQLRRPLTAPIPEPPLPDGVTLR
FT                   AYRPGADDDAWLALNAKAFADHPEQGQWTAADLQARRDEPWFDAAGFLLAVDPAGQLLG
FT                   FHWTKIHERPGSARIGEVYVLGVDPTAHGGGLGKALTAAGLAYLRDQRGLDRVMLYVDE
FT                   SNTAAVALYERLGFARWSAHVNYQLG"
FT   gene            complement(334015..334968)
FT                   /locus_tag="Strop_0292"
FT   CDS_pept        complement(334015..334968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0292"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52777"
FT                   /db_xref="GOA:A4X1M7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M7"
FT                   /protein_id="ABP52777.1"
FT                   /translation="MQTKGGGPTRMGGLRQFTPATRSLAIAAVVVIALLGSAFAIGRGI
FT                   APTGAPVTSSATTPHPTDQPAAPETPAPDDSSATAEAHDGGTVAVPEPTAVDESSPAAA
FT                   EPTAPEPTASSDYYDEGTQRTTGTSTVALTFDDGPNPQYTPQILTSLREYGVTATFCVT
FT                   GKNASAYPELIQAIVADGHTLCNHTWNHDIALGSRSPDEIRADLIRTSDAIHAAVPDAP
FT                   IAYYRQPGGAWTYSVVSAAQELGLTPLHWTIDPRDWETPGADPIATTVLDEVGPGSIVL
FT                   LHDGGGPRQDTVDALSQILPELITRFPVAALPPSIT"
FT   sig_peptide     complement(334798..334968)
FT                   /locus_tag="Strop_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.399 at
FT                   residue 57"
FT   gene            complement(335061..335780)
FT                   /locus_tag="Strop_0293"
FT   CDS_pept        complement(335061..335780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0293"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52778"
FT                   /db_xref="GOA:A4X1M8"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M8"
FT                   /protein_id="ABP52778.1"
FT                   /translation="MIVEILLLVTAHAGEPSAVLPALDLLPHSVRTAPRDVRTLVAGPS
FT                   PDVVVIDARSELSEARDTCRMLHATGLNAPLIAVVTEAGLIALNADWGVDDVILASAGP
FT                   AEVEARLRLVIGRLADTTMGADSSIRAGELTIDTDTYAAKLKGRPLDLTYKEFELLKFL
FT                   AQHPGRVFTRDQLLREVWGYDYFGGTRTVDVHVRRLRAKLGSEYESMIGTVRQVGYKLV
FT                   VPPARALPESEPAPISV"
FT   gene            336024..337055
FT                   /locus_tag="Strop_0294"
FT   CDS_pept        336024..337055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52779"
FT                   /db_xref="GOA:A4X1M9"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1M9"
FT                   /protein_id="ABP52779.1"
FT                   /translation="MLPSRRPETGREPWPEQPSSGPPAPRAGGDDGGPERGGTRRVRRD
FT                   GEPGRRPAGDPDDGHDQDVEETPPVEVRRSLALAVAGFAVLLGLGLVLAAQTSGPGHRL
FT                   PFTAVILGVQALSVLAWTMASRPPALMTVAGVGVATAIVADTVAVRSDPARLMPLVQVL
FT                   LVGLAAAVVGQFVRRVDRAQVIESLRGTMLIVAGSVAFPTMIVLTRIPMGTQVIMVCLV
FT                   AAGVALAVARITDAFAAWPRLAPQVPRGAAGVVGGAMIGTMVSAVLGSYLVTPFTPTRA
FT                   AIMGLVAAVVAVLADLAVGYAEAGRVMAGEPSPRWGIGHMQGPLTGFALAAPAAYVLCK
FT                   LVL"
FT   gene            337152..337943
FT                   /locus_tag="Strop_0295"
FT   CDS_pept        337152..337943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52780"
FT                   /db_xref="GOA:A4X1N0"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N0"
FT                   /protein_id="ABP52780.1"
FT                   /translation="MTTEERPYQDERPRPQRGRRVLVVLLVLLLLLVGLLVVADRVAAG
FT                   VAERALTEQVREELATQGVQAGPPEVEIGGFPFVTQVLDGRYERISIGLKEVRGSVQGD
FT                   VLALPTLDIDAYDVTASLDTLRSGRGGVIAGSVTGTGTISYDSLATRLDREGLQLGERD
FT                   GRLAVTAPVDILGQQVPVSGTADITVEQGQVALRFTGLTAEGLPNGSLARMLLSNFAEG
FT                   ISVDVPLPALPFDLTVSEVRPLPEGLQITAEAVEVPINAAS"
FT   sig_peptide     337152..337286
FT                   /locus_tag="Strop_0295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.849 at
FT                   residue 45"
FT   gene            338241..339146
FT                   /locus_tag="Strop_0296"
FT   CDS_pept        338241..339146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0296"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52781"
FT                   /db_xref="GOA:A4X1N1"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N1"
FT                   /protein_id="ABP52781.1"
FT                   /translation="MHHRLPRAGSPSILTRSDLMSRDSALVSADWAEKNLNTPGVVFVE
FT                   VDEDTSAYDTGHLPGAIKLDWKTDLQDQVRRDFVNKDQFAALLSERGIANGDTVVLYGG
FT                   NNNWFAAYAYWYFALYGHGDVRLLDGGRKKWELDARPLTTEAVSRPATQYVAQEPDHTI
FT                   RAFRDEVVAAIGTKNLVDVRSPDEYAGRLLAPAHLPQEQAQRAGHVPTAISVPWSKAAN
FT                   EDGTFKSDQELREIYAAAGLDDSRETIAYCRIGERSSHTWFVLQELLGHRNVKNYDGSW
FT                   TEYGSLVGVPVTLGDEPGKE"
FT   gene            339152..339478
FT                   /locus_tag="Strop_0297"
FT   CDS_pept        339152..339478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0297"
FT                   /product="protein of unknown function DUF1416"
FT                   /note="PFAM: protein of unknown function DUF1416"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52782"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010814"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N2"
FT                   /protein_id="ABP52782.1"
FT                   /translation="MTASTAAGCAAPDQAAPLPASLDLEKETVITGVVHDAAGEPVTGA
FT                   YVRLLDSADEFTAEVVTSPAGQFRFFAAPGTWRLRALSRHGNGDTVITASRGINEAAVT
FT                   VAVE"
FT   gene            complement(339696..340091)
FT                   /locus_tag="Strop_0298"
FT   CDS_pept        complement(339696..340091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52783"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N3"
FT                   /protein_id="ABP52783.1"
FT                   /translation="MRNPFRRFRRWRDRPAPSHPTARTDSLIGANVRRPTGTDSEVDRH
FT                   RSYAGNAGGHHRSATHWPLTPEQVRQQQFPQVRRGLDASEVELFLYRVAADLSAVQTEL
FT                   RRTRDENIRIKRALRDWQSRFTPGVRA"
FT   gene            340295..340534
FT                   /locus_tag="Strop_0299"
FT   CDS_pept        340295..340534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0299"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52784"
FT                   /db_xref="GOA:A4X1N4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N4"
FT                   /protein_id="ABP52784.1"
FT                   /translation="MPATPDYIRISDEIIDDIRSGRYEAGDKLPSIAQLCERYHVSPST
FT                   IQLVNVRLEALEVINRHQGKGVFVTDPKTWLRKP"
FT   gene            340915..341394
FT                   /locus_tag="Strop_0300"
FT   CDS_pept        340915..341394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52785"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N5"
FT                   /protein_id="ABP52785.1"
FT                   /translation="MPATGHRWKKEGGGYCSPMSFEPLSTMESALWGLLGSFIVEALEL
FT                   GAALRRAKTLPWNRPDEPGLPAYLASVVLRLAAGAGLAALIGADGQLASPFAAGLLGIT
FT                   APLLIEKILRQVDMAPAEATTPHHHSTLPLTRSVPPPIAKDQKRAPGEAGSSDVD"
FT   gene            341384..342175
FT                   /locus_tag="Strop_0301"
FT   CDS_pept        341384..342175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0301"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52786"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N6"
FT                   /protein_id="ABP52786.1"
FT                   /translation="MSTDSFRRQLVLALGRSTPAFHSPRAARPGRLRHLIDALSRRTPA
FT                   FASQQTVDLSSADLHQDDSRTADLRKSDLAGVELNNRDLRETDLAGVNLARANFAGVDL
FT                   TGANLAGVDLRGADLTDVDLTGANLAGVDLRGADLTDVNLTGALLIGADLTGVDLAGVN
FT                   LAGVDLRGVNLTGVDLTSADLREANLDRANLTGVNLREANLYGAVLTSTTLAGARWDWA
FT                   TIWPPDRAAEIWFRSAEWPDQPGVYVVLPDAGGRIRPSVVV"
FT   gene            complement(342419..344425)
FT                   /locus_tag="Strop_0302"
FT   CDS_pept        complement(342419..344425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52787"
FT                   /db_xref="InterPro:IPR023294"
FT                   /db_xref="InterPro:IPR036813"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N7"
FT                   /protein_id="ABP52787.1"
FT                   /translation="MFRPTHVRRRGTVPRRSALRLGLAIALIGSGITVTAGAHPAQASE
FT                   DAFSCTGAAQFFNSTSSGTLTHRKYETPGYDDGSSGEWTAATTIGVGWQQFGRVLGGPD
FT                   GRVYGIKSEGMFRYRWTGFGWERIDGAQGPQISSSFGSYAESANRNKITIDESGDFYTI
FT                   DDTGRLRWHRYSESSKTWTIDGRVIDTGWDRYNLLFATSPGVLYARAADDRLYRYRFDP
FT                   TTQRWISYNLHVGSGWGYYTSIFSAGGDTVYGVLDNGDLYQYRYREDLLDWELVFHKAG
FT                   WGWRFPEIFATTNTCHQGAISSPALPSIPLQPNMPIAAMQAPAASTALGTLEIAYNDNI
FT                   GQIRHGRANPDALATIQWSAPANIVHVGTPALVADAEDNVNVFSQTSTSDIQRLTQKAP
FT                   ASPDWKPWLELGGAMKSAPAAIQLSDDSLAVFAYDTNGTLWSRQQDGTTGELLPWTSTG
FT                   ATGLTGTPIAQIGPDRTATILATTSTGKVQTATWQAGTLTTEWTDLGDTQFTGSLTTTL
FT                   LPGYRVMAVGHATNGTIQTQLQNINGTWPGTWTTIGDNSITPDGSPSTILSPTTGRAWV
FT                   FIRATDGNIYRTRHTAAGSTTWTTWGPVTSGETYPVDPTAFTWQNSNGHQIAFVTRNTN
FT                   GSIRLYAADETTTTTKTTTEPTFTQHNIPTPHQ"
FT   sig_peptide     complement(344294..344425)
FT                   /locus_tag="Strop_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.958 at
FT                   residue 44"
FT   gene            345006..354827
FT                   /locus_tag="Strop_0303"
FT   CDS_pept        345006..354827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0303"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; SMART: Hedgehog/intein hint
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52788"
FT                   /db_xref="GOA:A4X1N8"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N8"
FT                   /protein_id="ABP52788.1"
FT                   /translation="MSFGPRRTFDRSAQPSRRAPLLRTGTVRSLVAAAMVGVLALGLGG
FT                   GGVSGLSPLPVAGDEAGRRAAAGAPAQKWSSAATGSDHVARGRVNRELPTTQRGRHPLH
FT                   RLAQEPKSVVNKASVEQPPAGEAKGFDQKTSREQPAERDANQRVYHNADGTQTVEFSSA
FT                   PINYQTSDGNWAPIDSSLVPSSDGGWQNAADATQVRLAPRSDAGDLVRLIFDEDIEFGY
FT                   SVADAAGTVGQVTGDAIVYPGVRPEMDLRLEPRPGGVKETLVLHSATAPTSYLFPLHLR
FT                   DLTARLVDGQVVLTDKAGVQRGVIPPGYMVDAGEGDRGPATSTGVRYELVNVDDQPALR
FT                   LTLDSAWLSDPDRRFPVEVDPTVGPPVTSEGADSSMYVHGSSSTSGGQELLVGRASGSN
FT                   AAAYLTFNGLVDQLRDQTIHGAALSVVNYDAASCKPRKITVHPVTESWTAGTGHSYPGP
FT                   SVGSSLASRSFAHGYIGLGQSQSACPAANEMFDLGTAGRDLVQRWVNGEQANNGLSLRA
FT                   PTTDSSAWKRLAGTGTANAPTLYITHSPYNAEYAIPNPTPEPPVLRNQDGNVQVTVTNR
FT                   GSEDWTPANYYLAYRVYNAQTGEAVTQQRSASLPSTLARGATVTLDASVKRLEPATYFL
FT                   DFTMVRTGGAVFTDHQVPPGRIVLQVFDVPPVVQELYPPNGYQAPTLNPLLWAQAVDTD
FT                   APPGATLSFKFEVCDRTDDGGETNCTDSGYLDEHAWVIPDGRLSWGESYLWRAYVRDGA
FT                   NEVRSPDSVLLTSVPQPDVLSRIARSPDAERGRDFDTQVGNVSTSAIDVTAMTVGPELN
FT                   LLRTYNSLDPRPSAVFGAGWSSRYDMKLTPDDDGSGNVVIRYPDGQEVRFGRNSDGTYV
FT                   APSGRVARLTLDDTGWKLRDRSGTTYEFSLTGKLVRITDKMARSVKLVYDVFSGKLARA
FT                   QVANSFTNTAGRALHFSWTDDHITAVKTDAIDGAPLTWTYSYSGDLLTKVCSPTDACTS
FT                   YEYAEGSHYRTAVLDARPDSYYRLGESEGTAAASDVAINLGKDSATYHHVTLAQPGVIE
FT                   GVGDTAASFNGASSHVELPKGLVKKSRDTAVELWFKVGKTQTGGPLIGYQDKALDSAAT
FT                   NGVPILYTGIDGRLRGQLAGGTIAPISSTVPVNDGKWHHVVLSAMGNVQTMYLDGVKVG
FT                   ERTGQTIEHSLLTFNQVGAASATTPGSWPGWGWTARRYFAGTIDEVAVYSHPIGPKTAA
FT                   AHFEYAKPAAQQLTKITLPSGKVASEVVYDTATDRVKEYTDENGGTWKIGQPAIYGGDD
FT                   DLRRSVQLLDPANRPHLYEYDALTGQMLRSGIPLGLETRREDQPGEPTPSPGPPPGETC
FT                   TEPDPIDPAFCTIIPDDSGGPVFVEHPLDGMAIRSYSYDEKGYQTKVTNENGDSVEMTY
FT                   DSKGRLTTRKNCRTTSECHTRYFTYSATITDRLDPRVDLVVESRDSRSSSPTDNQYRTT
FT                   FEYAIDGQLTRQTNPDGSTVRHTYTFGAEVAVGGGNPPAGLIKTSTDARGKVTRFVYYS
FT                   NGDLARVTEPGGLVSEYTYDTLGRQLTEKIVSDSHPEGVTTTFTYDDHSRVKTVTGPVV
FT                   TEEISGAEHQARTTNEYDADGNVTEVTVADLLGEDPERIVTTEYDEYNRPVRMIDAEGN
FT                   EESYEYDRFGNRTSMVDANDNRYDWAYTAQNKVAEVRLRGWRSDPDGIPAPDTGDYLVL
FT                   HAYSYDHAGRLASDTDAMGRRLEYTYYRDDRLHAITMKDFRDQDGTTRDYVVEERQYDA
FT                   AGNLTLKKEANGTRTSEFMYDRAGKLLTSVLDPTGLTRTETMAYDLNGNVTRTTRSGKA
FT                   SNVPWVVPVVTETVDYTYDDDGNLLTEKVTAGSETRTTSYTYDQRGLRLSATDPRGNVS
FT                   GADKAAFTTTYEYDELGRQVSSTGPAAAAESDGGEPVTTRAEVAFSYNTFGEQVAARDP
FT                   RGQISHVEYDKLGRPVRTLAPAYLPPGVSEQIIPETRQSYDGLGNVVEAIRPSGTTKFT
FT                   YDQLNRLVARDDPASTNDDRAVTHYTYTRVGEVLSVTDPTGARIESTYDDLDRQITQTR
FT                   VERQPTPRNLVTQMAYDDYGNLTSVVSPSGATTVNAYDSVGDMIRTTAPTGESMVFGYD
FT                   YAGRQIRASDGLGRTVSIEYDRFGDRASDASLDADGTLLRRQTYEYDEASNMISSTDPY
FT                   GTVTRYEYDALSRLRKQIEPVTDKKSITTTFGYDVAGNRTRYTDGRGNSTTYTYNTLGL
FT                   PESTIEPATTAHPAVADRTWTVGYDAEGQAVRLSAPGDVSRQRTYDAGGRLTAETGSGG
FT                   DTATTARELSYDLVGRPTSVSAPGGANSYTYNDQGALLSTAGPSGTASFTYDDDGRMTT
FT                   RTDLTGTSAFDYVKGRLDTITDSITGQAQRLSYDAAGEVETVDYGGGRIRTFGYDDFGR
FT                   VASDTVQNSAGSTVASVTYGFDLNGHLTGKKTTGTAGAGDNSYTYDKAGRLTSWTNPEG
FT                   TVAYEWDDSGNRISAGSKTATFDERNRLLSDGDYTYAYTARGTLSTRTSSGLSEQYSFD
FT                   AFDRLTEADEQTYTYDGLDRVTSRTGTTFTYAGFGDEVVHDGVEYFARGPGGELLATGQ
FT                   GNNERLSLTDVHGDVVAAFDPANTELAALNDSTAYDPFGQKIDSVGDTGNLGFQGDWTD
FT                   PDTGQVDMGARWYDPGTGSFTSRDSVTYAAGDSILANRYGYGAGAPLDFYDPDGHWPSF
FT                   VKKASSWVSNKWKSAKEAVGRTWNSAKSWGSRLWENARTWVTNQYNRVKSALTAAKTWV
FT                   SDKIHAVKNKAREGYAAYQDGKLGDWAKEQARAAAHEVKAKVTRAAKAAQEKLVKFTKL
FT                   PVVQALTKPLIAAKELVSAGVKVAASVVSVTAQAIKDPEKFREKLLNAAAEKVAPLVEG
FT                   VTDVWDKSTQFVEDHAAEIAGIAAGVAVGVGCGMAIGWTGVGAVACGALAGAVGSAVTG
FT                   SVIGKRGSDLLGEVATGAAFGAVGGALGPIAGRAIGAGVRALGGGLRAAGNVGGNLLAS
FT                   GGRAISAGASKVRSLAGRQFNRGCRTNSFTSATRVLLADGSRRAISEVRIGDRVLATDP
FT                   TTGRTEARVVTALIVGAGSKDLVEITVDTDGDAGDQTAKLTATDGHPFWEYGDGRWVEA
FT                   RDLEPGYEFETADHRPATVVAVRKWTEHQQVYNLTVDGLHTYYVVAGSTPVLVHNCTIL
FT                   GAGAPKAGNTAVVGRLEDTAVARDWASHDVLNIPDWTITKNDAWVNAVIKNKQDVYVAS
FT                   PLTHRNLWDAANGRQTVLARELKMLTGAGYKWDGDYLRPPRS"
FT   sig_peptide     345006..345182
FT                   /locus_tag="Strop_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.864 at
FT                   residue 59"
FT   gene            354824..355342
FT                   /locus_tag="Strop_0304"
FT   CDS_pept        354824..355342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52789"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1N9"
FT                   /protein_id="ABP52789.1"
FT                   /translation="MIVMNLDEKSFSFLELSKNVNYGRDALPSARDRQIRDLLLGAADS
FT                   ASLEQVKRLMPGDADRVLNAFAERAASIAVRHQDARELRAGILAAAIAQAITGDLRESL
FT                   AALSLLYRASEMIGHDPNSEFAAANDLSGGRAIGLLDFLRRSPEDKTIQAMGYEEGDDK
FT                   GGFRFVRNW"
FT   gene            complement(355558..359913)
FT                   /locus_tag="Strop_0305"
FT   CDS_pept        complement(355558..359913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0305"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; Kelch repeat-containing protein; Kelch repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52790"
FT                   /db_xref="GOA:A4X1P0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR033857"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P0"
FT                   /protein_id="ABP52790.1"
FT                   /translation="MFVRPSARSRLGRLAVAFGALALGLSAQPALAASPPGASERATVA
FT                   PELLDSSDSTSFMVYLRETAPLASTANLPAPDDRARAVHQLLTNTADRTQRGLRQLLDA
FT                   ERAEHTPYWIANAIQVHGDRALIDEIASRPEVERIEPIRSRPLIEPTPAEAEARIDAVE
FT                   WGIAEIGAPQVWDEFGDRGEGIVVANIDTGVQHDHPALVSAYRGNLGGGSFDHAYNWFD
FT                   PTGICSDSEPCDNNDHGTHTMGTIVGDDGGDNQIGVAPGARWIAAKGCEFTTCSDPSLL
FT                   GAGQWILAPTDVNGENPRPDLRPDIVNNSWGGGGGDPWYQQTVDAWRAAGILPVFSNGN
FT                   SGPSCGTAGSPGDYPNSYAVGAYGSNGAIAGFSSRGSGNELIKPNIAAPGVAVRSSVPG
FT                   GGYAAFNGTSMAAPHVAGTAALIWSIAPSLRGDLPATEALLDRTARDVDDTTCGGTAED
FT                   NNVFGEGRLDAYAAVNEAPRGPVGRISGTVTSTDGGDPIVGATIDDGTRSVTTGTDGRY
FT                   ALTVPAGETTVEVTAYGYESQSDTLTVDEGGAVTRDFALVASPVVTVGGQVTDDSGHGW
FT                   PLYAQVDIAGRPGEPVFTDPVTGEWSATVAGDNTYSITATPQYPGYHTVTREVPVDGDD
FT                   ATVDMAIPVEASCTAAGYTAAYGDPLLTEDFSGTTAPEGWSVVNRTEEGGWVFEDLGQR
FT                   GNLTGGSGGFAIIDSDELGPGNSQDTDLVSPSVDFSETAAPVLRFRSDWRALGTSDSAD
FT                   IDVSTDGGETWTNVWHQTDSLRGPRVEEVPLTGAGGAPEAQVRFRFAGSFAWWWQVDDV
FT                   ALLNRSCNPAPGGLLVGTTSDQNTGDPLNGVTVTSVGQPEDQAVSAGTPDDPAESDGFY
FT                   WLFSSLTGTHPFTATRTPYPPATEDVTIVADEVRRADIALAAGELTVSPTEVESHQPYG
FT                   STRSTRVTVKNTGTAPATVEVLERGGQFELLGQPGAPLREVTVKGISTAQTGTTYGDAP
FT                   ADAGPSADDSWTRVADLPTAVFDNTATSLDGKVYSIGGGTGSGTETKAWVYDPDADSWT
FT                   ELPELPSARAKPGVAAIGGKIYVTGGWGADGNPVATVDVYDPTSETWSTLDGVTSPAPA
FT                   AAAGTAVAGGKIYLVGGCADSACTATDETVVFDPQAGAFTTAASYPYPVSWMSCGGIGA
FT                   KVYCAGGSGGSTYGYQYDPATDTWDPIPDMPLDLWGSAHTTAGGMLVLAGGVTDNSNSL
FT                   TNETVGYDPASGSWQDLPNVEFTRYRGAAACGAYRLGGSPAPFVGSAESERLGGLESCG
FT                   DAAELPWLSTSPSSFTLEPGESRKVKVTLTATAEAGVDQPGQYTGELTFAADVPSSVPP
FT                   VTVEMNVSPPSNWGKLQGTVTGVTCGGETVGVPATVRVNAAGSGAGYTLTADASGAYVW
FT                   WLPKGRYDVIVAKDGWVPEIDRTRVKAGFVGTLDFSLEPSSDCTRASGI"
FT   sig_peptide     complement(359815..359913)
FT                   /locus_tag="Strop_0305"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.966 at
FT                   residue 33"
FT   gene            360124..360624
FT                   /locus_tag="Strop_0306"
FT   CDS_pept        360124..360624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0306"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52791"
FT                   /db_xref="GOA:A4X1P1"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P1"
FT                   /protein_id="ABP52791.1"
FT                   /translation="MSEAKGPIVVCVSPDMAVRERVLRRLDGVGPVLSCADLAELRVML
FT                   FPEPPSGQDRGAGPPETPVSYGELVVDPPGHLVTWRGRPLALTRTERRLLTRLVTPPVR
FT                   LWSYERLFAAVWGGAYLGDTAILHSAIKRLRRKLRLLSGGPRVLTVRGVGYRLVLGSDD
FT                   SGG"
FT   gene            360680..361528
FT                   /locus_tag="Strop_0307"
FT   CDS_pept        360680..361528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52792"
FT                   /db_xref="GOA:A4X1P2"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P2"
FT                   /protein_id="ABP52792.1"
FT                   /translation="MSAVHPGYAPPSGPDRPPPRSRARRWLLAGTLAWAVLLAGLAWWS
FT                   ARTDEPTVQEQRTIGQAVPVVDDAVGRLVAALDGTAWAMTPSRVEQGCRVTPFSAGTEL
FT                   IRGIDVLVAEGGERDLLGKVADSLPERWRAGVRVAADGPLLRADAGEFVLVEGESTSPG
FT                   RVRFTVLTGCRPTDVEFAGLLPESPPEPALRAALQALGRPVPERSDEVVASCPGGAKAW
FT                   TQRVAAGAGPASLSALAPLAAGAVVIDTPEAYAYRRGSGLVVADATGDQLHLAFSTGCV
FT                   D"
FT   gene            361647..362435
FT                   /locus_tag="Strop_0308"
FT   CDS_pept        361647..362435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0308"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52793"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P3"
FT                   /protein_id="ABP52793.1"
FT                   /translation="MTSEDLQFTVLGCATPYPSVDNPCSGYLVTGGGARVWVDAGSGTL
FT                   AQLQRHVRLDELDAIWISHLHADHSADLLTAYYGALYADIQLAAPIPLYGPPGIADRLA
FT                   HFLTNTATRSPIESAFAVEELHDGHRVEVGALTLTSQAVAHGIPAFALRVDNAGRSLVY
FT                   SGDTAPCPGLTSLARGCDVLLCEAESAQAPSAGEQVHHTPEDAGDTARLAEARRLIVTH
FT                   IGRFLTPQQAVTRASTRFDGPIDHAAPGATHPVDRVVTPR"
FT   gene            complement(362573..362947)
FT                   /locus_tag="Strop_0309"
FT   CDS_pept        complement(362573..362947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0309"
FT                   /product="peroxiredoxins-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52794"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P4"
FT                   /protein_id="ABP52794.1"
FT                   /translation="MLAPVGRTLVVKVTAGADAPERCAQAFTIAATAAAAGVDVSLWLT
FT                   GEATWFALPGRAQEFELPHAAPLGELLHVILTTGRLTACTQCAARRDIGPGDVLPGIRI
FT                   AGSAVFLEEIMAEEARALVY"
FT   gene            363062..363652
FT                   /locus_tag="Strop_0310"
FT   CDS_pept        363062..363652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52795"
FT                   /db_xref="GOA:A4X1P5"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X1P5"
FT                   /protein_id="ABP52795.1"
FT                   /translation="MSDENPLQPPWLNAPPVDSYPYEESHDLRTGPKLHPTLDGLLPYI
FT                   GVWRGRGRGGYPTIEDFDFAQEIRISHDGRPFLCYESRAWLLDEQSRPIRPAGREMGWW
FT                   RPVLDGDRATNEWEALMSTPTGVMELHLGKRTGTQLEFATDAVVRTPTAKEVTAGHRLF
FT                   GIVEGALLYAQEMAAVGHGLTPHLSARLIRVGG"
FT   gene            complement(363655..364521)
FT                   /locus_tag="Strop_0311"
FT   CDS_pept        complement(363655..364521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0311"
FT                   /product="aminotransferase, class IV"
FT                   /note="PFAM: aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52796"
FT                   /db_xref="GOA:A4X1P6"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P6"
FT                   /protein_id="ABP52796.1"
FT                   /translation="MTTARIAVLGRGRVPVTEPVLRGDDLGVLHGDGLFETMHLRAGRP
FT                   WLREAHLERMTRAAPALDLTLPPTGALVGLLDEICVGWPSEVEGALRLVCTRGVADGAA
FT                   PTAYATLAPVPPSARAARRDGITVATLPLGVPARGRAGLDWLPTASKTTSYAVHNAARR
FT                   WASRSGVNDALWTSTDGFVLEGPTANVLWLTGGALRTVPAAAGILPGTTVAWLLANAEE
FT                   VGLTAHEQLATPAELHAADAVWFSSSVRGLVEVRVLDGIDRPRSAYTRRLQALLGFPVP
FT                   PDDDQPD"
FT   gene            364558..365082
FT                   /locus_tag="Strop_0312"
FT   CDS_pept        364558..365082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0312"
FT                   /product="nickel uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52797"
FT                   /db_xref="GOA:A4X1P7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P7"
FT                   /protein_id="ABP52797.1"
FT                   /translation="MGPALHHRHGFRRSRAGSTGERCSARANYDRTVSESSLAELLRAR
FT                   GLRLTAQRQLVLQAVLDLGHATPEQVHTAVREVAAGVNITTIYRTLELLERLGLVTHTH
FT                   LSHGSPTFHAAGEDQHVHLVCRECGAIDEIDPALLRPLADQLAAQRGFRVDIGHVSLFG
FT                   RCDRCGNGEQE"
FT   gene            365079..366188
FT                   /locus_tag="Strop_0313"
FT   CDS_pept        365079..366188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0313"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); Glycine cleavage T-protein, C-terminal
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52798"
FT                   /db_xref="GOA:A4X1P8"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P8"
FT                   /protein_id="ABP52798.1"
FT                   /translation="MIDIVGAVSVESIDEASRDQPEPAHAAAGVRSVAAHYGDPLREQR
FT                   TLETGVGLVDRSHRGVIAVPGEDRLGWLHTLTTQHLADLPDGQGTELLVLSPHGHVEQH
FT                   AMVAEEGGTTWLDTEPGDTGGLLGYLERMRFFSKVEPRDVTPDHALLSLVGPAAVDAVA
FT                   TLGVSDLAEPDLLEVPGPKFRAGSVPPRPTVRYDVRALPIGGWARRGPLGVDLLVAREG
FT                   MGRVVAELRGADVPVVGLWAYEAVRVAARRPRVGLDTDHRSIPAEVDLVGPAVHLEKGC
FT                   YRGQETVARVHNMGRPPRRLVLLHLDGVTTDQPPSAGTPVTRDGRTVGFVGTAVHHHEL
FT                   GQVALAVVKRNVPDDARLLVGETAAMIDG"
FT   gene            366300..367142
FT                   /locus_tag="Strop_0314"
FT   CDS_pept        366300..367142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0314"
FT                   /product="3-keto-5-aminohexanoate cleavage enzyme"
FT                   /note="PFAM: protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52799"
FT                   /db_xref="GOA:A4X1P9"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1P9"
FT                   /protein_id="ABP52799.1"
FT                   /translation="MTTGTLITVAPTGAESAKAEVPALPVTLDELLLTAKECEALGASV
FT                   VHVHVRDGEAQPTLDQGRLRETVAALRESTDLVVQLSSGGAVSDPEADRLAVLDAAPDM
FT                   ASCTMGTVNFGADVFLNRWEFIVELHTRMQERGIVPEYEIFDLGHLTALQRLLGTYGLP
FT                   AGGHVHVDFVMGVPGGMPGTPAALVAAEQMLRDLPAGTTFSATGVGRSTIPVLLASLSA
FT                   GGHLRVGMEDTVTYAKGQPVESNMQLVARAVAFAQLAQRLPLTTTEARELLGLPALRR"
FT   gene            367170..368195
FT                   /locus_tag="Strop_0315"
FT   CDS_pept        367170..368195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0315"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52800"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q0"
FT                   /protein_id="ABP52800.1"
FT                   /translation="MAFPIPWLPVGWTFPTGGNVHAVGKTYEGGVPLVEVVRSGFVEGV
FT                   HRGSVVALDATGAAVARAGDVTSPIFPRSSNKPLQTVGMIRAGLRLTDPADLALVSASH
FT                   EGEDFHRARVGGLLARSGLDESALHCPPDLPADEEARAAVLRAGGGPTRIQMNCSGKHS
FT                   GMLLTCQAAGWPVEGYWRSEHPLQERLRAVVEEFADEPVTAIGIDGCGAPVLAVSLSGL
FT                   AMAYLRLVQAEPGSPGRAVADSMRAHPEIIGGTRADDSRVMRAVPGLLAKIGVEGVIAA
FT                   AVPGVGAVALKIDDGAGRARMPVLVSALRRLGVTAPALAEFAEVPLLGGGQPVGLVRSL
FT                   W"
FT   gene            368320..368895
FT                   /locus_tag="Strop_0316"
FT   CDS_pept        368320..368895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0316"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52801"
FT                   /db_xref="GOA:A4X1Q1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q1"
FT                   /protein_id="ABP52801.1"
FT                   /translation="MASGKDLPNIGGFIRDLRRSAKISLRQLSEQAGVSNPYLSQIERG
FT                   LRKPSAEVLQQLASALRVSTPAMYLRAGLLDDREGQGVLAAIAADSDLTMAQKQSLTQI
FT                   YETFRRENARLAEATAAADAASATTEAATGTTTAEPTTGTVTTESVTGLPTTEPEPGPA
FT                   QPSGASADLANIAVTGPTTTGGTPTGGA"
FT   gene            368998..369576
FT                   /locus_tag="Strop_0317"
FT   CDS_pept        368998..369576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52802"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q2"
FT                   /protein_id="ABP52802.1"
FT                   /translation="MTSQPKTSRIPAPLYAAAGAGDLAYQQLRKLPAVVSELRDRVAAD
FT                   LSTVNGAELRQKATETLRTATVTAENLRRRAATDLDLSRLRETATRNAAVVVASAQAAQ
FT                   ERAATTYGALVGHGERVVGAGVLEAADTVNTDMETTEKAPAPTPAQVAEAAEAKPAAVT
FT                   KRATKATGKPATSSTKSPRATKRTPPAGD"
FT   gene            369655..369981
FT                   /locus_tag="Strop_0318"
FT   CDS_pept        369655..369981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52803"
FT                   /db_xref="GOA:A4X1Q3"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q3"
FT                   /protein_id="ABP52803.1"
FT                   /translation="MLAGMAIAAPFAFEVRYVIELILLVFALIVQGVALVHVITQRSDA
FT                   FAAVGTLPKGAWAAILAVCLVLTLLGFGPISLFGLVGIAAGLIYLLDVRTGLRDLRDGR
FT                   GTSW"
FT   gene            369978..370865
FT                   /locus_tag="Strop_0319"
FT   CDS_pept        369978..370865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0319"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52804"
FT                   /db_xref="GOA:A4X1Q4"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q4"
FT                   /protein_id="ABP52804.1"
FT                   /translation="MRGFRWPPPPDGGPRTWGPGPSGPRTGRPALPEPETELAATPHGV
FT                   HLEQLVTGAGDPVTVFAHGLGSGIAATRPFGSGVTGRRLFFQFRGHGRSAAPPGPWSYH
FT                   DLARDLRAVADQGLATRAFGASLGAGALCRLLADSPARFDRLVFYLPAVLDRPRVDAAR
FT                   RRLAALLDALGSGDVGQLAEVVQLELPPAVRNTPSGWAYLRQRLDQLMRDGLASGLADL
FT                   SGSVPVRDAKELGEVAAPALVIGCVGDELHPVEVAEQLAATLPQATLHVYDRPGVLWAK
FT                   RADLRERISAFLNE"
FT   gene            complement(371005..372090)
FT                   /locus_tag="Strop_0320"
FT   CDS_pept        complement(371005..372090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0320"
FT                   /product="Polymorphic membrane protein, Chlamydia"
FT                   /note="PFAM: Polymorphic membrane protein, Chlamydia"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52805"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q5"
FT                   /protein_id="ABP52805.1"
FT                   /translation="MPCDADALIAAITLANARDGAVLDLARDCTYLLTADIDGNGLPVI
FT                   TAPITLNGNKNTTIERAANADEFRILTVDTGGNLTLDHLTITGGQTTSAGGGILVNPGG
FT                   TLTTNRSTVTRNIADSNGGGIVNNGTTRIISSTISHNTADGPGGGIYSLGVIDVKKSHV
FT                   NANTTTTAGAGVMSFGTARIEHSTVTANHAQGTIGGLFISGTGTVTDSKFSKNTALEAA
FT                   GVVMNFDTQLTLKAVTIIENIATQGRAGGLATSDNSSVVVEGGAITNNAATTDGGGIYN
FT                   FADLVLRDTRINGNQADQGAGIYNEETVILFDTKVVKNVAITDGGGIVNDGGTVELNTA
FT                   TGTIVIKNRPNNCVDVPGCAG"
FT   gene            complement(372471..373844)
FT                   /locus_tag="Strop_0321"
FT   CDS_pept        complement(372471..373844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52806"
FT                   /db_xref="GOA:A4X1Q6"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q6"
FT                   /protein_id="ABP52806.1"
FT                   /translation="MGKGIDTAMKHQHHTRPPGVSQAGARRRRWAVGLAGMTGLALTTV
FT                   GIAVVPANAAERPRATAGDRLGKADHPPVDNHRGGSKDTGKKAGKPQGTPVPCDADALI
FT                   AAITLANARGGATLNLAKDCTYLLTADLDSNGLPVITTPITLNGNKNTTLERAAAADQF
FT                   RILTVNVGGDLTLNHLKVTGGHTTDDGGGILVNPGGALTTNHSTITRNIADSDGGAIAN
FT                   NGTTRITHSTISHNTAGGIGGGINSAGLLDIKKSHVKANIATTGGGGVVSVDTARIAHS
FT                   TITANHAQSGNIGGLSIAGTGLVTDTKISYNSGLELGGVGTEIGAQLTLKSATIIGNVA
FT                   RTGRGGGLGVGPRSPVVIEDSVIADNTATTVGGGIFNFGDVVSRNTKITNNQADQGAGI
FT                   YNDETVTLFNTKVVKNVAITNGGGIVNVGGTVELNTATGTIVIKNRPNNCVDVPGCAG"
FT   sig_peptide     complement(373680..373844)
FT                   /locus_tag="Strop_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.996 at
FT                   residue 55"
FT   gene            374024..374932
FT                   /locus_tag="Strop_0322"
FT   CDS_pept        374024..374932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0322"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52807"
FT                   /db_xref="GOA:A4X1Q7"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q7"
FT                   /protein_id="ABP52807.1"
FT                   /translation="MAVRCRTWSDRRRQLALPEWSSAWLGSATMNASRGIAAPIAGAAG
FT                   QFFAGVGLFLRGIGLYLRNPGLMLLGVLPALISGAFFVAAFGTLVYFVGDLAALITPFA
FT                   DDWSDAGRGMTRVAAGLALLGLGGLLTVVAFTAVTLVIGDPFYEKISERVEDGLGGTPN
FT                   AVDVPFWSSLRHSIVDSLRLVGLAVLFGVPLFVAGFIPVVGQTVVPALGATIGGWLLAV
FT                   ELVGAPFYRRGLRLTDRRAALRADRPTALGFGVAVFVSFLIPLGAVLLMPAAVAGAALL
FT                   ARRVLGQPTTVELTGAAQDGG"
FT   gene            complement(374944..375792)
FT                   /locus_tag="Strop_0323"
FT   CDS_pept        complement(374944..375792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0323"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52808"
FT                   /db_xref="GOA:A4X1Q8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q8"
FT                   /protein_id="ABP52808.1"
FT                   /translation="MALRTRVLPHLVRGVASTRQMLAQPPPGQHWTAFVAEVDDEVVGW
FT                   VSTFRNASSSRSVGEISLLHVHPEYRGHGIGSGLLTAVLGHLAPLRLPLLRGRVLPESL
FT                   PYARRRGFLPSRQTRFSALELTALPPPAVPTGARLVPLSEVDPHHVYEVQRDASADEPE
FT                   DVAADALTYEHWRADTWDNVGLDREASAGVEVTGVLAAISLVKRDGSRMWSDYTASRPE
FT                   YRGRGLATAAKVGALRRAAGSGVTVAYTGNDEANKPMLAINERLGYRPVAAQWSCLREM
FT                   S"
FT   gene            complement(375831..376229)
FT                   /locus_tag="Strop_0324"
FT   CDS_pept        complement(375831..376229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0324"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52809"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Q9"
FT                   /protein_id="ABP52809.1"
FT                   /translation="MPELRHVSALAEAEYAYVTTVEPSTRLVFTAGACPLDADGRTVAP
FT                   GDHAAQARQVMANLETALTAAGACLIDVVKTTVYVASAHQPDLVTVWQVVRDTFGDHDP
FT                   PSTLLGVATLGYPEQLVEVEAVAAVSAA"
FT   gene            complement(376321..377328)
FT                   /locus_tag="Strop_0325"
FT   CDS_pept        complement(376321..377328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0325"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52810"
FT                   /db_xref="GOA:A4X1R0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R0"
FT                   /protein_id="ABP52810.1"
FT                   /translation="MTTAQRPTLEAVARRAGVSRATVSRVVNGSTTVAEPIRKAVHRAI
FT                   SELGYVPNLAARSLVTQRTDSVALVMSEAATRVFSDDQYFPGIIRGAAQELETADKQLV
FT                   LMLAGSPAGHERVERYTTGQHVDGVLFASLHGADPLPGRLARLGIPVVCSGRPLGGTSV
FT                   PYVDVDHIGGVSRAIQHLIDSGRQRIATIAGPQDMVGGIERLTGYQAAVAPAGLPEWVA
FT                   YGDFTRESGMAATRRLLAEHPDLDAIFAASDLMAHAALRTLRATGRRVPDDVAVIGFDD
FT                   IETAAYTDPPLTTVRQPIQQIGRRMTRQLLRLAAGEPIEPAVVLPTELILRESA"
FT   gene            complement(377341..378741)
FT                   /locus_tag="Strop_0326"
FT   CDS_pept        complement(377341..378741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0326"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52811"
FT                   /db_xref="GOA:A4X1R1"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R1"
FT                   /protein_id="ABP52811.1"
FT                   /translation="MSTLRFPENFRWGTATAAYQIEGAAHEDGRGPSIWDTFSRTPGKV
FT                   YQGHTGDVACDHYHRYADDVELMAGLGIQTYRFSVSWPRVQPDGTGPVNPRGLDFYDRL
FT                   VNALLARGIDPMVTLYHWDLPQTLQDRGGWAARETAEHFAGYGAAVHGRLGDRVKSWTT
FT                   LNEPWCSAYLGYGNGVHAPGVADPGAAFTAVHHLLLGHGLAARALHAAGAGSVGITLNP
FT                   ADVRPADPDSAADAAAVRLVDRLHNRIFLDPLFRAAYPADVLEHVARFVPPTFIRDGDE
FT                   NVIATPIDLLGVNYYAPLYVAGKPDGAGGGGAFPGTDGAVEFLSPAGPLTDMGWMIEPA
FT                   GLTRLLERLATDYPGVPLMITENGAAFPDRAAPPASLDQPEADGVSGVVDTDRIAYLDG
FT                   HLRAAHEAIARGVDLRGYLVWSLLDNFEWAEGYRKRFGIVHVDYLTQRRSPKASARWYQ
FT                   EVISRHGL"
FT   gene            complement(379049..379810)
FT                   /locus_tag="Strop_0327"
FT   CDS_pept        complement(379049..379810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0327"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52812"
FT                   /db_xref="GOA:A4X1R2"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R2"
FT                   /protein_id="ABP52812.1"
FT                   /translation="MNKLHGTKDFWIGALRVEGPAFAAAIAEAPADTPVLSCPGWTVTD
FT                   LTRHLASVYRWVHGNVSTNTVTPPSLHSELVEPNPGETDLQLWQQAYDELMVRFDALDP
FT                   EAPAWNWAPQPKKAGFWPRRIAHETALHRWDAQLSIGAGDPIETKLAADGVSEVLDTCL
FT                   PAGRRPDHGQWHGVVHLSASDAGQEWFLRLRGDGVALLDTDTIFDDHDHHARVQVVGTA
FT                   SDLLLALWGRVSFDTLAVTGERALLAGLRTG"
FT   gene            379842..380972
FT                   /locus_tag="Strop_0328"
FT   CDS_pept        379842..380972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0328"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52813"
FT                   /db_xref="GOA:A4X1R3"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R3"
FT                   /protein_id="ABP52813.1"
FT                   /translation="MGAAATPQLRVMGVTEVPQSTSGIQPDTECNLSRYTTLRLGGWAT
FT                   RVVTATSADDLVRGVREAGERGEQVLVLAGGSNVVISDAGFPGTVVLVRSRGLRVVDTD
FT                   TDTVTVRVEAGEPWDDLVAHTVASGWSGLECLSGIPGSTGATPIQNVGAYGQDVAETIT
FT                   GVQVYDRVAGTTGRIEARDCGFSYRSSIFKYSDRWVVLSVDFRLARSPLSGPVRYAELA
FT                   RALDVAVGDRVPLVKARDAVLRLRAGKGMVLDPTDPDTWSVGSFFTNPVLDQAGYERLR
FT                   ERAAELGEPPSWPGADGTVKVSAAWLIDKAGFGKGHPGPEGVVTISTKHTLALTHRSGT
FT                   ARTEDLVRLAREIRHGVQARFDVTLHPEPVLINCAL"
FT   gene            complement(380982..381788)
FT                   /locus_tag="Strop_0329"
FT   CDS_pept        complement(380982..381788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52814"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R4"
FT                   /protein_id="ABP52814.1"
FT                   /translation="MSRVTAVPARRPLGVATRGTTNPNRLRRVDNWMAVTCGDALRAAA
FT                   DPLVVDLGYGATGVTAVELRSRLAHAVRPDVRVVGLEIDPVRVAAAQPVADPPRLTFAR
FT                   GGFELAGLRPALVRAFNVLRQYDEGEVAGAWATMTGALAPGGLLVEGTCDELGRLGGWV
FT                   LIDEDGPRTLTLGARLATMDHPARLAERLPKALIHRNVEGEPIHALLQALEGAWRAAAP
FT                   YAPFGPRHRWLRTVTAVRDEGWPLAYQPRRWRQGLVTVDWAAVAPR"
FT   gene            complement(381785..382549)
FT                   /locus_tag="Strop_0330"
FT   CDS_pept        complement(381785..382549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0330"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52815"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R5"
FT                   /protein_id="ABP52815.1"
FT                   /translation="MTSVAVVTGASSGIGAATVRRLAAEGFHVLAAARRTDRLADLVEE
FT                   VETSGGSATAVSCDVTSDESVARLAAAAAAAPGPVTLLVNNAGGARGLDPVETGAVGDW
FT                   QWMYDVNVLGTLRVTQALLPALVSSGAGTIVVVSSTAGFTVYEGGGGYAAAKHAQTAVA
FT                   GTLRLELCGRPVRVVEIDPGMVRTEEFSLVRFDGDADRADAVYAGVSEPLVADDVADCV
FT                   AWCATRPQHVNVDRLVVRPLAQAAQHKVHRVG"
FT   sig_peptide     complement(382478..382549)
FT                   /locus_tag="Strop_0330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.721) with cleavage site probability 0.636 at
FT                   residue 24"
FT   gene            382614..384062
FT                   /locus_tag="Strop_0331"
FT   CDS_pept        382614..384062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0331"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52816"
FT                   /db_xref="GOA:A4X1R6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X1R6"
FT                   /protein_id="ABP52816.1"
FT                   /translation="MRNYRSPIGKMTPGVEVDREAPVVRAATVAEGADVAEQHTGVGHQ
FT                   RGARPWPLPRRIATLSVHTSPLHQPGTGDAGGMNVYILEVARRLAEANVEVEIFTRATA
FT                   ADLPPVVEMVPGVHVRHIMSGPLGGLTKEELPGQLCAFTAGVLRAEAVRAAGHYDLIHS
FT                   HYWLSGQVGWLAKERWGVPLVHTAHTLAKVKNAQLAAGDRPEPKARVIGEEQVVAEADR
FT                   LVANTKTEAGDLIDRYDADPTRVEVVEPGVDLARFCPASGDRARAQVLARRRLDLPERG
FT                   YVVAFVGRIQPLKAPDVLIRAAAALRQRDPALADDMTVVVCGGPSGSGLERPTHLIELA
FT                   AALGITDRVRFLPPQTGDDLPALYRAADLVAVPSYNESFGLVALEAQACGTPVVAAAVG
FT                   GLNTAVRDEVSGVLVDGHDPVAWARSLGRLLPDAGRRAMLARGAQRHARNFSWDRTVKD
FT                   LLDVYGEAVAEHRTRLSDFATCSR"
FT   gene            384152..384724
FT                   /locus_tag="Strop_0332"
FT   CDS_pept        384152..384724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52817"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R7"
FT                   /protein_id="ABP52817.1"
FT                   /translation="MNGRSELGALIESVCAERDLAWESTGPNSYAVTLPGTHKLRTICN
FT                   LIIGEYALRVEAFVMRQPDERREELWAWLLQRNARMYGVSFSIDAVGDVYLTGRVNSAG
FT                   VDADELDRLFGSVLTYADESFDRMLEIGFGSSIRREWEWRVKRGESTANLAAFAHLVES
FT                   ADGEAGPAAGKPAAGNPAAAPGGSTLS"
FT   gene            384799..385461
FT                   /locus_tag="Strop_0333"
FT   CDS_pept        384799..385461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52818"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R8"
FT                   /protein_id="ABP52818.1"
FT                   /translation="MAQRSSAGRGGTATRTGRGAGNQTQGTPQVSEATISRMRVDEIRG
FT                   QLRQHGVSGTSALRKPELVRTLVKTLRAERRSSGAKGPGRRAASSGRSAGGTAVRTGPR
FT                   TSRSVRSSQVIAAPTDRPERPGRSLVTTNHEVIRRWARQRNAKPATIRGTERDGRAGVL
FT                   TFNMPGYRESSRVREITWVEWFRTFDLRKLNLIYQERLRDGRISNFFRTESPDREDG"
FT   gene            complement(385875..387227)
FT                   /locus_tag="Strop_0334"
FT   CDS_pept        complement(385875..387227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0334"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52819"
FT                   /db_xref="GOA:A4X1R9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1R9"
FT                   /protein_id="ABP52819.1"
FT                   /translation="MRTMQGWLHDTAGGLPRTFWYLWTGTLINRLGSFILIFIAIYLTQ
FT                   ERDFSAAQAGLVLGLWGVGGAVGTTVGGTLADRWGRRPTLLTAHLGAASLMLALGFARD
FT                   LWLIALGALLLGLFAEAARPAFGAMMIDVVPAKDRLRAFSLNYWAINLGFACAAVLAGF
FT                   ATEAGYLLLFVVNAVTTLITALIIFFKVSETHQPVVATAGGPKAQTGALRAILSDRVYL
FT                   GFVTLNLFAALVFLQHISMLPIAMGDSGLSPATYGSVIALNGVLIVVGQLFVPRLIKGR
FT                   SRSHVLALSAVVLGCGFGLTAFAETAWFYGLTVLIWTIGEMLNSPSNATLIAELSPNEL
FT                   RGRYQGVFSLSWQIAGAAAPVLGGLVREGAGNATLWMGCALIGGLVAVAHLISGPTRER
FT                   RAAALRAVNQPAPPTPVGQQRATEAGEASLVTSPGSPPTENAAGAPAGEAR"
FT   gene            387363..388139
FT                   /locus_tag="Strop_0335"
FT   CDS_pept        387363..388139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0335"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52820"
FT                   /db_xref="GOA:A4X1S0"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S0"
FT                   /protein_id="ABP52820.1"
FT                   /translation="MAGMTASEGPTIGTLVLLRHGESDWNAKNLFTGWVDVDLTGKGET
FT                   EARRGGELLREHNLLPDVVHTSLLRRAIRTAELALDAAERHWIAVRRSWRLNERHYGAL
FT                   QGKNKKQTLDEYGEEQFMLWRRSYDTPPPPIADDDEWSQVGDPRYRLLPTELMPRTECL
FT                   KDVVDRMLPYWYDSIVPDILAGRTVLVAAHGNSLRALVKHLDQISDEAIAKLNIPTGIP
FT                   LRYDLDPQLRPMTLGGTYLDPAAARDAAAAVANQGR"
FT   gene            388340..389572
FT                   /locus_tag="Strop_0336"
FT   CDS_pept        388340..389572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0336"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52821"
FT                   /db_xref="GOA:A4X1S1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S1"
FT                   /protein_id="ABP52821.1"
FT                   /translation="MLLAWLVLTRRAGSTLMGSHQSGSPRPRGRPAIADGPQSGLGRRT
FT                   IDSLRVGVVVLADDDGPVLVNPAARAMGLLRAGGAPGTVTAHPLIRTLAGQVRRTGVRR
FT                   EIQLDLPRGDDSVAAENPLGVHLRAVGLGGGHVAVEAVDVTESHRLARVRRDFVANVSH
FT                   ELKTPIGALQLLAEALLDATEPADEEQPDLSEDLVATRRFAERIRHESTRLGRLVQELL
FT                   ELTRLQGADPQPAPEPVAVDWVVGEVVDRTRTGASARRIDVVVDGERGLTVYGSDTQLA
FT                   TAVSNLVENAINYSGEDTTVRITARHDDEHVTIAVTDQGIGIGPREVDRIFERFYRADQ
FT                   ARSRATGGTGLGLAIVKHIASNHGGRVEVASTPDEGSTFTLRLPARAPDDPLVIPPSAE
FT                   IEAEPAESQQT"
FT   gene            389592..390275
FT                   /locus_tag="Strop_0337"
FT   CDS_pept        389592..390275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0337"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52822"
FT                   /db_xref="GOA:A4X1S2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S2"
FT                   /protein_id="ABP52822.1"
FT                   /translation="MSRVLVVEDEESFSDALSYMLRKEGFEVSVAATGPSALTEFDRTG
FT                   ADIVLLDLMLPEMSGSEVCRQLRQRSHVPIIMVTARDSEIDKVVGLEIGADDYVTKPYS
FT                   PRELVARIRAVLRRKSVETVESGAATLAAGPVRMDIERHVVTVDGGPVQLPLKEFELLE
FT                   LLLRNAGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKVEPEPSTPRHIVTVRGLG
FT                   YKFEP"
FT   gene            complement(390360..391166)
FT                   /locus_tag="Strop_0338"
FT   CDS_pept        complement(390360..391166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52823"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S3"
FT                   /protein_id="ABP52823.1"
FT                   /translation="MRGQIELRTRPDDPDDPRGREVPLDFPREWIEFGDPADDTHLIRA
FT                   DLTWLLSRWTCVYGRGCHGISADRPADGCCSHGAFFTDSDDEQRVRSAVRRLTPETWQH
FT                   HRRGFNNWTETDTVDEKTPARRTATRPDGPCVFLNDAGFPGGAGCALHAQALRDGAHPL
FT                   EYKPDVCWQLPIRREQEWVQRPDGTKVLLSTLGEFDRRGWGAGGHDLDWWCTSSRDAHV
FT                   AAERMYVSYAPELTALIGAPAYAELAALCAARARHGLVAPHPADPD"
FT   gene            391240..392184
FT                   /locus_tag="Strop_0339"
FT   CDS_pept        391240..392184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0339"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52824"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S4"
FT                   /protein_id="ABP52824.1"
FT                   /translation="MRLGVLDVGSNTVHLLVVDAHRGAHPWPAHSEKAVLRLAEQIGPD
FT                   GALTPAGADSLVRAVASAKESAFGLGTDNLIAFATSAVRDATNSVAVLARVQAETGVRL
FT                   EVLTGADEARMTFLAVRRWFGWSAGRLLVLDIGGGSLEIAAGIDEDPDAAVSLPLGAGR
FT                   LTRHHLQVAAGSTSPPGAEQVEKLRAYVDGQLDAVAGGLNKVGWERPVATSKTFRTLAR
FT                   LAGAAPSGAGVWARRRLTRAGLRQVLGFIRHIPPAQLVELDGVSVGRAHQLLAGAVVAE
FT                   AAMRRLDIGTLEVCPWALREGVILRRLDQLVSM"
FT   gene            392238..393146
FT                   /locus_tag="Strop_0340"
FT   CDS_pept        392238..393146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0340"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52825"
FT                   /db_xref="GOA:A4X1S5"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S5"
FT                   /protein_id="ABP52825.1"
FT                   /translation="MPATLDAVPRVPVLLSTSSVFPERTAAAFQLAATLGYDGVEVMVW
FT                   TDAVSQDAGALAGLAKHYGVPVLSVHAPCLLVTQRVWSADPWERLRRSGQLAEALGAPT
FT                   VVVHPPFTWQRDYARNFAEGLDEVTGQFGGISFPVENMYPVRMAGRQFVPYAPGWDPTT
FT                   TGYPSYTLDLSHCAASHTDALELADRMGAGLTHVHLGDGTGEGRDEHLVPGRGTQPCAE
FT                   LLRSLAGRGFTGSVAVEVSTRRAKSRAVREADLRAALAFARQHLDPPAAATNAGPDPVR
FT                   RGGREAEELDSGAPRRPPAFS"
FT   gene            complement(393139..393753)
FT                   /locus_tag="Strop_0341"
FT   CDS_pept        complement(393139..393753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0341"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="PFAM: protein of unknown function DUF1470"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52826"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S6"
FT                   /protein_id="ABP52826.1"
FT                   /translation="MPRKSSTVGDVNFDAYARTGVDLINVRLDDLDALRSLFPDDVSWM
FT                   RDEVSERDLTIFRRAQKRLRDVFEYGTSGRDVQAVAELNVLLEAYPVQPRISGHDSSDW
FT                   HMHVTSRGASVSAEYLAGAVWGLSVWLCEYGSARFGVCADERCGNVYLDTSSNCCRRFC
FT                   SERCATRSHVAAHRARKRAAIRDRVAVAAQPTGADNLTVVS"
FT   gene            393822..394739
FT                   /locus_tag="Strop_0342"
FT   CDS_pept        393822..394739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0342"
FT                   /product="L-proline dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /note="PFAM: Proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52827"
FT                   /db_xref="GOA:A4X1S7"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S7"
FT                   /protein_id="ABP52827.1"
FT                   /translation="MLRTVILAAARSSRCERLVATAPLTRNMVRRFVAGPRTEDALRVT
FT                   RALVDDGLTVTLDNLGEDTVTPEQASAVRDEYLGLLESLAADGLTPAAEVSVKLSALGQ
FT                   TFDEQLAYDNARAICAAAEASGTTVTLDMEDHTTTDSTLDILVKLRADHPSTGAVLQAY
FT                   LRRTESDCRQLAGAGSRVRLCKGAYREPESVAYQSARDVDRSYVRCLTILMAGAGYPML
FT                   ATHDPRLIAIGEDRARWFDRGPDQFEFQMLYGIRSADQARLIGDGYTVRTYVPYGNEWF
FT                   GYLMRRLAERPANLGFFAHALMGR"
FT   gene            395085..395294
FT                   /locus_tag="Strop_0343"
FT   CDS_pept        395085..395294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0343"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52828"
FT                   /db_xref="GOA:A4X1S8"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S8"
FT                   /protein_id="ABP52828.1"
FT                   /translation="MAGSRSDGQLSEVRFLTVAEVATVMRVSKMTVYRLVHGGELGAVR
FT                   VGRSFRVPEHSVHEYLRGAFQETA"
FT   gene            395497..395598
FT                   /locus_tag="Strop_0344"
FT   CDS_pept        395497..395598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0344"
FT                   /product="Protein of unknown function DUF1713"
FT                   /note="PFAM: Protein of unknown function DUF1713"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52829"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1S9"
FT                   /protein_id="ABP52829.1"
FT                   /translation="MGSVVKKRRKRMAKKKHRKLLRKTRVQRRRLGK"
FT   gene            395718..396794
FT                   /locus_tag="Strop_0345"
FT   CDS_pept        395718..396794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0345"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52830"
FT                   /db_xref="GOA:A4X1T0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T0"
FT                   /protein_id="ABP52830.1"
FT                   /translation="MTPGGPSGAPGVVVVTGVSRYLGAHVAARLAADPRVGRVIGVDPP
FT                   EAGGELTDLLNGVERVRADAGSIGGLLADLDVDAVVHLALVSAPDPQHGGRAAMKDQNV
FT                   IGTMQLLAAAQHAPRLRKLVVRSSTAAYGASFRDPAVFTEETEPREVPRGGFGRDILDI
FT                   EGYVRGFRRRRPDVTATVLRFAPFIGSTADTTLTRYFAQPLVPTVFGRDPRLQFLHFED
FT                   ALEVLHRSIVLDHPGTYNVAGPGVLALSQAIRRAGRVAVPVLEPGLSGAAALARTLGFG
FT                   RYGLDQVDLFVHGRVVDTDRLEREFGFTPRSTAAAFDDFIRAHRNGIVVTRERLAAAEQ
FT                   LVLDGVRQVRSAAARERS"
FT   gene            396791..397663
FT                   /locus_tag="Strop_0346"
FT   CDS_pept        396791..397663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0346"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52831"
FT                   /db_xref="GOA:A4X1T1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T1"
FT                   /protein_id="ABP52831.1"
FT                   /translation="MSGGAVFEQPGDHWDRKVASGLAFLRGRLAGDYEVDEFGFDPQLT
FT                   ESVFHPLLRLLYRDWFRTEVTGLEHVPDVGAGLVVANHSGTVALDALILSAVLHDRHPR
FT                   HRFLRLLGADLVFRMPVVSAVARKGGGTVACNPDAERLLESGELVSVFPEGFKGVGKLY
FT                   AERYKLQRFGRGGFVSAALRTGTPIVPVAIVGGEETYPMLADVKPLARLLKLPYFPVTP
FT                   TFPWLGPLGMVPLPSKWMIEFCPPIATEHLTDSADDPLVVFNLADQVRETIQQTLHRLL
FT                   ERRPDPFGP"
FT   gene            397733..399010
FT                   /locus_tag="Strop_0347"
FT   CDS_pept        397733..399010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0347"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52832"
FT                   /db_xref="GOA:A4X1T2"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T2"
FT                   /protein_id="ABP52832.1"
FT                   /translation="MFVVRRVVEAVVPARLGNGFRWLLASSWATNLSDGIAVAAGPLLV
FT                   ASLTANPLLVALAALLRWAPPLVFGLWAGVLSDRLDRRRIVLVANAVRVGALGVLVGVL
FT                   VTGRVSVPVVLLTLALLATAEVFVDNTTGTLTPMLVRREDLAIANARVLAGLITLNKLT
FT                   GPAIGAVLFAAGRSWPFATNTILIAAGLLLVSRVSLPPRERESTGHPRDLRSDIAAGFR
FT                   WTVRHPAVRTLCLTALVFNITYGAAWSILVLYAGARLGLGAVGFGLLSTATAAGGLLAT
FT                   VGYGWLSRRVSLGDIMRAGLIIETLTHLGLAVTTSPWVAAAILFVFGAHAFTWGTTALT
FT                   IRHRAVPTHLQGRVASVYTMSGYGGLVVGAALGGPLVTLLGTTGPFWFAFAGSALLVGV
FT                   LWRRFAHIAHTDDPAPTPAPAGATAG"
FT   gene            complement(399039..399911)
FT                   /locus_tag="Strop_0348"
FT   CDS_pept        complement(399039..399911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0348"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52833"
FT                   /db_xref="GOA:A4X1T3"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T3"
FT                   /protein_id="ABP52833.1"
FT                   /translation="MASRKVPVNTDTRSHISGGSSAGDAPAPPPDRAAAAFFDVDNTMM
FT                   QGASIYWFARGLAARNYVTTSDLLRFAWQQLRFRVLATEHVGDMSQIKEAALAFVEGWQ
FT                   VNDVERLAEEIFDELMAPRIWAGARQLAQGHLDAGQRVWLVSAAPVEIGRVIAARLGLT
FT                   GAIGTVAEVVNGAYTGRLVGDLMHGPAKAEAVTRLAAAEGLDLSRCTAYSDSSNDLPML
FT                   AAAGRGVAVNPDAALAREARRRGWEVRDFRTGRRAVKIAVPSTAAVGLVAGAVTAGLAR
FT                   HRRRSSLRM"
FT   gene            complement(400074..400958)
FT                   /locus_tag="Strop_0349"
FT   CDS_pept        complement(400074..400958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52834"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T4"
FT                   /protein_id="ABP52834.1"
FT                   /translation="MNSDLFFSRRRAERFAQLLDEANGGRRHHVRSRVDEKLTELVAVG
FT                   QQLGDATPTVEVSTEFRTGLRAMLLATAEREGLGRPTPAATTDRTEHRPASSRSFLLPA
FT                   VTARRARARGAILIGIATGAVAVSGISAASENAVPGDALYGMKRSTERAQLVLTGSDHS
FT                   RGQLFLDFARTRLSEAAQLRGDRIGYSGVLDDMDADTRHGVRLLTTAAVQGSDLTALDV
FT                   VNTFVAAQRTAVSGLLDSGNRADRDRTQRSLTLLDDAHLRSDALRAAIVCGLPAPSGSD
FT                   ALGPTPTSCPTNR"
FT   gene            complement(401222..402157)
FT                   /locus_tag="Strop_0350"
FT   CDS_pept        complement(401222..402157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0350"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52835"
FT                   /db_xref="GOA:A4X1T5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014298"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T5"
FT                   /protein_id="ABP52835.1"
FT                   /translation="MTTFGYAQRPIGLGDPPPRSTTNERLTPRGPRDDGRLAARSDNGL
FT                   RSRPHPNEAPARSGTPGANAKPVGARVASPARPAMPVQGRRSADPPATADSAATDTAVL
FT                   PALPASTPATGFPSRPDPSDPATEIWALVERAQAGEAEAFGLIYDRYVDTVFRFVYFRV
FT                   GNRQLAEDLTSDTFLRALKRIGSFTWQGRDLGAWLVTIARNLVADHFKSGRYRLEVTTG
FT                   DVLDAEREDRGPEGSPEAAVVEHITNVTLLGAVKQLNPEQQECIVLRFLQGFSVAETAR
FT                   AMGKNEGAIKALQYRAVRALARLLPDGFRT"
FT   gene            402944..403195
FT                   /locus_tag="Strop_0351"
FT   CDS_pept        402944..403195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0351"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52836"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T6"
FT                   /protein_id="ABP52836.1"
FT                   /translation="MREPRLTLITRPGCHLCEDAKAALERVVSVTNDRWVEKDVTDDVE
FT                   LEREYGDRLPVVLLDGKEHGYWRVEEERLLRDLTIPQL"
FT   gene            403218..403865
FT                   /locus_tag="Strop_0352"
FT   CDS_pept        403218..403865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0352"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52837"
FT                   /db_xref="GOA:A4X1T7"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T7"
FT                   /protein_id="ABP52837.1"
FT                   /translation="MSSAHPHLVWDWNGTLLNDLDLVVASTNVAFASVGGPAVTADEHR
FT                   VRFRRPIADYYAEVLGQAVDETAFGQLDKLFHEVYKDGLTTCALAHDAVDAMSSWPGSQ
FT                   SLLSMWFHEDLVPTVQTYGLTKNFLRVDGLRAEIGGDRKAESLARHLAELRLDGRDVVL
FT                   IGDSLDDADAARSVGGRAVLYAGGFTDAARLRASGHPVAETLTEAVALAHPH"
FT   gene            complement(403935..404576)
FT                   /locus_tag="Strop_0353"
FT   CDS_pept        complement(403935..404576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0353"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52838"
FT                   /db_xref="GOA:A4X1T8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T8"
FT                   /protein_id="ABP52838.1"
FT                   /translation="MRIVIADDAVLLREGLIRLLTERGHQVVAAVGDGAALVQAVVTHR
FT                   PDLSIVDVRMPPSHTDEGLRAAVEARALAPAAPILVLSQYVEVSYADDLLATGVGVGYL
FT                   LKDRVAAIDEFLAALDRVAAGGTVLDPEVITQLFARRRRDDPLRALTPREREVLSLMAE
FT                   GHSNTAIARTLVVTDGAVEKHVRNIFTKLNLPPDVEQHRRVRAVLTYLRG"
FT   gene            complement(404587..405903)
FT                   /locus_tag="Strop_0354"
FT   CDS_pept        complement(404587..405903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0354"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, dimerisation and
FT                   phosphoacceptor region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52839"
FT                   /db_xref="GOA:A4X1T9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1T9"
FT                   /protein_id="ABP52839.1"
FT                   /translation="MTATRGAATPASSPLRNLLRQLLRDSGYVLSGLLLAVVGFVVAVT
FT                   GFTLSLSLLVTTLGLPVLAGTFYAVRVLADIERIRLPTVLNVPRIRPVYRGPDPDATFW
FT                   RRVLAPVRDPQSWLDLLHAFSKLLVAMPVFVILVCWWVLALAGICYAAYDRYLPHGPDS
FT                   PHLSELLGMGDGAGARIFLNTAIGVFALLTLPLVARACARTEGGLARALLTGVAELRNR
FT                   ITTLEEQKRAAVSAEANALRKLERDIHDGPQQRLVRLAMDLSRAREQLTSNPVAARDTL
FT                   DEAVDQTRETLTELRALSRGIAPPILVDRGLPSALAALAGRGLIPIELQVDAGLGEPGG
FT                   RLDPAVESTAYFVVAEALTNVAKHSRATECRVTVERAGQRLRVGVDDDGQGGAHLAKGH
FT                   GLVGIADRVRAAGGQLLVTSPAGGPTAIRAEFPVTTGKW"
FT   gene            406383..407153
FT                   /locus_tag="Strop_0355"
FT   CDS_pept        406383..407153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0355"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52840"
FT                   /db_xref="GOA:A4X1U0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U0"
FT                   /protein_id="ABP52840.1"
FT                   /translation="MSPHRPPGEPERPVAVPALPDLPEATVARLPEYLRALHNLAENGH
FT                   ETVSSEWLATAAGVNSAKLRKDLSHLGSYGTRGVGYDVALLIDQIEYVLGLTQRRSVAL
FT                   VGVGNLGHALAGYDGFATRGFRIAALFDADPVRVGEEINGLVVRHVDELSRVAIEESIA
FT                   IGVIATPAAAAQRVADRLVAGGVTSILNFAPCVLTVPDGVDVRKVDLAVELQILSFHEH
FT                   RKASLTALPAAGAATLTPLPGDLAATDPQEAIGT"
FT   gene            407150..408517
FT                   /locus_tag="Strop_0356"
FT   CDS_pept        407150..408517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0356"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; Shikimate/quinate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52841"
FT                   /db_xref="GOA:A4X1U1"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X1U1"
FT                   /protein_id="ABP52841.1"
FT                   /translation="MKLLVVGASYRTAPVAALERLTVAPADLSRVLTRLVAQPYVSEAV
FT                   LVSTCNRVEVYAVVSGFHGGLGDICAVLAESTGCQPAALADHLYVHFDAAAVNHVFRVA
FT                   VGLDSMVVGEAQILGQLRDAYHWASEAETVGRLLHELMQQALRVGKRAHSETGIDRAGQ
FT                   SVVTAALGLATELLHSDLACRPALVVGAGAMGSLGVATLARLGAGPVSVTNRGVDRAIR
FT                   LAESYGATAVPIADLTATLSTVDIVVAATAAPEAVLTRAVVTQALAGRNPSRGPLVLLD
FT                   LAVPRDVEPGVADLPGVQVIDIDRMAALVADGPVAADAAAVEQIVAAEVDTFLTWLRGA
FT                   DVAPTVAALRGRADDVVAAELGRLVHRRPDLTDEQRADVARTVHRVVQRLLHQPTVRVR
FT                   QLAAEPGGDQYTALLRELFDLEVPQTSAVGTVPDVVVPDVDPQLGGDAEAPPTGGE"
FT   gene            408517..409485
FT                   /locus_tag="Strop_0357"
FT   CDS_pept        408517..409485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0357"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52842"
FT                   /db_xref="GOA:A4X1U2"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U2"
FT                   /protein_id="ABP52842.1"
FT                   /translation="MKVPLRLGTRGSALAMAQSGQVAEALTAATGTPVELVEVVTTGDR
FT                   STAPVHQLGVGVFVSALRDALAAGAIDFAVHSYKDLPTAAAPGLYVAAVPPRQDPRDAL
FT                   VATGGRTLAELPPGARVGTGALRRIAQLHALGLQLEVQPIRGNVGTRLARVLGPEADLD
FT                   AVVLARAGLARLDRTDTITETLDPMLMLPAPAQGALAVECRSDDSALVELLAVLDHAPS
FT                   RATVVAERALLATLEAGCSAPVAAYAELAEGDVGEEIYLRGAVISPDGTRDLRLSRTGT
FT                   PADAVEIGKALATDLLDLGADSILGQQRNLGPGTQQFGSTV"
FT   sig_peptide     408517..408603
FT                   /locus_tag="Strop_0357"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.740) with cleavage site probability 0.440 at
FT                   residue 29"
FT   gene            409482..411062
FT                   /locus_tag="Strop_0358"
FT   CDS_pept        409482..411062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0358"
FT                   /product="uroporphyrinogen-III C-methyltransferase /
FT                   uroporphyrinogen-III synthase"
FT                   /EC_number="2.1.1.107"
FT                   /EC_number="4.2.1.75"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Uroporphyrinogen III
FT                   synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52843"
FT                   /db_xref="GOA:A4X1U3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U3"
FT                   /protein_id="ABP52843.1"
FT                   /translation="MTRTRKPVGRIAFVGAGPGDPGLLTRRGYDALVSADQVVYDRGVP
FT                   EALLDVVRAQAKQEAQLTLAEGGSGDVAKVLISAARSGLNAVHLVAGDPFGHEAVVREV
FT                   QAVARTAGQFEVVPGVGQAEGVATYAGVPLPGVRTAADVEDVTTLDFEALAAAVARGPL
FT                   ALAVEAGDLAAIRDGLLAAGVDDATAVGVTGDGTGETQYTTTSTVDSFVAAALGFTGRV
FT                   VLTLGEGVGQRDKLSWWENRPLYGWKVLVPRTKEQAGVMSARLRAYGAIPCEVPTIAVE
FT                   PPRTPAQMERAVKGLVDGRYAWVIFTSVNAVRAVWEKFAEHGLDARHFGGVKIACIGDA
FT                   TADAVRAFGIRPELVPAGEQSSEGLLAEFSPHDEVLDPVGRVLLPRADIATETLAAGLT
FT                   ERGWEVDDVTAYRTVRAAPPPAEIRDAIKSGGFDAVLFTSSSTVRNLVGIAGKPHARTV
FT                   VAVIGPKTAETATEFGLRVDVQPPHASVPDLVEALAGYAVELREKLAAMPAKQRRGSKV
FT                   QGPTALRFR"
FT   gene            411076..412059
FT                   /locus_tag="Strop_0359"
FT   CDS_pept        411076..412059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0359"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52844"
FT                   /db_xref="GOA:A4X1U4"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U4"
FT                   /protein_id="ABP52844.1"
FT                   /translation="MSYPEIRPRRLRRSPALRRLVAENRVDPAELVLPMFVKEGLTEPR
FT                   SVPSLPGVLQHSRESLRKAAVAAVRAGVGGIMLFGVPADRDELGSGGANPNGILNAAIR
FT                   DVVSEVGDATVVMSDLCLDEFTSHGHCGVLASDGSVANDATLAAYAEMAVAQAAAGVHV
FT                   VGPSGMMDGQVGVVRRALDAAGHQDVSILAYTAKYASAFFGPFRDAVESTLDGDRRTYQ
FT                   QDPANLRESLREVALDVAEGADMVMVKPALPYLDVVAAVRSAVDVPVAAYQVSGEYAMV
FT                   EAAAANGWIDREQAMLETLTSIRRAGAQIILTYWAVEAAQLLRQRY"
FT   gene            complement(412232..415507)
FT                   /locus_tag="Strop_0360"
FT   CDS_pept        complement(412232..415507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0360"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52845"
FT                   /db_xref="GOA:A4X1U5"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U5"
FT                   /protein_id="ABP52845.1"
FT                   /translation="MRPRRALAVFATVTATVSIAAVGVTPDAATAAPTDLFISEYVEGS
FT                   SNNKAIELFNGTGAPVDLAGGGYHLLLHFNGSTTPTTFTLTGTVAAGDVFVFAHSSANA
FT                   AILAQADQVTGAGLFNGDDAVVLRRGGIVLDAIGQVGVDPGTAWGTGLTSTANHTLRRL
FT                   GNVVSGDPEPGDSFDPAAEWAGFDTDTVDGLGAHRLDDGPVDTPATIICGDPLVTPAGT
FT                   AASREVTATDPDDEIVDLAVTSVTPTPATGTISRTALTPAGAVGGTARATVSASADLAA
FT                   GAYSVVLTATDTDGTTATCALPVQATRELTIGEVQGPTTDAEEGATDRSPLAPTSGNGA
FT                   SSARYDVRGVVTQRTLARDSSGRDQHGFFLQSRADATDGDPTSSDGIFVFMGSFTSLIG
FT                   GYVPTVGDEVVLHARVSEYYNMTQLSSASLVRRISTGLDVDRVVTVTDAVPPADLADAQ
FT                   RFWERHEGARLRVRADSQTVSGRNVFASTADAETWLVDRDDPLLDRDDPHTRRVFRDAH
FT                   PLDNDPTQIFDDGNGQRIMLGSMGVKATSGDNTTLLPPARTFDTLTDDAVGGLYYSFQK
FT                   YGVQVESAAFAAGTDPATNHPPKPARRSTEYAVAAYNVENLYDFRDDPFDGCDFAGNDG
FT                   CTGVRPPFDYVPGSEQEYRDQLAALADQIINDLHSPDLILIQETEDQDICTVDGTTLVC
FT                   GSTNDADGAPDSLQELALTIADNGGPAYAAAYDRSGADDRGISSAFLYRTDRVAMAEAT
FT                   ADDPLLGSAPTIQYRAPGLPSNADVQNPKALNAVLPPDVDTSTGKDGDNVFTRAPQLGR
FT                   FTIAAAPGSGERFTLWAASNHYSSGPDRRVGQRREQAAYGAAIVSAIAASDPDARVVFG
FT                   GDLNVFPRPDDPIATAADPTPSDQLGPLYEVGLHNLWDDLLADAPSSAYSYSFAGQAQT
FT                   LDHLFVTEALHDDLVQMRAAHVNADWPAEYAGDGSRGASDHDPQVARFRSRPTLTVADA
FT                   SVVEGDRGSSTLAFTVAVSRPLSEPALVCALTLGTSARPGIDYRSYTGCQMLRAGQTTL
FT                   TFPVSVRGDRRRETDERLTLLVAGGPGIQIADPLGTGTIVDDD"
FT   sig_peptide     complement(415412..415507)
FT                   /locus_tag="Strop_0360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.939 at
FT                   residue 32"
FT   gene            complement(415595..416596)
FT                   /locus_tag="Strop_0361"
FT   CDS_pept        complement(415595..416596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0361"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52846"
FT                   /db_xref="GOA:A4X1U6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013653"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U6"
FT                   /protein_id="ABP52846.1"
FT                   /translation="MVREWDLRAASSAEIVSLLDTLNAVLAADLPQDPPWQGSFLREYL
FT                   TEMMPGERRISWVAEDSGAARPGVVNVLLLGSIGVLEVLVHPSARRSGLGRELVLTAAR
FT                   RVYQEGFQTIGVEVVGDTPSVAFYEALGFTREYVETRSVLDLAGVDWAELGKTADGVSP
FT                   GYHVQFHPGGLPDQLIDAYARAKAEARDVEEGELRPSSYDPQRLRDSLGCLHRRGMTPY
FT                   IVLALHEQTGEVAGLTEVVAPAQHPTRADQYDTIVVPEHRGHGIDRAMKARMLLELRSA
FT                   EPALTEVQTWNAQDNEAMLKVNAELGYRPDREWYEYSIDVAELVHRLDATGQ"
FT   gene            complement(416668..417945)
FT                   /locus_tag="Strop_0362"
FT   CDS_pept        complement(416668..417945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0362"
FT                   /product="Membrane-bound lytic murein transglycosylase
FT                   B-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52847"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U7"
FT                   /protein_id="ABP52847.1"
FT                   /translation="MVDGEENQTLRPLRPATPGGGAQSGSGVAAGQRPGRVPRPRRPWL
FT                   RPPTAPDVEPTRAPDAATTDDPKSDLSTAADPTAADPTAARARVDTTVATADSDEPSHT
FT                   DADPVDEPSGSGDPAGPERAARAQRRRTRFAHAIRVTPTRLAVNAARSVHRWSRRPSGQ
FT                   LTVPGGFLLLLVTATVAAGALLLPATVRSDPDTTVASPGTTAAPTSAPDGAAPAGTLPP
FT                   PDPTMTGPTPGLGRPADTLASWAAQTGPKVGIAPVALQAYGYAELVLAQTNRSCGLSWT
FT                   TLAAIGHVESAHGQANNAQLGPDGRAAPEIIGLPLDGQGGRMLIRDTDRGTLDQDATYD
FT                   RAIGPMQFIPTTWQEIGADADSDGRKDPHDIDDAALAAANYLCKGGRNLTVAGDWWNAI
FT                   LSYNNVRQYAQDVFDKANQYGQASRT"
FT   gene            418002..418214
FT                   /locus_tag="Strop_0363"
FT   CDS_pept        418002..418214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0363"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52848"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U8"
FT                   /protein_id="ABP52848.1"
FT                   /translation="MPRYEFRCRACGDTFEVNRPMARAAAPARCPQGHDETVKLLSTVA
FT                   TVGLGGFGGTAPTAGGGCCGGGCGC"
FT   gene            418363..421311
FT                   /locus_tag="Strop_0364"
FT   CDS_pept        418363..421311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0364"
FT                   /product="Adenylate cyclase family 3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52849"
FT                   /db_xref="GOA:A4X1U9"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1U9"
FT                   /protein_id="ABP52849.1"
FT                   /translation="MSPRIHLPAGWVTFVFTDIEGSTRLAQLLGPDYRPVLWEHRRLLR
FT                   RTIVATKGAELLTEGDSFFLAFADASAALTACLAAQRALTNHDWPTPDATPRVRMGLHT
FT                   GWAEPRDGEYASAEVHRAARVAAAAHGGQVLCSAATVQHAAPLPSGASLLDLGLHRLRG
FT                   FDDRERLFQLTAPGLERQFPRPRTADAVAHNLPTQVTSFVGRQAEWAELRRLVENNRLV
FT                   TVVGAGGSGKTRLAVELAADLVESYPDGVWFVDLATVVEPGMVACAVAAGLGLRREPGR
FT                   SMMDTLVEYAAARRMLVLLDTADAQLPAAAEVISQLLAGGVGVRVLATSRESFGLPGEV
FT                   VWRIPPLSVDSPVTGAESDAVALLLDRATAARGGRRPDPAEWVDLRRVVRRLDGLPLAI
FT                   ELAAARLRVLSVGQLADRLDDVPCALDTGRDDPGPGLAMRHRTMQANLSWSYQQLGAGA
FT                   ARLLRWLAVFTGPVDLATVEWLLEDDQLDPLSVLVEKSMVLAEPDIGGSTYRMLDPIRA
FT                   YAAGRLAAAGEEQAARNRHVAWSADAVRRLGSGPDGRPVTLSLYAFDPLAGELRTALRW
FT                   CATGGSARSGLALVVGLDQWWRERGLAGKGRLWLSQLYDRSAETGERIPDAELAVGYHT
FT                   HSLHAGADGDFVEELRFSQRAEAVARRTGDAGLLARVLSSRAAPLVDLGQLAQAEQVCR
FT                   EVIGWAQRQDVVDDALFAVLSLAELLWCRGALDEAAELLGAARPVEASRPAERGRRTVD
FT                   MLLGLVALARGDLIAAHEHLSVSLRSRMAHGFHRRACDTLQAIAVRCAAGGDPLTAARL
FT                   FGAAQARGAALGSVPGINGDYFARWQAQVHGTLGDVTFDRAYGEGTGLGIREAATVALG
FT                   VEHPDLAADSTRFAAGVAPSAFTGPLEVASPPGAATSCPECAGNHPGRSRARLRSGEEA
FT                   GQVGLRGNWRIGRQEGQVGEDAGPVTAGVQGVPARSIRWALEADALDGLDVE"
FT   gene            complement(421138..421869)
FT                   /locus_tag="Strop_0365"
FT   CDS_pept        complement(421138..421869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0365"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52850"
FT                   /db_xref="GOA:A4X1V0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V0"
FT                   /protein_id="ABP52850.1"
FT                   /translation="MAMVALTLTPPSAQRLRAVDEFLADAWADQARHDSRLRDLAVEVD
FT                   FDRGVAHLTGEVDEPGDLRLVRDRVGQLAGVLAVWARVRVGGRDPVVVDLGCGGTKQWP
FT                   DNLGLDIYPAVGVDAVADLSRSLPLADNSVDVFFAVHILEHLIDFLPLVDEAHRVLRPG
FT                   GVLHVMSPWWGHVNAVADPTHVRLLDIQTIKGICLQRPPDAPRWYPLHAGCDGASIFAD
FT                   LTLLPPDAPVPTQAHLARFFA"
FT   gene            422088..422450
FT                   /locus_tag="Strop_0366"
FT   CDS_pept        422088..422450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52851"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V1"
FT                   /protein_id="ABP52851.1"
FT                   /translation="MDLLAEYRRATRCFEAGDPSEAARLLEPILAAEPGNTAVRQLLAR
FT                   SYFSSAQLSRAEEQLRELVDRDPSDHYAHHVLGRTLERLNRPVDALRHLRIAAAMHHGN
FT                   ADYQAALRRVQARVGR"
FT   gene            422530..422784
FT                   /locus_tag="Strop_0367"
FT   CDS_pept        422530..422784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52852"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V2"
FT                   /protein_id="ABP52852.1"
FT                   /translation="MKLKLDLHDIYNRGTDIDRALRGVIDEAVAKKATLVEIIPGKGSG
FT                   QLKKRVLRFLDQKDVKALYHRVEKDSKNFGRVFVHFRWK"
FT   gene            423138..423716
FT                   /locus_tag="Strop_0368"
FT   CDS_pept        423138..423716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0368"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52853"
FT                   /db_xref="GOA:A4X1V3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR001598"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V3"
FT                   /protein_id="ABP52853.1"
FT                   /translation="MHAARSAPGPLRHPNRYGADKGPGRHPRLSTTAAATTSGHWEGDL
FT                   IIGKAHTSAIGTLVERTTRFVALVHLPNGRQPAQVRDALVQTVSSLPAQLKSSLTWDQG
FT                   SEVALHTQFSTATDMPVFFCDPGKPWQRGSNENTNGLLRQYLPKGTDLTRYSRGDLDAV
FT                   AAELNSRSRKTLGWDTPAERLAKFLATAN"
FT   gene            425098..425910
FT                   /locus_tag="Strop_0369"
FT   CDS_pept        425098..425910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0369"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52854"
FT                   /db_xref="GOA:A4X1V4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V4"
FT                   /protein_id="ABP52854.1"
FT                   /translation="MTENLFDEVGTLLRTAADQVVLPLFRQLDDADIEEKAPGDLVTVA
FT                   DRRAEELISAGLRRLWPDSVVVGEEAVAEDPELLRELRRSGPVWLVDPIDGTANFAAGR
FT                   RPFVLMVALLIDGDPSAAWVFDPLVGTLAVTRPGAGAYVNGRAVRTTGASADPGRLRGA
FT                   AMSRYLPAAFRPRVQAAGARLGELLPGQHCAGREYLDLLLGVQQFVLFWHTLPWDHVPG
FT                   TRLVRAAGGVARRFDGAEYHPAVEGEGLLVAADERVWTAAREAFFGGA"
FT   gene            426119..427126
FT                   /locus_tag="Strop_0370"
FT   CDS_pept        426119..427126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52855"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V5"
FT                   /protein_id="ABP52855.1"
FT                   /translation="MRTVPPRRGSSPLTALAVAVAVAVLLGAVPAHAEPGEGGTEKLRN
FT                   ALTAAAKAHIDATAKLKNSKRRQGELATELKTVEARLTDLTAQVGEVAAQSYRLGRLTP
FT                   MATLLESTSPDEFLNRAMNLDVMAQRDGRKVRELTEGREAAKNAKIAIDSEVREQEKQL
FT                   DVLAKNKKAAEVALAAVSSGGGSGFGGGSASAASAPRNSDGSWPSESCSVNDPTTSGCI
FT                   SPRTLHMLKQSQADGFKRHVSCYRSGGGGEHPKGKACDFSAAPGGFENVSATGGDKTYG
FT                   DQLAAYLKNNASRLGVMYVIWYRQIWMPNTGWRSYNGGGSPAGDHTNHVHVSMY"
FT   sig_peptide     426119..426220
FT                   /locus_tag="Strop_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT   gene            427163..428716
FT                   /locus_tag="Strop_0371"
FT   CDS_pept        427163..428716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52856"
FT                   /db_xref="GOA:A4X1V6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V6"
FT                   /protein_id="ABP52856.1"
FT                   /translation="MNSASSHAPVRPARLGSATGPALPKGLAAFLVFFSSGAVLVLETA
FT                   ALRLVGPYVGVTLQVTSSVIGIALAAIAYGAWAGGWLADRRDPRTLLAPALVLAGIATA
FT                   VTLPVVRYAGEVLRGGAASAILLLVALAVFVPAMLLSAVTPLVVKLQLSDLRRTGQVVG
FT                   WLSSIGTLGAVTATLVTGFVLVAALPSTVILLGLAVSLGLVGLILGWWLGRTAGGQLTG
FT                   PARVSASLAVLGLLGAGLTTVAPNPCDIETAYHCARVETDPGRASGRTLLLNSARHSYV
FT                   DLADPTHLEYAYTRWIGAVADVMAPAGRRLDALHLGGGGFTVPRYLTATRPGTENVVFE
FT                   IDGGLVELGEEKLGVRQGPDLRAVVGDARMLVAAEPAESQDLVVGDAFGHLVVPWHLAT
FT                   REMAAEIRRVIRPDGGYVQNVIDYPPLRFIRSEVATVAAEFRQVALIAPPAALAGEQGS
FT                   NFVIVASDVPLPLAAVRERLSEVDPGAVVLDGAALQEFVAGALVLTDDYAPVDQLLATG
FT                   "
FT   gene            complement(428792..429460)
FT                   /locus_tag="Strop_0372"
FT   CDS_pept        complement(428792..429460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0372"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52857"
FT                   /db_xref="GOA:A4X1V7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V7"
FT                   /protein_id="ABP52857.1"
FT                   /translation="MSARKDQHSGVIVVGLGRFGSHLADTLVQLEHPVLAIDQDAERVQ
FT                   RWANRIDRVVQADATDEEALSQLGAADLGRAVVAIGASLEASVLSVLALTELGIPQIWA
FT                   RATSPEHAKILASVGARHVIFPEAEAGERLAHLIVSRMLDFIEFGDDFVIAKVRTPESL
FT                   TGRPLRELTPEHRRGVQVVGVKLAGKRFQAATEDTVLSSGTMLIVEGGSEEVQSFAALS
FT                   "
FT   gene            complement(429450..430784)
FT                   /locus_tag="Strop_0373"
FT   CDS_pept        complement(429450..430784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0373"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52858"
FT                   /db_xref="GOA:A4X1V8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V8"
FT                   /protein_id="ABP52858.1"
FT                   /translation="MQWLLRRPVRLVPIGFGATILIGTLALMLPWATGQQRHTPFVTAL
FT                   FTSASAVSVTGLAVVDTPNYWNDFGLAVITILTQVGGLGIVTGATLVILAVSHQLGLRN
FT                   RLLVQAETAEFGLGDVRRLLFRIAAIALTTEAIITVILTLRLWVKYDYAFGEALWTGVF
FT                   HAVQAFNNGGFALYSDGLIGLSSDAWLILPMAFGALLGGLGFPALFEAVRSGRRPRCWS
FT                   VSTKLTIWGSVTLVTVGFLALLATEWSNPYTLGIRPWPEKILAAFAQNAFFRTGGFNVI
FT                   NIEALGEESIPAIIALMFIGGGSASTAGGIKVSTFFLLAFVIWAELRGEPDVTIRHRRI
FT                   ATASQRQAVTVALLGVAIVVVGTVTLILLTQGVPHHVALFEVTSAFSTAGLSLGVAPDL
FT                   PDGGQYVLIVLMYIGRVGSLTLGSALALNTRRRLYRYPEEQPLVG"
FT   sig_peptide     complement(430629..430784)
FT                   /locus_tag="Strop_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.521 at
FT                   residue 52"
FT   gene            430869..431711
FT                   /locus_tag="Strop_0374"
FT   CDS_pept        430869..431711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0374"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52859"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1V9"
FT                   /protein_id="ABP52859.1"
FT                   /translation="MGVSGKPTAGGSPVRAHPANLLIDGGFEGGQRMGERLAVVSGGGT
FT                   GIGAATAQVLAVDGFDVLVVGRREDALRATTARLSWDLARPGAVRAVVADLTDPQQVPR
FT                   VVEAVDGRAVDAVVNNAGGYLGGEPDTLAGVAEQWRASLEANLLTAVLLTEALRPTLRR
FT                   PGGRVILVSSAAAQQGGGGPHSAAKAALHGWAYDLAVRLGPDQVTVNVVSPGYVVDTEF
FT                   FGGRRTPEGHARRVAATLVGRAGTPDDIAAAVRYLAGPAAGYVTGQVLGVDGGSVLGR"
FT   gene            complement(431740..432555)
FT                   /locus_tag="Strop_0375"
FT   CDS_pept        complement(431740..432555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52860"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W0"
FT                   /protein_id="ABP52860.1"
FT                   /translation="MTQRIGANPLGRRVTVGPATFLAAGLLLTGCGVGGTEPPPSTPAD
FT                   PKDTLLAAVPNETTPAFRFSGTEVGGASVSGSVDPLLKAMELTFIQTDIETKAGGEFSM
FT                   TMSLRLIDERAWTKVSVGETAEMNEQLGLPRQWVELDQSKLSSIPEYDGADMGNAALII
FT                   RAADEVQQQADGSYTGTVDLTDESEVAEVVMNGDIAALGEQATSLPFTAVIGSDGNLDT
FT                   LSVDLPAVDEQPAAEYVVKYFDYGNAPAITPPAGDVAPAPDAVYEMLGE"
FT   sig_peptide     complement(432421..432555)
FT                   /locus_tag="Strop_0375"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.650 at
FT                   residue 45"
FT   gene            432662..434800
FT                   /locus_tag="Strop_0376"
FT   CDS_pept        432662..434800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0376"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   PFAM: helicase domain protein; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52861"
FT                   /db_xref="GOA:A4X1W1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W1"
FT                   /protein_id="ABP52861.1"
FT                   /translation="MGQDRTAVREQAETVLRRLAGEHARLRDDQWRAIEALVVDRRRVL
FT                   CVQRTGWGKSAVYFVATALLRALGTQGPTVIVSPLLALMRNQVEAAARAGIRARTINSA
FT                   NLDEWDEVTGEIHAGAVDVLLISPERLNNPDFRDTVLPKLAATTGLLVVDEAHCVSDWG
FT                   HDFRPDYRRLRTFLGNLSAGTPVLATTATANARVTQDVAEQLGAASRLGAGPEALVLRG
FT                   SLDRESLRLGVVDLPGPAYRLAWLADHLDELPGSGIIYTLTVAAAAEITEFLRSRGYTV
FT                   ASYTGQADDADRRAAEQDLLDNKIKALVATSALGMGFDKPDLGFVVHLGAPPSPIAYYQ
FT                   QVGRAGRAVAHAEVLLLPGGAEDAAIWRYFAALAFPPEDQVRSVLAALHTDRPLSTPAL
FT                   EPIVDLRRTRLELMLKVLDVDGAVRRVRGGWISTGEPWIYDEARLRRVAAARTAEQAAM
FT                   REYATTSACRLRYLRECLDDAGATDCGRCDRCAAPTFTEELSDGALRAAEAFLGRSGVG
FT                   ISPKKLWPTGLAAVGVPLKGRIALPEQALPGRAVGRLSDLGWGGRLRELVGPDTADVDA
FT                   PDDVVAAVVEVLREWAHGTDPWPRRPVGVVAVGSRHTRLVASLAGRIAAVGRMPLLGTV
FT                   MVSAAGGPRGNSAQRVRALHGSVALPSELVGALAGLSGPVLLVDNLVDSGWTMTMVTRE
FT                   LRRAGAPEVLPLALAVAG"
FT   gene            complement(434805..435221)
FT                   /locus_tag="Strop_0377"
FT   CDS_pept        complement(434805..435221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0377"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52862"
FT                   /db_xref="GOA:A4X1W2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W2"
FT                   /protein_id="ABP52862.1"
FT                   /translation="MASGEGTAQAAFARFVRRAIDNARMERGWTVTDLAAQTGIGRSTV
FT                   FRWLAGDWHDYPELAKVRGFCVALDLPVAAAFRALGLPEAGSALPRRGNDGPVEADVRA
FT                   ILERLADPAVSVEEKHHIRDLLRYLAQRPIRQPE"
FT   gene            complement(435350..436555)
FT                   /locus_tag="Strop_0378"
FT   CDS_pept        complement(435350..436555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52863"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W3"
FT                   /protein_id="ABP52863.1"
FT                   /translation="MPEPLPAALAEVRALLLDAGLNRAVAAGHRRGLRPAAHRAELRPV
FT                   TLKSGPRLQVITTDGSAPHTRNLARGAEAEAAVDALLAEPFGNWHVETAATTLQLRVTK
FT                   SGAAQVHRMAAPPVAEPVGHDRTKAHLLDPGDPIFTVIGGSAAKRRQVDAFLRALAATL
FT                   PDGLRGPLRVVDLGCGNAYLTFAAYRWLTQQDIDVHLVGVDVREDQRQRNTELARRLGW
FT                   ADQVRFVAGTIADAAVGPDPDLVLALHACDTATDEALARAVRWGSRWVLAAPCCHHDLA
FT                   AQLRSQPTPPPYELLTRQGILRERFADVLTDAVRAGLLRLHGYRAEVVEFVDSRHTPRN
FT                   LLIRARRAGAPPTGEHWAQYRTLVDGWRVTPRLATLLGEPAGGTATSATNGPADTTTDP
FT                   TD"
FT   gene            complement(436657..438522)
FT                   /locus_tag="Strop_0379"
FT   CDS_pept        complement(436657..438522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0379"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52864"
FT                   /db_xref="GOA:A4X1W4"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W4"
FT                   /protein_id="ABP52864.1"
FT                   /translation="MGTDRRSISIWSQSIWSNDRLVPVSIWSQPAHDARAARSGSAIRC
FT                   PTVWPAPHRPRLEDSTGRTHERAPPIEMSELTHNLMDGTELAATAPVRPEAPTFAELGA
FT                   RKETVDALNAAGITRAFAIQEYALPIALRGVDLIGQAPTGTGKTLGFGVPLLERVFAPA
FT                   EGGDGTPQALVVVPTRELGIQVAKDLHAAGSTRGVRVLPIYGGVAYEPQIEALRTGVEI
FT                   LVGTPGRLLDLAKQKQLKLDRVRALVLDEADRMLDLGFLDDVEKILAMLPEERQTMLFS
FT                   ATMPDPIVALSRRFLRRPVTIHAGHTAETGPSPQTQQLAYRTHSLNKIEIVARILQAKG
FT                   RGLTMIFTRTKRAADRVAADLDFRGFAVAAVHGDLGQGARERALRAFRTGKIDTLVATD
FT                   VAARGIDVSGVTHVLNYDCPEDQDTYTHRIGRTGRAGASGVAVTFVDWDDMPRWRIIDK
FT                   TLGLEMPEPPETYHTSPHLYAELDIPSEVTGTLPTDARTRAGLSAEVEEDLGGGSRRGD
FT                   GRGPRRGTGRDRRRGRGGDASGGAGSSTTEPGEAGETAERTPRRRRRRRGGEVVTTGEP
FT                   AVVTVETGAAATTDSPGADAPKPRRRRRRRGGASGTGTAAKTTTD"
FT   gene            complement(438890..439117)
FT                   /locus_tag="Strop_0380"
FT   CDS_pept        complement(438890..439117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52865"
FT                   /db_xref="InterPro:IPR021456"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W5"
FT                   /protein_id="ABP52865.1"
FT                   /translation="MEVKIGVQYAPRELVLESAQSPAEIERIVTDAVAGDGGTLSLTDE
FT                   KGRRVIVPVDKVAYVEIAEASSRAVGFTVR"
FT   gene            complement(439183..439821)
FT                   /locus_tag="Strop_0381"
FT   CDS_pept        complement(439183..439821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0381"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52866"
FT                   /db_xref="GOA:A4X1W6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W6"
FT                   /protein_id="ABP52866.1"
FT                   /translation="MTAVGNGTQTAGRPTRLPRSARRRQLLAAAQEVFVAQGYHAAAMD
FT                   DIAERAGVSKPVLYQHFPGKMELYLALLDTHCDMLVATVQEAMRGTLDNKERVSASVRA
FT                   YFDFVDHESESFRLVFESDLRNDPAVRQRVERVEQGCIAAITDTIISDTGVSRAHAELL
FT                   ASGLVGAAETAAQFWLARGRQVPKGEAEALVAALSWRGIASFPLQGESA"
FT   gene            439967..442186
FT                   /locus_tag="Strop_0382"
FT   CDS_pept        439967..442186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52867"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W7"
FT                   /protein_id="ABP52867.1"
FT                   /translation="MSDAGQPGAASPGEHGDETGPQPVHSRSDSPWVPPTGGWAPEPST
FT                   PWRRSDSPVGWADSSPRHGDLPVPPPGATESGFHPQLNGYRVNGHPHPASGVPASRPSP
FT                   VSAPPGRPGEPAQEAGGDRATAPVSAAEQPPALAGGRSPEAGRDDWSDPPAEPGLTPAA
FT                   DRPTSPPEDWSGPSWGDEWASSQVSGESSPAGRRARMEPDGWDEPEPPGRRFRSGTARD
FT                   AAGKRRESSGRRFRPDPDATEAGEGRQPSTERPAWAVEPQRAYEPVRAEPASTFPIEPG
FT                   HRSGIRPKRQPGTEPAHQPSDPAAAWVPEQPAGSAEVDPPSATSARGGPGGWDRTPPEP
FT                   NPTSAPPHPARRSAPEPAATASLGDADRLPESVSAMLPQRVPAEPDVPVVPELPAAEAP
FT                   AKTPELARIATHLRQVDEPAPLRERPEGFDVDAILGAVRGVAGVRDAALRRTQSGAHSL
FT                   RLDLADGADPAEVSRHVARLLQERMGLAAAPQNMPEEPAGSVSSAPRRTDRPAHEEPAA
FT                   RAGRSPAGLPSRTERRNAALSEPPRRRRYSGGPHHGWATVDGPAVVSGAADGPATAETS
FT                   YGGGQITNTELAPSRPLDTGGRPGPRVVLDHVQVSTFGLDATVEVRLLSAGSPAAGYAT
FT                   GPAVDGYVLRLCATAAAAAVDELLRTPGSQPDRGRCFVEHATLVPLGNCEVATVVVLLV
FT                   CDGWVEQLAGSALVAGDPRQAMVRATLAAVNRRLEALLVDTGNAR"
FT   gene            442332..443513
FT                   /locus_tag="Strop_0383"
FT   CDS_pept        442332..443513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0383"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   Rhodanese domain protein; MoeZ/MoeB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52868"
FT                   /db_xref="GOA:A4X1W8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W8"
FT                   /protein_id="ABP52868.1"
FT                   /translation="MSLPPLVEPAAELTVDEIRRYSRHLIIPDVGVEGQKRLKNARVLC
FT                   VGAGGLGSPALMYLAAAGVGTLGIVDFDTVDESNLQRQIIHGVSDVGRAKAESASASIR
FT                   EINPLVEVKIHNTALDRDNVKEIFAQYDLIVDGTDNFATRYLVNDAAVLLGKPYVWGSI
FT                   YRFDGQASVFWAEHGPCYRCLYPEPPPPGMVPSCAEGGVLGVLCASIGSIQVNEAIKLL
FT                   AGVGESLVGRLMVYDALEMSYRKIKVRKDPNCALCGENPTVTDLLADYEDFCGAVSTEA
FT                   QEAVVDATVTAGELKAWQDAGKEIFLVDVREPAEFEIVRIPGSTLIPKGDIVSGHALGK
FT                   LPQDRQIVLHCKSGVRSAEALAALKAAGFRDAVHLQGGVLSWIRQVDPSLPAY"
FT   gene            443582..444454
FT                   /locus_tag="Strop_0384"
FT   CDS_pept        443582..444454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52869"
FT                   /db_xref="GOA:A4X1W9"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W9"
FT                   /protein_id="ABP52869.1"
FT                   /translation="MEDSRERDRICPGSVTAVVDIDAAIGYVVARGDVVERARLGRLRT
FT                   GTPPAEEVLAVAEVGQLPEGGWPAYLEGETASVDATCFRLGELDDLGALGRSAARRALD
FT                   WLAARQLPEGGWEEDATLADTAPEWARPGAPEAGFYLTASAAFWLSVAGLDARAAGPLD
FT                   ARVGGAYAGVVHGAALSLAARLNPDGTWPSFLAAGWLSAAVLFRQEMYQESARIQVALA
FT                   ERIGDMAPANVAWLGATLRRVGVDPQDWVLVRARRRLAETQRSDGGWESEDGHQFDVHA
FT                   TLTAIRACH"
FT   gene            complement(444542..445783)
FT                   /locus_tag="Strop_0385"
FT   CDS_pept        complement(444542..445783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0385"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52870"
FT                   /db_xref="GOA:A4X1X0"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X1X0"
FT                   /protein_id="ABP52870.1"
FT                   /translation="MSVVEQAQRARTAAAALAVATRADKDAALHAMADALVARTSEILA
FT                   ANGADLAAGRDEGLSTAILDRLALDAGRVADIADALRQMAALPDPTGEVVRGSTLPNGL
FT                   QLRQIRVPFGVVGIIYEARPNVTVDAAGICLKSGNAVLLRGSSSAARSNVALVSVLRDA
FT                   VAGTGLPADSVQLLDATTRDSVKELMRARGLVDVLIPRGGAALIRTVVEEATVPVIETG
FT                   VGNCHVYVDAAADVSKAVAIALNAKTQRLSTCNTAESLLVHTAVADAVLPPALAAFAAA
FT                   GVTVHGCPQVARHSTAVLPATDEDYATEYLSADISVAVVESLDAAVAHIQRYGTGHTEA
FT                   IVTDSQSAAREFVARVDAAAVMVNASTRFTDGGEFGFGAEIGISTQKLHARGPMGLPEL
FT                   TSTKYVVTGDGQLR"
FT   gene            complement(445835..446992)
FT                   /locus_tag="Strop_0386"
FT   CDS_pept        complement(445835..446992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0386"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52871"
FT                   /db_xref="GOA:A4X1X1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X1"
FT                   /protein_id="ABP52871.1"
FT                   /translation="MGTGPSVDQPTPQNGQVRDSVRAARRVVVKIGSSSLTTADGGLDD
FT                   GRVDALVDTLGTLAAQGREVVLVSSGAIAAGLAPLGLTRRPRDLATQQAAASVGQGLLI
FT                   RRYAAAFARHRRTVGQVLLTVDDMTRRAHYRNAYRTLRKLLDLGAVPIVNENDTVATEE
FT                   IRFGDNDRLAALVAALVDTDLLLLLSDVDALWTGDPTRPGSTRIAEVRDERDLSGVAIG
FT                   GAGRAGVGTGGMVTKVEAARIATGFGIPVILTSADQAAEALDGKPVGTFFHPSQRRPTA
FT                   RLFWLAHATSPRGRLQLDPGAVAAVVDRRKSLLPAGITAVRGAFTAGDPVDLVDTDGVP
FT                   VARGLVNYDAVELPGLLGRSTAELATALGPAYEREVVHCDDLVLL"
FT   gene            447033..447320
FT                   /locus_tag="Strop_0387"
FT   CDS_pept        447033..447320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0387"
FT                   /product="methylated-DNA-(protein)-cysteine
FT                   S-methyltransferase"
FT                   /note="PFAM: methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52872"
FT                   /db_xref="GOA:A4X1X2"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X2"
FT                   /protein_id="ABP52872.1"
FT                   /translation="MLELVERIPPGRAMSYGAVADALAERSGRASPRLVGSILARHGGG
FT                   VPWHRVVTSAGRLPPGHELSARARLLAEGTPLCGDRVDLRAAGWSPARGM"
FT   gene            447352..448845
FT                   /locus_tag="Strop_0388"
FT   CDS_pept        447352..448845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0388"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52873"
FT                   /db_xref="GOA:A4X1X3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X3"
FT                   /protein_id="ABP52873.1"
FT                   /translation="MDAPPAGTGPPAAGFTADRAPAGGPAGPSVAEALPRRVHLGYATG
FT                   SLATGAFGTVPGLLLLPYLTDTLGVTAGIAALLVLLPKAWDVLVNPVAGRISDRTRSRW
FT                   GARRPYLLGAGVALALFFALIFAAPFGTGAAAGGYVALAFLATATAFAFFQVPYVAMPA
FT                   ELTTGYTERTRLMTWRIAVLALAILVSGAVAPLVRDAGGGGISGHRWMGLFVAGLILLG
FT                   AVGAFVGTRSAPVGIVQESEPSLRAQLAVAGRNRAFRALLACFVIQSAGVATILAGVNY
FT                   FATQILRNPETGPTVLFACFVGPALLVMPVWSRIGQRFGKLTGLIAAALLFAAGALALV
FT                   AAELLPAVGIYLLVALVGVGYAGQQVFALAMLPDCIAYDEARTGRRQAGVFTGVWTAGE
FT                   TFGLALGPGIFGLVLQLSGYLSSDTGAAATQPESARLGILLGFTVLPAVMVGAATLLLR
FT                   PYSLTSADLGTVMEELSSRETGHSAGSTVTENHGKGTTG"
FT   gene            448842..450341
FT                   /locus_tag="Strop_0389"
FT   CDS_pept        448842..450341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0389"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: aminotransferase, class V; Pyridoxal-dependent
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52874"
FT                   /db_xref="GOA:A4X1X4"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X4"
FT                   /protein_id="ABP52874.1"
FT                   /translation="MIDEEGLPAHGLPAERVLDGIRALRSGDRPTHGGRLFAYVYDPAV
FT                   PGLDELTAAAHAESAHVNGLDPTAFPSLLAMENALVGAAAQLLGGGPGTTAPDVVGSVT
FT                   SGGTESLILAVKAARDAHPEITEPRIVMPVTAHAAFVKAGHYLRVAVDMVPVSAETLRP
FT                   DPAAMAAAIRPETVLVVASAPGYAHGVIDPVTEIAAVAADAGVRCHVDACFGGWALPWL
FT                   RRLGEPVPAFDFAVPGVTSISVDLHKYAYTPKGVSILLHRDPELRKTQYFAHADWPGYT
FT                   MINSVIASTRSGGPIAAAYATLRHLGEDGYLRLAAVTRDAMNELADVIRAAGGLRLVAE
FT                   PESTVICFTVTDPELDLFVLVDELAARGWHTQPQLAYAGLPRTVHLTLTASVAPVVGKF
FT                   GPDLADAVAATRAAGPVKLPAELLALARSLTPEGLTPDLVAGLAAGLGLGLGEAADAGA
FT                   EPVPARMAVVNTLLEEVPAALQERLLVEFVGLLQRPTWSRD"
FT   gene            450468..451034
FT                   /locus_tag="Strop_0390"
FT   CDS_pept        450468..451034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0390"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52875"
FT                   /db_xref="GOA:A4X1X5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X1X5"
FT                   /protein_id="ABP52875.1"
FT                   /translation="MQVPAVLGEPIRFVLNWGRRYSLWVFNFGLACCAIEFIATSMSRH
FT                   DFMRLGVIPFAHGPRQADLMVVSGTVTDKMAPAIKRLYDQMPEPKYVISFGACSNCGGP
FT                   YWDSYSVTKGVDQLIPVDVYVPGCPPRPEALLHGILRLQEKIAAEEAGVGGVSRPDALA
FT                   SPADALPPRAADSLTAPPVRPPDPS"
FT   gene            complement(451061..452107)
FT                   /locus_tag="Strop_0391"
FT   CDS_pept        complement(451061..452107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0391"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52876"
FT                   /db_xref="GOA:A4X1X6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X6"
FT                   /protein_id="ABP52876.1"
FT                   /translation="MRAVTVSPRIPGSLCLVEDWPEPAVEEGGILVEALAVGVCGTDQD
FT                   IIAGHFGEAPPGQEQLVIGHESLGRVLEDPTGTLHRGDLVAAIVRHPDPVPCLNCAVDE
FT                   WDMCRNGLFTEHGIKGLPGFARERWRVQPRFAVPLGAAFARVGMLLEPTSIVAKAWEHI
FT                   ERVGHRARWDPRTTLITGAGPIGLLAALLATQRGLTVHVLDRNTTGPKPDLVRALGATY
FT                   HTESVNEVDLQPDVLVECTGDPRVVLDSMCKVGPTGIVCLTGMSTGGRTIDFDAGALNR
FT                   TLVLENTVVIGSVNSNRRHWEQAAAALARADHSWLDALITHRIPMSDFTTAYEVNDGTI
FT                   KVVLDLTA"
FT   gene            452287..452892
FT                   /locus_tag="Strop_0392"
FT   CDS_pept        452287..452892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0392"
FT                   /product="NADH dehydrogenase (ubiquinone), 30 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 30 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52877"
FT                   /db_xref="GOA:A4X1X7"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X7"
FT                   /protein_id="ABP52877.1"
FT                   /translation="MTLDEVGQRMAALLAPVEVTTSVSGGQAYARATVDVPAESWHDAL
FT                   RAARDDDELACDFFDWLSAVDELAAGFDVVVHLWSSTRRHGLLLRTRVPRAAPRVASVV
FT                   DIYPGAAWHERETHEMFGIDFADHAGLKPLLLPPEFEGHPLRKEFVLASRVAKPWPGAK
FT                   EPGEAKAGGGRRPMRPPGVPAPGEWGPAPTATESGGTA"
FT   gene            452892..453854
FT                   /locus_tag="Strop_0393"
FT   CDS_pept        452892..453854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0393"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52878"
FT                   /db_xref="GOA:A4X1X8"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X8"
FT                   /protein_id="ABP52878.1"
FT                   /translation="MPLWVELLFRVGGVLVAFLTLPLLVGQAEHKIMAHMQGRLGPMYA
FT                   GAFHGWAQLIADGVKFVQKEEVTPRGADRPVFRLAPVVALVPYLLVLLVIPLGPGDLVA
FT                   QPLDIGLFFVLAVVGVGVVAVLMSAWASANKYSLLGGLRAAAQLLGYELPFVLAAASVA
FT                   MAAGTLSLPGIVEAWQPWWLLWQAPAMIVFFVAGLAEIRRPPFDMPIADSELVFGYLTE
FT                   YTGLRFALFLLAEYVGVVVIAALTTVLFLGGWQGPFADAQLGWLWTLLKVAAVSFVIIW
FT                   FRVSYPRLRADQLQRLCWLVLVPASLAQLVLTVTVRMAL"
FT   sig_peptide     452892..452978
FT                   /locus_tag="Strop_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.761) with cleavage site probability 0.752 at
FT                   residue 29"
FT   gene            453881..454846
FT                   /locus_tag="Strop_0394"
FT   CDS_pept        453881..454846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0394"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52879"
FT                   /db_xref="GOA:A4X1X9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X9"
FT                   /protein_id="ABP52879.1"
FT                   /translation="MTPRKLGYLYGIGAYVLWGFFPLYMRLLRPASPLEILAHRIVWSV
FT                   VFVALVLAAMRNRSFLRALLRRPRALAALGIAAALVALNWGTYIYGVNSERVVETSLGY
FT                   FVNPLVVVLLGVFVLRERLRPAQWAAIGVGGAAVVVLTVDYGRPPYLALVLSFTFAGYG
FT                   LVKKRLGLPAAQGLFVESAVLALPALAYLAWLGGTGGATFGAVSAGHTALLISAGAATA
FT                   IPLLMFAGAANRLPFTSLGMLQYLAPILQLGCGVIIFREPMPPARLAGFALVWLALAVF
FT                   TVDAVRAARRLPPPLADEVLAAVQPGSGTSPQQERKIVSG"
FT   gene            complement(455217..455870)
FT                   /locus_tag="Strop_0395"
FT   CDS_pept        complement(455217..455870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0395"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52880"
FT                   /db_xref="GOA:A4X1Y0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y0"
FT                   /protein_id="ABP52880.1"
FT                   /translation="MVRVLIVDDDPLVRAALSMIIDGVADLLVVGEATDGAEVPAAVAA
FT                   YAPDVVLMDIRMPRLDGLAATEKLRSEPNAPEVLVLTTFDADEQVLRALRAGAAGFLLK
FT                   DTAPAEIVHAIRRVAVGETMLSPTVTRQLVAHVTGGVGADSRRQRAQERLAMLSERERE
FT                   VAIALGRGRSNAEIAGELFMSVATVKAYVSRLLAKLDLNNRVQVALLVHDAGLV"
FT   gene            complement(455942..457216)
FT                   /locus_tag="Strop_0396"
FT   CDS_pept        complement(455942..457216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0396"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, dimerisation and
FT                   phosphoacceptor region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52881"
FT                   /db_xref="GOA:A4X1Y1"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y1"
FT                   /protein_id="ABP52881.1"
FT                   /translation="MTSAAVSEHSWLLPGTLTAPTARARRTLRDWFVDSLCFLAAFGWA
FT                   VVAWDNSLSAEPAMAMNVGPSWLNEVDFLASLVLCGALWVRRRWPVGLALASLPLALFT
FT                   VSGDVALLIILFTVSVHRPFPVAASMFGVHLLAIPIYLWLRHDPVMSLWLTVGWILLCL
FT                   GAVLAWGMFVRARRQLVVSLRERAHRAEAEQQLRVTQARQLERTRIAREMHDVLAHRIS
FT                   LLSLHAGALEFRPDASPEEVARAAGVIRGSAHAALRDLREVIGVLRAETGVAEGAEPER
FT                   PQPTLVDVPTLISESRAAGVRVSFVEEVADQVELPPRVGRSVYRIVQEGLTNARKHAPG
FT                   VVVDVRLTGRQGDGLTVEIRNPWPVGVAGQGVGSPAARSGTDIPGAGTGLVGVAERVGL
FT                   AGGRLEYGRDAGGHFRLAAWLPWPA"
FT   gene            457349..458248
FT                   /locus_tag="Strop_0397"
FT   CDS_pept        457349..458248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0397"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52882"
FT                   /db_xref="GOA:A4X1Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y2"
FT                   /protein_id="ABP52882.1"
FT                   /translation="MIMVEHLTKRYGPHTVVDNISFHCEPGTVTGFLGPNGAGKSTTMR
FT                   MICGLTPPTDGSATVAGRPYRQLPNPGREIGVLLDASAQHSGRTGRETLTLAATTMGVD
FT                   RSRVAEVLDLVGLNAVAARRRVGAYSLGMRQRLGLALALLGDPRVLILDEPANGLDPEG
FT                   IYWMRGLLRDFADRGGTVLLSSHLLREVEAVADRLLVVGGGRIVAQGGRDELLADTGTL
FT                   VRARDSLALRLTLQRAALDATADTNGGFVVHADPGVVGQAAADAGVVLTELRPAAGGGL
FT                   EQLFLTLTAGATTKEAVK"
FT   gene            458245..459030
FT                   /locus_tag="Strop_0398"
FT   CDS_pept        458245..459030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52883"
FT                   /db_xref="GOA:A4X1Y3"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y3"
FT                   /protein_id="ABP52883.1"
FT                   /translation="MTLTAEPTTEADSRVAAVRPSIARLTSIELRKLTDTRAGRWLLAT
FT                   IGLIAVAIAVVQLFVLDDAEQTFTGFLAPSLLPVGLLLPVVGILSITSEWTQRTALTTY
FT                   ALVPHRERVVLAKLAAVVLAALASVLVSLAVAAAGTLAAKATGGAGSWDGEWALVLHAA
FT                   VIQLVNVLMGAAFGLLLLNTPLAIVGYLLLPTVWSILAAMISALQGPANWLDTSVTMEP
FT                   LFGNEMTAGQWGRLAVSVLVWVAVPLVAGLLRTLRREVS"
FT   gene            complement(459178..460239)
FT                   /locus_tag="Strop_0399"
FT   CDS_pept        complement(459178..460239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0399"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52884"
FT                   /db_xref="GOA:A4X1Y4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y4"
FT                   /protein_id="ABP52884.1"
FT                   /translation="MTEGATANSGEAALRRTGGRYVEPGGEFTRDQRYIATRITADGGD
FT                   GWPVEPGRYRLAVSRACPWANRLVIVRRLLGLEGVLSMAIAGPTHDRRSWSFDLDPGGR
FT                   DPVLDIERLAEAYFARFPGYDRGITVPAIIDVPTGQVVTNDFGQMSLDLSTQWTAYHRD
FT                   GAPELYPQRLRDEIDEVNGVVFADVNNGVYRCGFAGSQSAYDRAYRRLFDRLDWLSDRL
FT                   AERRYLVGETITEADVRLFTTLVRFDPVYHGHFKCNRSKLTEMPVLWAYARDLFQTPGF
FT                   GDTIDFDHIKRHYYEVHGDLNPTGIVPLGPDLANWLTPHGRGELGGRPFGDGTAPPPPP
FT                   PAERVDPAHTPLR"
FT   gene            460425..461075
FT                   /locus_tag="Strop_0400"
FT   CDS_pept        460425..461075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0400"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52885"
FT                   /db_xref="GOA:A4X1Y5"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y5"
FT                   /protein_id="ABP52885.1"
FT                   /translation="MVGMTDPSERSDPADGERGLPGVGLVKGLAVTLKTMTRRSATQQY
FT                   PDVAPALPPRSRGVIALLEENCTVCMLCARECPDWCIYIDSHKEEVMVPGATRSRQRNV
FT                   LDQFDIDFSLCMYCGICIEVCPFDALYWSPEFEYAEYDIKDLLHDKEHLGEWMGTVPPP
FT                   PAHDPNGEPAKEETAAARKAAIPASPTDRPSAPPPRPGARPAGGAATGEGPTP"
FT   gene            461072..461635
FT                   /locus_tag="Strop_0401"
FT   CDS_pept        461072..461635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0401"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52886"
FT                   /db_xref="GOA:A4X1Y6"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y6"
FT                   /protein_id="ABP52886.1"
FT                   /translation="MTAADALLLALGALAVGSGALAVATRHLVRAGLYLVVCLAAVAGM
FT                   YLVLTAELVAWVQVLIYVGAVVVLLLFAVMLTRAPIGASTDLDRPGWPAALIGGGTGLG
FT                   LAALLVDAYRWSSVPLPTAGSAERIGEQIFGSWVLPFEVLSVLLLAALVGAIILSRPDI
FT                   GRSPMDPAGVSAADEASDEGRRSR"
FT   sig_peptide     461072..461140
FT                   /locus_tag="Strop_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.720) with cleavage site probability 0.472 at
FT                   residue 23"
FT   gene            461632..462015
FT                   /locus_tag="Strop_0402"
FT   CDS_pept        461632..462015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0402"
FT                   /product="NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52887"
FT                   /db_xref="GOA:A4X1Y7"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y7"
FT                   /protein_id="ABP52887.1"
FT                   /translation="MRPVIPYVTAALLFGLGTYGVLRRRNAVLVLIAVELMLNAVNLIL
FT                   VTADTTVRSQLPHGGQVFALFVIVLAAAEVGVGLAIVLQLYRLRASVAVDEVPLAEPPS
FT                   PNSPAEPSAPPPAAAATPGEADR"
FT   gene            462012..463961
FT                   /locus_tag="Strop_0403"
FT   CDS_pept        462012..463961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0403"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain L; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52888"
FT                   /db_xref="GOA:A4X1Y8"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y8"
FT                   /protein_id="ABP52888.1"
FT                   /translation="MTAPVLLGTLLPVVPLVTGLLGLLLPPASPEAGAARRRARRAAIA
FT                   FGTTGAALSLLLAVALLAILDAPAEATRTWIDFGGLTVTLGVRLDSTVALVAVAVAAVA
FT                   LAVQVYSVGYLRSGPHDEVDVDHRYPPYAAQISLFTAAMLLVVVAGDLILLLVGWEVMG
FT                   LCSYLLIAHERRLPAAPAAAMKAFLVTRVGDVGFLLGIALLGVSAGSFRIADVLGHDHA
FT                   TGLLTAACLLLLAGVAGKSAQFPLHTWLPDAMAGPTPISALIHAATMVAAGVYVVARLF
FT                   PLFVQVPVALAVLGVLASITLLLGAFAAIAQDDLKRVLAWSTVSQLGYLTGALAVGAPT
FT                   AALFHLLTHAAFKALLFLAAGAVIHAAGTALMSQLGGLRRTMPVTFWSMLIGLGALAGL
FT                   PPLSGFFSKDAVLYAAEEAALHGGPAPTWVGWSVWLAGLAGVTLTAGYATRLLLRTFFG
FT                   APRSPLRQPHDPPAVMRWPVLLLTVPAALLGLAGFSGAFAGWLEPSWSATRERPADLLP
FT                   VDPLVHLGPTVLLPLGLLALGAGLAWARWRRDPGGDPAALLGRLRPLSARAFWLDDLQH
FT                   SLVVRPVSRLAAGARTADEVVVDGAVTGSGRAAWWLGGGLAAWHRATLPRAAAGVLAGA
FT                   LLLGLAAVLIGGDA"
FT   sig_peptide     462012..462116
FT                   /locus_tag="Strop_0403"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.574 at
FT                   residue 35"
FT   gene            463958..465469
FT                   /locus_tag="Strop_0404"
FT   CDS_pept        463958..465469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0404"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52889"
FT                   /db_xref="GOA:A4X1Y9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y9"
FT                   /protein_id="ABP52889.1"
FT                   /translation="MSGVMGQVLLVAVLAVPAAGAAVVAALRHDRIARLVGTVAAGLTL
FT                   LAALPLVAGGDDGGAGSDANPAVRPWHQVDLPWVPGLDLRFHLGVDGISWPLVVLTALL
FT                   TLLCCGYTLWKVPSGGSGRALVALLLVVEVGILGTFLALDLVLFFVFFEVVLLPMYAII
FT                   VGWGGPDRYRAARKFALYTLLGSVLLLVGVMVVVTAAGTADIVALTGGTGLSRGPQLAA
FT                   FTLLALAFAVKSPLWPLHSWLPDAHTQAPTVGSVILAGVLLKMGTYGLIRVAVGVAPEG
FT                   AEWAAPVLGVLAVAAILVGSLVCLAQTELKRLIAYSSVGHMGFVLLGVATLTGTGLRAA
FT                   LIGNIAHGVITGLLFFLAGAVKDRAHTGDLADLSGLRETAPRLAGLLGFAAVASLGLPG
FT                   LAGFWGEAFAVIAAVRAGGPLWLTLAALAALGGALTAAYLLRLLRQVTHGPASSAVARV
FT                   GPGVARAELLTWAPLVLLTLAVGLAPILVLGVAQAPVDALLTGRP"
FT   sig_peptide     463958..464023
FT                   /locus_tag="Strop_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.583 at
FT                   residue 22"
FT   gene            465489..467039
FT                   /locus_tag="Strop_0405"
FT   CDS_pept        465489..467039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0405"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52890"
FT                   /db_xref="GOA:A4X1Z0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4X1Z0"
FT                   /protein_id="ABP52890.1"
FT                   /translation="MSMVQTVDNVALLPAYLAAGTAVLVLLADLLVARARVTISVAALG
FT                   ALATAAGAVLVGGGGERRTFCVGADCSYVFGGRAALVAVLVALLTLGVLGLSGPLLRAG
FT                   ATPVGEYCFLLAASMTGGVALGAAGDLITLIVALETLTLPLYVLVGLRRGSLASIEAAV
FT                   TFFVVSVVATTLTLLGAALLYATTGALHLGRLGALFAERPELLDIPLTTVAVALVVVGL
FT                   TVKVAAVPFHAWAPTTYDGAPLPVAAYLSTVSKLGGVVALLAVVQHALPAQITGLVLAL
FT                   LAVLTMTVGNLVALRQRRTVRLLAWSSVAQAGYILAPLGALALAAGRTGDARAAAYAAA
FT                   VAYTVFFVVLELAAFAAVVALRPAGADGGTLDELRGAARRRPWAAVGLALALVGLAGLP
FT                   PGLAGLFAKVTVVRSLLDGGAAGLALVVAVNAVLGLAYYLRVVAALWSTDRPAVIPTDP
FT                   TAVPTDPAAAATGPAVGSIDPSVALVRAKPVAVVLAAATVVALVVGFAPQLVLDLAAR"
FT   gene            467109..468029
FT                   /locus_tag="Strop_0406"
FT   CDS_pept        467109..468029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0406"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52891"
FT                   /db_xref="GOA:A4X1Z1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z1"
FT                   /protein_id="ABP52891.1"
FT                   /translation="MLNRSADRRDPRPEGVTVHHNRLKTAALLGLLTALILAVGYWFGG
FT                   SGGLVIAVVISLVMNGVSYFYSDKLALRAMQAQPVSEAQFPELYQMVRELAVEARQPMP
FT                   RLYVSPTRQPNAFATGRNPENAAVCVTQGIVEILDYRELRGVIGHELSHVYNRDILISS
FT                   VAAGLAGIITALANLAFFIRLGGDDEEGRNPLVLLLTIILGPIAATLIQLAIGRSREFQ
FT                   ADASGAQLTRDPLALASALRKIHKGTQARPLPPQGQLTSAAHLMIDNPFKGGGIAALFS
FT                   THPRMEERVARLEQMAGNTGPIQYR"
FT   gene            complement(468293..469051)
FT                   /locus_tag="Strop_0407"
FT   CDS_pept        complement(468293..469051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0407"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52892"
FT                   /db_xref="GOA:A4X1Z2"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z2"
FT                   /protein_id="ABP52892.1"
FT                   /translation="MRVAGAQDAEFGHQDLSHRAVARLLVVLSASSGCLDVFCVTQLGG
FT                   FFASVITGNLVQLGHNLVAADSRLLIGGSVAVGGYAVGVAAGTLPLRHAGLGWRFRTHV
FT                   VTAAQVLILVGVAGGWWATGGRPDYPVSLALLFAAATASGIQSVVTISSGIPHAATTYL
FT                   TGSLTYIVRGMVFDPHRFAAGAAGANRLLGLLGGAVLGAVVLRVAPLWAPALAAALVAW
FT                   VLATAIAISRLHRRAHPPLTEGPASRGRNR"
FT   gene            469214..469912
FT                   /locus_tag="Strop_0408"
FT   CDS_pept        469214..469912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0408"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52893"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z3"
FT                   /protein_id="ABP52893.1"
FT                   /translation="MVNLDGLRVAVTGAGRASGRLLATAFAEHGAQVFVSARDEVAARR
FT                   TTDSIRQRGRGRGEAFVCDLTSPDSVRAFAAALTDRTDHLDVLVNNGAGYLHGVDLGDV
FT                   EDDHIIATIGGTATGTVLLTKHLLALLRASTRPDIVNMISACGEVGHHRSEAHPAFYAA
FT                   KHAQAGFAEIMSHRLRVEGIRVISLFPPDFVQHGPRVASNNLTAQSVVDCVLFAVSQPR
FT                   DCFIREFRFE"
FT   gene            complement(470127..470621)
FT                   /locus_tag="Strop_0409"
FT   CDS_pept        complement(470127..470621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0409"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52894"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z4"
FT                   /protein_id="ABP52894.1"
FT                   /translation="MAANPSFDIVSKVDRQEVDNALHQTERELSTRFDFRGTGAEISWS
FT                   GEEAISLRAETEERVKAALDVFKEKLVKRNISLKSLDAGDPRASGKEFKVDCKVIQGIE
FT                   SDKAKAISKKIRDEGPKGVQAQIQGDQLRVTGKKKDDLQAIIAMLKGEDFGVALQFTNY
FT                   R"
FT   gene            470769..470852
FT                   /locus_tag="Strop_R0010"
FT                   /note="tRNA-Tyr1"
FT   tRNA            470769..470852
FT                   /locus_tag="Strop_R0010"
FT                   /product="tRNA-Tyr"
FT   gene            complement(471193..471564)
FT                   /locus_tag="Strop_0410"
FT   CDS_pept        complement(471193..471564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52895"
FT                   /db_xref="GOA:A4X1Z5"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z5"
FT                   /protein_id="ABP52895.1"
FT                   /translation="MTRVRHSGQQLRSGDHVGGGHMETWRFLAGVTMGVTMCLLGVALA
FT                   SNFRGMAERHVQQSMSFAGTLRRVPPWRWLPDASHDQRLARFILLERVFGVALAAVGFV
FT                   FLIGLAYSIAANQPMRMVK"
FT   gene            complement(471923..472396)
FT                   /locus_tag="Strop_0411"
FT   CDS_pept        complement(471923..472396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52896"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z6"
FT                   /protein_id="ABP52896.1"
FT                   /translation="MEQATLWMAKIDGSDRRELRDEVSELCGPAWLPDSRQLLVATRIT
FT                   ADRSGKGLVDVSSGKFTEVDHTDGCQPAWAADGTIAAPDGGDGTIVLTGPDGTDQRTIP
FT                   RLGYGHEYVSFDLSSLSPDGRRIALYRSNPARTVGDAARSLRANVVLDTPARR"
FT   gene            complement(472643..473293)
FT                   /locus_tag="Strop_0412"
FT   CDS_pept        complement(472643..473293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0412"
FT                   /product="Nucleoside phosphorylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52897"
FT                   /db_xref="GOA:A4X1Z7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z7"
FT                   /protein_id="ABP52897.1"
FT                   /translation="MTGVLVVTAVPAEAEAIRAGRGPTVTVAPVGVGPAVAGAATARLL
FT                   ALAEAAGRPYRLVVSAGVAGGFTGRVKVGGTVVGTSAVAADLGADSPTGFIPVDQLGMP
FT                   AELLGGGPTITADPTLVAALRAALPAAAAGPVLTVGTVTGTVAGTDALLRRHPDAVAEA
FT                   MEGYGVAVAAAHAGLPFVELRTISNPVGPRDRNAWRLREALTALTEAAAALPF"
FT   gene            complement(473290..474921)
FT                   /locus_tag="Strop_0413"
FT   CDS_pept        complement(473290..474921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0413"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52898"
FT                   /db_xref="GOA:A4X1Z8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z8"
FT                   /protein_id="ABP52898.1"
FT                   /translation="MEARTSSRWVRLVHMPSSLRSERSFLGWTVGTGVKAVRLLLRGSV
FT                   SGGRWMTQSVGRARARGAGREVGMVRLFDLHALSCAGDTLIAIGLAGTIFFNVPLGEAR
FT                   SKVALYLLVTMVPFALLAPVVGPLLDHFRHGRRYALATSMLGRAFLAWLISDYIHGFGL
FT                   YPAAFGVLALSRAYGVARSAAVPRLLPEGLGLSQVGARASVYGTIAGALLAPIGLAAFW
FT                   FGPQWPLRVASVIFLVGMVIALRLPPKADSEPPERVPRPLRALRRSSGDRPLGRGRPHG
FT                   RLVIATLVGAATLRAVYGFLLLFLAFAIKAGDLTTVVFGRDLGDEVALGLVGGALAIGS
FT                   FLATAIGTRLRIHRPAALQSSGMVIIAGVAVLATLKFSLPMVALLCLVTALTSGIAKLA
FT                   VDASIQERIPERLRASSFAHSETALMLAFVAGGGLGLVPFDGRLGIAVAAGVATLATAR
FT                   GILVAGRLRAERLAGRPLADDELTEDDPTPVEPTSGDPTPTSPAPRPGTGGDDDPAPPG
FT                   FHIYRPSSAVGGPGSGDEETRQGPIP"
FT   gene            474965..475804
FT                   /locus_tag="Strop_0414"
FT   CDS_pept        474965..475804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52899"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z9"
FT                   /protein_id="ABP52899.1"
FT                   /translation="MGNNGRVTRSASARAPRLDQVCAAAVEVARDAITEVDPADVGDHL
FT                   QTLAEGDRLVTHYFECRLAGYRGWRWAVTVTRVPRSRTVTVCETVLLPGPDALLAPGWL
FT                   PWQERLQPGDLGPGDLLPSPPDDDRLQPGYLLSDDPAVEEVAWELGLGRVRVMSREGRG
FT                   EAAQRWYDGDHGPTAPIATAAPMTARCGSCGFYLPLAGTLCQSFGACGNLYAPDDGRVV
FT                   SADHGCGAHSEILVETPEAPVEELPTVYDDSAVEAVPVRGADASAEVAEVAGSHGES"
FT   gene            complement(475823..476068)
FT                   /locus_tag="Strop_0415"
FT   CDS_pept        complement(475823..476068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52900"
FT                   /db_xref="GOA:A4X200"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:A4X200"
FT                   /protein_id="ABP52900.1"
FT                   /translation="MLKQPQPRPEPLDPPMVPFALAGMVGWAIAGVVLLFFRDQLVETG
FT                   REGWLWTCLAGFLWGLPGLAVMMRHDTHRRRRRAGH"
FT   gene            476158..477630
FT                   /locus_tag="Strop_0416"
FT   CDS_pept        476158..477630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0416"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52901"
FT                   /db_xref="GOA:A4X201"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A4X201"
FT                   /protein_id="ABP52901.1"
FT                   /translation="MAVAPPDDAIPPATPRNSFDRYFEISARGSTLGREVRGGLATFFT
FT                   MAYIVVLNPLILGSAVDGAGERLPIPALAAATALIAGLMTILMGVVGRFPLALAAGLGV
FT                   NALVAYEIAPEMTWADAMGLVVIEGVIIAVLVLTGLRTAVFRSVPTQMKAAIGVGIGLF
FT                   LTIIGLVDAGFVRRLPDAANTTVPVGLGIGGKLVSWPMLVFVVGLLLTLVLVVRRVKGA
FT                   ILIGILASTGLALVIEALGNIGPSVVDGVSNPKGWSLNVPELPSRILDVPDLSLLGRFN
FT                   VLDSWTRAGWLVVLMFIFTLLITDFFDTMGTMVAVGQEGGMLDEQGTPPRAKEILLVDS
FT                   IAAASGGAASVSSNTSYIESAAGVAEGARTGAANLVTGVLFLLAMFLAPLVLVVPFEAA
FT                   STALVVVGFLMMTAVRTIDWTDFEIAIPAFLTIVLMPFTYSISNGIGAGLIVYVLMKLA
FT                   RGKAREVHPLLYGVAALFVLYFLRGPIESVLL"
FT   gene            477762..478196
FT                   /locus_tag="Strop_0417"
FT   CDS_pept        477762..478196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0417"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52902"
FT                   /db_xref="GOA:A4X202"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X202"
FT                   /protein_id="ABP52902.1"
FT                   /translation="MTAKSVPPVQLAVQLRDAITRLNRRVRQARPVGDLTVTQLSALTS
FT                   LRLAGALTPRELADVERVQPPTMTKIVAKLEERGLVQRTPHPTDGRQVILAATEGGGAV
FT                   LDQFERVRDQWLAHRLAELSAEERETLRQAAEILQQLTRT"
FT   gene            478259..479539
FT                   /locus_tag="Strop_0418"
FT   CDS_pept        478259..479539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0418"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52903"
FT                   /db_xref="GOA:A4X203"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X203"
FT                   /protein_id="ABP52903.1"
FT                   /translation="MQKKLSTMFQSLQVRNYRLFASGQLIKLIGVWMMFIAQDWLVLEL
FT                   SDNSATALGFVTALQFAPVLLLTLISGRLADRYDKRVLLFAANLFWTVLSLAMSLLVIT
FT                   GLVQLWHVFAFAALLGVANAVETPVRQAFVSELVGTPLLPNALSLNAATFNSARIVGPA
FT                   LAGLAIALVDVGPVFLATALSSIAPLVNVIRIRPAELHREALPPREERASARVVDGLRY
FT                   VWGRPDLLLPMALISVIATSLFNFQLTLAALAKTVFETGAASFGLFSSALAVGALAGAL
FT                   AGTGRRSRPSVWLVLSAAIVCAVFGTLVGLAPTYWLVVVLLLPTGFSTVFFAQACNQRI
FT                   QLGTDAAFRGRVMALWVLVFLGTNPVGAPVIGWLAETYGAGASIWMGGLVSLAAALLAL
FT                   AWQLRRSGARLRFRVLPMPRFYLTERM"
FT   gene            479625..480128
FT                   /locus_tag="Strop_0419"
FT   CDS_pept        479625..480128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52904"
FT                   /db_xref="UniProtKB/TrEMBL:A4X204"
FT                   /protein_id="ABP52904.1"
FT                   /translation="MGRALLLTLMVAAVVCLPMVIALLFCADELLDRFACRWAQWRSRQ
FT                   RERRTIARLDRAVEADALTRNIDLSRLDRPDRQPLEQLATELRRLRGHRVGGYERSTVW
FT                   HEAALATYDSRLRLACAALGITQHLDELTGVDREIERVRVEGLLHQAGLILPAARPEHQ
FT                   QRRR"
FT   gene            480160..480738
FT                   /locus_tag="Strop_0420"
FT   CDS_pept        480160..480738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0420"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: 2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52905"
FT                   /db_xref="GOA:A4X205"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A4X205"
FT                   /protein_id="ABP52905.1"
FT                   /translation="MRLFVAVYPPPAVVAHLSARITELRIGEAAAAGVGVRLADPTQAH
FT                   VTLAFLEPVAADRLEAVERSLDQAAWRFRDSGAAPPRLHLAGSGTFGQGRSTIVWVDLR
FT                   GDVAELHLLGRLVRSRLRANHLCYDEKPLRPHLTVARPGARLPSAEVTADVAALQAYQG
FT                   PQWRARELVLTRSHPGPRPSHERVAAWQL"
FT   gene            complement(480740..481804)
FT                   /locus_tag="Strop_0421"
FT   CDS_pept        complement(480740..481804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52906"
FT                   /db_xref="InterPro:IPR021421"
FT                   /db_xref="UniProtKB/TrEMBL:A4X206"
FT                   /protein_id="ABP52906.1"
FT                   /translation="MRPVRFVALSEDGQALVLTDEVGRLLALPIDERVSTALHTEPGAA
FT                   PLAVASTPGTDPAPSLAPRDIQARIRAGESAEDVARIAGVPVDRVLRYAGPVLQERAML
FT                   AHHARRTRLRGAEKPTPLAEVVNGRLSQHGIDTEKISWDAWRRDDGTWRIVATWPSGKA
FT                   TAQAVWDLEKSRQSVTPHDDMAQYLCAERPMPILGQEPTSERGGHGLPGPPRAEPGRGG
FT                   HGLPGPTEPTRPVRDPIRAGRDALLASLDRPLGGASGRGLEPRGPETPRPRTVGGGAAA
FT                   LLGGGPGSAFDDDSDAPKEVPAVPSLAVLRPRRTGAATAGSTEPGESGNKPRKRLPSWD
FT                   DVLFGGAPAARESS"
FT   gene            complement(481990..483243)
FT                   /locus_tag="Strop_0422"
FT   CDS_pept        complement(481990..483243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0422"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="TIGRFAM: putative phosphoserine aminotransferase;
FT                   PFAM: aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52907"
FT                   /db_xref="GOA:A4X207"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A4X207"
FT                   /protein_id="ABP52907.1"
FT                   /translation="MRTGSAAGRSRIGRARRARCAVDPPRHVPRPTPRPCGRIFKTVAD
FT                   ASTIRIPDDIKPADGRFGCGPSKVRPAAVSALAAAASGYLGTSHRKSAVRDQVARLRRG
FT                   IAEFFALPEGYEVVLGNGGTTAFWEVAAFGLIRDRAQFASFGEFGAKFAKSVQDAPFLG
FT                   EPTIHRSPAGSAPSLVAEAGVDVYATPHNETSTGVAVPIRRVPGVDEGALLLVDGTSGA
FT                   GGLEVNVGETDVYYFAPQKCFGSDGGLWLALMSPAALERAAEVKAAGRYIPAFLDLGTA
FT                   IDNSRLEQTYNTPALATILLAAEQTDWMNAQGGLTWAAKRTAESASIIYGWAERSAVAT
FT                   PFVTDPALRSNVVATIDFVDEVDATAVAKTLRANGIVDTEPYRKLGRNQLRVALFPAID
FT                   PADVEALTASIDHVVERL"
FT   gene            complement(483343..484449)
FT                   /locus_tag="Strop_0423"
FT   CDS_pept        complement(483343..484449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0423"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52908"
FT                   /db_xref="GOA:A4X208"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A4X208"
FT                   /protein_id="ABP52908.1"
FT                   /translation="MADFKPGLEGVIAFETEIAEPDREGGSLRYRGVDIEDLIGQVSFG
FT                   NVWALLVDGRFGPGLPPAEPFPVPVHSGDIRVDVQSAVAMLAPYWGLHQLLDISDEQAR
FT                   EDLARVSVTALSFVAQSARGLGLPAVPQKEIDKASTIVERFMKRWRGEPDPRHVKAVDA
FT                   YFISAAEHGLNASTFTARIVASTGADAAACISSGIGALSGPLHGGAPSRVLNMLEAVER
FT                   SGDAEGYVRGVLDRGERLMGFGHRVYRAEDPRARVLRRTAKELGAPRFEVAEALEKAAL
FT                   AELHSRKPDRVLATNVEFWSAVVLDFAEVPAHMFTSMFTCARMGGWSAHILEQKKLQRL
FT                   VRPSARYVGPGSRRPHEVEGWDQVPHGV"
FT   gene            484569..485354
FT                   /locus_tag="Strop_0424"
FT   CDS_pept        484569..485354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0424"
FT                   /product="Pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52909"
FT                   /db_xref="GOA:A4X209"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:A4X209"
FT                   /protein_id="ABP52909.1"
FT                   /translation="MDAVPHTTSPGGTTLGGSVTLGCTGRPPAPRRAAQPPGRGGDVTG
FT                   DTVPPANLRNEYAADLGLTETNLAGDWYTQFDRWFTEAVAAGLPEPNAMVLGTADAAGR
FT                   PSARTVLLKGYGPDGFVLFTNYGSRKGTELAASPYASLVFPWFVLERQVAVTGRVERLD
FT                   RAETEAYFASRPRGSQLGAWASEQSRVLPDRAALDAAYRAMAERFVDGAPIPAPPHWGG
FT                   FRIRPDEVEFWQGQASRLHDRLRFRVTDGGDWVVERLAP"
FT   sig_peptide     484569..484670
FT                   /locus_tag="Strop_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.696) with cleavage site probability 0.482 at
FT                   residue 34"
FT   gene            485351..486643
FT                   /locus_tag="Strop_0425"
FT   CDS_pept        485351..486643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0425"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52910"
FT                   /db_xref="GOA:A4X210"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X210"
FT                   /protein_id="ABP52910.1"
FT                   /translation="MTEVRAARRQSSRWAIDLRPLAVPAFRRMWLGNTMAMLGFQLTAV
FT                   AVPVEMYALTGESFWVGLLGLAGFVPLLFFGLWGGAVADARDRRRVLLAGSALLWTTML
FT                   GLLAHASLGVGSPVLLLALVAVHSAGFAISSPARTAALPRLLPPGLVPAAATLNFTTFT
FT                   AASVVGPLAAGLIFAVTGTERGLPIAYAADALLFTGLVVAALRLPAMPPEPLGDGEVRR
FT                   GGLAGIRDGLRYLTTTPVLLLSFAIDLIAMVLALPRALFPEIAEERFGGGAAVGWLFSA
FT                   IAIGAMLAGLTSGWISRLRRQGLGLVVVVVGWGLAVAAAGLAQQLWLMVLLLAVAGAAD
FT                   LVSAVLRQSMLLVYAPDRMRGRLQGVNTVVVAGGPRLGDLRAGAMAGGFGSGVAWVGGG
FT                   LLSAVLALGLAVAFPALIRYRAAAVASEQRV"
FT   gene            486661..487587
FT                   /locus_tag="Strop_0426"
FT   CDS_pept        486661..487587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0426"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52911"
FT                   /db_xref="GOA:A4X211"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:A4X211"
FT                   /protein_id="ABP52911.1"
FT                   /translation="MDFPGQWSPSGAQWTIAAAGHEAVIVEVGGGIRTYRSNGVEHLDG
FT                   YTSAELCPDSAGQVLAPWPNRLRDGSYHFEGRDLQLAISDREHDAAFHGLVNWVPWRLL
FT                   ERSADAVTLGYELAATPGYPWSLRLRSRWCVGPDGLHVEHEVTNSGGEPAPFGFAAHPY
FT                   LRVPGGSVDDVVLRLPARSRLQVDGRLLPIAQSSVVGTEYDWTVPRRIGRAVLDDTFGD
FT                   VIRDGDGGSVVELAAPDGGARIQVWADRRFGWWQVFTGDTRSGPRRRRSVALEPMTCPP
FT                   DAFRSGRDLTTLRPGDTWRGVWGIRPA"
FT   gene            487601..488203
FT                   /locus_tag="Strop_0427"
FT   CDS_pept        487601..488203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0427"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52912"
FT                   /db_xref="GOA:A4X212"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A4X212"
FT                   /protein_id="ABP52912.1"
FT                   /translation="MEFVEVVRRRRMVRNYDPDRPVPPEVVDRLLAHAIRAPSAGFSQG
FT                   WGFLVLETAEDRDRFWAATTPGTGGRERWLAGMRRAPLIIVPHANRSAYLERYAEPDKG
FT                   WADRSEKHWSMPYWYIDTGFAALLMLLTAVDEGLGACFFGIPPQRLEDYRMAFGVPLEY
FT                   EPVGAVTIGYRASDQRSPSLRRGRRPVDEVVRRGRWN"
FT   gene            488389..488694
FT                   /locus_tag="Strop_0428"
FT   CDS_pept        488389..488694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52913"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:A4X213"
FT                   /protein_id="ABP52913.1"
FT                   /translation="MIFRAVRDGRPYPEHSLTLKQWAEIPPRPLRLDQLITTKRELALD
FT                   KLLAEDSTFYGDLFPHVVQWNGGLYLEDGLHRALRAALQQRNQIHARVFAFPAAVD"
FT   gene            488729..489889
FT                   /locus_tag="Strop_0429"
FT   CDS_pept        488729..489889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0429"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52914"
FT                   /db_xref="GOA:A4X214"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X214"
FT                   /protein_id="ABP52914.1"
FT                   /translation="MSPLDLLDVDSSLSAEERQIRAVVRQLVDEQVRPHVAGWYEEGRV
FT                   PARELAREFGRLGLLGMHLTGYGCAGSSAVAYGLACLELEAGDSGVRSLVSVQGALAMY
FT                   AIWRYGSTEQKQHWLPAMAAGETIGCFALTEPDHGSDPASMTTRARRDGDDWVLHGTKM
FT                   WITNATIADVAVIWARTDEGVRGFAVPTSTPGVAVREIRRKMSLRASVTGEISLDDVRL
FT                   PAAARLPDAVGLKAPLGCLTEARHGIVWGALGAARDCLETTLEYAGSRTQFGRPLAGFQ
FT                   LTQAKLADMAVEWSKGYLLALQLGRLADAHRLRPDQVSVGKLNNVREALAIARQCRTIL
FT                   GANGVSGEYPVLRHANNLESVLTYEGTSEIHQLVIGQRLTGLSAFA"
FT   gene            490067..491464
FT                   /locus_tag="Strop_0430"
FT   CDS_pept        490067..491464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0430"
FT                   /product="2-hydroxymethylglutarate dehydratase / L-serine
FT                   ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /EC_number="4.2.1.-"
FT                   /note="TIGRFAM: L-serine dehydratase 1; PFAM: serine
FT                   dehydratase alpha chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52915"
FT                   /db_xref="GOA:A4X215"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A4X215"
FT                   /protein_id="ABP52915.1"
FT                   /translation="MISIFDLFSVGIGPSSSHTVGPMRAARTFVAGLKADGLLSQTVRI
FT                   RAELFGSLGATGRGHGSDRAVLLGLAGEEPETVDTDAVEGRIDRIRGEQRISLFAAHEI
FT                   DFDPARDLVLHRRRSLPYHPNGMTFAAYGSTGDELRARTYYSVGGGFVVDEAAAGADRI
FT                   TSDTTPVRYPFSTGAQLLAVTQETGLSISEVMLANELSWRSEQEVRAGLLGIWRVMREC
FT                   VARGCERDGVLPGRLRVRRRAAELYRGLMMDADPMRSTAGRGAVDPLRAMDWVTLFALA
FT                   VNEENAGGGRVVTAPTNGAAGIIPAVLHYYDRFGLGATADGVVRFLLAAGAIGVLFKEN
FT                   ASISGAEVGCQGEVGSACSMAAAGLAEALGGSPEQVENAAEIGMEHNLGLTCDPVGGLV
FT                   QIPCIERNAVASIKAITAARLALRGDGVHHVSLDKVIKTMRETGADMKVKYKETARGGL
FT                   AVNVIEC"
FT   gene            491519..492346
FT                   /locus_tag="Strop_0431"
FT   CDS_pept        491519..492346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0431"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52916"
FT                   /db_xref="GOA:A4X216"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A4X216"
FT                   /protein_id="ABP52916.1"
FT                   /translation="MTAGVGTLWSHRGALRILVRRDLAVKYQQSALGYLWSLIEPLGFG
FT                   AIYWFVFGVLYERDTGRYLGEAADSYPLFLFTGIFAWMWTSSALGEATNALTGQARLIT
FT                   TMNLPRQFFPIGRVAGRVAEYLAGLPLLVAAAAAYAVAGRIHPGWSMLALPLAITLQGV
FT                   LLVGLALLLSAVNVLMRDVERVMRLVVRVLFYATPIIYPFGLVRDSGLPDWLKVGYELN
FT                   PLVGIFQLHHAVWYPDEFPDARLLGTTIAGCLLVLAVGWWTFRRLEPAVLKEL"
FT   gene            492348..493097
FT                   /locus_tag="Strop_0432"
FT   CDS_pept        492348..493097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0432"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52917"
FT                   /db_xref="GOA:A4X217"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X217"
FT                   /protein_id="ABP52917.1"
FT                   /translation="MADPIIEAAGLGIRFVRNRRRQLRLRDLALHRGRRGGRADGRFWP
FT                   LRDLSFSVEAGDTVGVIGRNGTGKSTLLRLIAGVLIPDEGWITVRGAVAPLLELSAGFS
FT                   AELTGRENLYLVGGLHGLSPSYLRRRVDEIVSFAGKQVEQALDTSVRHYSSGMKVRLGF
FT                   AIISHLPHPVLLMDEVTAVGDAEFRQRCYATIDRLLGEGRTLVLVSHNEQDLTRFCRRG
FT                   FYLDAGRMVMDGTMAEALAAYHGAVAR"
FT   gene            493109..495061
FT                   /locus_tag="Strop_0433"
FT   CDS_pept        493109..495061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0433"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52918"
FT                   /db_xref="GOA:A4X218"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A4X218"
FT                   /protein_id="ABP52918.1"
FT                   /translation="MLTTDGSAGIADRLAGQCRHAGIDEVRLVGDLATLADLAESASGP
FT                   VLVTGADLVAHTAVLRHLATSPAEPTVALVLAGPPVPGRTVVREDRGQVVAAGSPEALD
FT                   GEATGAFGGALRVDPANLPALAAAARAIAAEVVPVGAAAAHDVVDDEPAVDRLFADLVA
FT                   RDAVTFAHRVRLLVARRVAADDDRAAAESAVAAVDADQAELRLSVKERDDFFTTFFVST
FT                   WSPSVTKVAARLRLSPTTVTMISVAFAVAAALLFGAGGRPALVAGAVLLYLGFVLDCVD
FT                   GQLARYTRTFSAWGGWLDTMADRAKEFIVYAGLGYGATQAGFRYGWALAIAAMAVQTVR
FT                   HMSDTWYGAMHDEAARRPRVTPGGGFGDRLSAASNRVQADVGSVTYWLKRTVVFPIGER
FT                   WALVALAAALFDQRVALFAVLTGMVLALGYTAALRLLRARSMRVGVLNTVDASLHRDDG
FT                   PLARALPTLRWPGPLGLAVSAVLVAAVLLAFALLAEDSLPQWTALVALGGLLLAAVGAR
FT                   AAHGGALDWLVPAALRAAEYLFAIAVGVLGGVPAWLVFGYVFVLTLHHYDLTARLEKRK
FT                   LAPPLHDATLGWEGRSAVLTLSAITGIAAIGMATLGIYLLVVFVGSVALAWVIRPARAA
FT                   RAAGSVGGVGGRPPG"
FT   gene            495070..497265
FT                   /locus_tag="Strop_0434"
FT   CDS_pept        495070..497265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0434"
FT                   /product="CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /note="PFAM: glycosyl transferase, family 2;
FT                   CDP-glycerol:poly(glycerophosphate)
FT                   glycerophosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52919"
FT                   /db_xref="GOA:A4X219"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4X219"
FT                   /protein_id="ABP52919.1"
FT                   /translation="MALISFVVPAYRVQGYLRECLDSILGQPVAGIEVIGVDDGSPDGS
FT                   GEILAEYAARDQRVRPLALPANRGLGPARNAGLDQATGDYVWFVDGDDWLAPECLGEVA
FT                   ERLRATTPDVLVVDHVRAWWDGSATRSGMREVFPEPPGPETFRLRERPATIRLLHTAWN
FT                   KVLRREFLLEHGLRFAPGWYEDVSFTYPVLIRARRVGVLDRVCVNYRQRRAGAITRTRG
FT                   ERHFEVFAQWHRVFVLLDEAGTAEEDLRPALFERMIWHYLTVLGTGERIPADLRPAFFD
FT                   RIAADHARWRPAQGLPAPPGLEGLKHRLVATGRWRTYNALRGVARVRDTAAHTAQRVRR
FT                   GAVPALRRVRDAGLREYYRAELLRPVDPRLAVYAAYWYRGYACNPAAIYEAARRLAPHV
FT                   HGVWIVRRDRVDSLPAGVDYVVAGTPAGYRALAQARWLVNNVNFPNFVRKRPGTVHVQT
FT                   HHGTPVKVMGLDQQRYPVGAVMDFAGLLRRVDRWDYSITSNSFSTQMWERAYPAAYTTL
FT                   EVGYPRNDRLAAATTEEVLRIRAELGLGVGEQVVLYVPTHREHLPGYQPPFDPGQFLAA
FT                   LGPAGRLLMRSHYFDDRDSPVPDPTHPDRLRDVSGYPRVEDLYLAADVLVTDYSSAMFD
FT                   YAVLDRPIVVYAPDWAAYRLTRGVYLDVIAEAPGAVATDFAGLLDVFRSGALRDPSAEE
FT                   ARRRFRDRFCRLDDGHAAERVVRRVFGADVAGPGPAG"
FT   gene            497392..498753
FT                   /locus_tag="Strop_0435"
FT   CDS_pept        497392..498753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0435"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52920"
FT                   /db_xref="GOA:A4X220"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A4X220"
FT                   /protein_id="ABP52920.1"
FT                   /translation="MGLVTVVQVRVGQVGEERVTTVALKDVTKVFRTGTLAVDRVNLDV
FT                   DDGEFMVLLGPSGCGKSTVLRMVAGLEEPSSGAVFLNGELANDLPPRDRSVAMVFQDFA
FT                   LYPHLSVGDNIAFPLRLAGLEPGRRGERVADVAGALGIGDILDRRPGQLSGGQRQRVAM
FT                   GRAIVRRPELFLMDEPLSNLDSGLRSELRAEISGLTRELGVTTLYVTHDQTEALTMADR
FT                   VAIMRKGILQDVGTPSQVYGRPATLYVATFLGTPRMNLLEAAVHVHLGQYVALSLGEQS
FT                   LRLPWDDMRARAVGHYHGERIVLGMRAEALTPTAPSTPGPVLHGRIRHLEHHGHESLAF
FT                   LDIGATAVVVDEAAVPADGGAVRQRGLRQFGRAMRRITGRAGTAGDERRASASRTPASV
FT                   FPDPGRHHRRPAELAVRLAPYPAVSQGQKLAIEVRMDALHFFDERGDRIDVGWR"
FT   gene            498862..499293
FT                   /locus_tag="Strop_0436"
FT   CDS_pept        498862..499293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52921"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X221"
FT                   /protein_id="ABP52921.1"
FT                   /translation="MLAAVPFARTLGFEFVKVAPEADGAIQAVVRLPDTSATHNHVGGP
FT                   HAGAMFTLGETASGAVVVAAFAPVLDRATPLAVSAEIAYRKLAMGPVRATARLDRPAAD
FT                   VVAELDAGERPEFPVRVEIATEEGKPTGEMTVVWTLRPH"
FT   gene            499373..500107
FT                   /locus_tag="Strop_0437"
FT   CDS_pept        499373..500107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0437"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52922"
FT                   /db_xref="GOA:A4X222"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4X222"
FT                   /protein_id="ABP52922.1"
FT                   /translation="MTACLFDLDGVLTQTARVHNAAWRATFDEFLRRHAADADVPFQPF
FT                   DPDEDYRRYVDGRPRYDGVRTFLASRDIVLPEGTPDDPPEADTVHGIGNCKNVRLLQEL
FT                   RTHGVDVYPGSVTYLKAATDAGLRRAVVTASANGREVVAAAGLEALLETRVDGLVARAE
FT                   KLRGKPEPDTFLAGAERLGVAPGNAAVFEDALAGVAAGRAGDFGYVVGVDRAGQADALL
FT                   AHGADIVVQDLAELIEKREPDA"
FT   gene            500104..502479
FT                   /locus_tag="Strop_0438"
FT   CDS_pept        500104..502479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0438"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase, family 65 domain protein;
FT                   glycoside hydrolase family 65, central catalytic; glycoside
FT                   hydrolase family 65 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52923"
FT                   /db_xref="GOA:A4X223"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A4X223"
FT                   /protein_id="ABP52923.1"
FT                   /translation="MIRERAYPVEPWHVRETTLDMDVLAQSESVFALSNGHIGLRGNLD
FT                   EGEPYGLPGTYLNSFYELRPLPHAEAGFGFPESGQTIVNVTNGKLIRLLVDDEPLDVRY
FT                   GELLAHERVLDLRGGTLHRTVHWRSPAGREVCVRSTRLVSFRQRSAAAINYEVEVVDGK
FT                   PLRLIVQSELVANETLPAQSKDPRVAAVLESPLLAEEELTTHDGGLLIHRTKVSGLRLA
FT                   AAMEHEVHTTARTNLESEGYEDWVRTTTACVLKPGETLRVVKYLSYGWSSRRSLPALRD
FT                   QVGAALAAAKLDGWDGLLREQREYLDEFWDSADVLVEGDPEVQQAVRFGLFHVLQAGTR
FT                   AERRPISAKGLTGPGYDGHAFWDTEMFVLPVLTYTHPTAVRDALYWRHHTLPAAQDRAR
FT                   TLNLAGAAFPWRTIEGPESSGYWPAGTAGFHIAADIADAVRRYVHATQDTDLEREIGLE
FT                   LLVETARLWRSLGHHDRHGQFHIDGVTGPDEYTAIKNDNIYTNLMAQRNLTTAAETVMR
FT                   YRDEAAHLGVTDEEAASWRDAAADIHIPYDQEIDVHEQVEGFTRFQEWDFVHTPPEKYP
FT                   LLLHYPYFDLYRKQVIKQADLVLAMHWRGDAFTPEQKLRNFLYYERRTVRDSSLSACTQ
FT                   AVLAAEVGYSELAHTYLREAALMDLHDLNENTRDGVHIAALAGSWIALVAGFGGLRDHD
FT                   GTLCFTPRLSSRLGRLEFSLHWRRIQLRVDIQPHQTTYTLQHSDPEEALEFLHHGERIR
FT                   VTAAEPVTRPTPPAEEPSRAPEQPPGRDPLIRLPEREP"
FT   gene            502962..503609
FT                   /locus_tag="Strop_0439"
FT   CDS_pept        502962..503609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0439"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52924"
FT                   /db_xref="GOA:A4X224"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4X224"
FT                   /protein_id="ABP52924.1"
FT                   /translation="MDARSEVPVPAGDVQLTADLLVPAEPVGVVLFAHGSGSSRRSPRN
FT                   VAVAQVLHRSSLGTVLVDLLTPDEEAVDARTAQLRFDIGRLAGRLSAIVDWLETGAPMG
FT                   VVPIGLFGASTGAAAALVAAAERPDAVGAVVSRGGRPDLAGPALGRVRAPTLLLVGGLD
FT                   DQVLTLNEQAREALPEQAELTVVPGAGHLFEEPGALEQVAHAAATWFTDYLG"
FT   gene            503707..503895
FT                   /locus_tag="Strop_0440"
FT   CDS_pept        503707..503895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52925"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:A4X225"
FT                   /protein_id="ABP52925.1"
FT                   /translation="MKKFMDQAREYVEKQDEQVDRSIEKAGDMLNERTGGRYKEHVDRG
FT                   VDMMRSRTGESDRDQKR"
FT   gene            complement(503967..504626)
FT                   /locus_tag="Strop_0441"
FT   CDS_pept        complement(503967..504626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52926"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:A4X226"
FT                   /protein_id="ABP52926.1"
FT                   /translation="MNPITHTGGLSVAGLLVAGGCLLTPGTAIASAAPTNTEIHAHQAV
FT                   AAQSADDQAELLVTIEYQAQPNFYYCGPAATRMALSALGKPLPQDEVARRLGTTQAGTD
FT                   SALDVTRVLNELTGDTYRTTEIPDTTAKPDEVHQLREDTRHALAQGRAVVANVRGTTVD
FT                   TDGTPHSYEGGHYLTLVGYRAEGDLLRVADPAAAKGEYWMAVPKVANWIAERGYSS"
FT   sig_peptide     complement(504528..504626)
FT                   /locus_tag="Strop_0441"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.624 at
FT                   residue 33"
FT   gene            504923..505633
FT                   /locus_tag="Strop_0442"
FT   CDS_pept        504923..505633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0442"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52927"
FT                   /db_xref="GOA:A4X227"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A4X227"
FT                   /protein_id="ABP52927.1"
FT                   /translation="MNRPETPETHPGADELLSAGPSDQRKQPVSPQAAVAELYAGNRRF
FT                   AAGAPVRPHQDVDRRIALADGQQPFAVILGCSDSRLAVELIFDRGLGDLFVVRTAGHSV
FT                   GSEVLGSVEYAVTVLGAPLVVVLGHDSCGAVQAARSADATGVPGAGHLRAVVEAVLPSV
FT                   RRAEAAGVSDLDRIVDLHVEQTVAVLLDRSAAVAAAVAARECAVVGMSYQLTTGSVRTV
FT                   TEVGLAASSTPPET"
FT   gene            complement(505742..506842)
FT                   /locus_tag="Strop_0443"
FT   CDS_pept        complement(505742..506842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52928"
FT                   /db_xref="UniProtKB/TrEMBL:A4X228"
FT                   /protein_id="ABP52928.1"
FT                   /translation="MGCVRASGKHVQPQPVSSPSRRSTEGIIVTAPPRRWLTPVVAVLT
FT                   ALAVLTGPIPASATPTSPPLPSGHDEEPELLGDLIEVRNREYVKAKAQLAESEKRQAAL
FT                   EKEIEKAQDDLDELAPQVAQIATQSYRTGRVGAISMLLEADTPDSFIVRATALDELNRV
FT                   NDQRIKAVNTIKIHAEQSKVAVDEEVRKQQKLKSDLERGKLEAEKALRLVGGNGLTGGL
FT                   VDAESPVARVAPGRTSDGDWQPLGCTEDDPTTGGCITARTLHMYNEVKRAGFDRFVGCY
FT                   RSGGPWEHPKGRACDWSLQDSGFRSWYNNDMRLYGNNLTAFLVRNADRLGVYYVIWNRQ
FT                   IWFPATGWKSYNGPSNHTDHVHVSLL"
FT   sig_peptide     complement(506666..506842)
FT                   /locus_tag="Strop_0443"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.797) with cleavage site probability 0.729 at
FT                   residue 59"
FT   gene            complement(507057..508403)
FT                   /locus_tag="Strop_0444"
FT   CDS_pept        complement(507057..508403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0444"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52929"
FT                   /db_xref="GOA:A4X229"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:A4X229"
FT                   /protein_id="ABP52929.1"
FT                   /translation="MGADHTRPAPSAPPRVRRLLVATVVPLLLATLITAVALWPRDTST
FT                   ADPGTEPPRYHGTVTKVVTEPCPPTPETPDPGLATDDGPCGDVTVRVEQGPDSGRQVVT
FT                   PLPAGPGAPDVAIGDEIILVELTDPTDPTTSMYTIAEHQRGKPLLWLVALFAAAIVAFG
FT                   RWRGLAALAGLAASFAVLLTFVLPGISVGRSPLLVAVVGAALIMFVVLYLTHGVTVQTS
FT                   VAVLGTLGSLILTGLLGTLATATTRLTGYGSEEAITLSMFQADVDLHGLLLAGIIIGSL
FT                   GVLDDVTVTQAATVTELANANPGLSRRQLYRSATRVGRAHIASTVNTIVLAYAGASLPV
FT                   LLLLTADSRPVSQILTSEFLAQEIVRSAVATLGLIAAVPLTTGLAAIVTTAGRNAVGGS
FT                   GRSATAAPPPRPRAARVEVLEALSTSRAGPVTPVADRRADRDKNTDDPW"
FT   sig_peptide     complement(508263..508403)
FT                   /locus_tag="Strop_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.883) with cleavage site probability 0.522 at
FT                   residue 47"
FT   gene            complement(508593..508904)
FT                   /locus_tag="Strop_0445"
FT   CDS_pept        complement(508593..508904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0445"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52930"
FT                   /db_xref="GOA:A4X230"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X230"
FT                   /protein_id="ABP52930.1"
FT                   /translation="MVRMTRPEPAPVRGYTATKDQLLTRLRRVEGQVRGIEKMVEEDRY
FT                   CIDVLTQIAAIQAALDKVALGLLDGHARHCMREGAAEGRADEMATEMMAAVGRLMKRG"
FT   gene            508999..509235
FT                   /locus_tag="Strop_0446"
FT   CDS_pept        508999..509235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0446"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52931"
FT                   /db_xref="GOA:A4X231"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4X231"
FT                   /protein_id="ABP52931.1"
FT                   /translation="MVTTTYQVRGMTCGHCVNAVSAEVGGLTGVEKVQVDLEAGRLTVT
FT                   SQHPMEIEAVRAAVDEAGYDLVDAAPTSRPRPA"
FT   gene            509232..509441
FT                   /locus_tag="Strop_0447"
FT   CDS_pept        509232..509441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52932"
FT                   /db_xref="UniProtKB/TrEMBL:A4X232"
FT                   /protein_id="ABP52932.1"
FT                   /translation="MRTATKLTAFLLGLVAVFGAAYGVGQVTGPVTPAVETHHDDPERS
FT                   NPEHDNPGAGSNLPGHGPDRQGAR"
FT   sig_peptide     509232..509303
FT                   /locus_tag="Strop_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.337 at
FT                   residue 24"
FT   gene            509438..511729
FT                   /locus_tag="Strop_0448"
FT   CDS_pept        509438..511729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0448"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52933"
FT                   /db_xref="GOA:A4X233"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4X233"
FT                   /protein_id="ABP52933.1"
FT                   /translation="MTTTSSPKPRAVNQIELSIGGMTCASCAARIEKKLNRMPGVTATV
FT                   NYATEKARVAYADGVTSDDLIATVEKTGYTAVVPPPPAATAAPVAEPADESRGLGTRLW
FT                   VSAVLTVPVILLAMVPPWQFTYWQWLSLTLAAPVVVWGGLPFHRAAWVNLRHGAATMDT
FT                   LVSLGTLAAFGWSLWALFLGTAGVAGMTHPFSFAIVRGTGAGNIYLEAAAGVTTFILAG
FT                   RYFEARAKRTAGAALRTLLELGAKEVAVLRGDVETRIPIDQLVVGDRFVVRPGEKVATD
FT                   GMVVEGSSAVDASMLTGEAVPVEVKAGDAVVGATVNAGGRLVVAATRVGGDTQLAQMAR
FT                   LVEAAQSGKAAVQRLADRVSGVFVPVVITLAAGTLGWWLGSGAGPTAAFTAAVAVLIIA
FT                   CPCALGLATPTALLVGTGRGAQLGILIKGPEVLESTRTVDTVVLDKTGTVTTGRMTLVD
FT                   VVAASGVERAELLRLAGALEAASEHPIAQAVAVGAAEAGPLPPVADFANLEGLGVEGVV
FT                   DGHRVLVGRPRLLRERGLHVPEEMVTAGATAQAAGATAVLVAWDGRARGLLAVADVVRP
FT                   TSALALRQLRELGLDPVLLTGDNETVARAVAAEVGIDEVVAEVLPAEKVAVVQRLQREG
FT                   RVVAMVGDGVNDAAALAQADLGLAMGTGTDVAIEASDLTLVRGDLTAAVDAIRLSRRTL
FT                   AIIKGNLFWAFAYNVAALPLAAAGLLNPMIAGAAMAFSSVFVVVNSLRLRGFRPLAPVT
FT                   QGLRSTGHPR"
FT   gene            complement(512154..513197)
FT                   /locus_tag="Strop_0449"
FT   CDS_pept        complement(512154..513197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0449"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52934"
FT                   /db_xref="GOA:A4X234"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A4X234"
FT                   /protein_id="ABP52934.1"
FT                   /translation="MPDVLTSLPWPTGPSIAVFGVAGTLTVLGSIRLVALGDTLADRTG
FT                   WGEAFFGAVFIGLATSLSGIVMTAVTAAAEQPQLGYSNAVGGIATQTTAVAVADAFHRR
FT                   ANLEHASASLSNVLFGVLLIVLLSLALLGRYTPDVTVAGLHPASLAMVAAYLGGLHLVR
FT                   RSGASPLWRAVATAETLPDITHEHGSLDRTSSTRLWVRFAAVGLLVSIGGWAIARAAES
FT                   LVLVTDLSAGFVGAILMGAVNALPETVTAVAAVRRGAPTLAIAAVLGGNSLDALNLVVG
FT                   DVAYRGGSIYHAAGDAQLFVTTSALFMTAILLGGLLVRQAYGWGRLGFEGILLLTSYAA
FT                   MTIILAT"
FT   gene            513359..514150
FT                   /locus_tag="Strop_0450"
FT   CDS_pept        513359..514150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0450"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52935"
FT                   /db_xref="GOA:A4X235"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X235"
FT                   /protein_id="ABP52935.1"
FT                   /translation="MSIFHGTVGFYRQFRPDIPETVADVLDGAVPAGSPRRLLDIGTGV
FT                   GLVVEALRGRFDDIIAIDPDPEMLTAAENALRPRLPDDAQLRLEETTAEEFTPPAGWQA
FT                   DLVTICRTFHWLDKARVLNQLDAQVSRDGAVAIFADKSFWVAHHDWEMEVRAVIQDFLG
FT                   EQRRAGDGTFHEQRRPDIQVLRNSPFSQVEECIVPVHRTWTATSILGYLHSTTFAEPEL
FT                   FGDRLHEFDNAVRAALARCSDTDTFIEENEFVIHLGWRDRA"
FT   gene            complement(514356..515057)
FT                   /locus_tag="Strop_0451"
FT   CDS_pept        complement(514356..515057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0451"
FT                   /product="Spermidine synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52936"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X236"
FT                   /protein_id="ABP52936.1"
FT                   /translation="MHDFRQPPITLDRVTTSRGELVLRETNGRYEVISNGVFLMDTADG
FT                   RSERLLVDAAVSRCTGPAPRLLIGGLGVGFSLLRAVEHPHVAAIDVVEIEATVIGWHAR
FT                   HLRPLTGAAQADPRVRIVEADILAWLADTADQYDAICLDTDNGPNWLVFEANAELYAHR
FT                   GLDLVAGRLRPGGVLAIWSASRDDAFEQRLRERFGDLELLETPTDAGAPDVVYLVRAAT
FT                   AAPGELPESPA"
FT   gene            515174..515710
FT                   /locus_tag="Strop_0452"
FT   CDS_pept        515174..515710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0452"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52937"
FT                   /db_xref="GOA:A4X237"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4X237"
FT                   /protein_id="ABP52937.1"
FT                   /translation="MVDVDDGELLRLVGTGDRRAFELLYARNAPWLLLRLRRRCRDPEL
FT                   ARELLQETFLTVWRAAASYRGDGTAVGWLWSIASGRLIDARRRASVRPQLVNSPGEGTL
FT                   TWSPSAEDEALTHEYDAGLERALRQLPPELWTVLQATVLDGRTVREAATLLGVPEGTVK
FT                   SRAMRARQRLRAALS"
FT   gene            515707..516492
FT                   /locus_tag="Strop_0453"
FT   CDS_pept        515707..516492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0453"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52938"
FT                   /db_xref="GOA:A4X238"
FT                   /db_xref="UniProtKB/TrEMBL:A4X238"
FT                   /protein_id="ABP52938.1"
FT                   /translation="MTGEHVSAQVLAAYAEERLADGDAESVEAHLDRCDTCRASLAPNE
FT                   AVRRVVAGVALALDDRLSTPGRVRPATGWRRVRVLVGAAPAVRTAWLLSVLVTGLLTLG
FT                   LAVSPRTLPPWVLLLIAPALPVIGTALSYGRRTDPLHEVVAGTPQGGLRIVLWRTLSVL
FT                   TVATPVAVLAAVVTGVSTPLMWMLPGAALTAGTLALGSLIEPTYAAAVVAGGWAVVVLA
FT                   PPVGGLVVVASSAPVWLAVTGVAVVVLYVRRERVGRQAG"
FT   gene            516489..517244
FT                   /locus_tag="Strop_0454"
FT   CDS_pept        516489..517244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0454"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52939"
FT                   /db_xref="GOA:A4X239"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X239"
FT                   /protein_id="ABP52939.1"
FT                   /translation="MTTVSVAGLRVSYGKRVVLDDLAIELGVGVHGLLGPNGAGKTTLM
FT                   RVLATVLRPDRGEVRLLGHRTDDRVGLRQARRRLGYLPQAFGFYPRFTVREFVEYFAWL
FT                   REMPAARIPLAVDRAIERVGLLDRADDRMKHLSGGMLRRAGIAQAIVNDPRVLLLDEPT
FT                   AGLDPEQRVEFRTLLRELGLDAVVLVSTHLVEDVAAACARVSLVDDGRLVFAGLPGELI
FT                   AAGGDGDSGDSPIERGYTAVLRGARQVTR"
FT   gene            517241..518512
FT                   /locus_tag="Strop_0455"
FT   CDS_pept        517241..518512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52940"
FT                   /db_xref="GOA:A4X240"
FT                   /db_xref="UniProtKB/TrEMBL:A4X240"
FT                   /protein_id="ABP52940.1"
FT                   /translation="MRRALWVELRRGTAPYAALAMFGAGVWVLAAHPDDWAGRWVGLAD
FT                   YLRVSLLALCPLMVSAGAWQAGRERRRDIGELVAATPRPGWHSLVAAWLAVTLAGIAGL
FT                   VVAFAGAAVLVARVATYGGGDWWQRAAVGVLALAAASAGGVLVGRRVPLRVAAPIAGLA
FT                   TYLGLAILTYWNAAPARLSPAYGGRWMYSLVPEWVTGLQVTWLVALTALLLAVAVRRGR
FT                   VALLAGAVAVAAAVPISTAPSWNRAPADPAAVELVCTTSGPEVCLTRVNAFLLDEVAAV
FT                   AQPILARLDGIPGAPRQAVDQTVRPAGASVVEDADTVWLDLDFQATPLGGLANVDYLRS
FT                   AFRQMAGVECAYSSAVDQRDQRIHQADNMATDWLLDGTVFGVGGASAGLRELPPSAQRT
FT                   WFADYLDAAGRCDLPALVRLAEQP"
FT   sig_peptide     517241..517333
FT                   /locus_tag="Strop_0455"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.780) with cleavage site probability 0.758 at
FT                   residue 31"
FT   gene            518509..519132
FT                   /locus_tag="Strop_0456"
FT   CDS_pept        518509..519132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52941"
FT                   /db_xref="GOA:A4X241"
FT                   /db_xref="UniProtKB/TrEMBL:A4X241"
FT                   /protein_id="ABP52941.1"
FT                   /translation="MIARLLRLHLRVRGASAFVAGVSVITLLAWAGGTWLAGRSFLDGP
FT                   AARLPVVVLAPLLSAVLLGPTLAGVDEELERGTPLRWRVWRAGHVLLAVLAVATALVLT
FT                   GLRAPETFGAHALARNTLGWIGLVAGATALLGARLAWLPAFGYGCAVYFAAPRDAGVLA
FT                   ALWAWPVQTSTAAASWWAAGGVLALGLVGYAHGGAAVDRRSRRN"
FT   sig_peptide     518509..518604
FT                   /locus_tag="Strop_0456"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.959 at
FT                   residue 32"
FT   gene            519272..520117
FT                   /locus_tag="Strop_0457"
FT   CDS_pept        519272..520117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0457"
FT                   /product="transcription factor jumonji, jmjC domain
FT                   protein"
FT                   /note="SMART: transcription factor jumonji, jmjC domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52942"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:A4X242"
FT                   /protein_id="ABP52942.1"
FT                   /translation="MTVPQEAGVPVARMTFEEFQALGPGGLFKTDVPVVISLPESVRGL
FT                   GREGVAARLADMTVTLFTEPGDKNHPGRWETRDITLRDFFADERHLTESDTWHRVVSNI
FT                   RNSPADVNAVVGFDAEGFFGYGSSLYAANLWISHRGVFTKNHFDEFENFNIALEGRKRF
FT                   IIAPPGSRDYYPRSMLRGFGDKSQVFDLDNVDLGRYPRVAPKLAQRRDFVLEPGHMLYL
FT                   PLGWWHQAESLDPININVNFWLKSKKILRRPHVLGVALYTYAYRRVKGVYSYQPTEVSS
FT                   "
FT   gene            520114..521367
FT                   /locus_tag="Strop_0458"
FT   CDS_pept        520114..521367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0458"
FT                   /product="aminotransferase, class I and II"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52943"
FT                   /db_xref="GOA:A4X243"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4X243"
FT                   /protein_id="ABP52943.1"
FT                   /translation="MSDRKTITPTHRYRNNDKLIGIGNAFWNMSEANGVAGIVGDLADG
FT                   VFTMADGHHFVNFTVCSYLDLDTHPKVIDGAIAALRRFNVLDHCIPRTRVQTPVLLELE
FT                   ESLGELFGAMVISAVSTAAASTGLLPLIASGHLGNGTRPLMVFDKNAHVSLANAKPSCA
FT                   DESEVVTCKHHDLDYLEDMCRTYERVCYVVDGADSLGGYAPVKELADLQDKYNMLVFYD
FT                   DSHSLSAYGQRGIGYVRTHAPILDQRTITVATLSKGFGAGGTAVLLDGYPQATRRLVER
FT                   FAGPLGYSQKMNAAAVGAALASAEIHRTEELDQLQGRLRTNIAMFDSLLDTEQSGESYP
FT                   IRLVPMSDDTVVNAAQQVFAAGFYTSPVFFPIVARGTAGLRVMLRAGQTEEQIRRLCAV
FT                   LVQAGARPAAALDGPGPR"
FT   gene            521364..522224
FT                   /locus_tag="Strop_0459"
FT   CDS_pept        521364..522224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0459"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52944"
FT                   /db_xref="GOA:A4X244"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A4X244"
FT                   /protein_id="ABP52944.1"
FT                   /translation="MSAAPRAIPRSILYTPALSLDKVVKAWSYDADVHLIDLEDSVPPV
FT                   EKPAARVVCRDALEKAPWPVNVAVRINELGSVAALHDLLLLAESSVRPGIVMMTMVTSA
FT                   AEVTLLRRMLASAGAQPEIYVTVETVEAVTEIDAIAREADGLVLGSADLAATLNVEITW
FT                   EAMLAARQAMAMACARHGTACVDTANFRLSEPAVLAEETARVRALGFHGKATVHPSELA
FT                   TINQALRPQVNDLRLARRVVAAVHRANGGIAVLDGSMVGPPFARMAHVTVAREDAWEAR
FT                   FGGAG"
FT   gene            522221..523186
FT                   /locus_tag="Strop_0460"
FT   CDS_pept        522221..523186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0460"
FT                   /product="ornithine cyclodeaminase/mu-crystallin"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52945"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X245"
FT                   /protein_id="ABP52945.1"
FT                   /translation="MTATVMVGAADMAGARRMTQVIDVLGEMFMDLATGRTRSPARTVV
FT                   EHGEQRVLLVSPAVWERRGVGSVKITTLTPDNPGRGLPLIHGIVALTDLETGRITALLD
FT                   GAELTAVRTGAVAALATRFCTAATADDLAVIGAGVQARALVRAVAAIRPIKTLRIFSRT
FT                   RAGAEKLADEVRATTPIRVTVCDSAKTAVADAPIICTATSTSDSTPVVAADWVARGAHL
FT                   NVVGGTHPDAIELDPALLGDAVTVVEEQSAALDGAGEVRAARAAGLLVADDLRELGRLV
FT                   GGEVEFGGRNSVLRTVGMAIEDTAAAVALHDAVGVPDERG"
FT   gene            523173..524525
FT                   /locus_tag="Strop_0461"
FT   CDS_pept        523173..524525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52946"
FT                   /db_xref="UniProtKB/TrEMBL:A4X246"
FT                   /protein_id="ABP52946.1"
FT                   /translation="MSGAESIAAAGHPWFGDQRLAPTAPADTLRHRLRSVLHKTGWPYQ
FT                   PVLPAAPMTIPRASYAELFRVAGVLVELLRRTALEAAPSTRERLAAYRMPASEDQLWLC
FT                   DPLLDERYADCVARPDVVIGPDGPQFVEFNVSGALAGVVETQSRLDVWRGLYADGAGRL
FT                   PYRSPDPFAVRAEMFRSLAAELAVAPRVAIVGSAQVAGVTSHYFEVEAEYHRSQGLAAR
FT                   FFEPKELHEAWDCPPGLRYSVGLRNFTIPDWADAGVPTATVQEALDHGCLLVGTQTSTF
FT                   LHSKLTMGLLSEGRPWMTTAERDLVNRYLPWTRVLSERWTERAGEQVDLLPYVLRNRER
FT                   LVLKEALGDCGKQVVIGREVPPSKWEAAVAAGAAGASIVQEFVPPQTCRVALLADGADE
FT                   PHDADVAPVLGPLLFGRRPAGVFCRYRTDGTAGIVNARGSATGADNAMVAF"
FT   gene            524576..525067
FT                   /locus_tag="Strop_0462"
FT   CDS_pept        524576..525067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0462"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52947"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X247"
FT                   /protein_id="ABP52947.1"
FT                   /translation="MTLRRVSDHEYVEEHGGDYEDFEPGMVIRHWPGRTLSEADNTWLT
FT                   LLTMNQHPLHFDQHYAAGVEYGRVLVNSGITLCLIGGMTVQALSARAVANLGWDKVRLK
FT                   EPVFVGDTLYATSRILHKRLSRSRPGNGIVTVETTGTKANGEQVIVFERSFLVRCRQAG
FT                   "
FT   gene            525178..526680
FT                   /locus_tag="Strop_0463"
FT   CDS_pept        525178..526680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0463"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; peptidase M24B, X-Pro
FT                   dipeptidase/aminopeptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52948"
FT                   /db_xref="GOA:A4X248"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A4X248"
FT                   /protein_id="ABP52948.1"
FT                   /translation="MTSEKQAKASHRGIPSSNEFREFIASGWATPDREPTPRAAVADHA
FT                   ARRRAMLSQQFPGERLVIPAGGLKVRSNDTDYPFRPHTAFAHLAGLGAHTDPDSALVLD
FT                   PKPGGGHHAILYFRPLAPRDSEEFYADSRHGEFWVGPRPSIADRESELGISARHIDSLA
FT                   DDLAKDAAAARMRVVRTVDPRLTELVDSVRTQAGATGSEQEREEADTEFARHLSTMRLI
FT                   KDEWEVGEMRKAVAATHKGFDAMIASLPEAVRKGRGERWVEGIFGLYSRHEGNGVGYES
FT                   ICASGDHANTIHWTKNTGEVRDGDLILIDCGIEIDSLFTADITRTLPVTGRFTDVQRRI
FT                   YDAVYEAQQAGLAAVKPGNKFSDIHAAANAVIARILHEWGLLPEGVTLEQTLDREKGGW
FT                   HRRWMVHGTSHHLGMDVHDCQLMLREKYMDSELQPGMILTVEPGLYFKADDLRVPAEFR
FT                   GIGVRIEDDVLVTEDGCENLSAAMPRTSQEVEEWMARVWANA"
FT   gene            526703..526909
FT                   /locus_tag="Strop_0464"
FT   CDS_pept        526703..526909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52949"
FT                   /db_xref="UniProtKB/TrEMBL:A4X249"
FT                   /protein_id="ABP52949.1"
FT                   /translation="MTGARSRGLVLLARGRSTLHRHPGRTSPNSVTDAAANKHIGNIFS
FT                   KRDLPVTTDGHPRVLAVLAYLRS"
FT   gene            complement(526954..527649)
FT                   /locus_tag="Strop_0465"
FT   CDS_pept        complement(526954..527649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52950"
FT                   /db_xref="UniProtKB/TrEMBL:A4X250"
FT                   /protein_id="ABP52950.1"
FT                   /translation="MKSVAFPDSRMGLHRTDAASVGGLRLVAGGGGLVVGRNRQQEPVG
FT                   LRLFRAEPTRLMLTGGVRSAQLIAFRAIALGARLFIQTGREREWDAFLRRCVIGREIAS
FT                   FLPPGVSPPAAANPTEPQLVVVDTGPVTGPDPGLSMPWRATLVVRDDLAGWDSTALVRS
FT                   DIVLLQRLTAAEAATAASALGLVSVQSWFTQLHPEMVGLITRGKVQWVMLSMTQTERQL
FT                   IGSVARGGV"
FT   gene            complement(527646..529202)
FT                   /locus_tag="Strop_0466"
FT   CDS_pept        complement(527646..529202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52951"
FT                   /db_xref="GOA:A4X251"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:A4X251"
FT                   /protein_id="ABP52951.1"
FT                   /translation="MTHPGAARPGEPGWRHHPDVAAQQARQLPPEQRGAAGQQADAPTP
FT                   APPVSRAGRGPGHAWAAHRAPGRATTNTVYTPEGAVAAQPNAAVQANAAVQANTATLSA
FT                   AVAPTASPLPAASASSATAATAAGVPPTPDVPAARRVRPYRPPLQVGGVTVAQLVAWQF
FT                   GAAAMLAATRHSVALTAVVAVVTVLVLAPTAIRFRGRWLHQWMPVWWGFRRRHRQLPAV
FT                   DTDPARHLLAQLGHGVELETVEIDDQPVVLLTHPAGLSVVFDVDPTEGALLMSAPQALP
FT                   SPAALLPPADGKAPPVVVQLLIQVTPTPRARPGAAAVDRAYRELTNGDVPASRQAWVVL
FT                   QAARTPDFHADRDLLPTLTGAIRRTRRLLRQERVTARMLNRDEVLAAVTALTHLTDAAP
FT                   GGVGEQPLARESWRAWSTLGARQSCHRLLDWPSRRWEVDSLLRGLPAAGGVVSIAASRT
FT                   DDDLAVEAAFRLLGTDPAGLAAADQALHEAVRRHGGRLQRLDGEHAHGVAATLPLGGFL
FT                   R"
FT   gene            complement(529234..530928)
FT                   /locus_tag="Strop_0467"
FT   CDS_pept        complement(529234..530928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0467"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; Parallel beta-helix repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52952"
FT                   /db_xref="GOA:A4X252"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:A4X252"
FT                   /protein_id="ABP52952.1"
FT                   /translation="MKPGAMTRTLLVSPDQPGAYPSIGDALAAADADAVVSISPGTYHE
FT                   ALFVNDHAVTIVAAQGAGTVTVDASSGEYPTVSANSVRLELRDLVLKAGDAPVVAVDRA
FT                   KLQMTGCELSAGFGPAISVADRSEFTLTRCRVNGARYGLVVEDSDGTVEGCEFSDLSED
FT                   GIIIRIGAAPTIRTSTITRCGNRGIYVYQYGRPTIEACDISQTGHAGVAVVHQCAPVLR
FT                   RCRIRDTRGPAVSFARGCQGTVEECTTENTALPAIEVAADATPTIVESVANRRATFGAE
FT                   GAQTGQPQDTERTEQLLAELEAMVGLESVKEQVHALTDEIQVNEWRRSAGLPVGTVSHH
FT                   LIFAGTPGTGKTTVARIYGELLAALGALPGGAFREVSRRDLVGQYLGHTAEKTAAAFEA
FT                   ARGGVLFIDEAYTLSRSFGSGGDFGQEAIDTLVKLMEDHRDQVAVIAAGYTGEMRQFLD
FT                   ANPGLASRFAKTIEFGNYSPEQLVVIVERIAGGDEYLLADGASELIQAHFATIERDQNF
FT                   GNAREARKLFERVRKAQAQRLRQSGQRPGLDELRTVTVADIRVAIDS"
FT   gene            531153..531536
FT                   /locus_tag="Strop_0468"
FT   CDS_pept        531153..531536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52953"
FT                   /db_xref="InterPro:IPR025968"
FT                   /db_xref="UniProtKB/TrEMBL:A4X253"
FT                   /protein_id="ABP52953.1"
FT                   /translation="MAAPRMLPLTAGALLVNGTVHTHTSVRGDLAPNLHPVIRRFLDEL
FT                   PSGQRERFAGWCAEVVLLSDRLYEAEADGGSISPTQARSLLWGANVWVTRIREEGDPRD
FT                   EEQQPPCRSCAALLDWLGVEGLA"
FT   gene            531533..532018
FT                   /locus_tag="Strop_0469"
FT   CDS_pept        531533..532018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52954"
FT                   /db_xref="InterPro:IPR025850"
FT                   /db_xref="UniProtKB/TrEMBL:A4X254"
FT                   /protein_id="ABP52954.1"
FT                   /translation="MNDRFPPLVTEALQAAGWVPGRRDDDRAQQWALRLAADAAPDGRQ
FT                   HTIVRAAVEAYGEFGGLLVRPQGDGEQIAPSTFHLDPFLVGRSVGTLAELAAAIGAPLT
FT                   PIGEEGDGVGILAVDEPGRVFVLDHGGDWYLGADLDEAITALVLGRQPHRVRQDGTW"
FT   gene            532012..533292
FT                   /locus_tag="Strop_0470"
FT   CDS_pept        532012..533292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52955"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:A4X255"
FT                   /protein_id="ABP52955.1"
FT                   /translation="MVADWRPATPLEETLLAAAVAGERSSFLAALATGQLLLPVSPEAT
FT                   AGAAPMPWPTGRYDGGTYVIAFTSPEAIAACLPGQSVNYRALGIQDLASDWPDDGWLLA
FT                   VNAGLPVGTRITADELRVVAGPALEAERELRHAIDQQDPDALMAALLRTELLLPIRPGG
FT                   SESRDLSDPEFPWWCLPDEQGQPGLPIFTGEARLRQALGDHDVITVSSLQLAEQWPDPT
FT                   WQLLLNPGTPLAAALPGSALRNLCDWLGQLRQVVTDAAEEERQRREPTAGVEPAMPGVP
FT                   ASRTAPEEDDAADEPDPDLPIRLQLVIPHQYLSSYLEDGYQRAAGLVHAWGGPGRDTPA
FT                   RIYRRLGLLGEGSPFVESDEWVAVLRWDPDEATPEEWGQGQPRMESLVVSDGTGLHCLH
FT                   RDGRDELLACFDAATARWLPAGASAGS"
FT   gene            complement(533303..534604)
FT                   /locus_tag="Strop_0471"
FT   CDS_pept        complement(533303..534604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0471"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52956"
FT                   /db_xref="GOA:A4X256"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A4X256"
FT                   /protein_id="ABP52956.1"
FT                   /translation="MRLAPRPATTIAAATLGAIVALGVSVLPAPAADRKDAWHLDALEL
FT                   ADMHKITQGEGITVAVIDSGVDATHPDLKNNVLPGIDFFDEQASGHEDRSGHGTAMASL
FT                   IAGHGHGPGGHEGVLGVAPKAKILPITVRAPEGKSNYSLEAIALGIHWAIEQDVDVINI
FT                   SLGGPQNVELSQAVERAYQNNVIVVAGVGNKENAAIGSPANLPGSLAVTGTDRDGMPSS
FT                   IASLPAAQTHLAAPAEDLYQAVPGGGYATITGNSGATALVSGAVALVKSKYPNLNSLDL
FT                   FKRMVETTRDAGKPGKDFDYGWGQLDLRAALTGEPDGRASRTQAPSQEPQLDPTLARAR
FT                   AQGPAGENEALVMALSIAFILVVLGLIATPVLLLLRYRRRRRATTPAMEAATATRTSAT
FT                   GLASPPTATTNPSESGPPAHPTDPADDSPWRRPD"
FT   sig_peptide     complement(534509..534604)
FT                   /locus_tag="Strop_0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.797 at
FT                   residue 32"
FT   gene            complement(534703..536283)
FT                   /locus_tag="Strop_0472"
FT   CDS_pept        complement(534703..536283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52957"
FT                   /db_xref="UniProtKB/TrEMBL:A4X257"
FT                   /protein_id="ABP52957.1"
FT                   /translation="MTDQYYGWTPTLAGFAGGGDDYVADQAAQSTPYEPTQWDGVTIEQ
FT                   MWEYARRESDERTVALAETWRRTSILLQSTRENLKRHADGLRAKWRSPAGELFMSKVGA
FT                   ALYSLDEWKDVADKNANGLEQIASKIAQTQRDMRELWLTYQAEQKHQAQKRKADEGIQF
FT                   GDIFGLNNGKSYTEVQKEFHERAKNIVKPLAELYIDVYISNISRGGKYKGPTNIAEYNP
FT                   GQSPRPERPSAPIRPRPPAPNLLGGRPEMLARLDVTPPPSSPELSDGIGLAGGTVTAPS
FT                   PTPGPPPAATPPISPTPTPAPAPLPPPVLRGVSSPGTAQPTTPSTTRPSNAPRTTLPGA
FT                   NNPDARGPAPNRPAPPNTGKPGGSPAHRGPTPNQATLPGNTGTGRPPAGSIPPRPTPPP
FT                   PNLSGKHSTSRAASGPRTSSPSVGRPAPPPTTGRPTPPNGGSPLTGRTAAGGTRPAPTT
FT                   GPAPSLGGRRGAPTTPRPPARARPEETENWKYGEGDDELWVTDPAPAGTIDAPAENQPR
FT                   HHGKALGQG"
FT   gene            complement(536319..537080)
FT                   /locus_tag="Strop_0473"
FT   CDS_pept        complement(536319..537080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52958"
FT                   /db_xref="UniProtKB/TrEMBL:A4X258"
FT                   /protein_id="ABP52958.1"
FT                   /translation="MALAPPEWILSLRLRTCAIRIEALIRQMRSQDAHMRRSQTDDRGG
FT                   IMGDDWLVSENIDVNIQQLKDFAQAIQNELETNFRPSYQGGVLPMLQVQAPFGGGGMNE
FT                   GRFFRGRHDESRLAVIRLLEDAMQGMVSLSTVSMSISADYLTEDALVEATNTDVLNAFS
FT                   TVDGQQTLNNGVQQGDNEHGNSTDSLPPGAFGSTVTHLEQSVGLDGNTGEAPLMDQPET
FT                   VGEGSGAYRIQGDDERMHGDEVTPPDVDLRG"
FT   gene            complement(537101..541057)
FT                   /locus_tag="Strop_0474"
FT   CDS_pept        complement(537101..541057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0474"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52959"
FT                   /db_xref="GOA:A4X259"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X259"
FT                   /protein_id="ABP52959.1"
FT                   /translation="MSTVVVKRPARQPEPEYPSGEVLLEGPPEVPGPSGRGWGQMLMML
FT                   PMLAGSFAMALMFAGRGGSTLGYVTGGLFGLSAIGMLGSQLANNSGGPSKQEMLQRRRE
FT                   YMTHLSRQRRRVLKTVRKQRDAAHYRHPEPELLWSVPIGPRLWERRRADVDFGTVRIGL
FT                   GPQELATPLVPPPATALEKLEPMCALALRRFLTTYGEVPDLPVTMALNGFARVHLRGDD
FT                   DAVRGLVRSVLAQAAAFHAPDDLLVAVCVAADRRDAWEWTKWLPHALHPSRTDALGQLR
FT                   LVTSSVAGLEAMLDDVLASRPRFSSIGGAAQVGGPHVLVVIDGGDTAGSDHLMTDGGVE
FT                   GVTLLDLSNPAPRLLDRARLVLEVTPDLKLLSTTVDGVAEIGRADQCRITEIETLAMQL
FT                   TPLRLSAASRGGDSPLTAELGLAALLNIGDPHEFDLEAAWQPRPNRDRLRVPIGTGTDG
FT                   ASVELDLKESAQDGMGPHGLLIGATGSGKSELLRTLVLALAATHSSESLNFVLVDFKGG
FT                   ATFTRLDALPHASAVITNLADELPLVDRMTDSINGELVRRQELLRAAGNYASQRDYEKA
FT                   RAAGAPLAPLPSLLIICDEFSELLTAKPDFIDMFVQIGRVGRSLGVHLLLASQRLEEGR
FT                   LRGLDTHLSYRIGLRTFSAMESRVVLGATDAYELPRSPGHGYLRFGTEPLVRFKAAYVS
FT                   GAYRSEMAVAVAAGDSEARVQEYGTSYVAPPVTPTEAEVTPEPAEPGGDSLLDILVGRL
FT                   TGRGTPAHQVWLPPLAEPPTLDQLLPPLTADPDRGVTVAHAALVGELQVATGIVDKPFE
FT                   QRRDVLWFDLAGAAGHAVIVGGPQSGKSTLLRTIVTSLALTHTPREAQVYCLDLASNAL
FT                   SSLRGLPHVGAVATRLDAGLVRRTIAELQLLMGERERRFGERGVDSMAAYRHARRHGQH
FT                   TDDPFGDVFLVIDGWSTIRTEFEDLEPAISDIANRGLSFGIHLIVTAGRWMDLRPAVRD
FT                   VFGTRLELWLADAGDSMLDRRAAMNVPEKSPGRGITPDGQHLLAALPRADGSQEPESLP
FT                   EGSRKLINDLAASWEGPGAPPIRLLPPVVPFGSLPATGRPGIPIGIAEVDLQPVHLDFA
FT                   TDPHFLVFGDGESGKSTFLRALAQTIVDRNELNEARLVLVDYRRSMLGDITTEHLIGYG
FT                   SSAQLTENIIAEVAAVMRDRLPPADVKPDELRARSWWKGPDLYVLVDDYDLVAGAGSNP
FT                   LTPLLEFLPQARDIGLHLVVARRTGGASRALYEPVLMRLREISTPGIVMSGNREEGVLL
FT                   GTVRPGPLPPGRGWLVTRREGTRLVQLLDLPSQV"
FT   gene            541194..542582
FT                   /locus_tag="Strop_0475"
FT   CDS_pept        541194..542582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52960"
FT                   /db_xref="GOA:A4X260"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A4X260"
FT                   /protein_id="ABP52960.1"
FT                   /translation="MVTQAGTGLARIAVVTPNRRLDLALPEHLPLVGMLPAVLRQAEEH
FT                   PSDGTAHGGWMLRRIDGTAIDLHRTLAAQNIRDGETLHLAPRRTEWPELAYDDLMEAVA
FT                   AGARRRGLAWNPLATRLTGPIVASALLLTGLAVIIATDEPGWLSGVVALGAAAGLLLAG
FT                   VVLARAMADSLAGAVLAAAGLPYAFVGGILVIGTGESVWALGAPHVLLGSAALLLTGLL
FT                   GVLGVGDATRVFVAAVYAGIWGMLGGLVALGSIDAVQGAAIVVSAVTLLLPAVPLLAVR
FT                   LGKVPMPALPRTAEDLLRDEPQPPREVVYQAVARADEMLTGMIFGSVVVTVSCLVVLTA
FT                   AGSIPALVLTGVVALGYLLRARLVPTVRHRVPMLAGGLVGFALLALVGAADAGTAVRVL
FT                   AVLPVAMVAAGISVSAGLAYSRRAPSPRLARIGDVLDILVQLAVVPVACSVLGLYAFMR
FT                   ALNG"
FT   gene            complement(542592..543353)
FT                   /locus_tag="Strop_0476"
FT   CDS_pept        complement(542592..543353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52961"
FT                   /db_xref="InterPro:IPR025850"
FT                   /db_xref="UniProtKB/TrEMBL:A4X261"
FT                   /protein_id="ABP52961.1"
FT                   /translation="MISRDEALARARRWAAAGRPGPPPEVDFYEFDLGFVASRREPLRF
FT                   APDGTPKPPSATGQPTVVIDRGTGRLSSWPPLSNQEIAEWYGKYHAAEGRFPPDVREVL
FT                   DQAGWFPGRDMTAAVDLWLARFADELAGLECFPAVRAALIEFGGLILPQLGRSGEPGAG
FT                   FASGIQPTRTGGVLADCSEIFAEEFNNPVFPLGNNADGPSELVMDAQGRVFQLHWADDF
FT                   FIGPDIDTAIIALIRGGRMPAASDLTWRTDN"
FT   gene            543491..544930
FT                   /locus_tag="Strop_0477"
FT   CDS_pept        543491..544930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0477"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52962"
FT                   /db_xref="GOA:A4X262"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:A4X262"
FT                   /protein_id="ABP52962.1"
FT                   /translation="MPSRRDQVQSYQFFVQRMTSALVAREPDPATAAPFRRLGGAGFAS
FT                   IMVAVLCLAAVGVYGLLRPGGATKWKEESAVILEKETGSRYIYQEDRLYPVINYSSALL
FT                   ALGSAAQTVSVSRNSLVGTPRGTRIGIRDAPDALPDPKRLLSGPWTLCTQLAHDSAGGA
FT                   VATTVLTVGAAPSGGREMDEAALLVRDTATNRLHLIWQDHRYEIRDENVVLEGLTMTTE
FT                   PVVEVGGAWLNALPAGESIGISEVVDRGEPSRALQDARIGQIFVVESQNGGRQYYLAER
FT                   DQLRSLTQLQAEVLLADPKATRAYPDGSPPEPISLPAGVAASAQKAPPVAEGSHRAPAE
FT                   RPEIVQLRGDEPAVCAVYQPGQSEPTLLLEGRVRPEEGLLRTAEQTSAGIPLADRVVVE
FT                   PGHGVLVEAMPAPEAPTGALSLVTDLGYRYPLPSNEVAGLLGYGGVQPVEMPASLVVRL
FT                   PAGPVLDPTAAKQALGPELPQ"
FT   gene            545073..545402
FT                   /locus_tag="Strop_0478"
FT   CDS_pept        545073..545402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52963"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4X263"
FT                   /protein_id="ABP52963.1"
FT                   /translation="MTMRTDTGLMVKTEGDVDAVADRLTSNLNQLMDQLAPLYDQWKGA
FT                   GAGSFQQVRQRFDQDMARLNVALRAIAEAVGSAGKDYDVADDEIKSDMDAAGATAGKIT
FT                   TALKL"
FT   gene            545423..545710
FT                   /locus_tag="Strop_0479"
FT   CDS_pept        545423..545710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0479"
FT                   /product="protein of unknown function DUF909"
FT                   /note="PFAM: protein of unknown function DUF909"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52964"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4X264"
FT                   /protein_id="ABP52964.1"
FT                   /translation="MEIRYNFGALNAAADSCGTSLKNLNGELDGLKSGIAPLLATWDGE
FT                   ARDAYFRRQSDWEAAANDLRDLLGRIERALRDSAAKMQAREAANRAKFGD"
FT   gene            complement(545814..547109)
FT                   /locus_tag="Strop_0480"
FT   CDS_pept        complement(545814..547109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0480"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52965"
FT                   /db_xref="GOA:A4X265"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A4X265"
FT                   /protein_id="ABP52965.1"
FT                   /translation="MLFNRRTPTSVLLVALISSTALMLPTGAAAAASVCANPSAPGQVI
FT                   SDASWHQQWLTPQRVWPFSTGAGVRVAVVDSGSDGDHPQLNGQVANGFDALRGTSGGDI
FT                   DCVSHGTAVTSLIAARPQEGIGFHGLAPDATILPIRVSEQAGSGGGETPGESVSTEIFA
FT                   QAIRRAVDDGADVVNMSVTLYRPDPDVEGAIRYARERDVVLVAAAGNLHRNGEQSDPVP
FT                   YPAAYDGVIGVGAIDQQGARVEQSQVGPYVDLVAPGGGVVAATRVNGHAIWSGTSFATP
FT                   LVSATAALIRAAEPELSATQVSRRLLATADPARGGPGQGYGQGVLNPYRAVTERLSTAA
FT                   PVAPAPLPDPPYDAVALERAQRWHVLGRVALWGGLSVAVLALAIGATVLLLPRGRRLRW
FT                   HPIRPGEPPPSGPEIDDPEEAFFRVPTSLPRG"
FT   sig_peptide     complement(547014..547109)
FT                   /locus_tag="Strop_0480"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.659 at
FT                   residue 32"
FT   gene            547220..547657
FT                   /locus_tag="Strop_0481"
FT   CDS_pept        547220..547657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52966"
FT                   /db_xref="GOA:A4X266"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A4X266"
FT                   /protein_id="ABP52966.1"
FT                   /translation="MDRRWQHMDVQGEDAMDIQALRARADELMNQFERMRSGVGGLQQR
FT                   LKEVNATVTSDDGFVTVTVGPRGHVAKVEFDPRLYRRPNSKELSATVTATIQRATEKAL
FT                   AEVEELLRPFVPDSQFQAYLDHDLTGIFGQLERELPREGDR"
FT   gene            547654..547992
FT                   /locus_tag="Strop_0482"
FT   CDS_pept        547654..547992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52967"
FT                   /db_xref="UniProtKB/TrEMBL:A4X267"
FT                   /protein_id="ABP52967.1"
FT                   /translation="MTDAAETFVHPEGVRAGAGQLGAAGSMLARRWAQHAATIEMLNGN
FT                   SPWGADEYGKEFNKHYLGGDAIATTVLDGGQTIVERVQLLGPIVSSAVDGTVEMDEAVR
FT                   TMFGSDDT"
FT   gene            548035..559299
FT                   /locus_tag="Strop_0483"
FT   CDS_pept        548035..559299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52968"
FT                   /db_xref="GOA:A4X268"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR025968"
FT                   /db_xref="InterPro:IPR028908"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4X268"
FT                   /protein_id="ABP52968.1"
FT                   /translation="MAVPYPRDLIAEYPTVWNAVCWVSAGEAWPTGDEDQMRELAEAWK
FT                   GLAETINDALLEADPAVLKILQNWGGDSGEAFGQLWNQLAIDPGAGLPLIQEAAAAFAH
FT                   GAENAAMEIEYAKLTILIAFLITVISVFVALLMAWLGGVSAAGIPAILAAGRQAVTVAV
FT                   RRLVAQMGRQLFTRAGMHAALRNVGMQVGQRLTREGLGHAGRRFALELAEEVSEELIID
FT                   VTAQAYQINAGTRAEWDVRRTGTAALGGAFGAVLGTGLKAGTRFARNNLAPRMPISFSP
FT                   PAVDFPGAGIARWGGRTLAAGTQNAIVSPAASVLANRVMTGEWSMPGGDAVLGGFASGA
FT                   GRGGATMAASSGGSALAHLHNKLAGLDPSAVKGAGLDTGPSNLPTTGLGSISLAPPPAF
FT                   DPASLDGAGQVGVGADAVAGSVSPSSMAGDPQGGSSKHDGSIVVGQSAAPTIHSALSPF
FT                   ADGSVGDDSTADSAQHAPISPDSEPAVVPVVASSAPAAVGPTAGLLPTTPATGGAVANP
FT                   TVAGTPALATAQSSPAVSPSGSTSGTSASVAGGSSQTGSPQTAAGPGTQTGTRTPPASG
FT                   PPVPTGNPRAPNSAGSVSLGPATTPTASVPTSKLTPTVPAATGASPSTTPDPANRVPTQ
FT                   RVSVDGAMPASAPSHTGAPTTGTPDSPIGGNETSVPTEARRSTGPTGGNTHSWQGKSFT
FT                   VTGDPNGREAKRTLIEASRRLAEAVRTAVKGKAISKGKMPGMAGALMMPNGEVTTHTSM
FT                   TADKGTKPPTQPAVHPVVQDVLDRIKADLEAKHGEGAGHGKCAEVALVSDQIYRLEEEW
FT                   RQAGEPGALEQYALNALSGAKVVTHQVRTGWDEAGVKHDLGHYRLPCRSCRSLLPQFGI
FT                   DPLSDPERSPKVYQPPVPGVVGNGRPLSDERPYGEPEGLVPPEPAHQQALDDAVPRDPE
FT                   TGRPEVHPDPRLRSWVGKVNDGGPTVPGRDRNCADVGLSFLSTWFGRPEVAAATIEGAD
FT                   LEHASTARQEQALGSAFSYRGTGPSGLDDIAVTLQGAGHGSAALIVTTSTKADGRAHTW
FT                   NVVNHQGLIVWVDGQAGLVSDAGPFRSAGIGDVWSITLDAEGDPLPPGQPQSDTDAPAT
FT                   EPVPVPPHSTAPAEGQRPDDSVGGRAAGISEQSWGAENDYLGALSDAERATLFDELAAA
FT                   RSEATHILGELQSLAAGVNARLGLTGADALRTLGEEHRVKGAESLARKYRTTLATLGYD
FT                   IGSALATVNDVVRFSLRGPESELYGPAVDNVLASLEERGYQVTNLKNFWRSGNRFFGLN
FT                   CTLVSPGGRTFELQFPTATSYAIGKQTHVPYEVVRDPAQPAADRVHAFLDILAINKSQG
FT                   AAARMPGGMEAVRFGEANDSSFAKWIGASKRARLRKEYLDWLGQQPYAFADVCVERGLT
FT                   ASDLPGLDRDLIGETHGDADIRLLPPAAGPGRPAGQPDRERRHHGPDAGGDLGSVDRRV
FT                   DVPSGRGGGVSVGGPGDGRGPGGGSGHRGTGDGSLHDGSVADGSGVDRDLSRGVAEVAP
FT                   GRPEVAGPELLSVEPETNYGLPETRSMGPGKLAPLEDPRYQQDVALSLRTAEGYTYLAD
FT                   PFTHPYGRLINDGGPAEQGRGNNCLDCSLAALSSFYGDPQVAQPRWPDIRVGGSFETEL
FT                   GEDSGLTRAEEWLGGIWAGGSAGLPAAPTARAAAVSDQYARLYQRVAQSGPGSAALVVA
FT                   DWLGADDVTGELILDEEGGVTPDGAHAFILVYPSGVDRPVWWDPQHGVAMPEPPPAYVA
FT                   RTYALWSMMVPSGGGTNDGGRGTSADHSSAGDPKSGPAGRVRVRLGGSGGTLGGGASLG
FT                   KARGSGAIHHRPDGRGDSPLEPAAPADSSAVRGSPPPRPLHGTTGLAEGGPAGLNPTDT
FT                   ESAATSVVPPLTAADVAELATVTHQLRTANTFSRVAVRRELTATVDRLGLRDGMLGAEQ
FT                   RMATLPAEVRAALAEVINQGSAHTSERSRLRPDRRTSEAKERPVGLPRMRTYVGTHLTV
FT                   NSLLLTLATTFTLNAGGRPELALMLGAGAFVGAVTTGPTKWLAKRAGLAAEDRRARYDA
FT                   RQDARTAAEEDVATAAVLVAHTDDVTSTVQKLGAATTGLDGQVSAVQEQLRRDERRHRV
FT                   MGPPRRFPSAGEDAPAVSDDSPGTGTSSAGAPGGSTAVGLTSRERERLAELRSLVARHD
FT                   GARPWARFGVGREIRALLNSLGLRQGTPGVDHRRDLVPPDVRPLVERFGGSRTAVVRAR
FT                   ARAVIDRYPADDQRPGTVAPWWMSAVENAPNLLTATTVAGVGDLLGQLRLGWFGIAGAL
FT                   AAAATGVAVDPVVARREAVAKDARDTWDADNPAVPAEALLSQAAEAVADPISAVADRAA
FT                   TAVRRTADLEQRLADLERRVTDSQRRNGLIDSFRRLLFGDPAWAGLPPSKDATPISKDA
FT                   TPASRASADPEASTDPAAEPSVGSRDPASLQQLAELAVRHGSVGPLARPSVARQLRFLI
FT                   DRLGLREGTPGADQRRAQVPDELRPVVERHGQLGVTSRVITRFSRPPALATDSTERPSN
FT                   MRSLRVFAVEQTLGPLVQAGTWVGVAQVSQIAAGAGPSKILAGGLLGPLRDLLLNRAET
FT                   RVKDARRAWDLANPNPAMEPKTRAAGLAGPSATAVTSAVGQLDVASRRLDDITSTLDRL
FT                   AQGHAAGPSDPAATPGIGEPLDVAGPASLNRADAWELQTAAHQVRTADALSLRPALREL
FT                   HAVIDRLGLRAGMLGAPDRIAQLPGVARRVVAEFGGDRAGRARQLRTLRAQRRTAENTR
FT                   PPGIPGLRTYLVSSGLTTAATAGAATAVAIAVASPLTPVIPIAAAVAAPVIGVSKWYAR
FT                   RRGLAADDVRSRFDARVDARGAADQVDQVVDRVNEPVAELERAANRLEGQLGAAESATD
FT                   RLAERLAETHRRVGLLSRLFDIVGWGPTAPTGSNPEAGAVRESRGSPEDSPESGRITAA
FT                   AVPNSGFHGLGRPVADPVAVLATAHAALPQVASYAGVDDIGPTGPNRFEIYAAGRFSFR
FT                   VWLTTGPLTDGVVAQTTRNSDGSFTVTVSDRAVDGVVARALTHEIAELAALHDSRQILI
FT                   GPLDPGTDDGLINPAGLTAHDQGRMAEIRLLAAEYEFAGPPTRLALRVEIDALANHLGL
FT                   RLGDPAAPGRAAIIPRDVHAQLMRLSTPSVTQESVAEVLDGSPATEVEQRRWVDYRNQL
FT                   VPDSQVPSTTELQARLHELAIQGEREQVSLPRMSAHAGQILHLPPAQLGLIRDVHPTLA
FT                   DRIAAEGVYVDLAGRFDLRPYALTDAPEFSLAESRSAFDLGAEVGRQSLLAEDRARGYV
FT                   VIRAAFGARSAAMAMLHTHDLHYLTNARKLALVPGVLARALYALVPGAPPLDLEVTPTA
FT                   TAAEVTVIADRVTLPAGESGEPAPEYGRPRDLWTGQPAPLFDGPPKREQVQQGKLGDCG
FT                   MLASMAAVAGHRPEAIAQLFQPNPDGTVDVLLHESTLLGDSIGPTGRRLRITVHPDVPI
FT                   WDSVSGESAYADQSVIGSSWASLLEKALAAVDRTWSSDRHQQWQLTWAAWESPNDPLVA
FT                   APTGYARLDVGSHRQMQAELLTQLTGLPSRAASFDQTPGRETASEARLAALLAAGSPVI
FT                   TATRGEDQYPAAIRNQLPHGLVAGHAYEVVAVGNGQVQLHNPWNTRHPTPMTVREFLDL
FT                   MNESFAYLEPPPTPPVQSSDPHTLGRTWLEELGYSIAYYALLAADGTVSGLVVSESSRR
FT                   GQRTRHWMAAGAPSAPGSALPVDRTEAERIAREALGFTLPDEPALHDMLEG"
FT   gene            559353..560870
FT                   /locus_tag="Strop_0484"
FT   CDS_pept        559353..560870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52969"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="InterPro:IPR037883"
FT                   /db_xref="UniProtKB/TrEMBL:A4X269"
FT                   /protein_id="ABP52969.1"
FT                   /translation="MSIRNNTPSSIGPARLAVRWLEGDSPVRAEFIVMPLWSQESPHYE
FT                   VVLGETFPVGDETWRFADVDMKNADEWRVIVRRVDENEVMTPPTGRVWKSARLRPYGHL
FT                   DEVQLQAVEAELGTRLPPSYRRWLEQTNGAQPEMEHHVPGRPFVLIPERPLCGVHPQHP
FT                   SRDLVHAQRVHRDPWLSPDWLVIANLGGGLLLLSLRVRDMEREGIYFLPDAGLSGPIGS
FT                   EGAAGRERHIVPVARSMGHLLGRITPVDVSDLPPAEIVWPGQSGHSGQEAQSPWAVRPE
FT                   TESPWTLQPEGQPRFTETPAAPAPLLPVGQFFGTFYPVVGSPERIHRVRLGSEVWELDN
FT                   QRFILWALAHGSGAPSAGRPWTVSAVRDAAAGQLPGVDTAPLLDGLTAEGLLVEVAQEK
FT                   AVEFARRHRVGARLLGLGNSAEEPWLWSIGFFEHPMVKVTRTVYNLWERAPSGESLWAL
FT                   CQALAAEEREADATEPDLTDPERMLTAFLQDIHQLLVASVIYLEPLP"
FT   gene            560867..561556
FT                   /locus_tag="Strop_0485"
FT   CDS_pept        560867..561556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52970"
FT                   /db_xref="UniProtKB/TrEMBL:A4X270"
FT                   /protein_id="ABP52970.1"
FT                   /translation="MTDTTRNSTMVDRLILPVGRYTGEFFPSVGAPMKYNSLSIGRFST
FT                   TIADPEAFGVWAAAHCPVDRAGETWNRAAVIEAAEQIGVADPNRFIEEFLEEGLLLEID
FT                   PDAPDVEDFAQAYRVLPLMVSLGNTPDDPLHYGIGIFGAAPVLRLPALTHDVWQWSSTG
FT                   ANLWEVCTALADASARAEVADAREHNPRFVLREFLTTLPLLVGAFAACLDEARRDPAQP
FT                   TGGSISA"
FT   gene            complement(561526..562071)
FT                   /locus_tag="Strop_0486"
FT   CDS_pept        complement(561526..562071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52971"
FT                   /db_xref="UniProtKB/TrEMBL:A4X271"
FT                   /protein_id="ABP52971.1"
FT                   /translation="MILPASRTSAEAHLYMDLRPCACGEARFDRQSAVVALEDGGLAAR
FT                   YSGSCPTCGRARRFTFRLPAEPTLPPSGGFHYGADEPSQLLDPGEWLWVADAYARSVPA
FT                   GSATTDAGQQAQATLLRAVAALDEVLKFVPPGADTVPASAFTSGRGRHLRRRDPGRFRR
FT                   GRLAAVRDAYAEMLPPVG"
FT   gene            complement(562421..563698)
FT                   /locus_tag="Strop_0487"
FT   CDS_pept        complement(562421..563698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52972"
FT                   /db_xref="GOA:A4X272"
FT                   /db_xref="InterPro:IPR026588"
FT                   /db_xref="UniProtKB/TrEMBL:A4X272"
FT                   /protein_id="ABP52972.1"
FT                   /translation="MNKSAKVLTTRAAATAAVAAATAIVMMGNVVSAAPVGPIDPVEAT
FT                   EGFLVMTEGNATLIDTENEGTLAVGGNLAFSQYQLAVVSAGNFFAPGENNPTALVVDGQ
FT                   VDFLNSVPGTRLQVLQNGFAKIGNLNGTFVRDVDNNNAPANTRILPANDYDAFPRIELV
FT                   TSQSVASVGPVSVIDFAEAFQTFRSNSTELATCQNTVVLRDPNGDPISSPIPPGTNAVI
FT                   NLSPNTTNVLNITSTDLDNISVLTFADQPTASSPLLVNVNTTDVGNAFAWTAPNFAGVG
FT                   GPEARFILFNFPTATTLTLAPGGATVEGTIYAPRADYTDLDQSNTEGSIIARSLEHRGG
FT                   EIHDYPFSTTLACDSGSPTASPTVTPTADPTMTPTVTPSPTGTDLPITGSSSGSMLFVG
FT                   SLAVLTGTGLLLTLVLTHRRRRNVGS"
FT   sig_peptide     complement(563597..563698)
FT                   /locus_tag="Strop_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 34"
FT   gene            complement(563815..564069)
FT                   /locus_tag="Strop_0488"
FT   CDS_pept        complement(563815..564069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52973"
FT                   /db_xref="UniProtKB/TrEMBL:A4X273"
FT                   /protein_id="ABP52973.1"
FT                   /translation="MRRLSVNGLSGPRKINYRLSRRADLTTLAAALLEAGGVAVDDFCS
FT                   RTWTAAEIEADTMINGDRFGEGSVRGEAFSSRRSRRAPA"
FT   gene            564615..565061
FT                   /locus_tag="Strop_0489"
FT   CDS_pept        564615..565061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52974"
FT                   /db_xref="UniProtKB/TrEMBL:A4X274"
FT                   /protein_id="ABP52974.1"
FT                   /translation="MDIEALLPRARTPRDYLDLVTDPRVDQDGLHTLARSPYSFVRLAI
FT                   AKDIRTSPATLTELLLGEFDQWDRNYLLRLVAQHPQADRVVLLKVLHATEVLLRQSGAR
FT                   PYGVAIALASRHELAPHEVRRAHRLPGASRRMRRGVERALARRQ"
FT   gene            complement(565585..566049)
FT                   /locus_tag="Strop_0490"
FT   CDS_pept        complement(565585..566049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52975"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:A4X275"
FT                   /protein_id="ABP52975.1"
FT                   /translation="MPGAAALPCTRYGESKGSIMGAWGPGPFDNDTACDWGYELDDAVR
FT                   ADRVAVLRSALIAAADQSGHLGHTEAAEAVGAAAIVAAFQPGGPPLDPIYSPDCLRADG
FT                   LDVPPELVDLAARALDRVMGGDSEWRELWAEAGRLDDVTAVLAPIRASLT"
FT   gene            complement(566531..567283)
FT                   /locus_tag="Strop_0491"
FT   CDS_pept        complement(566531..567283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52976"
FT                   /db_xref="GOA:A4X276"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:A4X276"
FT                   /protein_id="ABP52976.1"
FT                   /translation="MSERFAARLAGALFLLVIAVVLASSAAAGGDAGGIAQRLASIAED
FT                   PSGLRLSIVLLTVAGIATLGLGAMLHAITRRQDPSLAAFALACRAVESGLYAVQILGAM
FT                   LLLSLSRQNTDRVRELGAATVDVAAWSNNVGACFFAVGSAVFAYILLRSRAVPRPLAIL
FT                   GLLASLLLAVSIPFQSAAGAVTTEGAGILLWLPMFAFELTAGGWLLIKGLRSTDPVRSP
FT                   SANAKRSAETKTAHNKLGLDRSAGGSSR"
FT   sig_peptide     complement(567197..567283)
FT                   /locus_tag="Strop_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.452 at
FT                   residue 29"
FT   gene            567472..570363
FT                   /locus_tag="Strop_0492"
FT   CDS_pept        567472..570363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0492"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   transcriptional activator domain; Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52977"
FT                   /db_xref="GOA:A4X277"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4X277"
FT                   /protein_id="ABP52977.1"
FT                   /translation="MAGPAVRIRLLGGVEVVDGSGTAVDIGAGKCRALLAALAMQPGRA
FT                   IPDWRLIDLLWGEQPPRTAVRTLQSYIARLRGGLGAGRIVRSGASYRLDVPADAVDVIR
FT                   FGRRVEAGDVAGALAEWTGDPLAGVPVPGLAATVDGLVEQWLGAVEADLTARVDADAAA
FT                   TVGPLTELSARYPFREGLWALLMTALYRVGRQADALTAYRTARQQLVEHLGVEPGPRLR
FT                   RLESAILDQDPRIGGERRSEPVHRLPRRAVRLIGRDGDLDLIGRALDESPVVTLVGPGG
FT                   IGKTALAVAAAQRTRLEHGAWLVDLTEITTDQDVPQAVAAAVRVEEGPGRSLSESIVLS
FT                   LSSLRALLVLDNCEHVADGAARLAQAVADGCPQVRVLATAREPLGLSHGHERLVAVTPL
FT                   PAAGAGADLFAERANALTAAFTTGAAREVIEEICRCLDGLPLAIELAAAQTVSHTPQEI
FT                   RERLDDQLGLLVGGRRTGADRHRTMRATIQWSYRLLTVAEQDLLQRLSVFAGPVDRAGA
FT                   AAVAAGSGLDVNDVLHTLVQRSMVTAEPGRFGQQFRLLEPVRQFAAEHLAAGSAAAPAQ
FT                   AAHTRYVRERVTSLHDQLTGTAEIQGVAHLDELWPNLRVAVDRAFACGDYRLAHDLFRP
FT                   IGTEALRRHRHEIGQWAQRLLEQAPAEDRPRVVAGLIAAGPRYHLRQDPAGFDTLVRQY
FT                   GDPDDPVARHMRANVHDDYAAQIHSAPQALAELRRLGADDLAAHVEVDLGAALVFQGQY
FT                   ARGDTKLTELADRFRSDGPPTLLNWTLMLLGFSAAFQGRRAAADQLFDQAVDVPLPVRT
FT                   HSPNQSVRAQALFRRGDRRAAYQLLRAHVEELLDADNMHGACVVSISFVTMMPAVARFA
FT                   EGARVLAFLDTAGLLDNVAWAAMVADARDELATFAPAFDESTIADQRQALVAIGDTLDD
FT                   LLAEQTSRPDANSIFNLLGGGIDPRRSWEQSLD"
FT   gene            complement(570421..572145)
FT                   /locus_tag="Strop_0493"
FT   CDS_pept        complement(570421..572145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0493"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52978"
FT                   /db_xref="GOA:A4X278"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A4X278"
FT                   /protein_id="ABP52978.1"
FT                   /translation="MHSATLSLATRERSLAALSSGLELDVLVIGGGVTGAGCALDAVTR
FT                   GLSVGLVEARDWASGTSSRSSKLIHGGLRYLEMLDFGLVREALRERGLLLQRLAPHLVR
FT                   PVPFLYPLRHRGWERLYAGAGVLLYDTMSYSGSNSRGVPAHRHLTRRGAVRACPSLRPE
FT                   SLVGALQYYDAQVDDARLVTCLVRTAAAHGAYPVSRARVVGLLRDGHRVTGARVHDLET
FT                   DQVFEIRARQVINATGVWTDDIQSLVDEPGPVQVRASKGIHLVVPRDRIHSTTGLILRT
FT                   ESSVLFVIPWGRHWLIGTTDSDWDLDKAHPAATSRDIDYLLERVNEVLATPLTRDDVEG
FT                   VYAGLRPLLSGQSDATAKLSREHTVASSMPGLVMVAGGKYTTYRVMARDAVDEAVRGLG
FT                   GGVPRSCTDQVPLHGAEGYVARWNQRRRIARQYGLTVERVEHLLRRYGAAVDEVLHLLR
FT                   EDPTLVEPLDGTDDYLRVEVVHAVSAEGALHLEDVLTRRTHVSIETFDRGLAAARPAAQ
FT                   LMAPVLGWDAERTDREVAHYVAQVDAERIAHDQIDDQAADAARLVVPDVVPQVALAA"
FT   gene            complement(572218..573735)
FT                   /locus_tag="Strop_0494"
FT   CDS_pept        complement(572218..573735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0494"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52979"
FT                   /db_xref="GOA:A4X279"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A4X279"
FT                   /protein_id="ABP52979.1"
FT                   /translation="MADFVGAVDQGTTSTRFMIFDHGGNDMGHHQLEHQQILPRPGWVE
FT                   HNPVEIWERTQTVIQTVLYEHRLTVTDLAALGITNQRETTVVWNRRTGRPYHNAIVWQD
FT                   TRTDRIASALERSGRGDVIRRKAGLPPATYFSGGKIQWILENVDGVREAAERGEAIFGN
FT                   TDTWLLWNLTGGTAGGVHVTDPTNASRTMLMNLETLDWDDELLSFFDIPRAMVPRIRPS
FT                   SDPDSYGVTAAHGPFTGSVPLTADLGDQQAATVGQVCFAAGEAKNTYGTGNFMLLNTGT
FT                   EIVRSQAGLLTTVCYQFSDQAPVYALEGSIAVTGSAVQWLRDQLKIINTAGQSEMLARQ
FT                   VDDNGGVYFVPAFSGLFAPYWRSDARGVIVGLSRFNTDAHIARATLESICYQSRDVAEA
FT                   MATDSGVPLECLKVDGGVTVNDLCMQLQADILGVPVSRPVVAETTALGAAYAAGLAVGF
FT                   WRSTDELRENWNESRRWQPTWPSEQREAEYERWKRAVQRTLDWVDVD"
FT   gene            complement(573774..574613)
FT                   /locus_tag="Strop_0495"
FT   CDS_pept        complement(573774..574613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0495"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52980"
FT                   /db_xref="GOA:A4X280"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A4X280"
FT                   /protein_id="ABP52980.1"
FT                   /translation="MTQRVRAPGLLGELAAEFAGTAILILFGVGVVAQVNAGGTGEFDS
FT                   IAWAWGLGVALGIYVAGRISGAHLNPAVTLALAVFKGFSWRKVMPYALAQTAGAFVAAL
FT                   IIRWNYSEVLQRFDPGLTSKSQGVFSTLPGAGITEWGALRDQIIGTAILLFLILAVTDA
FT                   RNSLPGANLAPLIVGLIVVAIGMAFAVNAGYAINPARDFGPRLASFLTGYETAFLDPSG
FT                   YPYFWVPIVGPLAGGVIGAGLYELFVGRFLPSDEPQPGANGSETATETAAVSERARL"
FT   gene            574702..575565
FT                   /locus_tag="Strop_0496"
FT   CDS_pept        574702..575565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0496"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52981"
FT                   /db_xref="GOA:A4X281"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X281"
FT                   /protein_id="ABP52981.1"
FT                   /translation="MNRRKHEEAGQRTPVDNAEHCCVGPERFSIRPMPGQVQSIARAAA
FT                   ILRLLASSSGRLGIGDIARSLNLPKGTAHGIIRTLQYVGFVEQDKTSGKYQLGAALLHL
FT                   GTSSLDVNELRSRSINWADPLAARSGEAVRVGTLLDGKVLVVHHVFRPDDTLQTLDVGS
FT                   LLPPHATALGKVLLAYDVGAANAVKQREPEPYTRRTLVTARALTRALSEVRDNGWGAEV
FT                   GEMTPGEAGIAAPIRGYGGLVVGAIGLSGPVDRTCDGSGNPRPALVTYVRDAARAVSRD
FT                   LGATRW"
FT   gene            575604..577127
FT                   /locus_tag="Strop_0497"
FT   CDS_pept        575604..577127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0497"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52982"
FT                   /db_xref="GOA:A4X282"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A4X282"
FT                   /protein_id="ABP52982.1"
FT                   /translation="MTERFVVAIDQGTTSTRCIVFDRRGNLVSVAQREHRQHFPRPGWV
FT                   EHDAMEIWRNVGKVVPRALTQAGITIDQIAAIGIANQRETTIVWDRRTGVPVAPALIWQ
FT                   DTRTDLVVDALTRASGAADIQELCGLPLTTYFSGPKLRWLLDHVPGLAERADRGEVLFG
FT                   TMESWLIWNLTGGPDGGLHLTDVTNASRTMLMDLRTLDWHPRLLSFFGVPAAMLPQIRS
FT                   SSEVYGTATAVLPGVRIAAALGDQQAALFGQTCFDPGDAKCTYGTGSFLLLNTGTEPVP
FT                   SRHGLLTTVGYRIGGEPALYALEGSIAITGSLVQWFRDRLELISTAPEIETLARTVGDN
FT                   GGCYIVPAFSGLFAPHWRSEARGMIVGLTSYITKGHLARAVLEATGWQTREVVDAMNAD
FT                   SGLDLTTLRVDGGMTANNLLMQFVADVLAVPVVRPMAAETVSLGAAYAAGLAVQYWPDL
FT                   EGLRSNWHPAARWVPEMDAAVRTRERENWRRAVERTFDWIRPTEDPARR"
FT   gene            577550..577855
FT                   /locus_tag="Strop_0498"
FT   CDS_pept        577550..577855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52983"
FT                   /db_xref="GOA:A4X283"
FT                   /db_xref="UniProtKB/TrEMBL:A4X283"
FT                   /protein_id="ABP52983.1"
FT                   /translation="MSDEDVEAIRRRPAYRAAMWLGRLVIMPQVVPFVVVAIDDDVTVA
FT                   DAVFSYSWLSLVVLAGGFLLLWRAGVPFTRRGWSVETAADFTLNEAMTSDFFFRRR"
FT   gene            577988..578272
FT                   /locus_tag="Strop_0499"
FT   CDS_pept        577988..578272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52984"
FT                   /db_xref="UniProtKB/TrEMBL:A4X284"
FT                   /protein_id="ABP52984.1"
FT                   /translation="MPWCSLPRSLPLMTVWNTGYRHTSGTVVRMSGGVRLTAPGLRAGK
FT                   ACCVTGFSCALDSVLGGKGGPYAQAPNQPDMAELQVLPLHVHMRMVCGW"
FT   gene            complement(578245..579243)
FT                   /locus_tag="Strop_0500"
FT   CDS_pept        complement(578245..579243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0500"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52985"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4X285"
FT                   /protein_id="ABP52985.1"
FT                   /translation="MGGANRVQYVRLGRTGLKVSRICLGMMSYGDRGKSAGWVLTEDAA
FT                   EPLVRRAVDAGVTFFDTADMYSLGTSEEVTGRLLGKIFSRRDDYVLATKVFFPMGSGPN
FT                   DGGLSRKHIHAAIDESLRRLGTDHVDLYQIHRWDDQTPIEETMEALHEVVRAGKARYIG
FT                   ASSMAAWQFAKAQHTADVSGWTRFVSMQNHYNLLYREEEREMIPLCRDQGVGVIPWSPL
FT                   ARGLVARAGATEAAATARVSSGDADRREALYGRGDERILRRVAHVANECVLPPAQIGLA
FT                   WLLSKSGVTAPIVGATKERHIDDAVAAVDVSLTENQIEYLEEPYQPQTIRM"
FT   gene            complement(579983..580789)
FT                   /locus_tag="Strop_0501"
FT   CDS_pept        complement(579983..580789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52986"
FT                   /db_xref="UniProtKB/TrEMBL:A4X286"
FT                   /protein_id="ABP52986.1"
FT                   /translation="MTDWRSLWDAVVASDVGARDGLGWEFTSRTGEPAWAVFRGDDGPF
FT                   PVFSAARGQVMPSADDLAAMTHEAVADLLAAAGLADQHGWITENISAALLLASMSVESW
FT                   EGEEWALESGPHDVATAWAEPDAALTPYAWLRAIGTNTSAEISIYQNDMLFGLCFIPTT
FT                   ELRLPEFDLGSLRSRQGIPLVRGPINQVDVVYDTIVEGGRCAGLVSEVLLHGDHASTLL
FT                   IAAEAYSRHEWHLFDESVVALTEPTTADSLAWIPERHRWRRTEGVR"
FT   gene            complement(581319..582395)
FT                   /locus_tag="Strop_0502"
FT   CDS_pept        complement(581319..582395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0502"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52987"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4X287"
FT                   /protein_id="ABP52987.1"
FT                   /translation="MPESSVLADIPAAVARAAETDGFSGVVLIRRGEDTLHSCVTGLAQ
FT                   RAWQVPHTLDTRFRVASVSKMFTAVGVLQLVERGLLDLDAPIVELLDLAETTISAQVTV
FT                   RQLLTMTGGIADWFDETGDWEATWAELLRTHPVYLLRRNADYLPLFADKPARFPPGERH
FT                   EYNGASYILLGMLIEQLTMAPFAEHLREHVFGPAAMTDTDLLPLEADAPRVADGYVPAR
FT                   DGTGAITGWTRNIYATTPEPAADGGATATAADLIAFTQALRAGALLPDQAVAEMLAPRV
FT                   AEREEKVRGYLWRYGYGVMSILDDDGTVIRWGHTGEEDGVSTRLYHYPSLNIDVAICAN
FT                   TSWSAGKLAWNIHDLLLP"
FT   gene            582508..583398
FT                   /locus_tag="Strop_0503"
FT   CDS_pept        582508..583398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0503"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52988"
FT                   /db_xref="GOA:A4X288"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X288"
FT                   /protein_id="ABP52988.1"
FT                   /translation="MAVLGPNGAGKTTLVRILSTLQPPDAGSARICGVDVVAAPAQVRR
FT                   RIGLSGQFAAVDEYLTGLENLTMVGRLYQLDCRTTRSRAESLIRRLGLDSAADHPARGY
FT                   SGGMSRRLDLACALIGRPDVLILDEPTTGVDPAGRRALWDIVRGLAEDGVTALLTTQYL
FT                   DEADRLADRIAILAGGRLVTEGTPEDLKKRLGGDRLAVTVDRRDADRAARLLAAHGLRE
FT                   PDRSPDGCRLSVPVADATVAMIGLAGDLRAHGVEPLELGTERPSLDDVFLALTAAEEGG
FT                   HRCRPCAGRSPTARS"
FT   gene            583404..583754
FT                   /pseudo
FT                   /locus_tag="Strop_0504"
FT   gene            583825..584169
FT                   /locus_tag="Strop_0505"
FT   CDS_pept        583825..584169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52989"
FT                   /db_xref="GOA:A4X289"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4X289"
FT                   /protein_id="ABP52989.1"
FT                   /translation="MTILRAHIDRFGVGADGRLFRSGRGNVVASSTYSRVWAEARRFSL
FT                   PPERVASPLAGRPYDLRHAGVSLWLNAGLPAPEVAERAGHLVDVLLKVYAKCLDGDRSR
FT                   MNERIEAALN"
FT   gene            complement(584162..584443)
FT                   /locus_tag="Strop_0506"
FT   CDS_pept        complement(584162..584443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52990"
FT                   /db_xref="UniProtKB/TrEMBL:A4X290"
FT                   /protein_id="ABP52990.1"
FT                   /translation="MTIGQPTPPSRADVEVRFTAILNGGQSRDEVDRWATRAMQTLEYA
FT                   EVDETIWWALGMLSGIDLRDGPDEPYLHDDEQVLGWLTEFRERCRAIS"
FT   gene            585090..585476
FT                   /locus_tag="Strop_0507"
FT   CDS_pept        585090..585476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52991"
FT                   /db_xref="UniProtKB/TrEMBL:A4X291"
FT                   /protein_id="ABP52991.1"
FT                   /translation="MPRPLAPHGTANRWRTGCGCDECYGAHLDDLFLWRRKKADLRFPA
FT                   PIRNEVLRLIRQGYRPVEAARRVGIHVQTVYARSRIDPAWQGRLDGALMAGRRPDVPHG
FT                   TPTGYRHFWCVCPECRAAHHKPKE"
FT   gene            complement(585555..586382)
FT                   /locus_tag="Strop_0508"
FT   CDS_pept        complement(585555..586382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52992"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4X292"
FT                   /protein_id="ABP52992.1"
FT                   /translation="MPDHQWDDLPTSVRRSIESHTGPVRAARSATTGATSEIAATLRAD
FT                   CGPVFCKAIRTTHPMSRMHRMEARVNPWLPDTAPRLRWVVEAEGWLALGFDHVEGRHPD
FT                   LSPGSDDLPAIADALTGLSHALTPCPPVRVQPATVRWQGRIAPHLVDGDTLCHTDVTPF
FT                   NFLVGRGVRLVDWSMPIRGAAWIDTALMIVRLIRAGHTPAQAESWADQIPPWKQASPEA
FT                   VEVFASSLADLWEQRRRENPVPHRRQLAEAAHAWAAHHGTQGPRPRPELTRPL"
FT   gene            complement(586463..586930)
FT                   /locus_tag="Strop_0509"
FT   CDS_pept        complement(586463..586930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52993"
FT                   /db_xref="UniProtKB/TrEMBL:A4X293"
FT                   /protein_id="ABP52993.1"
FT                   /translation="MSTTTLTRRGASLVSPELFGRLTARIAKDHPDLPAGMPARILDQA
FT                   LAFLGAAAVTTEPIGPSDLVDIGWHTFILYTRDYAEFCDRIAGRFIHHNPEDGSEWPTN
FT                   PTDAPVPLSRAVAAITTAGYQVDAALWRVNASATAADCTQCHAGCHDSPIR"
FT   gene            587003..588424
FT                   /locus_tag="Strop_0510"
FT   CDS_pept        587003..588424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0510"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52994"
FT                   /db_xref="GOA:A4X294"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X294"
FT                   /protein_id="ABP52994.1"
FT                   /translation="MNGLTVAATSVVMDGNWLPDPVQPAVQMVFGLALRQLRTEAGLSL
FT                   RALGKAAHYDYTRLSRAERGEHLVDPDVARALDRALQTGGLLGRLRSLEPPVAPARGRA
FT                   PALPRTTFGDGPGDTVKLELRTADGRTVQVSLTRREFAQLLGSGALHAVLPAGVTDLDQ
FT                   ADRLSHSLSGSRVDPEVLGYFQRLLTEHYTADKMLGPRQLLGPVMAQLDVLDTLRRTVR
FT                   LGDTQPVLQLLTQYAEFAGWLHQDGGDLRAAMHWSDRASQWAQAAGDDEMVAYMLVRKS
FT                   NIATLDNDPRAVVALAAAARQVRGDVSPKLLALASQQEARGWAQLHNVQRFRACLDRAS
FT                   DLLATHPAGLRPSSPVYLHGYDLDALEEQSASAYRSAGHTATAAAILERKIRQTPNHLA
FT                   RDQAHQRAKLANLVTAGPDPDPERAAELGIACLDAWRQTGSARIAGELHELKRTLARRW
FT                   PDLPAARPLHDALMA"
FT   gene            complement(588475..588921)
FT                   /locus_tag="Strop_0511"
FT   CDS_pept        complement(588475..588921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52995"
FT                   /db_xref="UniProtKB/TrEMBL:A4X295"
FT                   /protein_id="ABP52995.1"
FT                   /translation="MIRAHDPMRPLWRCRACGADWPCQPARLALLDEYRGRRSALLARQ
FT                   GKLLAQASDQLSRLNGTKPDLRERFVDWCWRAEHEDPTIGVFESVDLDFLFRAIEAVIR
FT                   YHWGGWTCPECTDSGCPRLDWVDASLDVLQRRSQGRPEAEGPKR"
FT   gene            589581..590393
FT                   /locus_tag="Strop_0512"
FT   CDS_pept        589581..590393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0512"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52996"
FT                   /db_xref="GOA:A4X296"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X296"
FT                   /protein_id="ABP52996.1"
FT                   /translation="MMLRALREAAELSTAQVAEHLASSQPKVSRIENAVSPVSKGDLML
FT                   MLNLYGVTDPDEQDRHWQLARAGRERGWWESYRDVLTGSLGSYIGFENEAESLKIWSWG
FT                   VFPGLLQTEAYARALFASDPVRTEPEEVDRLVAARMQRQQRIAEDGLNLWVVLDESLLH
FT                   RQVGPPGVLAKQLERIAEPPPGVTVQVLPSNVGCHPGLSGAFTIMEFAEFPTIAYRETL
FT                   TGDTPVEAVPDVGRYTLAFDHLRASALSPVESRKAAVSVTRELRKEQQ"
FT   gene            590390..590578
FT                   /locus_tag="Strop_0513"
FT   CDS_pept        590390..590578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0513"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52997"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4X297"
FT                   /protein_id="ABP52997.1"
FT                   /translation="MNLDGATWRKSTRSSGPGNGDCVEVADNLPGVVGVRDSKDPTGPA
FT                   LVFGPEAWQAFVQHARR"
FT   gene            complement(590639..591148)
FT                   /locus_tag="Strop_0514"
FT   CDS_pept        complement(590639..591148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52998"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:A4X298"
FT                   /protein_id="ABP52998.1"
FT                   /translation="MTYTRVFVEQTLPLMLDGRPGSHGRGPRPSRACRQCDPHRGRERC
FT                   THRCDLSPACISTFEGSEFGICQHVHSGRRTGGCGVCWCLGAHDRRATAASGASTIDAV
FT                   LADIGVAWERSPWLLHMHRRRMYMRYALDWPVGRIAQEEGVSASSVSRTLTAGVDAIVG
FT                   YLEDDT"
FT   gene            complement(591145..591618)
FT                   /locus_tag="Strop_0515"
FT   CDS_pept        complement(591145..591618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52999"
FT                   /db_xref="UniProtKB/TrEMBL:A4X299"
FT                   /protein_id="ABP52999.1"
FT                   /translation="MNITPRREEIAEVVAILESGAYDGPDAMAADLIRAVAGLLWFRTW
FT                   WVLGARGPRAANFGPFASEAEAVRWGKQVANMAIPAEWGVVQVHGMGRIATNAKGGREG
FT                   GGFGYCVTAGCGCPPYAHAMDKSTRGKCVICGSCDRYQQSERKPAKRAKREPA"
FT   gene            complement(591615..592094)
FT                   /locus_tag="Strop_0516"
FT   CDS_pept        complement(591615..592094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53000"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A0"
FT                   /protein_id="ABP53000.1"
FT                   /translation="MIDADWSVLELEGVMPALSRAARNVARRYPGTDLDDLLQDAALMA
FT                   ATRADLVRGWVAHGQLHHLYTDVMRDLEDDVRTQAQRGERSLDAMLEGWRSGEGGVERE
FT                   LADGDGPPPRQRIRNGEYGGKMLGLRWAAPHGAAGGLVATNSPSANPKATSERIR"
FT   gene            complement(592120..592905)
FT                   /locus_tag="Strop_0517"
FT   CDS_pept        complement(592120..592905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53001"
FT                   /db_xref="GOA:A4X2A1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A1"
FT                   /protein_id="ABP53001.1"
FT                   /translation="MDDDLSSDDRATARTLYIDIETAPSLAHVWGLWRQNIGLSQLLAS
FT                   GRVICLAWKWRGEEGVHFASEHGQGRDAMLASAHRILGEADVVVHYNGKRFDIPTLNRD
FT                   FILAGKLPPAPFRQLDLLETVKRRFRFTSNKLAHISQELGLEGKVKHEGHTLWVRCLAG
FT                   DPEAWEQMAEYNRRDVTLLEQLHDVLMPWLVRAPNPRLTDGVSDVDTCPNCGSTDLARE
FT                   GHAYTATGAYQRHRCRACGAWSRRGRRSHGIDIRPIANN"
FT   gene            complement(592886..593335)
FT                   /locus_tag="Strop_0518"
FT   CDS_pept        complement(592886..593335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53002"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A2"
FT                   /protein_id="ABP53002.1"
FT                   /translation="MSGASGDYLEAIGTAELGETTPGEEPDSGLLVRHARELVERLHTE
FT                   KAIDLLDKELDQQNITFGRRDLGMHADGRRSEYAKMADSYRGLVEHEFRMERPPTWDHI
FT                   LLMEVYKVLGKEDGSVGLGDVIQVAAVAIRIWLVQQDRAYGRRPE"
FT   gene            complement(593335..594006)
FT                   /locus_tag="Strop_0519"
FT   CDS_pept        complement(593335..594006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53003"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A3"
FT                   /protein_id="ABP53003.1"
FT                   /translation="MTERDPLRPLSVSQRETLEEATAAYQSQLTADVAGYLTARGIGQD
FT                   LADAHRLGAVVEPMPGHKRFQGMLAIPYLDKDGLPLSMRFRCIEAHEHRDYHHGKYNSM
FT                   TDESTRMFNIGAIHRDGSEIHLAEGEFDTILLDLVFSGAVGVAGARAFLPRHRRMLAGF
FT                   SRIWVWADPDDAGTELANTVTRGLRGARVVRLRGGDVTDIYMAGGAPSLHSLIDAEGGN
FT                   R"
FT   gene            complement(594832..595272)
FT                   /locus_tag="Strop_0520"
FT   CDS_pept        complement(594832..595272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0520"
FT                   /product="Recombination endonuclease VII"
FT                   /note="PFAM: Recombination endonuclease VII"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53004"
FT                   /db_xref="GOA:A4X2A4"
FT                   /db_xref="InterPro:IPR004211"
FT                   /db_xref="InterPro:IPR038563"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A4"
FT                   /protein_id="ABP53004.1"
FT                   /translation="MGDSEQHRGKPCKDCGGKKGPAYALQLRCFRCTQRRKQAARKSAH
FT                   ARRIQAAYGISGEEYDAIHEAQGGRCAICPRARGLSRRLAVDHDHELEGREGSRASVRG
FT                   LLCGRCNDMLAHVRDDVSVLVKAVEYLRDPPAQRVLREGVNR"
FT   gene            complement(595272..596084)
FT                   /locus_tag="Strop_0521"
FT   CDS_pept        complement(595272..596084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53005"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A5"
FT                   /protein_id="ABP53005.1"
FT                   /translation="MLNARRALTLNHDAGKELPRIPALDDLYGIGCRFRQGQVIMIAGR
FT                   SGTLKSMFATWLAAKWAVPALYFSADMSAYTASSRVAALVTGDLQEEIEEGMARGGGNR
FT                   QRYLDALASLPLTFAFGTPITWRHIDEEIEAHVELHDSYPSIVVFDNLMDFEAAESDYT
FT                   EQMAVMAGVTAFSRETGCTSIVLHHASDKSWDAKTAPYDPPSRQEVKGGLSEKPELSLT
FT                   VALDPSTMEYKVAVVKQRMGPSDPTARRFARLTAEPERTRFHPYRWRG"
FT   gene            complement(596148..596612)
FT                   /locus_tag="Strop_0522"
FT   CDS_pept        complement(596148..596612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53006"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A6"
FT                   /protein_id="ABP53006.1"
FT                   /translation="MAFVKPSANVSSEFLKGAEHLNDVAILFEPRSIRKGVPHRHNGVE
FT                   RIRDELKATVTFFRTMADLQDGKPSKVAKDMTITYAMVVGTLEPELPGTPSGGEDGNQV
FT                   AGVLRKIPTSSGSGYVIRDLDDDVWDLVVSYFLRREAAVAEAVAEAPDFD"
FT   gene            complement(596661..597170)
FT                   /locus_tag="Strop_0523"
FT   CDS_pept        complement(596661..597170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53007"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A7"
FT                   /protein_id="ABP53007.1"
FT                   /translation="MSDQDRGSDGPLSVTIKYGKGYEDSWISVRGSAAVVREELIRAFD
FT                   LDRDESLSLAALVLNATQQAHALHALGRGAGAQAISGERVGRSRSNPSAWQGAQTVRPA
FT                   ANPSRPPQEDGEASLRGAALSEIEGAESVEALKLWWAKNQSAFADPQVKSAYKARGKAL
FT                   QAASAK"
FT   gene            complement(597218..598189)
FT                   /locus_tag="Strop_0524"
FT   CDS_pept        complement(597218..598189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53008"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A8"
FT                   /protein_id="ABP53008.1"
FT                   /translation="MPLIKPSQAVKRQSRHRSGAQDGSKGVPRDRYDRPLIHVPDRCPA
FT                   CLDGGAASDHRLVPYTRTTTYVDCIEDQSTLARWGQRTVLLGATRAAPMVSAARELDPT
FT                   SDRRALDGIAEKLAAIGGAHEGRERGTRLHGLSEFVDRGEVMPAATEQDVADMAAYGIA
FT                   TLDLDVVHIETLVVCDELEVGGTPDRIVQYDGPGPGAGLAAMPARMRASRGLEYAPDWI
FT                   SGHLIADLKTGNVSYGALKMAMQLAVYSRSCLYDHETLIRRPLPPVNQDWGVIIHLPGA
FT                   ATATLYWINLRVGWQGAQLAKQVRELRSVGAKALVPFSSPVT"
FT   gene            complement(598639..598983)
FT                   /locus_tag="Strop_0525"
FT   CDS_pept        complement(598639..598983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53009"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A9"
FT                   /protein_id="ABP53009.1"
FT                   /translation="MRVIIFVPDSRGSARTRRVIQREVVAQGHVVVGATSAPAEAMAAW
FT                   RSQVADSIAGRPDHLIQLADDWALPITSRSRPDACADTEKSTAHGRSRAKPSRARRYRR
FT                   LPGGSALRTR"
FT   gene            complement(599029..599511)
FT                   /locus_tag="Strop_0526"
FT   CDS_pept        complement(599029..599511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53010"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B0"
FT                   /protein_id="ABP53010.1"
FT                   /translation="MPNVKVPNVDEVVRWIKDGKKLTWIVDEIQRKYGVKVGYSTVVDI
FT                   RRRNDIPALIGRHDDLIPWPLRKEHRHKMPPKMLRALGRRRNGEPLGPTVERELDRWLV
FT                   ARAETSPEAPYGTVVHYNPLTKEGWFYVARRPGIDNDLIRVPDEDASVRTRTRRDH"
FT   gene            complement(599930..600196)
FT                   /locus_tag="Strop_0527"
FT   CDS_pept        complement(599930..600196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53011"
FT                   /db_xref="InterPro:IPR020109"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B1"
FT                   /protein_id="ABP53011.1"
FT                   /translation="MELMTRAFWVYAWERAVKTTAQTALSLMSVDYVGLLEVDWAAVGS
FT                   AAGLAAVLSILTSLTGFSDSAPDAPEPAEAGDPGDTSRELPLT"
FT   gene            complement(600227..601231)
FT                   /locus_tag="Strop_0528"
FT   CDS_pept        complement(600227..601231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0528"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53012"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B2"
FT                   /protein_id="ABP53012.1"
FT                   /translation="MSPTSDALKWLWEEFRKVEGAARFGGIYANKRGYHNTRDANVARW
FT                   PGNYSYAQFSVDREGPPGLASAIDLTFADAQAGRYETIDKYSSRLLAAGHAGRAADPRT
FT                   IYMREFYGQADHDVHVEGWDYARGQAVTSDSSHLWHIHISVHRKYADDMTAMRAILSIL
FT                   KGETVEQWRKGQGGTPSPPPLPDQAAGSRMLRLTVPYARGTDVAAVQDAVGATRDGVFG
FT                   PKTRSAVIKYQRARGLTPDGIVGPKTWATLLGSLPSHPNGSRVLRLRRPTHMRGTDVEA
FT                   VQRFIGARCGAADGIFGTKTASGVRWYQRMRGLTPDGIVGPKTWAPIVRTIGR"
FT   gene            complement(601580..602926)
FT                   /locus_tag="Strop_0529"
FT   CDS_pept        complement(601580..602926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0529"
FT                   /product="Fibronectin, type III domain protein"
FT                   /note="PFAM: Fibronectin, type III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53013"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B3"
FT                   /protein_id="ABP53013.1"
FT                   /translation="MATTWGSAEGHLQAGINCWTSSPSASSTSVTVYLRAYVRVTDGWR
FT                   FADNQSYSISGTGGGSGSYYNGLDGTGATKLVFSKNFTASIGYGGGPTYSWTCNISGMY
FT                   NGGTPSHSRSLTLPARPPGVPSTPGTPAVSGVGATSATLSWATPSSNGASLDRTSGQVS
FT                   RNSTFTDIVASWDSGWATSRSVAGLPKGTTLYARVRAHNSVGWSPYSGTRTITTGTTVP
FT                   SAPGTPVLEDATATGVTVRWAAPADDGGITLTEYTVQRATDALFSADPHAAALGATTLQ
FT                   VTGLAPGTEYWWRVRAANAVGDSEWSETASVTTPAVPPGAPPEPVLTNVLATSMTVTYS
FT                   APADDGGSEIQSYEIQATDALFGASVTSPDTEPPYVVVGLSPATTYYVRVRAINAQGAG
FT                   SWSPSASVTTLSGVRVGDGASWRDAVVWVGNGASWVLASVKTGNGSQWM"
FT   gene            complement(602935..603621)
FT                   /locus_tag="Strop_0530"
FT   CDS_pept        complement(602935..603621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53014"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B4"
FT                   /protein_id="ABP53014.1"
FT                   /translation="MTITSFPFDDQDSTEAQYSQLFAELQDTGILDSIGGSGFRVTPHA
FT                   SAMSLLVAPGVAYVRGHVVVSTAQEVLPLTPSGALTRYDSAILRLDPAANAIDLTVKEG
FT                   TPGGTVPTLEQTDSEIFEEPLATAEVAQGAGVIAPNQLTDQRRYSGQRTGAWETVTRPA
FT                   SPRKYKLGFNATTGQWEFWSGAAWSALIPSQVADSLRWGGYRLTVSETTPSGSPDADRI
FT                   WIQPTT"
FT   gene            complement(603631..605100)
FT                   /locus_tag="Strop_0531"
FT   CDS_pept        complement(603631..605100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53015"
FT                   /db_xref="InterPro:IPR029432"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B5"
FT                   /protein_id="ABP53015.1"
FT                   /translation="MRRDDIIVEVRNLDLSIVGQIHPDDLDVQVTDVLSGVGTWRVRLP
FT                   AEHPMSPHLRTPGAGIVVTVAATGDVLFSGPVVKPEAAATADDPAGTLSVEGVSDDIHM
FT                   TDRLAAPDPTSPDLDVQALAHDVRTGAAETLMCAYVSANAGPSAPSTRRVDSLTVSASL
FT                   GRGPVLTKRARFHVLGALLNEIAGGTSLHWQVRQVGSGLRFGVEEGRDLTGDIRLDIHN
FT                   STLAAHRVAIGPPGATRVLVAGQGDLVDRQLVEMITEDAQAGEALWGRRIERFVDQRQT
FT                   DDPADLERAGKEVLDEEGFATIAVQIVPMEDSEGDDPGAMRFWWDWRISDRITVVVEGQ
FT                   EMTAIVTGYVLRIDEAGARVGAVLGDPAGLSPDLALARRVDGIALRVDNLERAGGILAP
FT                   LAVRFQSIGSLAPGTSVLVVTLPEGRSMGAEDYVVNGVVTEMTNGNFGTAVIRLESAVA
FT                   IDATTFRIQVTSDWSTPLPAHLSYVLTPVQG"
FT   gene            complement(605100..605963)
FT                   /locus_tag="Strop_0532"
FT   CDS_pept        complement(605100..605963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53016"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B6"
FT                   /protein_id="ABP53016.1"
FT                   /translation="MHLRFRSDTDVMRLDGISRTGYGVEALRGVTGFGLPPVSTQWRAG
FT                   AGDGAAYRGERKQPRDIDIPLHIFAPDREALEREKTRLSLVLMQGEFDLDVVEDGGAYW
FT                   TTRVVRVGGGDIAYGDGTTGDRELTTIVTLRAGYPYFTSHEERCKEVTNAGAGRGLLGA
FT                   GFSLVALKISGSQAIGDMLLVNDGDAVTWPVWRIVGPGQDLVVSDGSRAMKWLGALSAG
FT                   EELIINTRASTVRTLAGTNRYSELAPAPRFWPLPPGQTLARVSMVNTTGESAIRATWRP
FT                   RKWWVI"
FT   gene            complement(605966..609199)
FT                   /locus_tag="Strop_0533"
FT   CDS_pept        complement(605966..609199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0533"
FT                   /product="Phage-related protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53017"
FT                   /db_xref="GOA:A4X2B7"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B7"
FT                   /protein_id="ABP53017.1"
FT                   /translation="MTDQIIGRIFVKVTPDTSAFRAEAKAQLEREERRLPELTTRLAVE
FT                   LDDGEAAETAAEARAVRDSAQQAMRDLTLRVNLDDLSSVRSALARVNAELVNLDAIELP
FT                   VELDRDSLESMRDLLEQRVKDIGIDIKVNLDDEASIERAIKKVEAQLSALNEINLNVDL
FT                   NDASLSAAKAELEARLDQVRVETDIDNAASARVSAALAILTRTRDAVIRPVIDRSALAA
FT                   VRFVDVLSGFRALRESIAQARTAFLGLFTNLPQISTMALAVTALSGALVSAAGNAIGLA
FT                   GSLAQLLPIALALPGIAIGLAAMAVAFADFGNQLPAVAERFGQLQGIISDGFWEIARGP
FT                   INNLLTAALPLLEAGLGKVSGSIGGFFAAFAGSLGAEGGFLSELPQMFDRLNESINIFT
FT                   GYTPALAAIMTIFGQIGSSILPPLADLIGRTADEFAAFLTAQTAGDGLTSIVESSIEAL
FT                   SGLIETLKGAFQVFTALWRAADAAGTATLSSLGSGLQEFAKTLEGPEIQGALTSLFSAV
FT                   QEMFDSFVNEAGPAFSQVFIGLVSVLRDVLPLVGSAWGQMAAVLGEIFSTPAFQEGLTS
FT                   FFVGVNAAVTALLPALTPIADLVGSLGPVLGQLAAQIGEVFGSLTPTLDGLVAALLPVI
FT                   EMLGDGLVQVVRAISPALSEIATVASATLSGLTPLLQPIIDALVQIVQAVLPALMPVIS
FT                   ALQPLLLSIAELALPVISTLLAALAPILADAVAALQPVIDIIVELLDLLVPLLIPALDM
FT                   MTRALAQNLGVVVEGAAQAIAGLVDVIRGVIDFLVGVFTGDWERAWSGVQSIFSGIIDA
FT                   VIGILKIIFGPFGTMAGIFSDGLSRVSDLWSSVWSSVGAVAVAAWNGIVNHIQDRINFM
FT                   VGIFRGIWGAVSGAITSLWNEIRRQFERGIQTAVDAVDTGVDDTLSFFRNLPDQIRSAL
FT                   GNLGKLLVDAGKALLRGLIDGIQSMFGEVRGNLNSLTDLMPDWKGPPSTDRTLLYGAGR
FT                   LIIDGFIEGLESRYDMVRRSLGELTKDVASTEFGVPTASLGINSDAYGSDVGRATDSKT
FT                   INYHAAPGSSMDSEEDLFAALGRARAWGW"
FT   gene            complement(609256..609573)
FT                   /pseudo
FT                   /locus_tag="Strop_0534"
FT   gene            complement(609573..609983)
FT                   /locus_tag="Strop_0535"
FT   CDS_pept        complement(609573..609983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53018"
FT                   /db_xref="InterPro:IPR020132"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B8"
FT                   /protein_id="ABP53018.1"
FT                   /translation="MGRGRRRLNKLSGLCLETESRLLVSDQNDLTLDDIRAAVERKYAA
FT                   LPVKLGDGTKVMLLNPLRLDKAKRAHLEQTQRAMNDQGADQVDCLKDIIRTVAERRSAA
FT                   DKLLREIGDDTAMLAELFSAYGERCRPGEASA"
FT   gene            complement(609959..610696)
FT                   /locus_tag="Strop_0536"
FT   CDS_pept        complement(609959..610696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53019"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2B9"
FT                   /protein_id="ABP53019.1"
FT                   /translation="MLNDNATLVVGAGNFFRAPTGTIAPSDLFSIDSMWENVGHTSLED
FT                   IFGITSEGGEATTLGTLQAQTLRTTYAPRTESFAFTLQQFDRAGLRLYYGSNAPLLADG
FT                   SLGVPMSPVPTECAFLVVFYDGTNAFAFYAPKAEIFRADDLSVSDAESLAGLPLSVKPL
FT                   VFGSNAYAYTVTPIGGIEAEGASAGTPGAFSPDGADTPYNLTALAGVTASPATAWTTGQ
FT                   YVDLEDGTTAYWDSSVWVAGVAA"
FT   gene            complement(610719..611204)
FT                   /locus_tag="Strop_0537"
FT   CDS_pept        complement(610719..611204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53020"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C0"
FT                   /protein_id="ABP53020.1"
FT                   /translation="MAGLPPSVIAAQEFSPIEDLLLAALAYYLPDVKAGTLIMMAQTFP
FT                   FIHLRRLDSYGVWAGDERFIDDAHMAIYAYAEDPDGDEDAGRLAEAVRASLMRARRARF
FT                   GVPELGHFVGLTMTASPRRVPDWATATGPVQYADLPAGVWRYETRFDVTVRRPRQQP"
FT   gene            complement(611185..611661)
FT                   /locus_tag="Strop_0538"
FT   CDS_pept        complement(611185..611661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53021"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C1"
FT                   /protein_id="ABP53021.1"
FT                   /translation="MAQVFRRVAGRKIEGAIADLDGVQLYLSGETFAIYGRAQANLQAA
FT                   RDAGAVSPDRGVGGGAEVTWGQERDREYGHLDWYVGLDDRNSDFGALSIEFGRADHLID
FT                   DSGRTFGGHEGLYILTRAANLGIKRGRRVKTRLRRIRVRKGRVMGVPNGGGPSS"
FT   gene            complement(611661..612029)
FT                   /locus_tag="Strop_0539"
FT   CDS_pept        complement(611661..612029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53022"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C2"
FT                   /protein_id="ABP53022.1"
FT                   /translation="MLRPMPSMQRRRGQSATVYPYREVTDRRGHRVRVVDEDNPVVVVA
FT                   AFIPDRSSRAELPGQQQIHVVKMIVRDDVAGCELWAQVEWRGSRWDVVTPPAYHHGTRH
FT                   TRHVTVSLRRRPLTPTEV"
FT   gene            complement(612023..612583)
FT                   /locus_tag="Strop_0540"
FT   CDS_pept        complement(612023..612583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53023"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C3"
FT                   /protein_id="ABP53023.1"
FT                   /translation="MSEPFAQVEDVQGRIDFTMSAAEERVAGAALDDMSEEARYHAGQA
FT                   WPVPEEAPRMVRRLVLVAVARYMKNLDGLTQSRAGDETVAFTDLGDKAGAPFFSDAEIE
FT                   TLRRLGGAAQGGFVSAEVTAYRTDLRRYKHHQCTLVNTDGDPFPLNEECWGFGCDCSTW
FT                   HPSGGCRSGYGYGYSTWHPRRGC"
FT   gene            complement(612601..613683)
FT                   /locus_tag="Strop_0541"
FT   CDS_pept        complement(612601..613683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53024"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C4"
FT                   /protein_id="ABP53024.1"
FT                   /translation="MALNAIVKPQKLAALAAEVIEQSLVLPGLFQRSGFEQFRGAENDT
FT                   VHVRVPGILPAHEIANFRAERTSSIQFDAFTERKISLTFSGNTYSATKLQDEQRDWDSI
FT                   EWARVIRSQAEAVARALEDKAVALVTGQSYLATIGGTGVPQRTIRQSLIKLRAAANRLR
FT                   MPTGQRNFVIGSAVEEAILADDHLVLADAVGQDIASASVREATIGRLYGMNIVVSQEIP
FT                   ADQGYLFVPSAFVMSTAAPSVPQSGIGGSAAARSVAARWVLDYDPTVLAERSVINTYNG
FT                   VRSVKDVVLNAGRSDVIREGDTVGEFLVRAIAYDLDATADVLPDADNNADPSGVGGTPA
FT                   AGSLLDQLVAATGVGTPFTP"
FT   gene            complement(613745..614242)
FT                   /locus_tag="Strop_0542"
FT   CDS_pept        complement(613745..614242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53025"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C5"
FT                   /protein_id="ABP53025.1"
FT                   /translation="MPEDGPDTNGDTTPEGQALPVTSTDSLPDWAKKELADTRAEAANY
FT                   RTRLREAEASLKEAKTPEEVEAAVKELREGNAKLERDLALANASRGLTDDQAAILAAMT
FT                   WETPGDLTGHVEAIRKLTPPDDRGDTLPLSGTLRGGLTPGDEPGDDFDPAEVARKMRQG
FT                   LL"
FT   gene            complement(614246..615343)
FT                   /locus_tag="Strop_0543"
FT   CDS_pept        complement(614246..615343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53026"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C6"
FT                   /protein_id="ABP53026.1"
FT                   /translation="MVVALTQAQRTAEADAITTAFVLALNQIGAGAIRNALATWHGEVP
FT                   ASGAPGAQARWLGRAARQVMQQRAQAAALAIAYYRLVRALRTGETVGPEGGTTTLAQLR
FT                   ADINALTLGIPHSARQRAGLTAAVAGGGTPSAGERPSRRVRRRWTDVQWDPEVRGGATT
FT                   VRVVRLPGWRAADARLERAAEAEIRAALANLGLGTMRRKVRDLQPDIPASQADEARREA
FT                   HRLAGIRQAASSERVAMGGARSKVWDLAQRDRRVLGYIRVSLTGTPCDWCAMLISRGPV
FT                   YRSAEKRRFDEGDLYHDNCKCSVEPVFSREQYESDLYALNREYAELWPRVTRGLRGEAA
FT                   RQAWRRYHYTIRKAAREAAQSAQEA"
FT   gene            complement(615351..616004)
FT                   /locus_tag="Strop_0544"
FT   CDS_pept        complement(615351..616004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53027"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C7"
FT                   /protein_id="ABP53027.1"
FT                   /translation="MGNHYVLVLARYSASDPYTTVTDDGGNTWTRRDFAPKSGSAGRRI
FT                   ELWTCSPTAPFTGVSAAFTGSGSALGALVRVPGASGVVDVVLADHRSSSATPASVDITP
FT                   TEADTLVLAAVQANPNLASTITPGSGWISLVTDVNGPSLVFQIGPPAGVPIGVDWNFGS
FT                   AAGSGHVIIALQQGAAPPTGPACTVWVGGAEATASVEGVWDGQQVVSITSLEVT"
FT   gene            complement(616082..617215)
FT                   /locus_tag="Strop_0545"
FT   CDS_pept        complement(616082..617215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53028"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C8"
FT                   /protein_id="ABP53028.1"
FT                   /translation="MTTVHITLSETNPTAEYVALQRYSGAMLFGTRLRVYLDGAAEATV
FT                   DLESTVGRAWRWRAQEIGYHDMVTRTVAVPESETPVEYADLVDVDPETMQPDDEPEAAW
FT                   WQALSETAAGVVPDGSVGLVKLAPDVLAALDEVGQPGPQGDQGLSAYEVAVAGGYSGTE
FT                   ADWLLGLVGPAGLPGATGDPGPGVTAGGTVGQVLAKGSATDHDTEWIDPVPSAHASSHA
FT                   PGGADDLSATYSAVDTVHDSAPPRDYLRRIRLDYPISVGNPDIERIYVGTGAGELSAWR
FT                   NEWGGLRGTPHVAYKADALVRGIPRTDLGASADGGWLELEDASRTTQLYKRDWWGRLWR
FT                   SDGAAAAIQMADVLVLGPGDPVPSGTPAGTVIVRTEA"
FT   gene            complement(617219..618766)
FT                   /locus_tag="Strop_0546"
FT   CDS_pept        complement(617219..618766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53029"
FT                   /db_xref="InterPro:IPR021145"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2C9"
FT                   /protein_id="ABP53029.1"
FT                   /translation="MTTAPRALAAELLAILERDLPTLRRVDDYLNGRHDDPYMPARADA
FT                   EYRLLARRAITNMSLILVGTPAQALYVDNYRRGGTDRVADDTVLPEWLHWQESRLDARQ
FT                   TAVHRAALAYGHSFVLTERQAGRVRSKGLSPLRTVAVYDDPANDDAPVAAITVTQWPKP
FT                   GDKGSRGSARMWDGRREYTITFRSLTDATSVGITGKRVHGSSECPVTRFASCVDLEGRT
FT                   LGVIEPMIALQNRINQTVFDLLVAQTYGSFTVRTATGMAPPLKTRPVHQRGQEPYTYPD
FT                   EPAVAGVDSLGRAVDRDGWVLDDNGQRVILDTAPVVDPVTGQHVYEQVDISARRFLFAK
FT                   DPQSKWGSLDATPLGGFIDSLDMSFRQFSALAQVPPHHLLGQIANLSAEALQAAETALA
FT                   RKVEEFRKLFGESWERVFRLAAELSGDLSLAQNYLGEVIWRDMEMKSLGAVADGLGKMA
FT                   EQLGIPRRGLWPRVPNVTRQELEDWARILKEDSPEDRMADALIRATPGGDAPAPGEE"
FT   gene            complement(618800..620524)
FT                   /locus_tag="Strop_0547"
FT   CDS_pept        complement(618800..620524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0547"
FT                   /product="Phage terminase protein large subunit-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53030"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D0"
FT                   /protein_id="ABP53030.1"
FT                   /translation="MVRSAMTREEIDALQPTYHGMTWRHNGPLCHAAGLTKCGFGCDDW
FT                   LLPERTLGWDVIRWVGEYLLDEEGQRFRLTAEQRRFLLWWFAIDDAGRFAHRTGVLQRL
FT                   KGWGKDPVGAILCLVEFVGPARFARWATGEDAKRNPRLRPGRDAIGRQMPAAWVQIAAV
FT                   SREQTKNTMTLLPVMMSRRLIQDYGVKPGNELIRADRGRRRIEAVTSNPRTLEGGRSTF
FT                   VLLNETHHWIKGNNGHAMYETIDGNTTKKDSRYLAITNAYLSGEDSVAERMRLAYEDIC
FT                   DGLAPDVGLYYDSVEADAQTPLTIDGLEVTLPKIRGDAVWLRVDTIIKSIQNKTLSPSR
FT                   SRRMWLNQIDAVEDAVYRIEDLKAIERADAELKVGDEVVLGFDGGKTDDSTALVAIRLS
FT                   DACAFLLAVWERPARWPEDEPWMVPHERVDSEVHDTFRLYKVKAFYADVSYWESYISLW
FT                   NKAYGQGLTRKASPDSPIGWDMRSQKRATLAHERLMDAIARQNIHFDGDATLRRHAGNA
FT                   RRRTNSHGVSFGKEGAKSQRKVDAYAAWLLAHEAMCDLRNMTTKQEERSRSTEMWAY"
FT   gene            complement(620586..621017)
FT                   /locus_tag="Strop_0548"
FT   CDS_pept        complement(620586..621017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53031"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D1"
FT                   /protein_id="ABP53031.1"
FT                   /translation="MGSRGPVPNRSEDLSRDRDANRGGRPDITKGKARPVVWPQPDEGW
FT                   HDIARMLWDACQLSGQADFYQQSDIALLYSLCDDLSHYKDGRKRSGQMLQTIMSSFERL
FT                   LVAEGDRRRVRVELEVESAEDDGIAHYMEDDGPGLRLVS"
FT   gene            complement(621048..621323)
FT                   /locus_tag="Strop_0549"
FT   CDS_pept        complement(621048..621323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53032"
FT                   /db_xref="GOA:A4X2D2"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D2"
FT                   /protein_id="ABP53032.1"
FT                   /translation="MPLRPVAGLAEYKSRWRWAWAIWLAVVAASFAVMEGLALVRRRPG
FT                   DTLSEATRHWIKAKKGRGLSRGEWGLIAALGAFLIWFLPHITLEIW"
FT   gene            complement(621614..621925)
FT                   /pseudo
FT                   /locus_tag="Strop_0550"
FT   gene            624001..624342
FT                   /locus_tag="Strop_0551"
FT   CDS_pept        624001..624342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53033"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D3"
FT                   /protein_id="ABP53033.1"
FT                   /translation="MFGMWWGGPGYSHGDFPDSLESWPTITAAGYSLRERFEMGRDWRY
FT                   TPQKVALGDDGIAIPTVTESFDMPCVTFECYLDVYPAERVGRIGWRVGNEPAIRLRLGP
FT                   RLGIRRENF"
FT   gene            624413..624658
FT                   /locus_tag="Strop_0552"
FT   CDS_pept        624413..624658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53034"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D4"
FT                   /protein_id="ABP53034.1"
FT                   /translation="MPREVKHPKFGYTSTVYTLDDLIERLKGLRGEHGGSLAVACEKDS
FT                   SDSVHLLDSLGRYYDAEQAWDDDAHLGAAIVLSIND"
FT   gene            624738..625118
FT                   /locus_tag="Strop_0553"
FT   CDS_pept        624738..625118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53035"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D5"
FT                   /protein_id="ABP53035.1"
FT                   /translation="MIEIEQARELLAKAVETQGWDFVYNPGGNGPCKYEPISVHEAGGN
FT                   PDDPRTKTGCLIGVVLGMVDENRHRGLSNTIDALGEGALRGLMSHETTRYFRVAQHAQD
FT                   AGRTWGAAYDAAEAHYRAHYAR"
FT   gene            625197..625757
FT                   /locus_tag="Strop_0554"
FT   CDS_pept        625197..625757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53036"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D6"
FT                   /protein_id="ABP53036.1"
FT                   /translation="MEAKTDYTSAYEVREGRVHVTIRAAEERTHSLGLWGDRVTELWPR
FT                   VELHTDHEPSAREPYGFVKIRGRDYRLHTLVQQVPEGQRWNDRLGSEVVWRHESHPYRG
FT                   GYVNGNLLPVGFDSKARERLCEIEIEVLTLFEAFCPDWQRISARLGLEAQRSSQEHKTR
FT                   LAHKEMAQAEEKIAEINKRIAEL"
FT   gene            625861..626532
FT                   /locus_tag="Strop_0555"
FT   CDS_pept        625861..626532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53037"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D7"
FT                   /protein_id="ABP53037.1"
FT                   /translation="MPRRIRMANPMQARSQGQTLNELVNSTMAELGGVFECMGWAEDEI
FT                   ASAIRRHPGQRDALFHAFSLIKPRDELGIGMGTEFVVRSHMAELLERVAVGGDTRPATA
FT                   AEMCLMVGEVSQRVPLNSAAAGLYFRLWFSAFPSHPLATEHLPDQVHYERLHQTQIDDL
FT                   ESDLAARGGDQYRQLKSVDCRGWHHGERVNCRYASRAHGGHEARGSGRPGRKRIASMRN
FT                   R"
FT   gene            627903..628235
FT                   /locus_tag="Strop_0556"
FT   CDS_pept        627903..628235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53038"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D8"
FT                   /protein_id="ABP53038.1"
FT                   /translation="MSESHGREFSDEQWAVLEQIVEGLSLSDAEKRLLAGHADPDAACV
FT                   LNAVGKMLMFGVDPVELCFVVGVSVARTNPAQVRGLVGRVVNGVARGLINDLVGGLDFP
FT                   DSEGNR"
FT   gene            628504..629220
FT                   /locus_tag="Strop_0557"
FT   CDS_pept        628504..629220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0557"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53039"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2D9"
FT                   /protein_id="ABP53039.1"
FT                   /translation="MVCEVKGCGRGVAARGWCALHWRRWRVHGDPLTVLPRSGGRRPKP
FT                   PKPCSIEGCEGPCHARGWCMTHYQRWLRTGDTRDSRAGRSLCGLPGCGRQHYGRGWCKR
FT                   HHRRWEVSGDPLGADRPANHACPETLALWHCTTPLVRADIRACMTAWSLGRWGDVTLYA
FT                   RRARGHGRSLSRLEREVVDGMLADCRKNWVESAPLVAELAESGLSVSEISAQLGVSERT
FT                   VYRKRAQHRSLKEGRT"
FT   gene            629526..629711
FT                   /locus_tag="Strop_0558"
FT   CDS_pept        629526..629711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53040"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E0"
FT                   /protein_id="ABP53040.1"
FT                   /translation="MENELLTVPEVLSTLKETSRRTFYRWRELGIAPECIKLPNGQLRV
FT                   ERRDLEAWIEQHREAA"
FT   gene            629708..631102
FT                   /locus_tag="Strop_0559"
FT   CDS_pept        629708..631102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0559"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53041"
FT                   /db_xref="GOA:A4X2E1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E1"
FT                   /protein_id="ABP53041.1"
FT                   /translation="MKSRSVRIWEIRINKGAGKKKTYTVRWIVGGRVSSRNFASRALAD
FT                   NYRSDLMQAANRGEAFDAATGLPDSMTEPKNAMSWLEFVASYVDVKWPGAAAKSRESMI
FT                   DALATVTPALVRDQPGRPGPVELRRVLRDHLLPPAVRESEVPADLAPALRWLRRASLPL
FT                   AEVGETVAVRGALEALAVRLDGRAAAATTVRRKRSVFYNALQYAVELDALPFNPVDKIR
FT                   VRGQRAKIAKSIDRRVVINGRQARELLTAVSYVGERGRDGRRGERLVAFFGCLYFAALR
FT                   PSEALALREQDCDLPETGWGRLTLEKSRPAAGKRYTDSGEVHDRRGLKHRAVAEARTVP
FT                   IPPVLVKALRVHLDRFGAAKDGRLFRSERGNVVSSTTYSRVWKAARELALTPAQVASPM
FT                   AGRPYDLRHAAVSLWLNKGVPAPDVADRAGHSVDVLLKVYAKCIDGQEATVNQRIEEAL
FT                   DDDSHG"
FT   gene            complement(631297..631372)
FT                   /locus_tag="Strop_R0011"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(631297..631372)
FT                   /locus_tag="Strop_R0011"
FT                   /product="tRNA-Arg"
FT   gene            631876..632352
FT                   /locus_tag="Strop_0560"
FT   CDS_pept        631876..632352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53042"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E2"
FT                   /protein_id="ABP53042.1"
FT                   /translation="MVPMKLAEALALRSDAARRAERLRARITASARYQEGETPAEDASA
FT                   LLAEAGEALGELESLIRRINRTNAVTVVREGGTLTDALARRDVLRLRHSVVTSAADAAA
FT                   GEGQRGYRQLRSELTMVPALSVSELRGQADDLARQLREVDTLIQRTNWEVDLLD"
FT   gene            complement(632723..633175)
FT                   /locus_tag="Strop_0561"
FT   CDS_pept        complement(632723..633175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53043"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E3"
FT                   /protein_id="ABP53043.1"
FT                   /translation="MGIEYRLTLAGDIPLEDLASLVAPHGVEESTLPGYPRLLTADLGE
FT                   ELGYTVTVSAGSSGYFDAEDDDGTQWEWEPDTYTNIIFDLRTNNPPEDVVPTMVSAVAR
FT                   VLTNRPEDAAFVLNGNWLLLTRVTGQLREHRPTWWDNYDVKGVLLR"
FT   gene            complement(633191..633592)
FT                   /locus_tag="Strop_0562"
FT   CDS_pept        complement(633191..633592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53044"
FT                   /db_xref="GOA:A4X2E4"
FT                   /db_xref="InterPro:IPR033806"
FT                   /db_xref="InterPro:IPR040559"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E4"
FT                   /protein_id="ABP53044.1"
FT                   /translation="MVQRSLELENECADTLAHDGYRVHQNPTRQEIADARENTSDRGKP
FT                   DKDPDYLIEGHVFDCYSPTAGKAVRGVWTEVSQKVARQQTQRVVLNLCDWRGDIAGLQK
FT                   QFNDWPVPHLKELAAVTRNGAIIQIVRRN"
FT   gene            complement(633793..634263)
FT                   /locus_tag="Strop_0563"
FT   CDS_pept        complement(633793..634263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53045"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E5"
FT                   /protein_id="ABP53045.1"
FT                   /translation="MQLTVGSFLVVCNVGAGAEVTVLRRGTAGFEVLSTLADPAAGGTA
FT                   IDDAITAALTAHNGSHDGDSARWVLAASVRAAKHAPADRAAVTMTLPDNSATVLTVGLL
FT                   DQTARPVLRRVVHLMSEAIAAAEISVHDLTGTTRQAIEAAVAEARRLGSSGN"
FT   gene            complement(634269..634688)
FT                   /pseudo
FT                   /locus_tag="Strop_0564"
FT   gene            complement(634929..635897)
FT                   /locus_tag="Strop_0565"
FT   CDS_pept        complement(634929..635897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53046"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E6"
FT                   /protein_id="ABP53046.1"
FT                   /translation="MAEGSPKAWLMLAVGTDRQHGGNDGYDDDPDAHYSWDHTVANARA
FT                   VAVGDRIVLWDKKAVIGASVIQGIETGWAEKILYRCRHCGGANIKRRRQEAPRFRCTPC
FT                   DRTFEEALTRVERVETFRSRHDANWLDLGRCLDGDTLRALCVSPRSQHSMRPLRWDAFG
FT                   KALDQAGRARDTARLSEATAWAQSLPGGHRQARVRVRVGQSGFRRRLLAALGPVCAFTG
FT                   SSPAAALEAAHLYSYATLGQHHDDGGLLLRRDLHRLFDRGDIAVDPATLTISLRSDLLT
FT                   YPSYAPLQGKPLATKLESGHRSWIQKHWEQHRLTPLTAGIP"
FT   gene            636301..636834
FT                   /locus_tag="Strop_0566"
FT   CDS_pept        636301..636834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0566"
FT                   /product="DNA mismatch endonuclease vsr"
FT                   /note="PFAM: DNA mismatch endonuclease vsr"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53047"
FT                   /db_xref="GOA:A4X2E7"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E7"
FT                   /protein_id="ABP53047.1"
FT                   /translation="MTNHGDEGSRPPGRAEARSWVATTEGSHLRGRRTRDTAPEVALRR
FT                   AVHALGLRYRLGRTLFNRCRPDLAFPGPRVAVFVDGCFWHGCPQHGPSRFRGPNADRWA
FT                   AKIETNRQRDQRVDKELVEAGWRVVRVWECEVRQEVGGAARRVAGVVRDSSRPNPLPAG
FT                   PTARRPPGRHAAPD"
FT   gene            637247..638563
FT                   /locus_tag="Strop_0567"
FT   CDS_pept        637247..638563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53048"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E8"
FT                   /protein_id="ABP53048.1"
FT                   /translation="MSARNLYSVAPSAARLTDSLRDIGYDFPTAVADVVDNSVAAGANR
FT                   VEIDIVFDGFDSWVMIADDGEGMSANGLLEALRYGSRRDYGRGDLGRYGLGLKTASLSQ
FT                   CRSLTVVSRRRAATARTVSRMIDLDLIAEVDDWVVAEPANDERVVKARETVADTGGTVV
FT                   LWRGLDRVLPERKPEGGWARRRLEALAGRTADHLGTVFHRFLEGEVGDGLVITVNGEKV
FT                   QPWNPFAPDEPSREVLPPLRFEVTVGEATGTVSLQRYVLPSRDQFSSQAEFERLSGPLN
FT                   WNRQQGLYVYRAQRLVQWGGWNGMRGIDEHTKLARAALDFDTDLDVVFNINVAKIRVAM
FT                   PPQLRQLLERPVHELCMRADDAYRKNSRGASEGAEVASEQLAALSRSEASGATPPMPVV
FT                   GLALRAAAMRAGEYAALQRIGERLRAEAPDVAAALGFRD"
FT   gene            complement(638553..640511)
FT                   /locus_tag="Strop_0568"
FT   CDS_pept        complement(638553..640511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0568"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53049"
FT                   /db_xref="GOA:A4X2E9"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2E9"
FT                   /protein_id="ABP53049.1"
FT                   /translation="MTENTVERRRAGYGVKLVRGPFVRLAPHPEACENDDEFLRFAKAC
FT                   RERGERLAADLFSGAGGLSLGLTEAGFRVVLAADRDPESVETHRHHYPGLTLDYDLGES
FT                   ANIRRIAALVKEAGIELLTGGPPCQPFSRAGRSLIRHQVRHGLRPAHDERRDLWHSFLE
FT                   VIQLATPAAVIMENVPDMALDREMFILRTMVHELESIGYAVEEQVVDTLRYGVPQFRQR
FT                   LILVALRDGVAFDWPPEVPDRVSVWNAIGDLPEVEGGWRPEGGADGWSDYTGPASAFQR
FT                   QMRQGVAPVDTGKVFDHITRPVREDDQRAFDMMDAGTRYSELPEDVKRYRDDIFDDKYK
FT                   RLSEDTYSRTITAHIAKDGYWYIHPRQDRTLTVREAARLQTFPDWFRFAGPPSAAFRQI
FT                   GNAVPPALGTQLGRAVMAALDALRPTPYRSRDIAHALATWFDDLSEPALPWLRARTRWQ
FT                   VISAEMLLDRTAPEQVRILWSLLERWEQPQDTVDAGDELVEIGRWINREHRAERLLELA
FT                   RTLTSQPDLLDDYKIHSLRGVDASVIDLAVLAIPTRDEDNAEEPVLITKGTHRVAARFT
FT                   GEHVERSHRMTAGRLAVARMIGDDADARRAHLGLIELATSVCRPTDPACPRCPLNRACS
FT                   EAAKRGSRIERQPVVSP"
FT   gene            complement(640759..640941)
FT                   /locus_tag="Strop_0569"
FT   CDS_pept        complement(640759..640941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53050"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F0"
FT                   /protein_id="ABP53050.1"
FT                   /translation="MNGELATAEPEKLRYRLLHVAARITRTARRTRVAITASWPWADAL
FT                   TSAFTKLTALPRPTG"
FT   gene            complement(640970..642127)
FT                   /locus_tag="Strop_0570"
FT   CDS_pept        complement(640970..642127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53051"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F1"
FT                   /protein_id="ABP53051.1"
FT                   /translation="MVTGGGRGVVSHAGARLLADLADATGLASAFSQALAGLRQRQSGH
FT                   DPGRIAVDVAVMLADGGEAIADLAVLRNEAALFGPVASDPTAWRLLSQLDESALAELRS
FT                   ARAHAREVAWAQHAEVHGDLPRPTVAGRPVDGLVLDIDATIVICHSEKESATRTWKKTF
FT                   GFHPLLCFLDNTGEALAGLLREGRAGSNTTADHISVLDQALTQIPDAVRHGTPILLRSD
FT                   SAGSSHGFLAHIQALREQHLDIRFSVGAAITEPVRAAIRAATGWVPAVDTNGDLREHAE
FT                   VCEITGLFDAAGWPEGTRFLVRRERPHPGAQLSLFDTLEGWRHQIVATDTPAGSGSVQF
FT                   LEARHRAHARVEDRIRCGKNTGFGRFPSHVFAINQAWLQLALTGN"
FT   gene            642553..644538
FT                   /locus_tag="Strop_0571"
FT   CDS_pept        642553..644538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53052"
FT                   /db_xref="InterPro:IPR018891"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F2"
FT                   /protein_id="ABP53052.1"
FT                   /translation="MAEPDVSAYAHGLIEDVRAQAEIEGCDLHEAFTQLMLDQLAADGH
FT                   TEDAVAVHFKDHGVEVSGYGAATDDRSLDLFLTYYSPRADDDHKIGRADVEAAFRRLEN
FT                   FLSHCLRGTLARRDPSSEVVAMRDAVTDKFGRVESIRLVLVTNARSVARDAVAPMSFEG
FT                   RHVTRELWDLRRLANWSASGNKAEPIVAEFPAGLPCLATPRTDEDYSVLLAIVPARGLA
FT                   DLYSTHGARLLELNVRSFLQVRGAVNRGILDTLRGNPERFLAYNNGIAATASRVDFENT
FT                   PSGQRVIRRIHGLQIVNGGQTTATIHHAYRYKVDVDAAHVQMKLTVVSPDRLDDIVPQI
FT                   SAYSNTQNRVTASDLKANSAFHVDVERIMRTLWAPPSASHPHDTHWFYERARGQYANAL
FT                   TREGTPARQKVFKAANPPAQKFTKSDLAKFEHSWARQPHLVSLGAEKNFTLFSQRLDEH
FT                   PPAVDKQYCRHLVAKAILFRKVDKLVARQNFGGYKANIVTYTVAKLVQATRGRVDLDHI
FT                   WRTQDLTSALQDAVTDLSMLVHKVITSPPEGRTNVGEWTKRPECWSAVQDLDWTPPPAL
FT                   EAELVDLDTYSTNMDLIRGTAATDWTDLAAWGAETGYLDAEHRRSSAEIAQALDQGWDP
FT                   AGKYIRGALEAMRQGRRNGFRRVNGF"
FT   gene            644580..646094
FT                   /locus_tag="Strop_0572"
FT   CDS_pept        644580..646094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53053"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F3"
FT                   /protein_id="ABP53053.1"
FT                   /translation="MSVWFQEVPTEGSVELPPDPRALDALGRNHSLETALADLVDNSLD
FT                   AGATEILIRFVQWGTRLVGLYVVDNGRGIAPESIDDAMTVGGQRQYTGNDLGHFGLGLK
FT                   AASFSQAASLTVLSRAAGRKPVGRRWQLDLVRHSFDCDIVPDSFVAAELNRDWQLPNGS
FT                   SGTVVRWDSVSGFPSSDDPEQVDEFLSRTVSHLQGHLGLTFHRILSDRGVRIVIDVEDA
FT                   DLGPGVRHPVTPIDPFAYPDTLAGWPKQLRAPIDGAKVVLDCHIWPRRSNAPEYRLPGG
FT                   AETRQGLYFYRRGRLLHAGGWEGIHAPDTRLQLARVRIDIDGDTAGLFVMNPEKSRVSA
FT                   GPRFAPAVAAAHADDGTTITDYLQAAEAAWAAANRRRTARRSAALPPGKGFHPKVAREI
FT                   RDELPLLHEDPVNIQWKRFTTDAFLEFDRDTRTLWLNRAYRQALLGGRRGGGNDLPVLK
FT                   ALLFLLAGNVFEGAHFGARDKDNIELWQEVLTVAAKAERSTFEARQ"
FT   gene            646091..647080
FT                   /locus_tag="Strop_0573"
FT   CDS_pept        646091..647080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53054"
FT                   /db_xref="InterPro:IPR025534"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F4"
FT                   /protein_id="ABP53054.1"
FT                   /translation="MTTAADRHLSTDSFSTYLHTRAPIDHPIPGSPRVVLFVDPHTSRV
FT                   GLRGPATPHEIPPAGLEHLTAQAVHHGGQRMIEIAVTDPRLFVDAYPLLCAVADRVQLD
FT                   QQTLTAALAETLRRLGHLLQTEDVLPQENETGLVGELLVLAGLVYAVGPDTALTAWRGG
FT                   RAEEHDFGLDEHDVEVKTTMSERRSHWVSSLTQMVATGDRPLWLVSLQITTAGSGGRSL
FT                   PELITAVRALLPTTMQHHEFDGLLCASGWRDRYTATCQRRWRLRTPPRVFAVTEAFPRL
FT                   TPRLLAHAGVEVTHVTDVRYRLDLTDLTGDETPQILNDALTRGQRELP"
FT   gene            647077..649980
FT                   /locus_tag="Strop_0574"
FT   CDS_pept        647077..649980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53055"
FT                   /db_xref="InterPro:IPR018310"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F5"
FT                   /protein_id="ABP53055.1"
FT                   /translation="MSDTVTTAYSAALDAMQRTGPKRLHALAAMLGADTPDIADGSALL
FT                   AHLRDAGPEDALRQQIAHTLAGWDHEQSSAPWTEGTINNTAERRAAVIAALAVEDPTAD
FT                   LIADLFPYAVADGVIVIADDWEEWRTPQRRAERTFYWAHYHRYLLDKWRNPDAVADLDR
FT                   ATEEVVRRLSDPTRPVAYQAKGLVVGYVQSGKTANFTGVVAKAVDAGYRLVIVLTGTTN
FT                   MLRAQTQRRLDIELCGRENIEREISPHDQKAHEYQNDPDWKGDRFVRHGGRPSDAGYPD
FT                   IHRLSNHAGDYRRLKMGFSVLEFRGRERNRKFFDPANLHTSDARLVVAKKNASVLEALV
FT                   ADLGRISDRLGEVPVLIVDDESDQASVNTVSPKKWKEDSKKRTAINRLIGQLLRMMPRA
FT                   QYVGYTATPYANVFIDPSDVEDIFPRDFLISLPRPDGYMGAEDFHDFDVELPLDQRPLT
FT                   TSKERAHVRYLGDEPDDSELRCAVDMFVLTGALKLYRQRHGTSYRHHTMLVHEAMGKDS
FT                   HRQTAELIGHLWNAAGYYQPTGLARLRDLYHTDVLPVSRAQAPTLLTPNNFDDLRDDIG
FT                   DALRLISPADRNGSPVIVVNSDTDLEKQQESLDFDQREIWRILVGGNKLARGFTVEGLT
FT                   VTYYRRTTAQVDTLMQMGRWFGFRPGYRDLVRLYTTPDLHDMFEAACRDEDFLRRELRQ
FT                   YAAPTGGSPQLTPRQIPPLIAQHRPDLRPTGRNKMWNAMLVLKSSPGRPMEPVAFPSTV
FT                   AKVKHNLEQWKPLIAAATERTVRFAVPGAKTTYTAGVAAISHPTLLTVLCNLKWLADDT
FT                   FQPELAWLRRLSTDQLARWVVFLPQQTRSTTRRVVAGHGPISVFERQRTSSGASFRVFS
FT                   EERHRNAAMRIAGIETPIPDSEADALRGRATGAIILYPTVEKDNLEPGEDGAVADEKVT
FT                   VGFHLVTPLSAVPAGGKLMHWATLDKMNPRALVVDAL"
FT   gene            650379..650945
FT                   /locus_tag="Strop_0575"
FT   CDS_pept        650379..650945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53056"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F6"
FT                   /protein_id="ABP53056.1"
FT                   /translation="MSRFSEDELHTVVSRYEATRAQALTERDEQLRAFHAAGWRPVDLQ
FT                   RVTGYSRETVRQALRPEVRRATNLSRRRTPPRPPVDYRPYGDRKPYVTAETLAALHGPT
FT                   KGTVTLPRHLDWSGHAEYDLNRPARLASMYKVVLTEASAVEDLHTWLNADLLRRLWPTL
FT                   WLPPQLRQRWEDAFPELAATRSNAA"
FT   gene            650976..651596
FT                   /locus_tag="Strop_0576"
FT   CDS_pept        650976..651596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53057"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F7"
FT                   /protein_id="ABP53057.1"
FT                   /translation="MPGLGAADRYGFALAGGYAVQAAGLLERPSEDLDLFTAWDRRNEF
FT                   TAAVTAVVHVYRDDSLTVETKRQYDTFARLAVTDGIRASKVELRVDWRANEPILMAIGP
FT                   VPHPDDAVANKMSALYGRAFARDFIDLDATLRSGRYTHDALLALARRADRGFDPRTFAD
FT                   ALGQATQLDPDDFAQYGVTGPVLDNLRGRFAEWRRELLDDEKG"
FT   gene            complement(652216..652371)
FT                   /locus_tag="Strop_0577"
FT   CDS_pept        complement(652216..652371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53058"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F8"
FT                   /protein_id="ABP53058.1"
FT                   /translation="MTCYVAGYTGELAAANEIAELAWLTMRDRERVSPVDKMIFAHLHE
FT                   AHLLRD"
FT   gene            complement(653062..653493)
FT                   /locus_tag="Strop_0578"
FT   CDS_pept        complement(653062..653493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53059"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2F9"
FT                   /protein_id="ABP53059.1"
FT                   /translation="MHRGAVTVPETAAGLPAALLDLPDPLCRLGVLHRLTVVLIAAICA
FT                   VAVSNRSYTAIAEWFPDVPAATGARGGHRPGPSPVGNDDPLQVAGRGSRPAHRLRQRLN
FT                   GHPDNGDSTVPAAGSHRVRQDPTLLPHYRHRRSACPRRL"
FT   gene            complement(653600..654076)
FT                   /locus_tag="Strop_0579"
FT   CDS_pept        complement(653600..654076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53060"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G0"
FT                   /protein_id="ABP53060.1"
FT                   /translation="MAVEYRLTLAGDIPLEQVAELAAPEAVETSTASGGRMLSADLNDE
FT                   RGYVVDITGGRHGYYSAEDDGGALWEWEPKTYVDVSFYMRKDTLADRGKTHMLAAVART
FT                   LAGRAEDAALTLNGDVLMLTRVAGTLRKHNTHGWCCRDVPSIVGGHMTSAEVYP"
FT   gene            complement(654093..654538)
FT                   /pseudo
FT                   /locus_tag="Strop_0580"
FT   gene            complement(654685..655209)
FT                   /locus_tag="Strop_0581"
FT   CDS_pept        complement(654685..655209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53061"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G1"
FT                   /protein_id="ABP53061.1"
FT                   /translation="MSQIEKITGELRALMAGVERAQGSAAADRQAQETASRAAGAGFVA
FT                   VAAGVARVRNAITGIQGGLGRLAGSIGEATTAAAAVPNEATPQETIAGLAPVQSAVDAA
FT                   RDAAAGAITGVGEAQQFVAMVLQGGQPGPLLQALEAIKQVLVLVVQRTGGARQAVEAAI
FT                   AHARQLGSPGN"
FT   gene            complement(655381..655644)
FT                   /locus_tag="Strop_0582"
FT   CDS_pept        complement(655381..655644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G2"
FT                   /protein_id="ABP53062.1"
FT                   /translation="MDNAWPVHSPLRHQTLAYDDAHDRIAPHIDVSVGLEEHSATGYTS
FT                   HLLAATVQFLTEMLIIEISGPVMRLIPEASLYDMPQLRISDS"
FT   gene            655708..655803
FT                   /locus_tag="Strop_R0012"
FT                   /note="tRNA-SeC1"
FT   tRNA            655708..655803
FT                   /locus_tag="Strop_R0012"
FT                   /product="tRNA-Sec"
FT   gene            655829..656842
FT                   /locus_tag="Strop_0583"
FT   CDS_pept        655829..656842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0583"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /note="TIGRFAM: selenide, water dikinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53063"
FT                   /db_xref="GOA:A4X2G3"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G3"
FT                   /protein_id="ABP53063.1"
FT                   /translation="MVAVAEEMLRLTRYARGGGCACKIPPGELEASLGGLLSPLTAPAH
FT                   ELLVGLETGDDAAAVRLSGETAIIVTTDFFTPVVDDPYDWGRIAAANALSDIYAMGGDP
FT                   ILAVNLLAWPRDLLPMSIASEVLRGGYDIACAAGCHLAGGHSIDDAEPKYGMAVTGIGD
FT                   ARRLLRNDAGRAGMPLSLTKPLGVGVLNSRHKATGEVFPAAVATMTALNRDASHAALRA
FT                   GVTCATDVTGFGLLGHLHKLARASGVTAVVDAAAVPYLDGAREAVRDGFVSGGSHRNLD
FT                   WVQPHTRWGAGVTDSERLLLADAQTSGGMLIAGEIPGATVIGELVPADGEHTLVVG"
FT   gene            656839..658134
FT                   /locus_tag="Strop_0584"
FT   CDS_pept        656839..658134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0584"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53064"
FT                   /db_xref="GOA:A4X2G4"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G4"
FT                   /protein_id="ABP53064.1"
FT                   /translation="MTGDPRRQIPRTDTLLTDPRLSEAHRMLGAEVVKQAVREAQQRAR
FT                   DGRIKPVDVLPAALAALPPAPALLRRVINATGVVLHTNLGRAPLSAAAVEAVTAAAGYV
FT                   DIEYDVTTGARARRGRSALDALRAAVPDAGDVHVVNNGAAAIVLAATALAARREIVVAR
FT                   SEMVEIGDGFRLHELLASTGAGLCEVGATNRAHLRDYAEAVGPRTGFILKVHPSNFRIE
FT                   GYTSAVGVADLARLPVPVVADIGSGLLRPEPLLPDEPDAATWLREGATVVTASGDKLLG
FT                   GPQAGLLLGTREVIETLRGHPLARALRVDKLTLAALEATLRRPVTPTASALHADEGELR
FT                   ERVERLAARLVASGIAATVTPSAGVVGGGSAPGLRLPGWAVRLPPGLAEPLRHGVPCVV
FT                   GRVHDGHLLLDLRCVPPAEDGTVAQAVERACS"
FT   gene            658125..659939
FT                   /locus_tag="Strop_0585"
FT   CDS_pept        658125..659939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0585"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu, domain 2 protein;
FT                   translation elongation factor, selenocysteine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53065"
FT                   /db_xref="GOA:A4X2G5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G5"
FT                   /protein_id="ABP53065.1"
FT                   /translation="MFVIATAGHVDHGKSTLVRALTGMEPDRWAEERRRGMTIDLGFAW
FT                   TTLDNEHMTAFVDVPGHQRFVSNMLAGVGPVTAVLFVVAADEGWRRQSAEHLAALQALD
FT                   VRHGVLAVTRCDLADPGPAIEQAHERLRDTGLAGMPAVAVSAASGHGLAALRTALRELT
FT                   RALPAPRTGPARLWVDRSFTVRGSGTVVTGTLGSGTMAVGDELVLEPAGRPVRIRGLQS
FT                   LKTKVERAKAVSRLAVNLRGLGANEVRRGYALVQPGAFTRVTTMDVRLIRQADRLPTHL
FT                   VLHIGSAAVPVRLRKLGPHAARLALTTALPLHVGERGLLRDPGAQHIVAGIVVLDTMPP
FT                   QLHARGDARRRATQLTGMSDRPDAVADIARRGAVRREALVTAGVLAYETEVPADVVAVG
FT                   EWLVAPTLWKTWVSALSAAVDEWAAANPLSPGLAPEAAAGRAGIPDLRLIGALMADAGL
FT                   VLGSGAMRRKDAKIRFPEPVRRALDEIRARLREDPFAAPSAEELARHRLSRQHLAAAVN
FT                   AGLLCRIAPDVYLLPDAPTEAARRLAGIDQPFTVSQARIAWGTSRRVAVPLLEYLDNQG
FT                   ATRRTGNTHRLLTFRTVAGPSLPEPQYH"
FT   gene            660116..661552
FT                   /locus_tag="Strop_0586"
FT   CDS_pept        660116..661552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0586"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53066"
FT                   /db_xref="GOA:A4X2G6"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G6"
FT                   /protein_id="ABP53066.1"
FT                   /translation="MDRTLILSGKDHVMADKKNAVQLPQPTAAEVEFAQQLVERARADG
FT                   VSLVGPGGLLAGITRTVLGSALDAELDAHLDTVGVDEATGRRTNIRNGHGVKTVQTEVG
FT                   PVRIQIPRDRAGSFAPRIVSKHARRLDGFNEAILSLYAKGLTTGEISAHLADVYDAEVS
FT                   RELISRVTDSVLDEMEAWRQRPLDRVYPVVFIDALVMKIRQGQVANRPVYVVVGISLDG
FT                   ERDVLGMWAGTGGEGAKQWAGYLTELRNRGVKDVFMVCSDGLKGMTDAIEHVWPQAVHQ
FT                   QCVVHLVRASLRGTNRQDWQKITPALREIYTAPTVAAAEARFEEFATQFGDQYPAVIRL
FT                   WRTSWPQFVPFLDYDHEVRKVLCTTTIIESLNARFRQAARRRGHFPTEQAGRDEGPLPR
FT                   RPAETPGRWEHHRPGLRLGQGPQRPDPRLRRPDHHLTASITSSGQTRKTPHSRLLGELL
FT                   GGLDLHQDDRGPAGWSSCGC"
FT   gene            661546..661881
FT                   /locus_tag="Strop_0587"
FT   CDS_pept        661546..661881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53067"
FT                   /db_xref="GOA:A4X2G7"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G7"
FT                   /protein_id="ABP53067.1"
FT                   /translation="MLTVRGLSGVRLVISDAHAGLVATIEATLPAVAEHLDAARDDVLA
FT                   LTGFPGEVWRQIWSTGGDHPPRRRGPGRAGRRHHPTRHRTDRLGTDRRIASDRIPRCPS
FT                   PTPPART"
FT   gene            661962..662345
FT                   /locus_tag="Strop_0588"
FT   CDS_pept        661962..662345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53068"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G8"
FT                   /protein_id="ABP53068.1"
FT                   /translation="MERVYGIGGYFFRARDPEGLSRWYRDNLGVVAEDLDGYWFQQGGP
FT                   TVFAPFPEHTDYFGSSGQKTMLNFRVVDLDAMLAQLRAGGAEVDHRVETDDNGRFGWAI
FT                   DPEGNRFELWEPADGVADPVTPA"
FT   gene            complement(662476..663054)
FT                   /locus_tag="Strop_0589"
FT   CDS_pept        complement(662476..663054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0589"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53069"
FT                   /db_xref="GOA:A4X2G9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2G9"
FT                   /protein_id="ABP53069.1"
FT                   /translation="MAGLSVATDIVHPLLTPAANTQIFDGSALPWTRVAGLLEAARWTT
FT                   SRWNRQPWRFLVGRKGDRTFHELHRALTPTNRTTARGAGTLILALRQTRSVEGGPLDGT
FT                   EYELGLAVARLSVQARATGWRIAQLGGFRRRPLMAAFEVPADFEPFVILAVGRATADIS
FT                   CALPPRPRLPLAEIAFTGRWGTTHRRRAS"
FT   gene            663369..665141
FT                   /locus_tag="Strop_0590"
FT   CDS_pept        663369..665141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0590"
FT                   /product="peptidase S9B, dipeptidylpeptidase IV domain
FT                   protein"
FT                   /note="PFAM: peptidase S9B, dipeptidylpeptidase IV domain
FT                   protein; WD40 domain protein beta Propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53070"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H0"
FT                   /protein_id="ABP53070.1"
FT                   /translation="MKRIAGGGGIAGAGVKGFRLRRLAADPNGSGDGAIAPDGTRFVAS
FT                   SKRNGSVNLWFFDLSSGKWQQGTWGTGDDIEAQWSPDGRQLTFTSSRGGHKAIWLYRLS
FT                   DGQVRQLTSADHEEEYPSWSPDGSTVAFVGGSWGRRHFLVVPATGGTPRPVTTNPGRAG
FT                   ACSWAPDGRWLVCHSYDTGAGAVWLLDSQTAEAIQVTDGSSWDYKPTICPTRPAVAFSR
FT                   SNEGRSVIWVQRLGDGTGGPLVVTGADDRWPTWTRDGNHLFFHRLVDEGAGIAVWDRRT
FT                   RVVRDLVPAEHKPRYASFAPDGRRIVYGTEAGGRSRLRILNLDTGTSQPLPAGEAAFPT
FT                   WSPDGRTIACTVRPDPSSRWEIATVDVSSGQVQLWTTGRTDLRGLHAPVSFAPDGRRLV
FT                   FRSETEPFEANLLVLDLNSGRFTNLTEDSWWDEAPSFSPDGRSVIFMSTRGGDWTWGFY
FT                   RIDLDSKEIVTVAGPDYIERNNPQLTVDGRVLSTMVASKVEELYEQLPDGAGRVVTEAG
FT                   PAVRYPVPSADGEQVVFTRTRTTVEYWLAENVWAADSPLAPLARPLVAEAGTPQVIDQP
FT                   PLGPVRSPVDTRRR"
FT   gene            665220..666083
FT                   /locus_tag="Strop_0591"
FT   CDS_pept        665220..666083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0591"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53071"
FT                   /db_xref="GOA:A4X2H1"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H1"
FT                   /protein_id="ABP53071.1"
FT                   /translation="MAEASEQARKVDVVLGEGDKNLLYDTVTGPIWRKAVYEPVHGGWE
FT                   FTNIAGARLLDAVATMFRIGPLTHVLEFCSGTGAVARYLNQRAGCSVTGVELNSVQLAT
FT                   ARRARAEAGPGLARVSFVEGDVTRWQPDRLYDLALVIDSLTLLSDPVAALRNARRALCS
FT                   EGWLIFSDTAAGPRMTADTERQAWDLDGLRPLPRHPGTVDLFASAGMTDVHTIDATDTA
FT                   VDCFQTIAAALTDRADELAAVATAEELADWHVSTHFYLDAYRTRQLTYWHGCARRPRRA
FT                   SSPTAA"
FT   gene            666263..667210
FT                   /locus_tag="Strop_0592"
FT   CDS_pept        666263..667210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53072"
FT                   /db_xref="InterPro:IPR012964"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H2"
FT                   /protein_id="ABP53072.1"
FT                   /translation="MPPLTPAIVELAGRQHRRGEAASRLLLQTRAIAFVEGYELRRRTR
FT                   RNDVHAELARIRPDNRGFAYEGAALAAALADLATPRRGQRRYGLGSSDTHLGSLLAGPG
FT                   TGFVHLIHVGAGWSAALLPWRMLHRRLPLDSLLRWLAVDGAGFSRGFFGGPRWIRRLAH
FT                   RPDREDPVQAVLCQGVGRSLWFVECGDGAGLGRHIERFPPGLRRELWAGVGLAASYAGG
FT                   GTDRQIEQLLTLGGEDRAALAQGAVFAAEAQRTAGHIPAHTEAAVSAFTGVSAHTAADW
FT                   ARDSYEFARALGSEIESYRWWQCEIRSRATAVAD"
FT   gene            667278..669140
FT                   /locus_tag="Strop_0593"
FT   CDS_pept        667278..669140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0593"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53073"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H3"
FT                   /protein_id="ABP53073.1"
FT                   /translation="MSMSLRRMLPGALATVLVAAIGVFTVRPAPDPGEMDVLAARFAFE
FT                   VHPLNTAPAGAQHVRVVAPDVSGIRSWISAVGAAVALLDADGNRRHDDVCLVDPRDDSV
FT                   RVFPVPGTGDRYPAASLSPPPGPIDHFAPMGCVPTDLDADGDSDLIVYYWGRSPVQFLR
FT                   IGAGWHPVELVQPAQVWNTTALVVGDLDGDGAPDVLVGNYFPDGARLLDPGAAGDGRMH
FT                   MQAGMADAGNGGTNRAFLSRPGPPDTAPAWLDASTGVPDRAARSWTLAFGLQDLTGDLL
FT                   PEVYLANDFGPDHLLVNHSRPGQLDLRPVVGTRSALVPKSKVLGRDSFKGMGVTYTYPD
FT                   GAELPTIVVSNITTPWGLQESNFAFTPTGPGADLLDGRLPYKDRSEALGLSRSGWAWDV
FT                   KAVDFDGDGNDELLQATGFVAGKRWRWPELQELAMANDQLLQHPWAWPHFRPGDDISGH
FT                   QANVLWTRHGGRYIDIAPQSGLGHRDVSRGIAIGDVDLDGRPDALVANQWQDSRLVLNR
FT                   SRSTSQSTLILKRAGEGGRQTTLALGASVVARPGDGRPDLRAQLYPSNGHAGVSSPELF
FT                   FAVDGITPFVVSWRTAGGVRTAQVSLGPGRHELVLHDDGQVATR"
FT   sig_peptide     667278..667448
FT                   /locus_tag="Strop_0593"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.354 at
FT                   residue 57"
FT   gene            669137..670186
FT                   /locus_tag="Strop_0594"
FT   CDS_pept        669137..670186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0594"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: L-seryl-tRNA selenium transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53074"
FT                   /db_xref="GOA:A4X2H4"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H4"
FT                   /protein_id="ABP53074.1"
FT                   /translation="MRAQTSRPTAMPTRTDGDLPPATTDARTRGERTSDMSGVAPLGRG
FT                   ATGATRHVINATSVLVHPGLGRAVLSGSAQRAVEVAFGCTDLEYGLNTGQRGRRGRETV
FT                   AALLAAVPTAGAAYVVNSNPAALVLAATVLAPGRELVISQRELYEIRDGFRLPELLTST
FT                   GARLCPVGTADGAVLDDYRQAVWSGTGCVLTLVPARGGSDGACGRPDVTALAGLRVPVI
FT                   ADISSGLLRPEPALSGEPDAETALRQGATLATASGDKLLGWAADRAADRRPGRHRAGAT
FT                   APARPCDVGGQTGPRRPVRDHRRRRYPHARCRSDGSQRLESPRQVVDWRTAGRGSRRRT
FT                   GRVPRHGAR"
FT   gene            670458..670736
FT                   /locus_tag="Strop_0595"
FT   CDS_pept        670458..670736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53075"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H5"
FT                   /protein_id="ABP53075.1"
FT                   /translation="MSGSVRVGHCARHLAGTRTSERDRQELRATVEWSKAPLVCLLCVQ
FT                   PTAQASSADVRCHLLDIEVAPTPLRPRSRKFLLVRRHSPGLGLRQRL"
FT   gene            671414..672109
FT                   /locus_tag="Strop_0596"
FT   CDS_pept        671414..672109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53076"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H6"
FT                   /protein_id="ABP53076.1"
FT                   /translation="MRHPDAGFSGHESAGPDASAPASHRGSGGDLVGHRGRGVDDGRLA
FT                   VRYLACRAGPRLACGELPADRRPRRGQGAVECEPEELTVDWQSLGTPIAAVCTAILTYL
FT                   GTRHVTKVERRREEARLAEVARDEALVVEQALSVAHEKARAAIILERNELLERWQRTLD
FT                   EARDDRQRLLHEHRAEIARVREEARDEVASVRESAQLIIGDLRRQVVQLRSDLQASRDQ
FT                   WRYDRPNDL"
FT   gene            672087..673316
FT                   /locus_tag="Strop_0597"
FT   CDS_pept        672087..673316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53077"
FT                   /db_xref="GOA:A4X2H7"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H7"
FT                   /protein_id="ABP53077.1"
FT                   /translation="MTGRTICDRLIPLCVEPRRIARRKKYAECRAIYNRLFDCRRKAAA
FT                   PGPIACASLRRSGACARTVREEWRRNDRGTELRRAGQALFSSARMPAERLFHPGPSPDE
FT                   AGCVVISAAPGELRVKALRRFALSITILTVLGHLFLGFEQAPVTPVLTLLLGYVLDLAL
FT                   ETFQARVEGRPVGFLGGFQPLVDYLLPTHIGALACAMLLYGNSSPWPYLFAIATAVASR
FT                   HILRIRVDGRPRHVLNPSNAGIALTLVLFPWVSIAPPYHFTAGISGALDWLLPLGVLMA
FT                   GTLLNGRLTGKMPLIVGWLAGFVGQALLRSVLFDHNFVAALLPMTGLAFILFTNYMITD
FT                   PGTTPRARGNQVWFGLCTAAVYGLLVLAHVSYGLFLALVITCILRAGLLLVGRHRLIRA
FT                   RRIRLRKAAA"
FT   gene            673313..679168
FT                   /locus_tag="Strop_0598"
FT   CDS_pept        673313..679168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0598"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; acyl transferase
FT                   domain protein; short-chain dehydrogenase/reductase SDR;
FT                   KR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53078"
FT                   /db_xref="GOA:A4X2H8"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H8"
FT                   /protein_id="ABP53078.1"
FT                   /translation="MRAIERQIAVVGMACRYPDADDPTQLWRSVLARRRAFRAIPAERL
FT                   DPEHRLGAPHAPDSTYVRRAALLRDWHFDREAFRVSGSAWRAADHAHWLALETARAALA
FT                   DAGFPGGADLDADRVGVVLGNSLTGEFSRAGMVRMHWPFVRRSVEAALRDTRVDSAVTA
FT                   QVLEHAWHHITAAFPDPGDESLAGALSNTIAGRICNHFDFHGTGYTVDGACASSLLAVI
FT                   TAANALLSGELNFALAGGVDLSLDPLEMIGFARLGALAHGQMRVYDEQPTGFLPGEGCG
FT                   IVALMRADEAQRRGLRVYARLTGWATSSDGSGGLTRPDTSGQALALRRAYQAAGVKPEQ
FT                   VGLIEGHGTGTAVGDRVELETLTQIRRDATGTAVLGSVKANIGHTKAAAGAAALIKTVL
FT                   AVYHRTLPPTTGCHTPHPLLREADATLRVLDEPEPWRGERLTAGVSAMGFGGINSHVVV
FT                   EGSAPGVAASHRRASVSARAWSHPPIQPEIVLLEAADQGELTERLNRLADWGSMLSDAE
FT                   VGDVAATLSAAAGGTARIRCALVAHDADELSAAARAATGLLATWNGHVLVDETAGVALG
FT                   AGPPARVGLLLPGQGAPVRYDPGPLARLLPELPERPADTGATGTEAAQPAVVWQSMLGL
FT                   AWLDQLGCAPLGAVGHSLGELTALAWAGALDMDRLVQLAVVRGRVMARHGVAGTGMVSL
FT                   SLDEARAVRLANEHGLVVSALNAPDRTVLAGADEDLARLEAVLRDSGIEAIRLPVSYGF
FT                   HSPAMEPAQPAWAAELNMVGFPRQSWPVVSSVTGEALRDSDDLVALLTHQLTAPVRFLA
FT                   AARTLGQQCDLLVEAGPGTMLSRLAARFSAAPAVSLDCGGPPRSLALATAAVVAAGAGD
FT                   IAAWYAGRPYRPLQPGTTMSFLSSPCGSGISSAGLLGAGSVSTDTDPVPLPGRVEQLSS
FT                   VAAAVVRTASARPAPTPPEADPAGSVDPAGSAASSQDPLSQLRAHLATELELPVASITP
FT                   ANRLLGDLHLNSLQIARTVAAVASALGRQPPSAPLSLAEATVAEAAEVLAQLPAGDDEE
FT                   APVQGVAPWIRLFRHDWAPVENTVTAIGGVRWRVAAPEGHPLHAVFPSVPEQTAVPHGL
FT                   AVALGPDDGPVEVAAVLTQIAVEQPARLALVHDGHPAAAAVGRSVAAELPGCAVTVIKA
FT                   TSPADIARLAVLAVPAGYAELRIGPRGVQRLVTSLHRPADDSREIPLGPDDVCIVTGGA
FT                   TGITAFAAAAIAERTGCRLVVLGRRPVEDAETSEALRRLGAVLGDDRLHYERVDLTDPD
FT                   TVQAAVSRAGRLGVIRAVVHGAGINRPAPLTQVSEEELQDHLGGKVAGLQSLLAAAGPD
FT                   LRLVLAFGSIIGRQGLAGQAAYCVSNDWLRHEVERWASENPAVRAHVIEWSVWSGIGMG
FT                   VRLDVLDSLHRRGVAGIAPDDGVAALWRILTDPTAPVTVLCTAAFPESATLSPEPAPDA
FT                   PDLGRLRFAEVPVGRIGRVATVTEAVLSAGADPYLRDHRVSDVPLLPAVLGLEAMVQLA
FT                   SLTIGNRAGWAIRDVSFAAPIDVPEFDVRRIRVAALAAESGADVAVVIRADTDGFATDR
FT                   FSGTVVGEPSVPPTTSAAGGGQSRPCARMGVAGPEANTIHSWYGSVLFHEGQMRRLLCA
FT                   EPVSAFAVRAVVEAGDPERWFASFLGQDLLLGSPGGHDAAIHSLLACAPHRRVLPVGAA
FT                   EVVVWQPLRGRLTVEAREVWHSADEYVFDVEVTHSGGPVARWRGLRLRAVGENPEFMAA
FT                   RDCGRLGVELVGPWLSRRLIEVGAVDAVEFVVGAGRRETEGARSLVARHLALPESELGH
FT                   KPSGALRVPGRYASASYADGQVLVALADRPVGVDWEPVTDRSLAGLLDSSARVAAEELR
FT                   QRTGDTQKVATTRLWAAREALVKLGVDPDQALAHGEAEPDGVLVSTGRDVTVTTALAWG
FT                   DRTNQVAVAVATKSGRHD"
FT   gene            679161..679577
FT                   /locus_tag="Strop_0599"
FT   CDS_pept        679161..679577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0599"
FT                   /product="thioesterase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53079"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2H9"
FT                   /protein_id="ABP53079.1"
FT                   /translation="MIRWYVYRHVVHLDETNVVGNVYFAHFLHWQGHCRERFLADHAPT
FT                   VLDQVRRGDLALVTVSCAMDYYEECFGLDEIEVRMRLNGRNGHRLGMHFEFLRGGREVA
FT                   RGQQTVACLRRTPDGPAPVDLPVELRVALTAFSG"
FT   gene            complement(679659..680552)
FT                   /locus_tag="Strop_0600"
FT   CDS_pept        complement(679659..680552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0600"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53080"
FT                   /db_xref="GOA:A4X2I0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I0"
FT                   /protein_id="ABP53080.1"
FT                   /translation="MTTADQLWRQRGNCLECAEVTRCSTLGMCLDNPTDAARLDSVTRA
FT                   VEYMTAHFSEPQRLSDIAQAALLSPFHFHRVFRHVTSTTPARFLTALRMARARSMLVNS
FT                   NLSVTEVCLGVGYSSLGTFISQFTKLTGMSPRRFRAAMSVFGHIRLSELTDPSAERHFA
FT                   PGPVGAVTGGPSAGGCAVLALYRSEEPDDVPVTYGVLETNRLSHFRPLADGAYHAVALG
FT                   FDNRSTLSDVLGDNGQQAQFVGTGDVPIVVRGGRTRRSFQIALRCPRPIDPPVQLTSAL
FT                   LALAQRRQPRLLATGS"
FT   gene            complement(680912..682120)
FT                   /locus_tag="Strop_0601"
FT   CDS_pept        complement(680912..682120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0601"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="SMART: PBS lyase HEAT domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53081"
FT                   /db_xref="GOA:A4X2I1"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I1"
FT                   /protein_id="ABP53081.1"
FT                   /translation="MTLQSIGLSTGGRDRAPEWEHYLKGDPALLNSELGDILDRDAVRL
FT                   DIRTDDQVAYEALHHPDPMVREQSLYQAMDRRLPEAIDLIAESIATDENREVRWNALWA
FT                   LEKIGGPRALQIIERHVNDDDADVGEWAQLFSSELRTGLPAFDNRSFAWDSDRTFDETI
FT                   LLNIHCDVYVALDETGRNWGKISLAPQGLARSYGQAHACPNTDTRNQKLIISKTLSGLH
FT                   EDGTPHTENFVFRGLTNHANAGRGSFYFESRGLRPIFLSGRADDDSLGHRNEMVAAKRS
FT                   GEWTLDPRIQIRGESAIRYVRGRVHTWGYVNFDTMAGSSLEEVLFPGNSILGTLDTPTG
FT                   PLANAFIVGTFKGKLVDWDGDDKVNVNSLDIYSTLDGDVDSDQDGVADIPGVQFCPRTN
FT                   WMN"
FT   gene            682590..683900
FT                   /locus_tag="Strop_0602"
FT   CDS_pept        682590..683900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0602"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53082"
FT                   /db_xref="GOA:A4X2I2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I2"
FT                   /protein_id="ABP53082.1"
FT                   /translation="MLKRLFRRWALVVRAATIAVLLAGWVGRLAVRLLIDALRRAWPKG
FT                   TRGPSGRERLAVTLTDTVERLGPTYVKLGQVLSTRVDLLPPWLCRNLSRLHDRVSPPSD
FT                   VAAVIRTVPPMVTARVVGGAAGLTPAAAGSIACVYQARLDDGREVAIKVRRPGIEQTMR
FT                   LDLALVNVVARAAGRLPAMRQVPLAEIVDQISAAVYEQLDFVREAQSLTRLRDNLRSLP
FT                   DVRVPAVVSELSGHTVLVTEWIGALERSAERSPARQAAVLNGLRAAYQMLFRDGFVHCD
FT                   LHPGNLYLMPDGTAVIVDTGFVRSLTDFTRRRFAEFFYYLGRNDGHRCAEILLSTVLDR
FT                   GGRYDRDGFRDDVVALVARNSSVRASDFDLASFAATLFAIQRSRGLYADPQFVFPILAL
FT                   LVLEGSVHALVPDIDFQAEAVPYVLRGLQETASVRRS"
FT   gene            684254..685447
FT                   /locus_tag="Strop_0603"
FT   CDS_pept        684254..685447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0603"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53083"
FT                   /db_xref="GOA:A4X2I3"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I3"
FT                   /protein_id="ABP53083.1"
FT                   /translation="MATVPRLTFADGGVSVLPWFRQMRDDQPVWYDQGTGSWNVFRYAD
FT                   IAQILTDPATFSSDPGRTMPPELVEEAEGSLVAVDPPRHGRLRALISTAFTPRLVEQLA
FT                   PRVRSIAERLLDRTFVDRGPEGEFDAIGDVAYLLPVYVIGELLGLPETDREYLVRTADE
FT                   FYAISADDPFDGTYMASMQSTLDGLGTYMLDQAERRRARPGDDLMSALAHAEIDGEQLN
FT                   DREIRNFAVLLLTAGHITTTALLGNTLLALGERRDVMLRWRHGQVDTADVLEEVLRHRT
FT                   PFTEVYRFTTTEVTIGNQVVPGDQLLRLWIASGNRDERQFADPDTFVLGRDSRHLGFGL
FT                   GIHYCLGASLARMESSVVLEVLAERTTTLAPAVQGLSYYDAPGIFCLRSLPVSYRRS"
FT   gene            685475..686305
FT                   /locus_tag="Strop_0604"
FT   CDS_pept        685475..686305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0604"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53084"
FT                   /db_xref="GOA:A4X2I4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR020803"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I4"
FT                   /protein_id="ABP53084.1"
FT                   /translation="MSATDEQAKYDYKSDESMRIDVWDENLHVGYWDGPGDTSDQTLAT
FT                   ERLTDLVLARSGLGAGQHLLDVGCGMGKPARRAATETGCSVSGVSDSDTQVERANEGAA
FT                   AAGIAGRVGFQTADATQELPFPDAHFDVAWAIESLVHMTDRARALAHVARTLKPGGLLV
FT                   ATDFFTHPPLTGARADAVDAFRGVALLGPIVSLDDYPALLRTTGFELREFVDLTEHTHR
FT                   TYALLLQALRDNEADLRAQHGDAVFDGFVTAFAYCVESLEPRYMLYVARRVADR"
FT   gene            complement(686319..686702)
FT                   /locus_tag="Strop_0605"
FT   CDS_pept        complement(686319..686702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0605"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53085"
FT                   /db_xref="GOA:A4X2I5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I5"
FT                   /protein_id="ABP53085.1"
FT                   /translation="MSQDKVGTIAGFDLTVQNADGVRDFYADVVGWKPEPLSMGDYDDY
FT                   MMLAQDGNPVAGICHAKSSNADLPPQWITYIAVSDLSASLARVTEKGGEVVRQPNGTGP
FT                   GGFALIKDPAGAIVALMQNPHTS"
FT   gene            complement(686736..687437)
FT                   /locus_tag="Strop_0606"
FT   CDS_pept        complement(686736..687437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53086"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I6"
FT                   /protein_id="ABP53086.1"
FT                   /translation="MNTPKIEITVDTTVDAAWQALRDTETIRRWHGWDTDEIAEEIRSI
FT                   YFTDVTVDDQRHVLVANGGDRFEVHPLPDGVRVTLTRAPLSGDPNWDAYYDDITEGWTS
FT                   FLQQLRFLLSHNPGGMRRTLFFSYRGVDSSTIVDRLGLAGIAATPAGSPYTATVAGGTT
FT                   TGNVWFRSTHQLGLTIDAWGPGLLVLAGNTPSQTNPAGTATALLSTYDLDDTAFDQLSQ
FT                   QWSAWWATHTH"
FT   gene            complement(687434..688051)
FT                   /locus_tag="Strop_0607"
FT   CDS_pept        complement(687434..688051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53087"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I7"
FT                   /protein_id="ABP53087.1"
FT                   /translation="MDDRSMTSGINYVDEPERVAAALSPLRRQLLGTLRVPASATQLAT
FT                   SLHIPRQRVNYHLRALEAIGLVELVEERQRRGFTERIMRAKPGALVVNPTLMGVGETVP
FT                   EPDGALADQHAAEHLVRVAAAAVRDVARMQVKADEHGKRLLTFTLEAHVRFADPAAVHR
FT                   FTKELTELVTQLTTTYDTEGGRPYRMVAAGYPAPATEAPTDQ"
FT   gene            688455..688913
FT                   /locus_tag="Strop_0608"
FT   CDS_pept        688455..688913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53088"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I8"
FT                   /protein_id="ABP53088.1"
FT                   /translation="MSGTPSLVELLERLARLEARIVELERDNAELRRENAVLRAENADL
FT                   RARLGQDSSNSSRPPSSDGLAKPAPKSLRKRSGRRPGGQPGHEGRTLRQVADPHERIEH
FT                   EPAGCGGCGEPLGAAPMTGVAVRQVFDLPDIAVRVIEHQIVSRRCRCG"
FT   gene            689219..689902
FT                   /locus_tag="Strop_0609"
FT   CDS_pept        689219..689902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53089"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2I9"
FT                   /protein_id="ABP53089.1"
FT                   /translation="MATTGKYTLVWVHPTRGRAGIDVGQIMGSMAGIVVHDAWAPYDTY
FT                   TPAGHQLCCAHLLRELTAAAELAPEAVWPAQASDALLTLKTAADTARAAGRTEIDPSLL
FT                   AEQTGLFRQAALVAVKDHQAQPSKTARKLAALARRMRGRIDDYLRFAVDLRSPFDNNAA
FT                   EQQIRMVKIRQKVSGSLRILDGAQQFALIRSYLATATPHGGNIISALTELAAGRPWLPT
FT                   AVATT"
FT   gene            complement(690095..691012)
FT                   /locus_tag="Strop_0610"
FT   CDS_pept        complement(690095..691012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0610"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53090"
FT                   /db_xref="GOA:A4X2J0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J0"
FT                   /protein_id="ABP53090.1"
FT                   /translation="MRGQSTLRWIPEANCLECTNIGLCAGVGRCLREPTDAARVTAVAR
FT                   AVDYMIEHRAQPIQLVDVARAATMSQFHFHRIFREITCTTPARFLTALRMCEAQHLLLN
FT                   SRRSVTEICSSVGYSSLGTFISQFGRLTGLSPRRFRTVVERIGQVPIQELTDLSGAMAE
FT                   RGPIGAVTSDRQERYCALLGLYRTDRPWERPSAFQVIETDHVVRIPPVSDGEYDTVSVG
FT                   YSPVTTVAEVLGAPVGTLGRVGFGTRTLVARGGRSRHPFHVALRRQRRIDPPVEFSRPL
FT                   LCLVTRANQRDAAPALPTDAADRG"
FT   gene            complement(691568..691810)
FT                   /locus_tag="Strop_0611"
FT   CDS_pept        complement(691568..691810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53091"
FT                   /db_xref="GOA:A4X2J1"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J1"
FT                   /protein_id="ABP53091.1"
FT                   /translation="MARDVAVCKGGAVILRREPVLVQAAVVAVLNLIVAFDVISLTPSQ
FT                   SNALIALTAAVLGLITRRYVAPVPLPGTKTDGSLW"
FT   gene            complement(692079..693851)
FT                   /locus_tag="Strop_0612"
FT   CDS_pept        complement(692079..693851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0612"
FT                   /product="Periplasmic component of the Tol biopolymer
FT                   transport system-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53092"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J2"
FT                   /protein_id="ABP53092.1"
FT                   /translation="MNGSAGMLSQPGRVRGPTFQLHRLAEDPAGAGDGAISPDGTRFVA
FT                   SSRRTGSLNLWFYEIATEQWHQGTRGAGDDIEAQWSPDSACLAFTSSRCGHKAVWLYRL
FT                   HEARISRLTFGPYDEEYPNWSPDGSKITFVGGGWAQRQVYLVSATGGPPMPVTDEPGRT
FT                   GACTYLPDGSGLICHSYDTGASAVSILPLDGSMPRQVTDGSTWDYKPTVSSAHPVVAFS
FT                   RSLEGRSVIWVQQLAEPYRGRALVVEAGDDRWPNWTADGQHLFFHRLVDRGVGIWVLDR
FT                   RTDTVTQVVGPDEQPRYGNISPDGTRLIYAAEESGRSVVKVREISGGLTKVLPLGDAAF
FT                   PQWSPNGRTVAYLTRDVSRPRWEIATYDLATATSTVWTCGVTWPKSLHGPLDWSPDSTR
FT                   LVFSTDTEPFEADLCVLDLRDGSVTKLTEDPWWDEAPSWTPDGTGVVFLSTRGGDWTWG
FT                   FYRMDLSTGEIHALARPDYIEKNNPRMLPDGTLIYSLAVSGIEDLFEQLPDGRGRVLSS
FT                   VGPAVRYPVPSRDGSMLAFTRTHRTVEYWLAKNVWGAGSPIADLADGDARRRGTHGPQT
FT                   RTGPVRSPVNTRRR"
FT   gene            694139..694798
FT                   /locus_tag="Strop_0613"
FT   CDS_pept        694139..694798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53093"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J3"
FT                   /protein_id="ABP53093.1"
FT                   /translation="MTEVQDFGRQLGEFSRGLLGATGADEGTEFVSDGRAESEIRGFLA
FT                   ELQEAYARADIDWIVNSLAEDFTTYELVALDGSPVVIREKAAMREYLTTLFPASGENQV
FT                   KSITANQVVATATLGLINEEGDVVISKADTTKEHQPLRASALAVRTEDGWKWRHWHMSE
FT                   AGPRFRVNAAGVPIDDNGQVIPGARVVTQDGVGRVVVDGHETRPGVTLAPGQTRRD"
FT   gene            694840..696357
FT                   /locus_tag="Strop_0614"
FT   CDS_pept        694840..696357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0614"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53094"
FT                   /db_xref="GOA:A4X2J4"
FT                   /db_xref="InterPro:IPR016119"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J4"
FT                   /protein_id="ABP53094.1"
FT                   /translation="MSSTVGRVTRPEHSTAGATPTSVTHVTNGEENLYPDYLGNFSKGL
FT                   PHDEFGEVDRTAYRQLVRRLSSEDPGEIEGIELDPSCGRRLVNPQAGLSVDAIGPRSTD
FT                   MTMPPVPRMDSAELSAELCELYWMALCRDVPFTRLTESDVARAAADDLTKLSDYRAVRQ
FT                   NGRVTPGLLFRGDTPGDHAGPYLSQFLWRDIQFGTYRFVQRQDTVRPNQDYMTTFGTYL
FT                   KVQRGWNRTLAASERDQENRRYLYSPRALAHWLHFDGGPSPAKAFFHAGLILDSLDMPV
FT                   DAGNPYVDSTVQHGFSTFGTPHLLALVTEVANRALRAVWYQKWFVHRRMRPEVFGARVH
FT                   QRLTGGRAYEFIDREVLESDAVDRVFSKWGSYLLPQAFPEGSPMHPSYGAGHGTAAAAA
FT                   ATVLKAWFDETAVLDNPIQANEDGTALVPYEGQDAGRLTVGGELNKLAANVGIGRNIAG
FT                   VHWRTDWTESAKLGESLAIQLLREQKAWFKEPHWFTVTRFDGTTVRF"
FT   gene            complement(696538..697176)
FT                   /locus_tag="Strop_0615"
FT   CDS_pept        complement(696538..697176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0615"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53095"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR018309"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J5"
FT                   /protein_id="ABP53095.1"
FT                   /translation="MAHCSSEALGPLVERHKEETADVADDRRESALPSTAYAVLGLLTM
FT                   TGEVTGYELRKWAMNMRYFYWSPAQSQLYLELRRLRDRALVYERTEAQPGRPDKRYYTI
FT                   TDTGRRVFRDWLDHSEVGPPLLKHSVALRLFFGHQTSHSRLREVLTQYAEWARRQQQEL
FT                   SALKGDMLPALRYSSIVADWGVGYFAAEINAVESALASLDAMDSEVGES"
FT   gene            697437..698597
FT                   /locus_tag="Strop_0616"
FT   CDS_pept        697437..698597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0616"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53096"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J6"
FT                   /protein_id="ABP53096.1"
FT                   /translation="MIQHRWSRAGDGRLLGLAAAAALCAACTTDGVPAPGEESKGPPLL
FT                   FDISATTPVGDNPRAIAAADLNGDGVPDLVTPNLGPGNASVLFGDGRAGVRQVVEIAAG
FT                   PAALRNVTADLNNDGNQDVATINVSDETVTVLHGDGLGGFSEPVAYEAGDGPSGVIAVD
FT                   LNGDDVLDLATANYDGDDVSIMLAEGSGYAAPVHVAVGDGAADIVAADVNGDGQIDLVT
FT                   GNHHSDDVSVLLGDGAGGVAPAISSAAGDGPHGIAAGDFDGDGHVDLATPDYEGDTTSV
FT                   LLGSGDGTFAAPAKLPAGDGPTGLVAVDLDGDGSIDLATANFESDDVSVLRGNGDGTFG
FT                   EPAYVPAGDGAVKIVAVDLDGDGLLDLATANSHDDNVTVLRNTTSQ"
FT   sig_peptide     697437..697547
FT                   /locus_tag="Strop_0616"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.612 at
FT                   residue 37"
FT   gene            698695..699684
FT                   /locus_tag="Strop_0617"
FT   CDS_pept        698695..699684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0617"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53097"
FT                   /db_xref="GOA:A4X2J7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J7"
FT                   /protein_id="ABP53097.1"
FT                   /translation="MTAAIVAQGLVKRYGETTALNGFDLEVAEGTVLGLLGPNGAGKTT
FT                   AVRVFATLIEPDAGHAEIAGLDVVRQAGQVRQTIGLSGQYAAVDDILTGQENLELLGRL
FT                   HHLGRRGARSRAKELLERFGLTEAANRRLKEYSGGMRRRLDLAGALVARPKVLILDEPT
FT                   TGLDIRSREATWETVGELVSGGSTLLLTTQYLEEADRFADRIAVIEHGVVLAGGTPDEL
FT                   KDQVGGHRLEVTLSRPADLSRARSVLAPVAAGEAVSDEAEGRLAVTVAAADGVLVDGIR
FT                   RLDAAGIEVIDASLRRPTLDDVFLALTGHIAETTTEPASEQETQEAVR"
FT   gene            699681..700484
FT                   /locus_tag="Strop_0618"
FT   CDS_pept        699681..700484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0618"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53098"
FT                   /db_xref="GOA:A4X2J8"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J8"
FT                   /protein_id="ABP53098.1"
FT                   /translation="MSSLVMTVGDGMVLAKRNLIRTLRMPDLFMSSLIMPIMSTLLFAY
FT                   IFGSAIEAPGVSYREFLLAGVFVQTVVFNSVITGAGLAEDIQRGIVDRFRSLPISSYSV
FT                   LFGRTASDLANNVLSLAVMVLAGLLVGWRIDSSFGEGVAGLLLLLAFAYALSWLLAVVG
FT                   LSVRAPEVVSNASFMVIMPLSFIANTYVSPEGFPGPLRVIAEWNPVSAVAQAARELFGN
FT                   TNPAYPPPDVWPLQNPIVASIGWIVLILVIFVPLATHRYRKAVRR"
FT   gene            complement(700538..700969)
FT                   /locus_tag="Strop_0619"
FT   CDS_pept        complement(700538..700969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0619"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53099"
FT                   /db_xref="GOA:A4X2J9"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2J9"
FT                   /protein_id="ABP53099.1"
FT                   /translation="MTQQSRNEQTLRALYRNFNENNLDGAMALLTEDYEGVEVPTGEVV
FT                   HGPAGWRRRQELNRAPMPDARVEIVNLIMCGDIAVAEVVNEGTHTAPFPLPNGDIHPPT
FT                   GNRIRGLSCELYCFRDGRIANGKLYYDFLTVATQLGLPL"
FT   gene            701160..702398
FT                   /locus_tag="Strop_0620"
FT   CDS_pept        701160..702398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0620"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53100"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K0"
FT                   /protein_id="ABP53100.1"
FT                   /translation="MRGGPVRKNAVGRWWFAAPVAVALVASGCTTDNDGGEQPPPTTSA
FT                   TSATPALPVEPRTPEPGPLPAIPAAFASAAVYPAGDAAADILAADLNNDGHLDLATPNY
FT                   NSNDVAVLMADGTGGFLPPVALAAGRTPNGLVAGDFNGDNWLDLVAANLGSDEISVYLN
FT                   DGQGRFGEPVFTPAGDGAARIVARDLNGDGNLDLATPNLNGDDVTVLLGDGQGGFGEAS
FT                   HFAAGDGALRLSIADITRDDKLDLIVSNYNAGSISVLEGDGRGRFGPPSDYPAGDTASG
FT                   AALADFNGDGALDVASALYEVDQVAVLLGDGQGGFGAPTILTSGVHPGDLATGDFNGDG
FT                   YQDIVAPNFDSDDVTLFHGDGRGGFAVPENIAVGAGAPAIVVTDFNGDGKSDFATANSL
FT                   DDNVSVLLNTTGG"
FT   sig_peptide     701160..701303
FT                   /locus_tag="Strop_0620"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.971) with cleavage site probability 0.576 at
FT                   residue 48"
FT   gene            complement(702606..703439)
FT                   /locus_tag="Strop_0621"
FT   CDS_pept        complement(702606..703439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0621"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53101"
FT                   /db_xref="GOA:A4X2K1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K1"
FT                   /protein_id="ABP53101.1"
FT                   /translation="MPYITVGTENSTSIDVYYEDHGQGQPVVLIHGYPLSGHSWEKQAA
FT                   ALLQAGYRVITYDRRGFGQSSQPTVGYDYDTFATDLNTILETLDLTEVVLVGFSMGTGE
FT                   VARYLSRYGSARVAKAAFLASLEPFLLQTDDNPTGVPQDVFDGISAAVTADRYAYFTDF
FT                   YRNFYNTDDTLGTRLSEEALRNSWNVAAGASWYAASAAVPTWLTDFRADIPKIDVPSLI
FT                   LHGTADKILPVDATAREFHKRLPEADYVEIDGAPHGLLWTHTTEVNQALLTFLSR"
FT   gene            703659..703979
FT                   /pseudo
FT                   /locus_tag="Strop_0622"
FT   gene            complement(704329..705438)
FT                   /locus_tag="Strop_0623"
FT   CDS_pept        complement(704329..705438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0623"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53102"
FT                   /db_xref="GOA:A4X2K2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K2"
FT                   /protein_id="ABP53102.1"
FT                   /translation="MNLRRVNLAVRLFAAQVLVLAVGGLTLGLVAVAVGPRIFHAHLGR
FT                   VGGEVGAEARWHVEQAYASANALALGVGLLASLIAALAASAYATRRIARPVTHFAYASA
FT                   SLTDGHYDVRMADPGLGNELKILADSFNTMAERLETVEATRRRLLADLGHELRTPLATI
FT                   EAYLEAAEDGVAVDDEDLQSVLRAQTDRLHRLADDIAAVSRAETHQLDLHPVRTAPGDL
FT                   VRDAVAAAWPRYAGKGVTLRSDLRPSPQVDVDPQRMGQVLGNLLDNALRHTPEGGTVTV
FT                   HVIGGARSVELAVADTGPGIPAQHLPHIFERFYRVDTARDRGNGGSGIGLAIVRAVVSA
FT                   HGGRVRAENVPGGGAMVKVVLPPAGQAQV"
FT   sig_peptide     complement(705337..705438)
FT                   /locus_tag="Strop_0623"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.735 at
FT                   residue 34"
FT   gene            complement(705435..706157)
FT                   /locus_tag="Strop_0624"
FT   CDS_pept        complement(705435..706157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0624"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53103"
FT                   /db_xref="GOA:A4X2K3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K3"
FT                   /protein_id="ABP53103.1"
FT                   /translation="MRSRAARDQDTNGRVLVVDDEQSLAKVVASYLERDGYQVRCVFDG
FT                   PAALDAAREDEPDVVVLDLMLPGLDGVEVCRRLRAFSDCYVIMLTARTEETDKLTGLGV
FT                   GADDYLTKPFSPRELVARVAAMRRRPRQPRIRPEPALRRFGPLEVDVPAREARLDEVPV
FT                   PLTRTEFDLLAVLSGRPNVALSRAQLITAVWGDGWVGDERLVDVHIGHLRRKLGDGPAR
FT                   PRFILTVRGIGYRMRPQS"
FT   gene            complement(706154..707071)
FT                   /locus_tag="Strop_0625"
FT   CDS_pept        complement(706154..707071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0625"
FT                   /product="glycosyl hydrolase, BNR repeat-containing
FT                   protein"
FT                   /note="PFAM: glycosyl hydrolase, BNR repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53104"
FT                   /db_xref="GOA:A4X2K4"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K4"
FT                   /protein_id="ABP53104.1"
FT                   /translation="MRPRSTPGSGRKTQGRSASAAPTRKIVIAALAGLAVLTAVVVFAL
FT                   RGQGSSDDHTTGDAGNQGFGHVHGIAIDPGSSALHVATHVGLFRIDDPRTAVRVSKDDL
FT                   DLMGFTVVGPQHFLASGHSAHGPANVGLIESTDGGATWQEKSLSGAADFHGLQVAHGSV
FT                   YGYNSTDGAFMVSADQRSWEQRSRTAIGAFAVSPIDGGTVLAVGRDGLQRSTDGGRSWQ
FT                   SVPDTPAVGLLAWDRTGVWAVARDGAVWSSTDGGGQWQRRGAVPGEPDSFAVQDGTLFA
FT                   ALSGDRVVASTDGGATWTDRYAPE"
FT   sig_peptide     complement(706922..707071)
FT                   /locus_tag="Strop_0625"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.950 at
FT                   residue 50"
FT   gene            707302..708828
FT                   /locus_tag="Strop_0626"
FT   CDS_pept        707302..708828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0626"
FT                   /product="multicopper oxidase, type 3"
FT                   /note="PFAM: multicopper oxidase, type 1; multicopper
FT                   oxidase, type 2; multicopper oxidase, type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53105"
FT                   /db_xref="GOA:A4X2K5"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K5"
FT                   /protein_id="ABP53105.1"
FT                   /translation="MALLLTRRHLLAGTAGAVGLAGTAGIVAVAAERAAPKLVDPHAEA
FT                   IRRAELARRRSGAATVRATLNPRPVTLDLGGVTVDTWGYAEAATGPLIRAKAGDRLRVD
FT                   VVNDLPTDTSVHWHGVAMRNDMDGVPGVTQDPIGAGGHFTYEFILPDPGTYFYHPHSGV
FT                   QLDRALHGVLIVDDPNDAGRYDQEWIVVLDDWVDGTGRTPDDVLAALGADMSGMHGGHG
FT                   MPGMNHGAGMPMGGGEMETMMSPLLGGAGDIDYPHYLINGRVPAAPVTLTARPRQRVRI
FT                   RLVNAASDTAFRVALGGHRLTVTHSDGFPVVPDVTDALVVGMGERVDVEVVVADGAFPL
FT                   VAVAEGKTGQALAVVRTGGGRPPSAQVRAAELDRRVILTNQLRADDSVQLPQRSPDRTH
FT                   DLVLGGSMMPYRWTINGKTFGDAESLLVREGERVRLRMVNQTMMFHPMHVHGHTFALRD
FT                   GGPRKDTVIVTPRQTVTVDLDADNPGQWMTHCHNIYHAETGMMINLAYQL"
FT   sig_peptide     707302..707394
FT                   /locus_tag="Strop_0626"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.666 at
FT                   residue 31"
FT   gene            709083..709508
FT                   /locus_tag="Strop_0627"
FT   CDS_pept        709083..709508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53106"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K6"
FT                   /protein_id="ABP53106.1"
FT                   /translation="MGGLVVPTVDELVSRWVGFVAECEKSYQGDLDEYYNFIGLRSILS
FT                   GFFSNERMIAYTDVVDCIFKVVQADRRLVALLDHEQPVDVARGMIDDGAAWYWHFFPRY
FT                   CGPALAEEVHVNYQITLEVRGKPSVDSRGHRQRCRPR"
FT   gene            complement(709774..709977)
FT                   /locus_tag="Strop_0628"
FT   CDS_pept        complement(709774..709977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0628"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53107"
FT                   /db_xref="GOA:A4X2K7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K7"
FT                   /protein_id="ABP53107.1"
FT                   /translation="MTTGTVKWFNADKGFGFITPDGGGADVFAHFSAIATSGFRSLDEN
FT                   QKVEFDITQGQKGPQAENIRPL"
FT   gene            complement(710582..711163)
FT                   /locus_tag="Strop_0629"
FT   CDS_pept        complement(710582..711163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53108"
FT                   /db_xref="GOA:A4X2K8"
FT                   /db_xref="InterPro:IPR025588"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K8"
FT                   /protein_id="ABP53108.1"
FT                   /translation="MLVSPAAACRTAPATQLPVGATGHYRSGVHIRFDVPADPAYPSRV
FT                   AAALTIDQLRKYLYLGAALAATGMAGLAVARSLGWGDQIQPLWLTMLTGGLLAMLYWPW
FT                   VRLRARRRSSGYAVEGAYEITDDNILMRSGSQSSGIAWDGVDQVKDTPEFWILYVGQMP
FT                   ATVIPRRLMSAEDAETLRAYLTERGLLQVR"
FT   gene            711856..712317
FT                   /locus_tag="Strop_0630"
FT   CDS_pept        711856..712317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53109"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2K9"
FT                   /protein_id="ABP53109.1"
FT                   /translation="MIYVAAGDWEGDEVEPIDLDWQQGSNLNRCRRPADVDAAFDRGEE
FT                   HVGAALIALVHNNPDTDAVLPRVARGLRSPHPETRRQSLLALMHTARLHGRVDAVTVEL
FT                   LHGLLSDGTPISAGSPYEVRGTATQTVGDLTVFLPSAQLPDWVNHVSDY"
FT   gene            712307..712675
FT                   /locus_tag="Strop_0631"
FT   CDS_pept        712307..712675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53110"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L0"
FT                   /protein_id="ABP53110.1"
FT                   /translation="MTTDDWNAHVQQARTETAVRRRCFEVVGFEAGRLHSWRCNSLQRD
FT                   AQDRLGITVNELGLLNTVEQARAAAEMANRDASGSGAVHPGRRTLCLRGCDGDLCRRHL
FT                   LSWSGHGRLRCPRLCRHQ"
FT   gene            complement(712620..713948)
FT                   /locus_tag="Strop_0632"
FT   CDS_pept        complement(712620..713948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0632"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53111"
FT                   /db_xref="GOA:A4X2L1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L1"
FT                   /protein_id="ABP53111.1"
FT                   /translation="MPTATTVPADPTVGGHHGWRVVTALAITSTIGYGTLYYAYPVLLT
FT                   PMATSIGSSTAAVTGALTASVLTSALMAIPVGRWLDHHGGRALMTTGSIIATALLIAWS
FT                   QVHTIGQLYAVMIGIGACGAMVLYEPAFAVIVSLFTPDRRATALLAVTIVAGFASAVFM
FT                   PLTGLLTEHLGWRGALLVLAAIHGTVTVPLHAMTVRKPRPTGTAPAGPVRRAHPGRRAV
FT                   VHAAMRDSRFWILTATFTAHGLATSTMTVHLIGYLISRGHPATFAATATGLLGVLSVTG
FT                   RLVLTAARRHLRVSTVVAAVYATQAAAVLAMPLLAATRTGAIISVIGFGLGFGITSLAT
FT                   PALLTEQYGTTAYATIAGRLAAPVTVAKATGPLAAAALLHISVGYAPLLVGVATCCALA
FT                   AIGVTARAKVLAAANQQDDSLGLVGITDVGRDGGTGGDRGRTN"
FT   gene            complement(713948..715222)
FT                   /locus_tag="Strop_0633"
FT   CDS_pept        complement(713948..715222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0633"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53112"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L2"
FT                   /protein_id="ABP53112.1"
FT                   /translation="MRTLDTLPVVVIGAGPVGLSAAAHLHERGLPFLVLEAGDTAGAAV
FT                   RQWGHVRVFSPWRYDIDPAARRLLEDADWVAPDLDALPTGAELSAEYLQPLAELPQLKP
FT                   HLRYGARVEAISRLGLDRLRTAGRDTTPFLVRLADGEEMLARAVIDASGTWGTPNVLGA
FT                   SGLPAHGEADARAYLEHALPDVLGADRDRFAGRHTLVVGAGHSAANTLLSLADLAIEQS
FT                   GTEVTWAIRTASPSRAYGGGDADALPARGALGSRLRAHVDAGQIRLLTGFSVHALTPTD
FT                   SRVTVVVRHGDGSEESLTVDRIVAATGFRPDHCIAAELRLDLDPVMGATRALAPLIDPN
FT                   EHSCGTVPPHGVDELTHPEVGYYAVGMKSYGRAPTFLMATGYEQARSVVAALAGDWAAA
FT                   RDVQLDLPETGVCNSNPADPPAGGC"
FT   sig_peptide     complement(715154..715222)
FT                   /locus_tag="Strop_0633"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.703) with cleavage site probability 0.568 at
FT                   residue 23"
FT   gene            715559..716920
FT                   /locus_tag="Strop_0634"
FT   CDS_pept        715559..716920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0634"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; major intrinsic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53113"
FT                   /db_xref="GOA:A4X2L3"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L3"
FT                   /protein_id="ABP53113.1"
FT                   /translation="MGENRPMTPTLWRRLLAEFTGTALLVTAVVGSGIMAATLSPADVG
FT                   LQLLQNSIATAFALGTLILIFGPVSGAHFNPVVSIADWFLGRRTGTGLTARDLGGYVVA
FT                   QVLGAIAGSVLANLMFDLAAVDLSGKDRAAGHLWLGEVVATAGLILIIFALARSGRAPI
FT                   APAAVGAYIGAAYWFTSSTSFANPAVTVGRAFTDTFAGIAPSSVPGFVLAQLVGLAVGV
FT                   GLLAALYPDAGQAADHVVVPLPRQRPGARPQQPPRPAPARDLRRGSGQPVPQSALHERL
FT                   VMSDKPSVLFVCVHNAGRSQMAAGWLRHLAGDTVEVRSAGSAPAKTVNPAAVEAMREVG
FT                   IDITDQTPKLFEYATAESSDVIVTMGCGDACPVFPGKRYEDWKLDDPAGKGVDAVRPIR
FT                   DDIRTRVEKLLAELRPAVGEVDRDVAGGGDGQVRLSARLSGEGRHLRPGGTNGV"
FT   sig_peptide     715559..715669
FT                   /locus_tag="Strop_0634"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.531 at
FT                   residue 37"
FT   gene            717090..718073
FT                   /locus_tag="Strop_0635"
FT   CDS_pept        717090..718073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0635"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53114"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L4"
FT                   /protein_id="ABP53114.1"
FT                   /translation="MKQLRDRLDELLQAGQLGGLHAVVAVRGGQTLLEYYGTGEDFAWS
FT                   DSRGIVEFGPETLHDIRSVTKSVTALLYGIALGDGLVPPPEEPLVPRFPQYPDLAADPQ
FT                   RARLTVAHALTMSLGLEWSEDLPYNSPANAEIAMELAPDRYRYILERPILEPPGTRWTY
FT                   CGGATALLGQLITDGTGLSLPQYGQAMLFTPLGIDQFEWMAGADGVASPASGLRLAPRN
FT                   LARLGELVLANGAWDSQPLVPAGWIHTMLQPRLQTTWGGQYGYQWYVESTKDPQLVAGM
FT                   GNGGQRLYVLPDLDLTVAVTAGNYDDPDQWRTPLAVLEQVILPAVA"
FT   gene            complement(718170..719606)
FT                   /locus_tag="Strop_0636"
FT   CDS_pept        complement(718170..719606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0636"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53115"
FT                   /db_xref="GOA:A4X2L5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L5"
FT                   /protein_id="ABP53115.1"
FT                   /translation="MKDDSSFRTLANAMAEEIEALPEGTRIATHRELVKRFSASGTTVS
FT                   AALALLTQRGLIVSRPGAGTYRTADRRVTPTGDTSWQESALDAAGPHASPVGSQRDFKA
FT                   HAWMGTLLTPDPDIVDLSGGYLHPGLQPLDALATALSRAAKRAQAWDRPPAAGLPELRD
FT                   WFAADIGGGLGRHDILLCAAGQSALATTMRALAQPGEPVIIESPTYQGTIAAAQAAGLR
FT                   PVPVPLDTDGLRSDHLDQALTRTRARVIIVQPLFQNPTGASLSMARQHEIKAIARRHCA
FT                   FVVEDDFARHMTHDDADPTPPPMISHDPDGTVVHIRSLTKVTSPNLRVGAIAARGQVLA
FT                   RLRSAHLIDTLIVPAPLQLTALEVVTSSGWRRTLKALGVALTHRRTVATEAVTATFGDH
FT                   ALALRPRGGYHLWVSLPAHLDEQQLTAAALAKGVAVTPGTNYYVTDSNPTRIRISYAAA
FT                   PSASDVADAIRRLAPLIIEP"
FT   gene            719605..720507
FT                   /locus_tag="Strop_0637"
FT   CDS_pept        719605..720507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0637"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53116"
FT                   /db_xref="GOA:A4X2L6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L6"
FT                   /protein_id="ABP53116.1"
FT                   /translation="MRVENSAITEIRIPPLSSGTLFASLGVLSFSFSLPATLWVLDGFG
FT                   PWSATGVRGVLAAAVALTALIVARVPLPTRGDWHALTVVAVGCVIGFPLLTTLALQTST
FT                   TAHSAVVVGAMPLATAAISALRTGRRPSLMFWTAASIGAATVMAFTISQNHGQPTIADL
FT                   YLLGGLVVCAAGYVEGGRLSVRMPGWQVIAWGVVLAGPVSLAVCVVALPHEPVRLTVEA
FT                   LVGMAYIAGVSQFGGFVLWYGGMGLIGVTRASQLQLAQPMLTLLWASLILGEPLNVAMP
FT                   LTAAVALGCIVVTQRARMA"
FT   gene            complement(720750..721526)
FT                   /locus_tag="Strop_0638"
FT   CDS_pept        complement(720750..721526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53117"
FT                   /db_xref="GOA:A4X2L7"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L7"
FT                   /protein_id="ABP53117.1"
FT                   /translation="MEVSVLNEVDRTRRWWHALRLALVLLWLLAAVTAWWTAPRQQSYE
FT                   KVRADSAAGHVVAYQWGDHWGANDPGHWFGAPVLQQGSGQPGPLFAWKTSDGRVHWTDT
FT                   TTFDQVAVTDAVAVESYSGVGAVGIAQNLRDAGIDHRAILASQRTPVVTGIVVLLAAIA
FT                   LGVVIVGPTPHLGTRWFWFWLLFFTPQGLGLLYWLAREHPWARPTADPAAPGGGDRRDR
FT                   GALGFAIGIIVAIVYSAVLLILHRTLGDWWVPSPGA"
FT   gene            721801..723000
FT                   /locus_tag="Strop_0639"
FT   CDS_pept        721801..723000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0639"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53118"
FT                   /db_xref="GOA:A4X2L8"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L8"
FT                   /protein_id="ABP53118.1"
FT                   /translation="MTYAVLPHTRAPVRVWTDPHTIEPQAARQLRNIGTLPWVQGVAVM
FT                   PDVHFGKGATVGSVIAMRQAVSPAAVGVDIGCGMSAVRTSLTAADLPDDLAGLRRAIED
FT                   AIPVGFAQRDKAVNPRRVRGLEQAGWDAFWQRFTGLHEGVTRLERRAMNQMGTLGGGNH
FT                   FIEVCLEQGGVDAGRVWLMLHSGSRNIGKELAERHMAVARRLPHNAALPDRDLAVFLAG
FT                   TAEMDAYRRDLWWAQEYARRNRAVMLALLCTVVRDRFPQVRYDEPISCHHNYVAEETYD
FT                   GVEVLVTRKGAIRAGAGELGIIPGSMGTGSYIVRGRGNESAYCSASHGAGRRMSRGQAK
FT                   RSFTTDDLAAQTTGVECRKDAGVVDEIPGAYKDINAVMAQQTDLVEVVAHLKQVVCVKG
FT                   "
FT   gene            723025..723909
FT                   /locus_tag="Strop_0640"
FT   CDS_pept        723025..723909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53119"
FT                   /db_xref="InterPro:IPR022074"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2L9"
FT                   /protein_id="ABP53119.1"
FT                   /translation="MAGMDGSGFPGVSLHPACSQALRHVATRSAGPPVDASLRITLNFH
FT                   PDWMTTGSPVLGKMVEDGVYLSQFVTGTSNGGLSAYPGGDRWRWEQRMFGGAYDAVPAH
FT                   CRPVYGALNFRHKPTGAAPRFGSAHLRLTASTLGRATFCYPDSHLEPTMFGVAERMSLV
FT                   DLARADCRDDLDDYVEAQVHGAVRLDRDVEALVLDSCYRGTDVENLARRLPCPLEWHPG
FT                   FRLSIAELRRHPDYRGPRYVELGVALAIGGYLNPRLIGDAVRTGRYRRQDLKRVWHHLA
FT                   RFGGPATPSRIPG"
FT   gene            complement(723975..724772)
FT                   /locus_tag="Strop_0641"
FT   CDS_pept        complement(723975..724772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0641"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53120"
FT                   /db_xref="GOA:A4X2M0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M0"
FT                   /protein_id="ABP53120.1"
FT                   /translation="MIGAKIGAGREADVHAWRDDAIIKLYRPGLLGHRAEAKALATLAG
FT                   HGIAPRLDDTVQWDGRVGLVLERLDGADLLTLLQRQPWRMLGMARTLAATHLAVHQVSA
FT                   PADLPELRSVLAARITTATMPTRLRSFALRLLDALPEGERLCHGDYHPGNLMLTDGRAT
FT                   VIDWPNATRGVPAADHARTMLLLRYSAPLPETSRVTRRLITSSRSVFTRRYSRAYRAGS
FT                   VQPLSQSGPWLAVQAAARLSEGVAVERATLFDLLERLVHQIKR"
FT   gene            complement(724769..725542)
FT                   /locus_tag="Strop_0642"
FT   CDS_pept        complement(724769..725542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0642"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53121"
FT                   /db_xref="GOA:A4X2M1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M1"
FT                   /protein_id="ABP53121.1"
FT                   /translation="MRAFQELVDEAAAADVSGWSFDWLDGRATEQRPPWRYSRLLAARL
FT                   PHSPSALDIDTGGGEVIAEMPQLASRMVVTEGWPPNVERARVLLQPRGVAVVAVEPGRS
FT                   LPFADASFSLVTSRHPVRPDWSEIARVLRDGGSYLAQHVGPASAFELIEYFRGPLPHER
FT                   FARDPHRGVAAARRAGLEIVELRTARCRMEFFDIGAVVYTLRKCAWWVPDFAVEWHRAR
FT                   LERLDAHIRTHGAFVAHSTRILIEASRAPRREAQQ"
FT   gene            complement(725692..725877)
FT                   /locus_tag="Strop_0643"
FT   CDS_pept        complement(725692..725877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0643"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53122"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M2"
FT                   /protein_id="ABP53122.1"
FT                   /translation="MTNLTGARWRKSTRSGNGNNCVEVADNLPGVVGVRDSKDPTGPAL
FT                   VFGPEAWQAFVTHARR"
FT   gene            complement(725870..726763)
FT                   /locus_tag="Strop_0644"
FT   CDS_pept        complement(725870..726763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0644"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53123"
FT                   /db_xref="GOA:A4X2M3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M3"
FT                   /protein_id="ABP53123.1"
FT                   /translation="MVGSALVRRSIGRRLAILRRAANLTQEQAAEHLQKGRATIARMED
FT                   GTEGVRFRDIDVKAMCELYGAEQADLDLLLALTAETRNGRKKSWWHDYTETELPQFFGL
FT                   YVSLEDSAETIRQYEVELIPGLLQTRAYAEQVHQVPKGYVDQAERERRVTVRLARQSLL
FT                   SRPRAPHLSVILNEAVLHRLVGGADVMAEQFKHLLDVTQRGNISVRVLPFAAGIHGGMA
FT                   ASTPFSLLDFPTDPVGEVLEPPLAYVDTLTGALYLNKPDESSAYQLVWEDLDDRAIDEA
FT                   ASKKMIATALEELSGD"
FT   gene            727572..727778
FT                   /pseudo
FT                   /locus_tag="Strop_0645"
FT   gene            728026..728853
FT                   /locus_tag="Strop_0646"
FT   CDS_pept        728026..728853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0646"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53124"
FT                   /db_xref="GOA:A4X2M4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M4"
FT                   /protein_id="ABP53124.1"
FT                   /translation="MAGGVGVGGPELRRWLAGTAAVVAGGAVVHALPVVTASGALRRRC
FT                   WPRLAGVGAASRIALTFDDGPSRTSTTRFLRALERADVRATFFLLGTLLDRDPGLGREM
FT                   AAAGHELAVHGWEHRNLLCRSPAATYADIARARDTVAAVTGASPLWYRPPYGVLTVSAL
FT                   LACRRLGLTPRLWTTWGRDWDATRSPAVIWETIVQDLDGGGTLLLHDSDHAASPGAWRG
FT                   ALAILPRLVSWAQERELTIGTLGAHEETEAAREPGAWRTPVRARPGHDDVPGG"
FT   gene            728863..730056
FT                   /locus_tag="Strop_0647"
FT   CDS_pept        728863..730056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0647"
FT                   /product="Monogalactosyldiacylglycerol synthase"
FT                   /EC_number="2.4.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53125"
FT                   /db_xref="GOA:A4X2M5"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M5"
FT                   /protein_id="ABP53125.1"
FT                   /translation="MKPWPGGRSPRAGTSPAAAGTSPAAGRDDPDGGPGQLRILVVSAD
FT                   IGAGHDAAAAELAARLAGDGVVEQLNFFAALPRPLHRLVREGYRTMLQRFPWSYDALFR
FT                   FTDRSSLMVRAFRAALRAAVPRMLSRISADTCLVVTTHPFANQLLGPMRGTGQLTVPVL
FT                   SYVTDFVVHPIWISPGVDTYCVVHDGTQRQAAARGAADVRVVNPLISAEFAASATACQR
FT                   TARARFGLPEQERLALIVAGSWGVGDVARTARDVLAAGCVTPVVACGRNVRLRQRLRTF
FT                   PGHVLGWVEDMPTLMRAVDVVVENAGGLTCQQSLAGGLPTVTYRPISGHGRANAQLLAE
FT                   AGLTTHVTSAAELGPALTKLTGVAGSPALPVGSATDMASVVSEVVRSGNRLDRKRPV"
FT   gene            complement(730082..731002)
FT                   /locus_tag="Strop_0648"
FT   CDS_pept        complement(730082..731002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53126"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M6"
FT                   /protein_id="ABP53126.1"
FT                   /translation="MTLFKWLRQADVDAGVKPGVSGVVSRAARGPQTDPLAGAGERGPA
FT                   SGRGVSVAGASAGKGRYSLVSELAADGIPVAVTCRVLNIARQPYYRWLGRPVGDAEIVA
FT                   AHRANALVDAHRDDPEFGYRFLVDEARTAGQAMAERTGWKICSDNGWRSALGKRKKRGK
FT                   GGKVGPPVHDDLVQRDFTTDGPNRLWLADITEHRTGVRLARPLAVDLCHPWERPAPRLT
FT                   QPASAADFGTYAPTAPVPPVHRNPPDQDPAAHQDDPTATPPAATTSTSSPAAARPGGQH
FT                   LPRRSRPIPGRAGPGRYAAVAPRTG"
FT   gene            731455..731703
FT                   /pseudo
FT                   /locus_tag="Strop_0649"
FT   gene            732259..732393
FT                   /locus_tag="Strop_0650"
FT   CDS_pept        732259..732393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53127"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M7"
FT                   /protein_id="ABP53127.1"
FT                   /translation="MVETVLGSLTGLLFIADALHTQTAHADEIAAGGARLAGGLPAQG"
FT   sig_peptide     732259..732339
FT                   /locus_tag="Strop_0650"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.950 at
FT                   residue 27"
FT   gene            complement(732618..733301)
FT                   /locus_tag="Strop_0651"
FT   CDS_pept        complement(732618..733301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53128"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M8"
FT                   /protein_id="ABP53128.1"
FT                   /translation="MDHQITRRTVLRTAGLTSAAVAVSSVLPDTSASAAERRRPKRPAT
FT                   STNGWTIQANVDRDSQVWTRSVAGTGLSVPVWIGDVEVILLHAVRRFHYEIEEIQRTDL
FT                   TGWCDISKLRKSAPESNLASGTAVRIRPGARAKGGFFPLQELVLRDILADCEGAVRWGG
FT                   DDREVDESLFYIAFGPHDRRVRQAAVKLRGWEVKPGEGAGVRFDFLSPSRLSRADNLAR
FT                   AQHSG"
FT   sig_peptide     complement(733197..733301)
FT                   /locus_tag="Strop_0651"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 35"
FT   gene            complement(733327..733659)
FT                   /locus_tag="Strop_0652"
FT   CDS_pept        complement(733327..733659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53129"
FT                   /db_xref="GOA:A4X2M9"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2M9"
FT                   /protein_id="ABP53129.1"
FT                   /translation="MTRTRTWNLPVPVGVNLLLGIPAIVPLFLAWYIIVNGPLAALGWT
FT                   QRNPNEDDGMLLWLVIAAPVFCLFGLIWGLANLRMRRRTATSASQYWIACVIASLAPYI
FT                   VGFFLF"
FT   gene            complement(733671..735866)
FT                   /locus_tag="Strop_0653"
FT   CDS_pept        complement(733671..735866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53130"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2N0"
FT                   /protein_id="