(data stored in ACNUC8465 zone)

EMBL: CP000668

ID   CP000668; SV 1; circular; genomic DNA; STD; PRO; 4517345 BP.
XX
AC   CP000668;
XX
PR   Project:PRJNA16700;
XX
DT   20-APR-2007 (Rel. 91, Created)
DT   01-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Yersinia pestis Pestoides F, complete genome.
XX
KW   .
XX
OS   Yersinia pestis Pestoides F
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Yersiniaceae; Yersinia.
XX
RN   [1]
RP   1-4517345
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Di Bartolo G., Chain P., Malfatti S., Shin M., Vergez L., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Worsham P., Chu M., Bearden S., Garcia E.,
RA   Richardson P.;
RT   "Complete sequence of chromosome of Yersinia pestis Pestoides F";
RL   Unpublished.
XX
RN   [2]
RP   1-4517345
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Chain P., Malfatti S.,
RA   Shin M., Vergez L., Schmutz J., Larimer F., Land M., Hauser L., Worsham P.,
RA   Chu M., Bearden S., Garcia E., Richardson P.;
RT   ;
RL   Submitted (05-FEB-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 13f1369eb8376f8fb3df3318485b92bf.
DR   BioSample; SAMN02598373.
DR   EnsemblGenomes-Gn; EBG00001058146.
DR   EnsemblGenomes-Gn; EBG00001058147.
DR   EnsemblGenomes-Gn; EBG00001058148.
DR   EnsemblGenomes-Gn; EBG00001058149.
DR   EnsemblGenomes-Gn; EBG00001058150.
DR   EnsemblGenomes-Gn; EBG00001058151.
DR   EnsemblGenomes-Gn; EBG00001058152.
DR   EnsemblGenomes-Gn; EBG00001058153.
DR   EnsemblGenomes-Gn; EBG00001058154.
DR   EnsemblGenomes-Gn; EBG00001058155.
DR   EnsemblGenomes-Gn; EBG00001058156.
DR   EnsemblGenomes-Gn; EBG00001058157.
DR   EnsemblGenomes-Gn; EBG00001058158.
DR   EnsemblGenomes-Gn; EBG00001058159.
DR   EnsemblGenomes-Gn; EBG00001058160.
DR   EnsemblGenomes-Gn; EBG00001058161.
DR   EnsemblGenomes-Gn; EBG00001058162.
DR   EnsemblGenomes-Gn; EBG00001058163.
DR   EnsemblGenomes-Gn; EBG00001058164.
DR   EnsemblGenomes-Gn; EBG00001058165.
DR   EnsemblGenomes-Gn; EBG00001058166.
DR   EnsemblGenomes-Gn; EBG00001058167.
DR   EnsemblGenomes-Gn; EBG00001058168.
DR   EnsemblGenomes-Gn; EBG00001058169.
DR   EnsemblGenomes-Gn; EBG00001058170.
DR   EnsemblGenomes-Gn; EBG00001058171.
DR   EnsemblGenomes-Gn; EBG00001058172.
DR   EnsemblGenomes-Gn; EBG00001058173.
DR   EnsemblGenomes-Gn; EBG00001058174.
DR   EnsemblGenomes-Gn; EBG00001058175.
DR   EnsemblGenomes-Gn; EBG00001058176.
DR   EnsemblGenomes-Gn; EBG00001058177.
DR   EnsemblGenomes-Gn; EBG00001058178.
DR   EnsemblGenomes-Gn; EBG00001058179.
DR   EnsemblGenomes-Gn; EBG00001058180.
DR   EnsemblGenomes-Gn; EBG00001058181.
DR   EnsemblGenomes-Gn; EBG00001058182.
DR   EnsemblGenomes-Gn; EBG00001058183.
DR   EnsemblGenomes-Gn; EBG00001058184.
DR   EnsemblGenomes-Gn; EBG00001058185.
DR   EnsemblGenomes-Gn; EBG00001058186.
DR   EnsemblGenomes-Gn; EBG00001058187.
DR   EnsemblGenomes-Gn; EBG00001058188.
DR   EnsemblGenomes-Gn; EBG00001058189.
DR   EnsemblGenomes-Gn; EBG00001058190.
DR   EnsemblGenomes-Gn; EBG00001058191.
DR   EnsemblGenomes-Gn; EBG00001058192.
DR   EnsemblGenomes-Gn; EBG00001058193.
DR   EnsemblGenomes-Gn; EBG00001058194.
DR   EnsemblGenomes-Gn; EBG00001058195.
DR   EnsemblGenomes-Gn; EBG00001058196.
DR   EnsemblGenomes-Gn; EBG00001058197.
DR   EnsemblGenomes-Gn; EBG00001058198.
DR   EnsemblGenomes-Gn; EBG00001058199.
DR   EnsemblGenomes-Gn; EBG00001058200.
DR   EnsemblGenomes-Gn; EBG00001058201.
DR   EnsemblGenomes-Gn; EBG00001058202.
DR   EnsemblGenomes-Gn; EBG00001058203.
DR   EnsemblGenomes-Gn; EBG00001058204.
DR   EnsemblGenomes-Gn; EBG00001058205.
DR   EnsemblGenomes-Gn; EBG00001058206.
DR   EnsemblGenomes-Gn; EBG00001058207.
DR   EnsemblGenomes-Gn; EBG00001058208.
DR   EnsemblGenomes-Gn; EBG00001058209.
DR   EnsemblGenomes-Gn; EBG00001058211.
DR   EnsemblGenomes-Gn; EBG00001058212.
DR   EnsemblGenomes-Gn; EBG00001058214.
DR   EnsemblGenomes-Gn; EBG00001058215.
DR   EnsemblGenomes-Gn; EBG00001058217.
DR   EnsemblGenomes-Gn; EBG00001058219.
DR   EnsemblGenomes-Gn; EBG00001058221.
DR   EnsemblGenomes-Gn; EBG00001058223.
DR   EnsemblGenomes-Gn; EBG00001058225.
DR   EnsemblGenomes-Gn; EBG00001058226.
DR   EnsemblGenomes-Gn; EBG00001058227.
DR   EnsemblGenomes-Gn; EBG00001058228.
DR   EnsemblGenomes-Gn; EBG00001058229.
DR   EnsemblGenomes-Gn; EBG00001058230.
DR   EnsemblGenomes-Gn; EBG00001058231.
DR   EnsemblGenomes-Gn; EBG00001058232.
DR   EnsemblGenomes-Gn; EBG00001058233.
DR   EnsemblGenomes-Gn; EBG00001058234.
DR   EnsemblGenomes-Gn; EBG00001058235.
DR   EnsemblGenomes-Gn; EBG00001058236.
DR   EnsemblGenomes-Gn; EBG00001058237.
DR   EnsemblGenomes-Gn; EBG00001058238.
DR   EnsemblGenomes-Gn; EBG00001058239.
DR   EnsemblGenomes-Gn; EBG00001058240.
DR   EnsemblGenomes-Gn; EBG00001058241.
DR   EnsemblGenomes-Gn; EBG00001058242.
DR   EnsemblGenomes-Gn; EBG00001058243.
DR   EnsemblGenomes-Gn; EBG00001058244.
DR   EnsemblGenomes-Gn; EBG00001058245.
DR   EnsemblGenomes-Gn; EBG00001058246.
DR   EnsemblGenomes-Gn; EBG00001058247.
DR   EnsemblGenomes-Gn; EBG00001058248.
DR   EnsemblGenomes-Gn; EBG00001058249.
DR   EnsemblGenomes-Gn; EBG00001058250.
DR   EnsemblGenomes-Gn; EBG00001058251.
DR   EnsemblGenomes-Gn; EBG00001058252.
DR   EnsemblGenomes-Gn; EBG00001058253.
DR   EnsemblGenomes-Gn; EBG00001058254.
DR   EnsemblGenomes-Gn; EBG00001058255.
DR   EnsemblGenomes-Gn; EBG00001058256.
DR   EnsemblGenomes-Gn; EBG00001058257.
DR   EnsemblGenomes-Gn; EBG00001058258.
DR   EnsemblGenomes-Gn; EBG00001058259.
DR   EnsemblGenomes-Gn; EBG00001058260.
DR   EnsemblGenomes-Gn; EBG00001058261.
DR   EnsemblGenomes-Gn; EBG00001058262.
DR   EnsemblGenomes-Gn; EBG00001058263.
DR   EnsemblGenomes-Gn; EBG00001058264.
DR   EnsemblGenomes-Gn; EBG00001058265.
DR   EnsemblGenomes-Gn; EBG00001058266.
DR   EnsemblGenomes-Gn; EBG00001058267.
DR   EnsemblGenomes-Gn; EBG00001058268.
DR   EnsemblGenomes-Gn; EBG00001058269.
DR   EnsemblGenomes-Gn; EBG00001058270.
DR   EnsemblGenomes-Gn; EBG00001058271.
DR   EnsemblGenomes-Gn; EBG00001058272.
DR   EnsemblGenomes-Gn; EBG00001058273.
DR   EnsemblGenomes-Gn; EBG00001058274.
DR   EnsemblGenomes-Gn; EBG00001058275.
DR   EnsemblGenomes-Gn; EBG00001058276.
DR   EnsemblGenomes-Gn; EBG00001058277.
DR   EnsemblGenomes-Gn; EBG00001058278.
DR   EnsemblGenomes-Gn; EBG00001058279.
DR   EnsemblGenomes-Gn; EBG00001058280.
DR   EnsemblGenomes-Gn; EBG00001058281.
DR   EnsemblGenomes-Gn; EBG00001058282.
DR   EnsemblGenomes-Gn; EBG00001058283.
DR   EnsemblGenomes-Gn; EBG00001058284.
DR   EnsemblGenomes-Gn; EBG00001058285.
DR   EnsemblGenomes-Gn; EBG00001058286.
DR   EnsemblGenomes-Gn; EBG00001058287.
DR   EnsemblGenomes-Gn; EBG00001058288.
DR   EnsemblGenomes-Gn; EBG00001058289.
DR   EnsemblGenomes-Gn; EBG00001058290.
DR   EnsemblGenomes-Gn; EBG00001058291.
DR   EnsemblGenomes-Gn; EBG00001058292.
DR   EnsemblGenomes-Gn; EBG00001058293.
DR   EnsemblGenomes-Gn; EBG00001058294.
DR   EnsemblGenomes-Gn; EBG00001058295.
DR   EnsemblGenomes-Gn; EBG00001058296.
DR   EnsemblGenomes-Gn; EBG00001058297.
DR   EnsemblGenomes-Gn; EBG00001058298.
DR   EnsemblGenomes-Gn; EBG00001058299.
DR   EnsemblGenomes-Gn; EBG00001058300.
DR   EnsemblGenomes-Gn; EBG00001058301.
DR   EnsemblGenomes-Gn; EBG00001058302.
DR   EnsemblGenomes-Gn; EBG00001058303.
DR   EnsemblGenomes-Gn; EBG00001058304.
DR   EnsemblGenomes-Gn; EBG00001058305.
DR   EnsemblGenomes-Gn; EBG00001058306.
DR   EnsemblGenomes-Gn; EBG00001058307.
DR   EnsemblGenomes-Gn; EBG00001058308.
DR   EnsemblGenomes-Gn; EBG00001058309.
DR   EnsemblGenomes-Gn; EBG00001058310.
DR   EnsemblGenomes-Gn; EBG00001058311.
DR   EnsemblGenomes-Gn; EBG00001058312.
DR   EnsemblGenomes-Gn; EBG00001058313.
DR   EnsemblGenomes-Gn; EBG00001058314.
DR   EnsemblGenomes-Gn; EBG00001058315.
DR   EnsemblGenomes-Gn; EBG00001058316.
DR   EnsemblGenomes-Gn; EBG00001058317.
DR   EnsemblGenomes-Gn; EBG00001058318.
DR   EnsemblGenomes-Gn; EBG00001058319.
DR   EnsemblGenomes-Gn; EBG00001058320.
DR   EnsemblGenomes-Gn; EBG00001058321.
DR   EnsemblGenomes-Gn; EBG00001058322.
DR   EnsemblGenomes-Gn; EBG00001058324.
DR   EnsemblGenomes-Gn; EBG00001058327.
DR   EnsemblGenomes-Gn; EBG00001058328.
DR   EnsemblGenomes-Gn; EBG00001058330.
DR   EnsemblGenomes-Gn; EBG00001058332.
DR   EnsemblGenomes-Gn; EBG00001058335.
DR   EnsemblGenomes-Gn; EBG00001058337.
DR   EnsemblGenomes-Gn; EBG00001058339.
DR   EnsemblGenomes-Gn; EBG00001058340.
DR   EnsemblGenomes-Gn; EBG00001058343.
DR   EnsemblGenomes-Gn; EBG00001058344.
DR   EnsemblGenomes-Gn; EBG00001058346.
DR   EnsemblGenomes-Gn; EBG00001058347.
DR   EnsemblGenomes-Gn; EBG00001058349.
DR   EnsemblGenomes-Gn; EBG00001058351.
DR   EnsemblGenomes-Gn; EBG00001058353.
DR   EnsemblGenomes-Gn; EBG00001058355.
DR   EnsemblGenomes-Gn; EBG00001058357.
DR   EnsemblGenomes-Gn; EBG00001058359.
DR   EnsemblGenomes-Gn; EBG00001058361.
DR   EnsemblGenomes-Gn; EBG00001058363.
DR   EnsemblGenomes-Gn; EBG00001058365.
DR   EnsemblGenomes-Gn; EBG00001058367.
DR   EnsemblGenomes-Gn; EBG00001058368.
DR   EnsemblGenomes-Gn; EBG00001058369.
DR   EnsemblGenomes-Gn; EBG00001058372.
DR   EnsemblGenomes-Gn; EBG00001058373.
DR   EnsemblGenomes-Gn; EBG00001058375.
DR   EnsemblGenomes-Gn; EBG00001058376.
DR   EnsemblGenomes-Gn; EBG00001058379.
DR   EnsemblGenomes-Gn; EBG00001058380.
DR   EnsemblGenomes-Gn; EBG00001058381.
DR   EnsemblGenomes-Gn; EBG00001058383.
DR   EnsemblGenomes-Gn; EBG00001058384.
DR   EnsemblGenomes-Gn; EBG00001058386.
DR   EnsemblGenomes-Gn; EBG00001058387.
DR   EnsemblGenomes-Gn; EBG00001058389.
DR   EnsemblGenomes-Gn; EBG00001058391.
DR   EnsemblGenomes-Gn; EBG00001058392.
DR   EnsemblGenomes-Gn; EBG00001058394.
DR   EnsemblGenomes-Gn; EBG00001058396.
DR   EnsemblGenomes-Gn; EBG00001058398.
DR   EnsemblGenomes-Gn; EBG00001058400.
DR   EnsemblGenomes-Gn; EBG00001058402.
DR   EnsemblGenomes-Gn; EBG00001058404.
DR   EnsemblGenomes-Gn; EBG00001058406.
DR   EnsemblGenomes-Gn; EBG00001058408.
DR   EnsemblGenomes-Gn; EBG00001058409.
DR   EnsemblGenomes-Gn; EBG00001058411.
DR   EnsemblGenomes-Gn; EBG00001058413.
DR   EnsemblGenomes-Gn; EBG00001058415.
DR   EnsemblGenomes-Gn; EBG00001058416.
DR   EnsemblGenomes-Gn; EBG00001058418.
DR   EnsemblGenomes-Gn; EBG00001058420.
DR   EnsemblGenomes-Gn; EBG00001058422.
DR   EnsemblGenomes-Gn; YPDSF_R0001.
DR   EnsemblGenomes-Gn; YPDSF_R0002.
DR   EnsemblGenomes-Gn; YPDSF_R0003.
DR   EnsemblGenomes-Gn; YPDSF_R0004.
DR   EnsemblGenomes-Gn; YPDSF_R0005.
DR   EnsemblGenomes-Gn; YPDSF_R0006.
DR   EnsemblGenomes-Gn; YPDSF_R0008.
DR   EnsemblGenomes-Gn; YPDSF_R0010.
DR   EnsemblGenomes-Gn; YPDSF_R0012.
DR   EnsemblGenomes-Gn; YPDSF_R0013.
DR   EnsemblGenomes-Gn; YPDSF_R0014.
DR   EnsemblGenomes-Gn; YPDSF_R0015.
DR   EnsemblGenomes-Gn; YPDSF_R0016.
DR   EnsemblGenomes-Gn; YPDSF_R0017.
DR   EnsemblGenomes-Gn; YPDSF_R0018.
DR   EnsemblGenomes-Gn; YPDSF_R0019.
DR   EnsemblGenomes-Gn; YPDSF_R0020.
DR   EnsemblGenomes-Gn; YPDSF_R0021.
DR   EnsemblGenomes-Gn; YPDSF_R0022.
DR   EnsemblGenomes-Gn; YPDSF_R0025.
DR   EnsemblGenomes-Gn; YPDSF_R0026.
DR   EnsemblGenomes-Gn; YPDSF_R0027.
DR   EnsemblGenomes-Gn; YPDSF_R0028.
DR   EnsemblGenomes-Gn; YPDSF_R0029.
DR   EnsemblGenomes-Gn; YPDSF_R0030.
DR   EnsemblGenomes-Gn; YPDSF_R0031.
DR   EnsemblGenomes-Gn; YPDSF_R0032.
DR   EnsemblGenomes-Gn; YPDSF_R0033.
DR   EnsemblGenomes-Gn; YPDSF_R0035.
DR   EnsemblGenomes-Gn; YPDSF_R0036.
DR   EnsemblGenomes-Gn; YPDSF_R0037.
DR   EnsemblGenomes-Gn; YPDSF_R0039.
DR   EnsemblGenomes-Gn; YPDSF_R0040.
DR   EnsemblGenomes-Gn; YPDSF_R0041.
DR   EnsemblGenomes-Gn; YPDSF_R0042.
DR   EnsemblGenomes-Gn; YPDSF_R0043.
DR   EnsemblGenomes-Gn; YPDSF_R0044.
DR   EnsemblGenomes-Gn; YPDSF_R0046.
DR   EnsemblGenomes-Gn; YPDSF_R0047.
DR   EnsemblGenomes-Gn; YPDSF_R0048.
DR   EnsemblGenomes-Gn; YPDSF_R0050.
DR   EnsemblGenomes-Gn; YPDSF_R0051.
DR   EnsemblGenomes-Gn; YPDSF_R0052.
DR   EnsemblGenomes-Gn; YPDSF_R0053.
DR   EnsemblGenomes-Gn; YPDSF_R0054.
DR   EnsemblGenomes-Gn; YPDSF_R0055.
DR   EnsemblGenomes-Gn; YPDSF_R0056.
DR   EnsemblGenomes-Gn; YPDSF_R0057.
DR   EnsemblGenomes-Gn; YPDSF_R0058.
DR   EnsemblGenomes-Gn; YPDSF_R0059.
DR   EnsemblGenomes-Gn; YPDSF_R0060.
DR   EnsemblGenomes-Gn; YPDSF_R0061.
DR   EnsemblGenomes-Gn; YPDSF_R0063.
DR   EnsemblGenomes-Gn; YPDSF_R0064.
DR   EnsemblGenomes-Gn; YPDSF_R0065.
DR   EnsemblGenomes-Gn; YPDSF_R0066.
DR   EnsemblGenomes-Gn; YPDSF_R0067.
DR   EnsemblGenomes-Gn; YPDSF_R0068.
DR   EnsemblGenomes-Gn; YPDSF_R0069.
DR   EnsemblGenomes-Gn; YPDSF_R0070.
DR   EnsemblGenomes-Gn; YPDSF_R0071.
DR   EnsemblGenomes-Gn; YPDSF_R0073.
DR   EnsemblGenomes-Gn; YPDSF_R0074.
DR   EnsemblGenomes-Gn; YPDSF_R0075.
DR   EnsemblGenomes-Gn; YPDSF_R0076.
DR   EnsemblGenomes-Gn; YPDSF_R0077.
DR   EnsemblGenomes-Gn; YPDSF_R0078.
DR   EnsemblGenomes-Gn; YPDSF_R0079.
DR   EnsemblGenomes-Gn; YPDSF_R0080.
DR   EnsemblGenomes-Gn; YPDSF_R0081.
DR   EnsemblGenomes-Gn; YPDSF_R0082.
DR   EnsemblGenomes-Gn; YPDSF_R0083.
DR   EnsemblGenomes-Gn; YPDSF_R0084.
DR   EnsemblGenomes-Gn; YPDSF_R0085.
DR   EnsemblGenomes-Gn; YPDSF_R0086.
DR   EnsemblGenomes-Gn; YPDSF_R0087.
DR   EnsemblGenomes-Gn; YPDSF_R0088.
DR   EnsemblGenomes-Gn; YPDSF_R0090.
DR   EnsemblGenomes-Gn; YPDSF_R0091.
DR   EnsemblGenomes-Gn; YPDSF_R0092.
DR   EnsemblGenomes-Gn; YPDSF_R0093.
DR   EnsemblGenomes-Gn; YPDSF_R0094.
DR   EnsemblGenomes-Gn; YPDSF_R0095.
DR   EnsemblGenomes-Gn; YPDSF_R0096.
DR   EnsemblGenomes-Gn; YPDSF_R0097.
DR   EnsemblGenomes-Gn; YPDSF_R0098.
DR   EnsemblGenomes-Gn; YPDSF_R0099.
DR   EnsemblGenomes-Gn; YPDSF_R0100.
DR   EnsemblGenomes-Gn; YPDSF_R0101.
DR   EnsemblGenomes-Gn; YPDSF_R0102.
DR   EnsemblGenomes-Gn; YPDSF_R0105.
DR   EnsemblGenomes-Gn; YPDSF_R0106.
DR   EnsemblGenomes-Gn; YPDSF_R0107.
DR   EnsemblGenomes-Gn; YPDSF_R0108.
DR   EnsemblGenomes-Tr; EBT00001661151.
DR   EnsemblGenomes-Tr; EBT00001661152.
DR   EnsemblGenomes-Tr; EBT00001661153.
DR   EnsemblGenomes-Tr; EBT00001661154.
DR   EnsemblGenomes-Tr; EBT00001661155.
DR   EnsemblGenomes-Tr; EBT00001661156.
DR   EnsemblGenomes-Tr; EBT00001661157.
DR   EnsemblGenomes-Tr; EBT00001661158.
DR   EnsemblGenomes-Tr; EBT00001661159.
DR   EnsemblGenomes-Tr; EBT00001661160.
DR   EnsemblGenomes-Tr; EBT00001661161.
DR   EnsemblGenomes-Tr; EBT00001661162.
DR   EnsemblGenomes-Tr; EBT00001661163.
DR   EnsemblGenomes-Tr; EBT00001661164.
DR   EnsemblGenomes-Tr; EBT00001661165.
DR   EnsemblGenomes-Tr; EBT00001661166.
DR   EnsemblGenomes-Tr; EBT00001661167.
DR   EnsemblGenomes-Tr; EBT00001661168.
DR   EnsemblGenomes-Tr; EBT00001661169.
DR   EnsemblGenomes-Tr; EBT00001661170.
DR   EnsemblGenomes-Tr; EBT00001661171.
DR   EnsemblGenomes-Tr; EBT00001661172.
DR   EnsemblGenomes-Tr; EBT00001661173.
DR   EnsemblGenomes-Tr; EBT00001661174.
DR   EnsemblGenomes-Tr; EBT00001661175.
DR   EnsemblGenomes-Tr; EBT00001661176.
DR   EnsemblGenomes-Tr; EBT00001661177.
DR   EnsemblGenomes-Tr; EBT00001661178.
DR   EnsemblGenomes-Tr; EBT00001661179.
DR   EnsemblGenomes-Tr; EBT00001661180.
DR   EnsemblGenomes-Tr; EBT00001661181.
DR   EnsemblGenomes-Tr; EBT00001661182.
DR   EnsemblGenomes-Tr; EBT00001661183.
DR   EnsemblGenomes-Tr; EBT00001661184.
DR   EnsemblGenomes-Tr; EBT00001661185.
DR   EnsemblGenomes-Tr; EBT00001661186.
DR   EnsemblGenomes-Tr; EBT00001661187.
DR   EnsemblGenomes-Tr; EBT00001661188.
DR   EnsemblGenomes-Tr; EBT00001661189.
DR   EnsemblGenomes-Tr; EBT00001661190.
DR   EnsemblGenomes-Tr; EBT00001661191.
DR   EnsemblGenomes-Tr; EBT00001661192.
DR   EnsemblGenomes-Tr; EBT00001661193.
DR   EnsemblGenomes-Tr; EBT00001661194.
DR   EnsemblGenomes-Tr; EBT00001661195.
DR   EnsemblGenomes-Tr; EBT00001661196.
DR   EnsemblGenomes-Tr; EBT00001661197.
DR   EnsemblGenomes-Tr; EBT00001661198.
DR   EnsemblGenomes-Tr; EBT00001661199.
DR   EnsemblGenomes-Tr; EBT00001661200.
DR   EnsemblGenomes-Tr; EBT00001661201.
DR   EnsemblGenomes-Tr; EBT00001661202.
DR   EnsemblGenomes-Tr; EBT00001661203.
DR   EnsemblGenomes-Tr; EBT00001661204.
DR   EnsemblGenomes-Tr; EBT00001661205.
DR   EnsemblGenomes-Tr; EBT00001661206.
DR   EnsemblGenomes-Tr; EBT00001661207.
DR   EnsemblGenomes-Tr; EBT00001661208.
DR   EnsemblGenomes-Tr; EBT00001661209.
DR   EnsemblGenomes-Tr; EBT00001661210.
DR   EnsemblGenomes-Tr; EBT00001661211.
DR   EnsemblGenomes-Tr; EBT00001661212.
DR   EnsemblGenomes-Tr; EBT00001661213.
DR   EnsemblGenomes-Tr; EBT00001661214.
DR   EnsemblGenomes-Tr; EBT00001661215.
DR   EnsemblGenomes-Tr; EBT00001661216.
DR   EnsemblGenomes-Tr; EBT00001661217.
DR   EnsemblGenomes-Tr; EBT00001661218.
DR   EnsemblGenomes-Tr; EBT00001661219.
DR   EnsemblGenomes-Tr; EBT00001661220.
DR   EnsemblGenomes-Tr; EBT00001661221.
DR   EnsemblGenomes-Tr; EBT00001661222.
DR   EnsemblGenomes-Tr; EBT00001661223.
DR   EnsemblGenomes-Tr; EBT00001661224.
DR   EnsemblGenomes-Tr; EBT00001661225.
DR   EnsemblGenomes-Tr; EBT00001661226.
DR   EnsemblGenomes-Tr; EBT00001661227.
DR   EnsemblGenomes-Tr; EBT00001661228.
DR   EnsemblGenomes-Tr; EBT00001661229.
DR   EnsemblGenomes-Tr; EBT00001661230.
DR   EnsemblGenomes-Tr; EBT00001661231.
DR   EnsemblGenomes-Tr; EBT00001661232.
DR   EnsemblGenomes-Tr; EBT00001661233.
DR   EnsemblGenomes-Tr; EBT00001661234.
DR   EnsemblGenomes-Tr; EBT00001661235.
DR   EnsemblGenomes-Tr; EBT00001661236.
DR   EnsemblGenomes-Tr; EBT00001661237.
DR   EnsemblGenomes-Tr; EBT00001661238.
DR   EnsemblGenomes-Tr; EBT00001661239.
DR   EnsemblGenomes-Tr; EBT00001661240.
DR   EnsemblGenomes-Tr; EBT00001661241.
DR   EnsemblGenomes-Tr; EBT00001661242.
DR   EnsemblGenomes-Tr; EBT00001661243.
DR   EnsemblGenomes-Tr; EBT00001661244.
DR   EnsemblGenomes-Tr; EBT00001661245.
DR   EnsemblGenomes-Tr; EBT00001661246.
DR   EnsemblGenomes-Tr; EBT00001661247.
DR   EnsemblGenomes-Tr; EBT00001661248.
DR   EnsemblGenomes-Tr; EBT00001661249.
DR   EnsemblGenomes-Tr; EBT00001661250.
DR   EnsemblGenomes-Tr; EBT00001661251.
DR   EnsemblGenomes-Tr; EBT00001661252.
DR   EnsemblGenomes-Tr; EBT00001661253.
DR   EnsemblGenomes-Tr; EBT00001661254.
DR   EnsemblGenomes-Tr; EBT00001661255.
DR   EnsemblGenomes-Tr; EBT00001661256.
DR   EnsemblGenomes-Tr; EBT00001661257.
DR   EnsemblGenomes-Tr; EBT00001661258.
DR   EnsemblGenomes-Tr; EBT00001661259.
DR   EnsemblGenomes-Tr; EBT00001661260.
DR   EnsemblGenomes-Tr; EBT00001661261.
DR   EnsemblGenomes-Tr; EBT00001661262.
DR   EnsemblGenomes-Tr; EBT00001661263.
DR   EnsemblGenomes-Tr; EBT00001661264.
DR   EnsemblGenomes-Tr; EBT00001661265.
DR   EnsemblGenomes-Tr; EBT00001661266.
DR   EnsemblGenomes-Tr; EBT00001661267.
DR   EnsemblGenomes-Tr; EBT00001661268.
DR   EnsemblGenomes-Tr; EBT00001661269.
DR   EnsemblGenomes-Tr; EBT00001661270.
DR   EnsemblGenomes-Tr; EBT00001661271.
DR   EnsemblGenomes-Tr; EBT00001661272.
DR   EnsemblGenomes-Tr; EBT00001661273.
DR   EnsemblGenomes-Tr; EBT00001661274.
DR   EnsemblGenomes-Tr; EBT00001661275.
DR   EnsemblGenomes-Tr; EBT00001661276.
DR   EnsemblGenomes-Tr; EBT00001661277.
DR   EnsemblGenomes-Tr; EBT00001661278.
DR   EnsemblGenomes-Tr; EBT00001661279.
DR   EnsemblGenomes-Tr; EBT00001661280.
DR   EnsemblGenomes-Tr; EBT00001661281.
DR   EnsemblGenomes-Tr; EBT00001661282.
DR   EnsemblGenomes-Tr; EBT00001661283.
DR   EnsemblGenomes-Tr; EBT00001661284.
DR   EnsemblGenomes-Tr; EBT00001661285.
DR   EnsemblGenomes-Tr; EBT00001661286.
DR   EnsemblGenomes-Tr; EBT00001661287.
DR   EnsemblGenomes-Tr; EBT00001661288.
DR   EnsemblGenomes-Tr; EBT00001661289.
DR   EnsemblGenomes-Tr; EBT00001661290.
DR   EnsemblGenomes-Tr; EBT00001661291.
DR   EnsemblGenomes-Tr; EBT00001661292.
DR   EnsemblGenomes-Tr; EBT00001661293.
DR   EnsemblGenomes-Tr; EBT00001661294.
DR   EnsemblGenomes-Tr; EBT00001661295.
DR   EnsemblGenomes-Tr; EBT00001661296.
DR   EnsemblGenomes-Tr; EBT00001661297.
DR   EnsemblGenomes-Tr; EBT00001661298.
DR   EnsemblGenomes-Tr; EBT00001661299.
DR   EnsemblGenomes-Tr; EBT00001661300.
DR   EnsemblGenomes-Tr; EBT00001661301.
DR   EnsemblGenomes-Tr; EBT00001661302.
DR   EnsemblGenomes-Tr; EBT00001661303.
DR   EnsemblGenomes-Tr; EBT00001661304.
DR   EnsemblGenomes-Tr; EBT00001661305.
DR   EnsemblGenomes-Tr; EBT00001661306.
DR   EnsemblGenomes-Tr; EBT00001661307.
DR   EnsemblGenomes-Tr; EBT00001661308.
DR   EnsemblGenomes-Tr; EBT00001661309.
DR   EnsemblGenomes-Tr; EBT00001661310.
DR   EnsemblGenomes-Tr; EBT00001661311.
DR   EnsemblGenomes-Tr; EBT00001661312.
DR   EnsemblGenomes-Tr; EBT00001661313.
DR   EnsemblGenomes-Tr; EBT00001661314.
DR   EnsemblGenomes-Tr; EBT00001661315.
DR   EnsemblGenomes-Tr; EBT00001661316.
DR   EnsemblGenomes-Tr; EBT00001661317.
DR   EnsemblGenomes-Tr; EBT00001661318.
DR   EnsemblGenomes-Tr; EBT00001661319.
DR   EnsemblGenomes-Tr; EBT00001661320.
DR   EnsemblGenomes-Tr; EBT00001661321.
DR   EnsemblGenomes-Tr; EBT00001661322.
DR   EnsemblGenomes-Tr; EBT00001661323.
DR   EnsemblGenomes-Tr; EBT00001661324.
DR   EnsemblGenomes-Tr; EBT00001661325.
DR   EnsemblGenomes-Tr; EBT00001661326.
DR   EnsemblGenomes-Tr; EBT00001661327.
DR   EnsemblGenomes-Tr; EBT00001661328.
DR   EnsemblGenomes-Tr; EBT00001661329.
DR   EnsemblGenomes-Tr; EBT00001661330.
DR   EnsemblGenomes-Tr; EBT00001661331.
DR   EnsemblGenomes-Tr; EBT00001661332.
DR   EnsemblGenomes-Tr; EBT00001661333.
DR   EnsemblGenomes-Tr; EBT00001661334.
DR   EnsemblGenomes-Tr; EBT00001661335.
DR   EnsemblGenomes-Tr; EBT00001661336.
DR   EnsemblGenomes-Tr; EBT00001661337.
DR   EnsemblGenomes-Tr; EBT00001661338.
DR   EnsemblGenomes-Tr; EBT00001661339.
DR   EnsemblGenomes-Tr; EBT00001661340.
DR   EnsemblGenomes-Tr; EBT00001661341.
DR   EnsemblGenomes-Tr; EBT00001661342.
DR   EnsemblGenomes-Tr; EBT00001661343.
DR   EnsemblGenomes-Tr; EBT00001661344.
DR   EnsemblGenomes-Tr; EBT00001661345.
DR   EnsemblGenomes-Tr; EBT00001661346.
DR   EnsemblGenomes-Tr; EBT00001661347.
DR   EnsemblGenomes-Tr; EBT00001661348.
DR   EnsemblGenomes-Tr; EBT00001661349.
DR   EnsemblGenomes-Tr; EBT00001661350.
DR   EnsemblGenomes-Tr; EBT00001661351.
DR   EnsemblGenomes-Tr; EBT00001661352.
DR   EnsemblGenomes-Tr; EBT00001661353.
DR   EnsemblGenomes-Tr; EBT00001661354.
DR   EnsemblGenomes-Tr; EBT00001661355.
DR   EnsemblGenomes-Tr; EBT00001661356.
DR   EnsemblGenomes-Tr; EBT00001661357.
DR   EnsemblGenomes-Tr; EBT00001661358.
DR   EnsemblGenomes-Tr; EBT00001661359.
DR   EnsemblGenomes-Tr; EBT00001661360.
DR   EnsemblGenomes-Tr; EBT00001661361.
DR   EnsemblGenomes-Tr; EBT00001661362.
DR   EnsemblGenomes-Tr; EBT00001661363.
DR   EnsemblGenomes-Tr; EBT00001661364.
DR   EnsemblGenomes-Tr; EBT00001661365.
DR   EnsemblGenomes-Tr; EBT00001661366.
DR   EnsemblGenomes-Tr; EBT00001661367.
DR   EnsemblGenomes-Tr; EBT00001661368.
DR   EnsemblGenomes-Tr; EBT00001661369.
DR   EnsemblGenomes-Tr; EBT00001661370.
DR   EnsemblGenomes-Tr; EBT00001661371.
DR   EnsemblGenomes-Tr; EBT00001661372.
DR   EnsemblGenomes-Tr; EBT00001661373.
DR   EnsemblGenomes-Tr; EBT00001661374.
DR   EnsemblGenomes-Tr; EBT00001661375.
DR   EnsemblGenomes-Tr; YPDSF_R0001-1.
DR   EnsemblGenomes-Tr; YPDSF_R0002-1.
DR   EnsemblGenomes-Tr; YPDSF_R0003-1.
DR   EnsemblGenomes-Tr; YPDSF_R0004-1.
DR   EnsemblGenomes-Tr; YPDSF_R0005-1.
DR   EnsemblGenomes-Tr; YPDSF_R0006-1.
DR   EnsemblGenomes-Tr; YPDSF_R0008-1.
DR   EnsemblGenomes-Tr; YPDSF_R0010-1.
DR   EnsemblGenomes-Tr; YPDSF_R0012-1.
DR   EnsemblGenomes-Tr; YPDSF_R0013-1.
DR   EnsemblGenomes-Tr; YPDSF_R0014-1.
DR   EnsemblGenomes-Tr; YPDSF_R0015-1.
DR   EnsemblGenomes-Tr; YPDSF_R0016-1.
DR   EnsemblGenomes-Tr; YPDSF_R0017-1.
DR   EnsemblGenomes-Tr; YPDSF_R0018-1.
DR   EnsemblGenomes-Tr; YPDSF_R0019-1.
DR   EnsemblGenomes-Tr; YPDSF_R0020-1.
DR   EnsemblGenomes-Tr; YPDSF_R0021-1.
DR   EnsemblGenomes-Tr; YPDSF_R0022-1.
DR   EnsemblGenomes-Tr; YPDSF_R0025-1.
DR   EnsemblGenomes-Tr; YPDSF_R0026-1.
DR   EnsemblGenomes-Tr; YPDSF_R0027-1.
DR   EnsemblGenomes-Tr; YPDSF_R0028-1.
DR   EnsemblGenomes-Tr; YPDSF_R0029-1.
DR   EnsemblGenomes-Tr; YPDSF_R0030-1.
DR   EnsemblGenomes-Tr; YPDSF_R0031-1.
DR   EnsemblGenomes-Tr; YPDSF_R0032-1.
DR   EnsemblGenomes-Tr; YPDSF_R0033-1.
DR   EnsemblGenomes-Tr; YPDSF_R0035-1.
DR   EnsemblGenomes-Tr; YPDSF_R0036-1.
DR   EnsemblGenomes-Tr; YPDSF_R0037-1.
DR   EnsemblGenomes-Tr; YPDSF_R0039-1.
DR   EnsemblGenomes-Tr; YPDSF_R0040-1.
DR   EnsemblGenomes-Tr; YPDSF_R0041-1.
DR   EnsemblGenomes-Tr; YPDSF_R0042-1.
DR   EnsemblGenomes-Tr; YPDSF_R0043-1.
DR   EnsemblGenomes-Tr; YPDSF_R0044-1.
DR   EnsemblGenomes-Tr; YPDSF_R0046-1.
DR   EnsemblGenomes-Tr; YPDSF_R0047-1.
DR   EnsemblGenomes-Tr; YPDSF_R0048-1.
DR   EnsemblGenomes-Tr; YPDSF_R0050-1.
DR   EnsemblGenomes-Tr; YPDSF_R0051-1.
DR   EnsemblGenomes-Tr; YPDSF_R0052-1.
DR   EnsemblGenomes-Tr; YPDSF_R0053-1.
DR   EnsemblGenomes-Tr; YPDSF_R0054-1.
DR   EnsemblGenomes-Tr; YPDSF_R0055-1.
DR   EnsemblGenomes-Tr; YPDSF_R0056-1.
DR   EnsemblGenomes-Tr; YPDSF_R0057-1.
DR   EnsemblGenomes-Tr; YPDSF_R0058-1.
DR   EnsemblGenomes-Tr; YPDSF_R0059-1.
DR   EnsemblGenomes-Tr; YPDSF_R0060-1.
DR   EnsemblGenomes-Tr; YPDSF_R0061-1.
DR   EnsemblGenomes-Tr; YPDSF_R0063-1.
DR   EnsemblGenomes-Tr; YPDSF_R0064-1.
DR   EnsemblGenomes-Tr; YPDSF_R0065-1.
DR   EnsemblGenomes-Tr; YPDSF_R0066-1.
DR   EnsemblGenomes-Tr; YPDSF_R0067-1.
DR   EnsemblGenomes-Tr; YPDSF_R0068-1.
DR   EnsemblGenomes-Tr; YPDSF_R0069-1.
DR   EnsemblGenomes-Tr; YPDSF_R0070-1.
DR   EnsemblGenomes-Tr; YPDSF_R0071-1.
DR   EnsemblGenomes-Tr; YPDSF_R0073-1.
DR   EnsemblGenomes-Tr; YPDSF_R0074-1.
DR   EnsemblGenomes-Tr; YPDSF_R0075-1.
DR   EnsemblGenomes-Tr; YPDSF_R0076-1.
DR   EnsemblGenomes-Tr; YPDSF_R0077-1.
DR   EnsemblGenomes-Tr; YPDSF_R0078-1.
DR   EnsemblGenomes-Tr; YPDSF_R0079-1.
DR   EnsemblGenomes-Tr; YPDSF_R0080-1.
DR   EnsemblGenomes-Tr; YPDSF_R0081-1.
DR   EnsemblGenomes-Tr; YPDSF_R0082-1.
DR   EnsemblGenomes-Tr; YPDSF_R0083-1.
DR   EnsemblGenomes-Tr; YPDSF_R0084-1.
DR   EnsemblGenomes-Tr; YPDSF_R0085-1.
DR   EnsemblGenomes-Tr; YPDSF_R0086-1.
DR   EnsemblGenomes-Tr; YPDSF_R0087-1.
DR   EnsemblGenomes-Tr; YPDSF_R0088-1.
DR   EnsemblGenomes-Tr; YPDSF_R0090-1.
DR   EnsemblGenomes-Tr; YPDSF_R0091-1.
DR   EnsemblGenomes-Tr; YPDSF_R0092-1.
DR   EnsemblGenomes-Tr; YPDSF_R0093-1.
DR   EnsemblGenomes-Tr; YPDSF_R0094-1.
DR   EnsemblGenomes-Tr; YPDSF_R0095-1.
DR   EnsemblGenomes-Tr; YPDSF_R0096-1.
DR   EnsemblGenomes-Tr; YPDSF_R0097-1.
DR   EnsemblGenomes-Tr; YPDSF_R0098-1.
DR   EnsemblGenomes-Tr; YPDSF_R0099-1.
DR   EnsemblGenomes-Tr; YPDSF_R0100-1.
DR   EnsemblGenomes-Tr; YPDSF_R0101-1.
DR   EnsemblGenomes-Tr; YPDSF_R0102-1.
DR   EnsemblGenomes-Tr; YPDSF_R0105-1.
DR   EnsemblGenomes-Tr; YPDSF_R0106-1.
DR   EnsemblGenomes-Tr; YPDSF_R0107-1.
DR   EnsemblGenomes-Tr; YPDSF_R0108-1.
DR   EuropePMC; PMC2519523; 18606739.
DR   EuropePMC; PMC2530875; 18647395.
DR   EuropePMC; PMC2806259; 20017936.
DR   EuropePMC; PMC3172189; 21931876.
DR   EuropePMC; PMC3364912; 22480257.
DR   GOA; P0C5Z7.
DR   InterPro; IPR011720; Thr_lead_pept.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01405; STnc490k.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   SILVA-LSU; CP000668.
DR   SILVA-SSU; CP000668.
DR   UniProtKB/Swiss-Prot; P0C5Z7; LPT_YERPP.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 2773191
CC   Source DNA and bacteria available from Emilio Garcia
CC   (garcia12@llnl.gov)
CC   Contacts: Emilio Garcia (garcia12@llnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4517345
FT                   /organism="Yersinia pestis Pestoides F"
FT                   /strain="Pestoides F"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:386656"
FT   gene            34..1422
FT                   /locus_tag="YPDSF_0001"
FT   CDS_pept        34..1422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0001"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38428"
FT                   /db_xref="GOA:A4TGL5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGL5"
FT                   /protein_id="ABP38428.1"
FT                   /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVRDKYLNNINGLLNDFCGTEVPLLRFEVGSKPAARAHNNPVTASVSAPVAPVTR
FT                   SAPMRPSWDNSPAQPELSYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNGIMARKANAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIA
FT                   NANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVA
FT                   RPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIR
FT                   TLSS"
FT   gene            1427..2527
FT                   /locus_tag="YPDSF_0002"
FT   CDS_pept        1427..2527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38429"
FT                   /protein_id="ABP38429.1"
FT                   /translation="MKFIIEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVTEGSLRLT
FT                   GTDLEMEMVACVALSQSHEPGATTVPARKFFDIWRGLPEGAEITVALDGDRLLVRSGRS
FT                   RFSLSTLPAIDFPNLDDWQSEVEFTLPQATLKRLIESTQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPIGQTLPSHSVIVPRKGVMELVRLLDGGDTPLRLQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKMLEAGCDLLKQAFSRAAILSNEKFRGV
FT                   RLYVSHNQLKITANNPEQEEAEEILDVSYEGTEMEIGFNVSYVLDVLNALKCEDVRLLL
FT                   TDSVSSVQIEDSASQVAAYVVMPMRL"
FT   gene            2502..3779
FT                   /locus_tag="YPDSF_0003"
FT   CDS_pept        2502..3779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38430"
FT                   /protein_id="ABP38430.1"
FT                   /translation="MSSCQCVCSIYRAILLAPLRLGSARHPLVHEVRSGGCALAARKWP
FT                   ATITPLIRNKATLPSIIRISFMALTRLLIKDFRNIESADLALAAGFNFLVGPNGSGKTS
FT                   VLEAVYTLGHGRAFRSLQAGRVIRHECAEFVLHGRVDANEREASVGLSKSRQGDTKVRI
FT                   DGTDGHKVAELAQMLPMQLITPEGFTLLNGGPKFRRAFLDWGCFHNEPGFFTAWSNLKR
FT                   LLKQRNAALRQVSRYTQIRAWDQEIIPLAERISEWRAAYSDAIAADISATCALFLPEFA
FT                   LSFSFQRGWDKESDYGELLARQFERDRALTYTAVGPHKADFRIRADGTPVEDLLSRGQL
FT                   KLLMCALRLAQGEFLTRQSGRRCLYLLDDFASELDTGRRRLLAERLKATQAQVFVSAVS
FT                   AEQVADMVGEKGKMFRVEHGKIEVQP"
FT   gene            3805..6219
FT                   /locus_tag="YPDSF_0004"
FT   CDS_pept        3805..6219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38431"
FT                   /protein_id="ABP38431.1"
FT                   /translation="MSNTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGHCKEILVTIHADNSVSVQDDGRGIPTGMHDEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRREGKVHEQTYKMGVPQAPLKVVGETEQT
FT                   GTTVRFWPSFQTFTNNTEFQYEILAKRLRELSFLNSGVSIKLKDKRNDKEDHFHYEGGI
FT                   KAFVEYLNKNKNPIHPKVFYFSTMKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LVGFRTAMTRTLNSYMDKEGYSKKAKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVETLMNEKLVEYLLENPTDAKIVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIIERGHVFIAQPPLYKVKKGKQEQYIKDDDAMEQYQMTLALDGAALHTNAHAPALA
FT                   GEPLEKLVAEHYSVQKTIARMERRYPRALLNNLIYQPTLQEEDLGNKEVVTQWIDSLVV
FT                   LLNEKEHHGSSYSSVVRENRERQLFEPILRIRTHGVDTDYDLDFDFIHGGEYRKICLLG
FT                   DKLRGLIEDGAFVERGERRVPVSSFEEALDWLVKESRRGLAIQRYKGLGEMNPDQLWET
FT                   TMDPESRRMLRVMVKDAIAADQLFTTLMGDAVEPRRAFIEENALRAANIDI"
FT   gene            6435..7244
FT                   /locus_tag="YPDSF_0005"
FT   CDS_pept        6435..7244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0005"
FT                   /product="haloacid dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38432"
FT                   /protein_id="ABP38432.1"
FT                   /translation="MAIELIAIDMDGTLLNPQHEITPRVKQAIAAARAKGVCVVLATGR
FT                   PYIGVQRYLRELNMENSGDYCISNNGALVQKAATGECILQETLSFEDYLYFEALSRELG
FT                   VSFQAFDFNTLYTANKDISKYTLHEVMLTGIPLKYRAVEEMDPTLRFPKVMMIDEPERL
FT                   DRALAMMPAEVFERFTIMKSAPFYLEILSKRADKGTGVKMLAEHLGIAQKNVMALGDQG
FT                   NDIAMVNYAGVGVAMGNAIPELKEIAQYVTGTNCEDGVATAIEKYIG"
FT   gene            complement(7638..8423)
FT                   /locus_tag="YPDSF_0006"
FT   CDS_pept        complement(7638..8423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0006"
FT                   /product="transposase for insertion sequence IS1661"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38433"
FT                   /protein_id="ABP38433.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            complement(9199..10152)
FT                   /locus_tag="YPDSF_0007"
FT   CDS_pept        complement(9199..10152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0007"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38434"
FT                   /protein_id="ABP38434.1"
FT                   /translation="MLILNKQKILDKFDADRITLLLKEGFIAFSQQRVQMPPVQHLLFD
FT                   QANGDCCIKSGYLQGDDQFVVKVSGGFYDNPAQGLASNQGVMMAFSAKTGEPQAILLDE
FT                   GWLTALRTALAGRIVAELCAPQHISALGIVGTGIQARLHLMYLKNVMTCRQLWVWGRSE
FT                   TALEEYRQYAQAEGFAVNTTLNAAELAHHSQFIVTTTPSREPILQAEDIQPGTHITAVG
FT                   ADSAGKHELSAELVARADKILVDSIAQCTDFGEVSLAFKQGLLAHHNLTEIGLALAQGI
FT                   PFRENDQQITLADLTGLGIQDVQIVKGILGDKKGVL"
FT   gene            complement(10146..11108)
FT                   /locus_tag="YPDSF_0008"
FT   CDS_pept        complement(10146..11108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0008"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38435"
FT                   /protein_id="ABP38435.1"
FT                   /translation="MNTLFDAIREAHQILRPQVRVTPLEHSPLLSQHSGCEIYLKCEHL
FT                   QHTGSFKFRGASNKLRLLNEAQRQQGVITASTGNHGQGVALAAKLAGIKSTIYAPEQAA
FT                   AIKLDVIRALGGQIELVSGDALNAELAAGIAAEQQGKVYISPYNDPQVIAGQGTCGMEM
FT                   VEQQPDLDAVFVAVGGGGLISGIATVLKTLSDKTQVIGCWPANATSLYTCLEKGQIQEV
FT                   AEQETLSDGTAGGIEPGAITFALCQQLIDQKVLVSEQEIKEAMGLIARTDRWMIEGAAG
FT                   VALAAALKLAPQWQGKKVAVVLCGKNIVLEKYLGAVSGC"
FT   gene            11316..11627
FT                   /locus_tag="YPDSF_0009"
FT   CDS_pept        11316..11627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38436"
FT                   /protein_id="ABP38436.1"
FT                   /translation="MNAQKNRFLPEQQLTFDPRGHQLTNINVWTPDSQWLAYDVRPSGG
FT                   TFNGLTIEQVNCITGEIEVIYRARQGAHVGVVTVSPDMPAPLAAFIAGWQCHCLPDER"
FT   gene            11617..11931
FT                   /locus_tag="YPDSF_0010"
FT   CDS_pept        11617..11931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38437"
FT                   /protein_id="ABP38437.1"
FT                   /translation="MNDDNGVVQLWLISPNGGELRQLTASQWGIQSAFSWSPQGEHLAF
FT                   ICDNSVMLCDSLTGHLRRLTARSVVAPLADAVVFSPNGKKIAFMREIDGWAQIFTVHAD
FT                   "
FT   gene            complement(11971..12309)
FT                   /locus_tag="YPDSF_0011"
FT   CDS_pept        complement(11971..12309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0011"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38438"
FT                   /protein_id="ABP38438.1"
FT                   /translation="MRNIVIPFATGCSLLLTSGCSSILTHTSSSQGYYSGTEANIAMLK
FT                   DDDTGWALRPLLAVDLPFSAVMDTLFLPYDYLRSDSEDKAASSPRERVRQSEMQNQQTN
FT                   QTGDTPKQ"
FT   sig_peptide     complement(12217..12309)
FT                   /locus_tag="YPDSF_0011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.383 at
FT                   residue 31"
FT   gene            12677..13090
FT                   /locus_tag="YPDSF_0012"
FT   CDS_pept        12677..13090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0012"
FT                   /product="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38439"
FT                   /db_xref="GOA:A4TGM6"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGM6"
FT                   /protein_id="ABP38439.1"
FT                   /translation="MRNSDLAPLYRSAIGFDRLFNLLESGQNQSNGGYPPYNVELVDEN
FT                   NYRIAIAVAGFAEQELEITTQDNLLIVRGSHANEPAQRTYLYQGIAERNFERKFQLAEH
FT                   IKIKGANLVNGLLYIDLERLVPESLKPRRIEIK"
FT   gene            13371..13835
FT                   /locus_tag="YPDSF_0013"
FT   CDS_pept        13371..13835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0013"
FT                   /product="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38440"
FT                   /db_xref="GOA:A4TGM7"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR022848"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGM7"
FT                   /protein_id="ABP38440.1"
FT                   /translation="MRNYDLSPLLRQWIGFDKLASTMQGGQEPQGFPPYNIEKTDDNHY
FT                   RISLALAGFKQSELDIEVEGPRLTVRGKPTPVEKQVEYLHQGLVRKEFSLTFTLAEHLN
FT                   VDNAQFENGLLHIDLLRQVPEALQPQRIAIGSATPQERQVLESPEAPDQQ"
FT   gene            14208..15866
FT                   /locus_tag="YPDSF_0014"
FT   CDS_pept        14208..15866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0014"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38441"
FT                   /db_xref="GOA:A4TGM8"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023018"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGM8"
FT                   /protein_id="ABP38441.1"
FT                   /translation="MSAIALTVSMLALVAVLGLWIGNWKIYGVGLGIGGVLFGGIIVGH
FT                   FAQTYQIVLNGDMLHFIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNCFAILMVVVG
FT                   GLVTAIIHKLFAVPLPIILGVFSGAVTNTPALGAAQQILTDLGSPPQLVSQMGMGYAMA
FT                   YPFGICGILLVMWLIRLFFKINIDREAKAFDSSYGQNRELLQTMNVAVRNPNLHGLSVQ
FT                   DVPLLNSDEVVCSRLKRGDLLMVPMPATVIEIGDYLHLVGQRDALEKVRLVVGEEVDVT
FT                   LSTAGTALQTARVVVTNEAVLGKKIRDLNLKQKYDVVITRLNRAGIELVASNSASLQFG
FT                   DILNLVGRPEAIEAVSAIVGNAQQKLQQVQMLPVFIGVGLGVLLGSIPLFVPGFPAALR
FT                   LGLAGGPLVVALILGRIGSIGKLYWFMPPSANLALRELGIVLFLSVVGLKSGGDFINTL
FT                   VNGDGLAWIGYGAMITGIPLLTVGILARMLVKMNYLTLCGMLAGSMTDPPALAFANGLH
FT                   PTSGAAALSYATVYPLAMFLRIMSPQILAVLFWTL"
FT   gene            complement(15979..17349)
FT                   /locus_tag="YPDSF_0015"
FT   CDS_pept        complement(15979..17349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0015"
FT                   /product="valine-pyruvate aminotransferase"
FT                   /EC_number="2.6.1.66"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38442"
FT                   /protein_id="ABP38442.1"
FT                   /translation="MAIFSRSQKKFFRIASAFICEYGTCSLTDNNTFSFMKFSLFGDKF
FT                   TRYAGITRLMDDLNDGLRTPGSIMLGGGNPAHIPEMDTYFQQLCQEMLTEGKLTEALCN
FT                   YDGPQGKDLLLKALAKMLRDELGWQIEPQNIALTNGSQSAFFYLFNLFAGRYADGSRRR
FT                   VLFPLAPEYLGYADAGLDEDLFVSAKPNIELLPEGQFKYHVDFEHLNITDDIGLICVSR
FT                   PTNPTGNVITDEELIRLDAIAQQRNIPLLIDNAYGVPFPGIIFTDATPLWNPNIILCMS
FT                   LSKLGLPGSRCGIVIADEKVISAITNMNGIISLSPGGMGPAIAAEMIERGDLLRLSNEV
FT                   IRPFYFERVQQTIAILRKYLPAERCLIHKPEGAIFLWLWFKDLPISTELLYQRLKKRGV
FT                   LMVPGHYFFPGLGYDWPHTHQCMRMNYVPAPEMIEKGVAILAEEIERAFQEAKQLTD"
FT   gene            complement(18557..20620)
FT                   /locus_tag="YPDSF_0016"
FT   CDS_pept        complement(18557..20620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0016"
FT                   /product="alpha-amylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38443"
FT                   /protein_id="ABP38443.1"
FT                   /translation="MKRLTLPLLLVLSPAAMANWSLQHFPAFTEQDSGIFLSSSSLTKG
FT                   EYPLKFYQDKQCWQPTGPVKLNQMLSLQPCQENIAIPWRLFRDGQYQARIDTRSGTPTL
FT                   TLSVTAPVAEAVQVVTHVCQRWDGNPVTVDVSKTFAEGEIVRDFYSGQTATVSLGKITL
FT                   RPAPESGGLLLLESAQTQQAAPFSWQNATVYFALTDRFNNGNPANDHSYGRHGDGMQEI
FT                   GTFHGGDLAGLTEKLDYLQQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYGLD
FT                   WTRLDANMGTEQDLRTLVEQAHKRGIRILFDVVMNHVGYATLADMQNDQFGALYLQGDQ
FT                   QEKTLGKRWSDWTPGSGQTWHSFNDYINFSDKTAWDNWWGKKWIRTDIGDYDTPGYDDL
FT                   TMSLAFLPDIKTESTQPSGLPVFYRNKPDTAAQEIAGATPRDYMTHWLSQWVRDYGIDG
FT                   FRVDTAKHVEKPAWQQLKQQSIAALAEWKAAHPEQALDNLPFWMTGEAWGHGVMKSDYY
FT                   QNGFDAMINFDFQDQANQALACFSSIESTYNQMAEKLQNFNVLSYLSSHDTRLFFKDDA
FT                   QQSLAKQQRAGSLLLLAPGAVQIFYGDESGRKFGPTGSDPLQGTRSDMNWSELSGEKGA
FT                   LLAHWQKVSQFRARHPAIGAGVQQSQQTANYYAFSRQHQGDKVLVVWVGDKN"
FT   sig_peptide     complement(20564..20620)
FT                   /locus_tag="YPDSF_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(20909..21889)
FT                   /locus_tag="YPDSF_0017"
FT   CDS_pept        complement(20909..21889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0017"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38444"
FT                   /db_xref="GOA:A4TGN1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR023756"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGN1"
FT                   /protein_id="ABP38444.1"
FT                   /translation="MKPSIVLYKSIPTDLHQRLAQHFTVNSFDGLTPDNQPELLAALQQ
FT                   AEGLIGSGGKIDQDFLQLAPNLRAASTISVGYDNFDVEALSQRGIALMHTPTVLTETVA
FT                   DTMMALMLSTARRVVELAERVKAGEWQESIGDDWFGVDVHHKTIGILGMGRIGMALAQR
FT                   AHFGFSMPVLYTSRRPHEAAEQRFGARHCSLDTLLAEADFLCITLPMTEQTYHMIGREQ
FT                   LAKMKSSAILINAGRGPVVDEQALIAALQDGTIHAAGLDVFEQEPLPVDSPLLTLRNVV
FT                   AVPHIGSATHETRYNMAACAVDNLINALTGTVKENCVNPQVLITH"
FT   gene            22408..23052
FT                   /locus_tag="YPDSF_0018"
FT   CDS_pept        22408..23052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0018"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38445"
FT                   /protein_id="ABP38445.1"
FT                   /translation="MNIDHGARQPQSVGERLLLLLKTHGPLQAGEAGNILGTTGEAARQ
FT                   QFVKLAKKGLVVAEAQTRGVGRPIQLWQLTESGNTHFPDAHGELAVQLLRLIRTQLGDN
FT                   ALELLIDSREQETRDQYCQAMVGVSNVAERVERLVAIRTGEGYMAQSQVEADGTILLIE
FT                   NHCPIWAAAASCQRFCRTELAVFQQALGVPVERVEHILSGARRCTYRIHPE"
FT   gene            complement(23183..23842)
FT                   /locus_tag="YPDSF_0019"
FT   CDS_pept        complement(23183..23842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0019"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38446"
FT                   /protein_id="ABP38446.1"
FT                   /translation="MKKRILAPVAIVSVALILSACTTNPYTGESQAGKSGYGAGIGAAL
FT                   GAGIGLLSSSKHDRGKGALIGAAAGAALGGGAGYYMDVQEAKLREKMSGTGVSVTRQGE
FT                   NIVLNMPNNVTFDTNSSNLKPAGANTLTGVAMVLKEYDKTAVNVTGYTDSTGARAHNIV
FT                   LSQQRADNVASALIVQGVAANRIRTYGAGPDNPVASNSTAAGKAQNRRVEITLSPL"
FT   sig_peptide     complement(23780..23842)
FT                   /locus_tag="YPDSF_0019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.752 at
FT                   residue 21"
FT   gene            complement(24200..24655)
FT                   /locus_tag="YPDSF_0020"
FT   CDS_pept        complement(24200..24655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0020"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38447"
FT                   /protein_id="ABP38447.1"
FT                   /translation="MIRVYQPDDLNALMQLWLTSTIDAHPFVAEQYWYESAPLIRETYL
FT                   PAARTWVYQQPGAAAEENTIIGFISILEEQLVGALFVAQAFHGHGVAKALMDHVQQRYP
FT                   ALSLEVYQQNRRAYRFYRKQGFTVIGRAYHAETQGTILTMHWQHPAH"
FT   gene            complement(24652..25224)
FT                   /locus_tag="YPDSF_0021"
FT   CDS_pept        complement(24652..25224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0021"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38448"
FT                   /protein_id="ABP38448.1"
FT                   /translation="MSLQRCGWVTSDPLYLAYHDTEWGVPLKDSRALFEMICLEGQQAG
FT                   LSWITVLKKREHYRKSFHHFDPVKVAKMGPEEVEIRVQDSGIIRHRGKIQAIITNAQAY
FT                   LAMEANGEDFSRFIWSFVDDEPKINHWWCLAEAPATTAVSDAMSKALKKRGFKFIGSTI
FT                   CYAFMQASGLVNDHMANCFCHPDNAVK"
FT   gene            25552..26466
FT                   /locus_tag="YPDSF_0022"
FT   CDS_pept        25552..26466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0022"
FT                   /product="glycyl-tRNA synthetase alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38449"
FT                   /db_xref="GOA:A4TGN6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGN6"
FT                   /protein_id="ABP38449.1"
FT                   /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRAIGPEPIAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKE
FT                   LGLDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLIWCDGPLGTTTYGDIYHQNEVEQSTYNFEYADVDFLFSC
FT                   FEQYEKEAQSLLALETPLPLPAYERILKAGHTFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCKKNQN"
FT   gene            26476..28545
FT                   /locus_tag="YPDSF_0023"
FT   CDS_pept        26476..28545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0023"
FT                   /product="glycyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38450"
FT                   /db_xref="GOA:A4TGN7"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGN7"
FT                   /protein_id="ABP38450.1"
FT                   /translation="MTQQTFLVEIGTEELPPKALRSLAESFAANFTAELDNANLSHGEV
FT                   SWYAAPRRLAVKVANLSAAQADREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQ
FT                   AERLVTDKGEWLLYRAHVKGQPAQLLLAGMVNTALSKLPIPKLMRWGDKETQFVRPVHT
FT                   VTLLLGTEVIPGTVLGINSDRVIRGHRFMGEAEFTIDSADQYPQILLERGKVIADYELR
FT                   KSIIKRDAEQAAQQIGGVADLSESLLEEVASLVEWPVVLTAKFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDTAGHLMPHFIFVANIESKDPQQIISGNEKVVRPRLADAEFFFKTDRKK
FT                   RLEDNLPRLETVLFQQQLGTLRDKTDRIQALAGWVAAQIGADVNHATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDDLPSNPVACALAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLSLDLQTLTEEAVRLYGSKLTN
FT                   AKVVDDVIEFMLGRFRAWYQDEGHSVDTIQAVLARRPTKPADFDARVKAVTYFRTLDAA
FT                   AALAAANKRVSNILAKSTDTLNDHVHASILKEPAELKLATHLVVLRDQLEPVFAAGQYK
FT                   EALVELAALRETVDEFFESVMVMAEDDAVRVNRLTLLSKLRELFLQVADISLLQ"
FT   gene            29018..29737
FT                   /locus_tag="YPDSF_0024"
FT   CDS_pept        29018..29737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38451"
FT                   /protein_id="ABP38451.1"
FT                   /translation="MIFALNTVRNPRWLAPLLAFLVMFLVTACGDKELEQRKAFIDYLQ
FT                   NTVMRSGMKLPTLSEDQKQKFGPYVSDYAILVTFSQQLSKSVDASLVPAIEQINQIRVA
FT                   QDYLSKRDALQQSAGALNLLVQQIRTAKAQADSAQAALKLPDDLKVVFNRAFDNIVTQP
FT                   ANVLIPAVPVVSSFVQDLVQVGDFLQQQGTQVTFNNGGIQFQTPQQAAQYNTMMSNLVA
FT                   KYPEMMAAQKRVMKVMQ"
FT   sig_peptide     29018..29104
FT                   /locus_tag="YPDSF_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.923 at
FT                   residue 29"
FT   gene            30387..32318
FT                   /locus_tag="YPDSF_0025"
FT   CDS_pept        30387..32318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0025"
FT                   /product="PTS system, mannitol-specific IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38452"
FT                   /protein_id="ABP38452.1"
FT                   /translation="MFSPDAKVRVQNFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLP
FT                   NETLAKLVGPMITYLLPLLIGFTGGRLVGGDRGGVVGAITTMGVIVGADMPMFLGAMIV
FT                   GPLGGWAIKHFDRWVEGKIKSGFEMLVNNFSSGIIGMLLALLAFMAIGPLVEVLSKGLA
FT                   YGVDVMVQNNLLPLASIFVEPAKILFLNNAINHGIFSPLGVQQAAETGKSIFFLIEANP
FT                   GPGLGVLMAYMFFGKGNAKQSAGGAAIIHFFGGIHEIYFPYVLMNPRLLLAVILGGMTG
FT                   VFTLTLLNGGLVSAASPGSILAILAMTPKGAYFANIAAVATAFAVSFVVSAILLKSSKA
FT                   KDDEEGLEGATRRMQDMKAQSKGVQAANAAAAAGDLSTVRKIIVACDAGMGSSAMGAGV
FT                   LRKKVQDAGLKHIAVTNCAINNLPEDVDLVITHRDLTERAMRHAPQAQHISLTNFLDSQ
FT                   LYNSLTAELLQASQLVDNTKVQKVIEKLDDSFEAFEDNLFKLGAENIFLNQHATAKEQA
FT                   IRFAGEQLVKGGYVEPEYVEAMLDREKLSSTYLGESIAVPHGTIEAKDRVLKTGVVFCQ
FT                   YPEGVRFGDEEDDVARLVIGIAARNNEHIQVITSLTNALDDDSVIARLSKTTSVQEVLD
FT                   LLGGKTSA"
FT   gene            32455..33618
FT                   /locus_tag="YPDSF_0026"
FT   CDS_pept        32455..33618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0026"
FT                   /product="D-mannitol 1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38453"
FT                   /db_xref="GOA:A4TGP0"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGP0"
FT                   /protein_id="ABP38453.1"
FT                   /translation="MKALHFGAGNIGRGFIGKLLADAGAQLTFADVNQPLLDELNKRKR
FT                   YQVNVVGEQARVEEVKNVSAVNSGSPEVVALIAEADIVTTAVGPQILARIAATVAQGLI
FT                   TRHQQGNTRPLNIIACENMVRGTSQLKQHVFAALSEDEQIWVEQHVGFVDSAVDRIVPP
FT                   SEAGSTDILAVTVETFSEWIVDGTQFKGQPPEIVGMELTDNLMAFVERKLFTLNTGHAI
FT                   TAYLGQLAGHQTIRDAILDPAVRQTVKGAMEESGAVLIKRYAFDPQKHAAYINKILSRF
FT                   ENPYLHDDVERVGRQPLRKLSAGDRLIKPLLGTLEYQLPHDSLVTGIAAAMSYRSEQDP
FT                   QAQELVTLLAQLGPKAALAQISGLPADSEVVEQAVSVYNAMQQKLAH"
FT   gene            33825..34379
FT                   /locus_tag="YPDSF_0027"
FT   CDS_pept        33825..34379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0027"
FT                   /product="mannitol repressor, MtlR"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38454"
FT                   /protein_id="ABP38454.1"
FT                   /translation="MIEKKQAFENRVLEHLNAGKTVRSFLMAAVDLLAEALNILVVQIF
FT                   RKDDYAVKYAVEPLLVGDGPLSELSVRLKLVYALGVITRHEYEDAELLMALREELNHDG
FT                   TEYRFTDDEILGPFGELHCVDELPPVPTFLRPDEADASLIAMQRQRYQQMVRSTMVLSI
FT                   TELLSRISVKQVSKLSPLSQG"
FT   gene            34628..34984
FT                   /locus_tag="YPDSF_0028"
FT   CDS_pept        34628..34984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38455"
FT                   /protein_id="ABP38455.1"
FT                   /translation="MKEHAEIKRLSDMLDALNHKDPTVIQQGNVELITQHMKEKEKLAA
FT                   EIQRLKEVRVKNLSAEAQKLAQLPFSRAITKKEQADMGTLKKAVRGIVVVHPMTALGRE
FT                   MGLKEVTGYAKKAF"
FT   gene            complement(35153..35629)
FT                   /locus_tag="YPDSF_0029"
FT   CDS_pept        complement(35153..35629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0029"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38456"
FT                   /protein_id="ABP38456.1"
FT                   /translation="MTNRMKALMLVTHLAVFGAGTGLGIYILPILTAETNATAPEIQAV
FT                   KQSAKYTGEFSRNQKGSDAVHWAEGKLYVSEHEIAFEGEIAPGPDYKIYLTKTQADDKE
FT                   SFLKIKDDAKLIGDLKNFGNFKKTLPAGVNPDDYTTVQIWCETFSQFIGSASYK"
FT   sig_peptide     complement(35573..35629)
FT                   /locus_tag="YPDSF_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.604 at
FT                   residue 19"
FT   gene            complement(36262..36492)
FT                   /locus_tag="YPDSF_0030"
FT   CDS_pept        complement(36262..36492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0030"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38457"
FT                   /protein_id="ABP38457.1"
FT                   /translation="MAVKKITPIAQRTVDSMKKIIFFIMPFFILLGYSHAAEKYPADIT
FT                   AYLNVADDCQYFSGEWDSTLPKERQIEIEKK"
FT   sig_peptide     complement(36382..36492)
FT                   /locus_tag="YPDSF_0030"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.972 at
FT                   residue 37"
FT   gene            complement(36682..38631)
FT                   /locus_tag="YPDSF_0031"
FT   CDS_pept        complement(36682..38631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0031"
FT                   /product="methyl-accepting chemotaxis protein II"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38458"
FT                   /protein_id="ABP38458.1"
FT                   /translation="MAVFSKIIGSFDNVKVGKKLGLSFFLMLLLVGVIAGTTAYHFSVI
FT                   EEHAYKVELSYKINDEANQAKYNRALYERTYDLKYITENTQHINNIKNLLTQSANLRWS
FT                   VDNRKNIANINHVVEEYQQQQTNFVNAVTNKDKVRQSWSISESLNNINALQQSLLNEGA
FT                   DTNTQILLAEMSQKLMTVRYNARGLLLDRNKDAETALITSINIANSAANAFMPVLSAEQ
FT                   QKLLAPVAANLALYKDNVLAYLPAYQQELEVGKVMEASANALNTLATQLFTQELQGTHN
FT                   EINNAQYQLAIAALVALLLGLLIAWRMTRQITVPLRATLDMAERIATGDLTAATTSSRT
FT                   DELGMLMNAVARMNENLRAMIDEIRIGVSQVSHASGEIAAGNTDLSSRTEQQAAAVEET
FT                   AASMEQLNATVKQNTDNAHHANQLATEASQTAQQGGKLVNDVVRTMNDISGSSKRISEI
FT                   TSVINSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRNLAQRSAQAAKEIEGLIGE
FT                   SVSQVNAGTSLVKNAGNTMEEIVRSVSHVRDIMAEIASASDEQSRGITQVSLAISEMDS
FT                   TTQQNAALVEESAAAADSLAEQAILLAQAVAVFRLSEDEGATDEGRVVTPKASNGRHTP
FT                   EDHRINQQKSWETF"
FT   sig_peptide     complement(38524..38631)
FT                   /locus_tag="YPDSF_0031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.651 at
FT                   residue 36"
FT   gene            complement(38975..39598)
FT                   /locus_tag="YPDSF_0032"
FT   CDS_pept        complement(38975..39598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0032"
FT                   /product="superoxide dismutase (Mn)"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38459"
FT                   /protein_id="ABP38459.1"
FT                   /translation="MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLES
FT                   FPELADLSVEDLIKDLDKVPAEKRTFMRNNAGGHANHSLFWKGLKLGTTLAGDLKAAIE
FT                   RDFGSVDSFKEKFEQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGVSGF
FT                   PIVGLDVWEHAYYLKFQNRRPDYIKAFWNVVNWDEAAARFAQAK"
FT   gene            complement(40034..40858)
FT                   /locus_tag="YPDSF_0033"
FT   CDS_pept        complement(40034..40858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0033"
FT                   /product="formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38460"
FT                   /db_xref="GOA:A4TGP7"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGP7"
FT                   /protein_id="ABP38460.1"
FT                   /translation="MSQIKPSRLSSSAEIRGARQLDVLQRHKLAEPQQDWLAEEVPVAL
FT                   VYNGISHVVMMATPKDLAAFALGFSLSEGIISSPQEIYSIEMTPGCNGIEVNIELSSRR
FT                   FAGLKERRRAMAGRTGCGVCGIEQLDDIFRPITPLPFTQAFNLEHLDTALAQLKQVQPV
FT                   GQLTGCTHAAAWINPEGELLGGCEDVGRHVALDKLLGIRAKQPWQQGAVLVSSRASYEM
FT                   VQKTAMCGAEILFAVSAATTLAVEVAERCNLTLVGFSKPGRATVYTHPQRIK"
FT   gene            41055..41642
FT                   /locus_tag="YPDSF_0034"
FT   CDS_pept        41055..41642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0034"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38461"
FT                   /protein_id="ABP38461.1"
FT                   /translation="MQVSRRQFFKICAGGMAGTTVAALGFAPSVALAETRNYKLLRARE
FT                   TRNTCTYCSVGCGLLMYSLGDGAKNAKESIFHIEGDPDHPVNRGALCPKGAGLVDFIHS
FT                   ESRLKYPEYRAPGSDKWQRITWDDAFTRIAKLMKEDRDANFIKTNDAGVTVNRWLSTGM
FT                   LCASASSNETGYLTQKFSRALGMLAVDNQARV"
FT   sig_peptide     41055..41156
FT                   /locus_tag="YPDSF_0034"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 34"
FT   gene            41691..44102
FT                   /locus_tag="YPDSF_0035"
FT   CDS_pept        41691..44102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0035"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38462"
FT                   /protein_id="ABP38462.1"
FT                   /translation="MTNHWVDIKNADLIIVMGGNAAEAHPVGFRWAMEAKIHNNAKLLV
FT                   IDPRFTRTASVADFYTPIRSGTDIAFLSGVLLYLISNNKINREYVEAYTNASLLVREDY
FT                   AFDDGLFSGYDAENRKYDKTSWNYQLDEDGFAKRDVTLQHPRCVWNLLKEHVSRYTPEV
FT                   VSNICGTPKDDFLQVCEYLAETSVSNKTATFLYALGWTQHSVGAQNIRTMAMIQLLLGN
FT                   MGMAGGGINALRGHSNIQGLTDLGLLSQSLPGYLNLPSEKQPDIDTYLKANTPKTLLPG
FT                   QVNYWSNYPKFFVSLMKSFYGDNAQKENGWGYDWLPKWDKGYDVLQYFEMMSQGKVNGY
FT                   LCQGFNPIASFPDKNKVTAALSKLKFLVTIDPLNTETANFWQNHGEFNDVDPSKIQTEV
FT                   FRLPSSCFAEENGSIVNSSRWLQWHWKGADSPGEALNDGAILAGIFMRMREMYQREGGA
FT                   VPEQVLNMTWDYLTPENPEPEEVAMESNGRALADLTDADGKVLVKKGEQLSTFAQLRDD
FT                   GTTSSGCWIFAGSWTPAGNQMARRDNADPSGLGNTLGWAWAWPLNRRILYNRASADPQG
FT                   KPWDPKRQLLEWDGAKWAGIDVADYSAAAPGSDVGPFIMQPEGMGRLFAIDKMAEGPFP
FT                   EHYEPFETPLGTNPLHPNVISNPAARVFKDDLAAMGSHEQFPYVGTTYRLTEHFHYWTK
FT                   HALLNAIAQPEQFVEIGEKLAAKKGIKQGDTVKVSSNRGFIKAKAVVTKRIRTLNVHGQ
FT                   EVDTIGIPIHWGYEGVAKKGFLANTLTPYVGDANTQTPEFKAFLVNVEKV"
FT   gene            44115..45086
FT                   /locus_tag="YPDSF_0036"
FT   CDS_pept        44115..45086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0036"
FT                   /product="formate dehydrogenase beta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38463"
FT                   /protein_id="ABP38463.1"
FT                   /translation="MSLQTQDIIRRSGTNSLTPPPQVRDHQEPVAKLIDVTTCIGCKAC
FT                   QVACSEWNDIRDEVGHNVGVYDNPADLTAKSWTVMRFSEVEDEESGKLEWLIRKDGCMH
FT                   CADPGCLKACPSEGAIIQYANGIVDFQSEHCIGCGYCIAGCPFDVPRMNKDDNRVYKCT
FT                   LCVDRVGVGQEPACVKTCPTGAIHFGTKESMKEVAAGRVAELKTRGFDNAGLYDPAGVG
FT                   GTHVMYVLHHADKPQLYHGLPENPTISPTVTFWKGIWKPLAAVGFAATFAASIFHYVGV
FT                   GPNRVEEEEEDDETTDPTPSETVAKAPEQTTSERSDEGETRK"
FT   gene            45083..45757
FT                   /locus_tag="YPDSF_0037"
FT   CDS_pept        45083..45757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0037"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38464"
FT                   /protein_id="ABP38464.1"
FT                   /translation="MKKEKPIQRYSAPERINHWIVAFCFILAAISGLGFFFPSFNWLMN
FT                   IFGTPQMARILHPFAGVVMFAAFLIMFFRYWKHNLINKDDLEWAKNIHKIAMNEEVGDT
FT                   GRYNFGQKCVFWAAIISLVLLLVSGVVIWRPYFASSFPIPLIRLALLVHSLAAVGLIIV
FT                   IMVHVYAALWVKGTITAMVEGWVPAAWAKKHHPRWYREVRSKDDARANAKGQPQEKQKE
FT                   KP"
FT   gene            45757..46686
FT                   /locus_tag="YPDSF_0038"
FT   CDS_pept        45757..46686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0038"
FT                   /product="formate dehydrogenase formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38465"
FT                   /db_xref="GOA:A4TGQ2"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGQ2"
FT                   /protein_id="ABP38465.1"
FT                   /translation="MSIRIVPKDQLGKQREKGTTAGNIPPLLFANLKSLYTRRTERLQQ
FT                   LALDNPLADYLDFAAKITEAQQKALHDHPLVLDMQAELVQSAASGKPPLDGSVFPRTEH
FT                   WRKLLSALIAELRHDAPDHILAVLDNLDKASVHELELYADALLNRDFSQVGSEKAPFIW
FT                   AALSLYWAQMASQIPGKARAEYGEHRQFCPVCGSIPVSSVVHIGTHNGLRYLHCNLCES
FT                   EWHVVRIKCSNCEQTRDLNYWSLDSELAAVKAESCGDCGTYLKILYQEKDPQVEAVADD
FT                   LASLILDAKMEGEGFARSSINPFLFPGE"
FT   gene            46870..48258
FT                   /locus_tag="YPDSF_0039"
FT   CDS_pept        46870..48258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0039"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38466"
FT                   /db_xref="GOA:A4TGQ3"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGQ3"
FT                   /protein_id="ABP38466.1"
FT                   /translation="MSAEPHPLYRQLPAIDRLLNEPEMAPLLAEYGPVLLADTLRQLQA
FT                   EAREYIGQFHTLADWCADWPAALRQRLNQRQPALKPVFNLTGTVLHTNLGRAPLAESAI
FT                   AAVTDAMRSAVTLEYSLEGAGRGHRDRAVADLLCALTGAEDACIVNNNAAAVFLLLTVM
FT                   AAGKQVVVSRGELVEIGGAFRIPDVMRQAGCELVEVGTTNRTHLKDYRQAINENTGLLM
FT                   KVHTSNYSIEGFTAAVSEQQLAALGQECSIPTATDLGSGSLVDMTRYGLPAEPMPQQLI
FT                   AAGVDLVTFSGDKLLGGPQAGIILGKKQWIERLQQHPLKRALRADKMTLAALDATLRLY
FT                   QQPDRLVEQLPSLRLLTRPASEIAACAQRLLAPLIACYGTDFTLDIESCWSQIGSGSLP
FT                   VDRLPSWALTFTPKDGRGSTLEALTARWRTLTKPVIGRVADGRLWLDLRCLEDEAALLR
FT                   ELAS"
FT   gene            48255..50207
FT                   /locus_tag="YPDSF_0040"
FT   CDS_pept        48255..50207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0040"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38467"
FT                   /protein_id="ABP38467.1"
FT                   /translation="MIIVTAGHVDHGKTTLLQAITGVNADRLPEEKQRGMTIDLGYAYW
FT                   PLPDGRIMGFIDVPGHEKFLANMLAGGGGIDHALLVVACDDGVMAQTREHLAILRLSGR
FT                   PALTVALTKADRVDDERIAQVHQQILQELVAQGWSAEQISLFVTAAVTERGIGELREHL
FT                   AQCHQQRDPKGRLQRRFRLAIDRVFSVKGAGLVVTGTALAGQVAVGDTLWLTGGDCPVR
FT                   VRGIHAQNQPAQQAQAGQRIALNISGDISKQQINRGDWLLAQPPLPPVDRVLVTVDADT
FT                   PLQHWQPLHLYHGARHITGRFSLLGHQQLIDDQQPLIDHQQIINNQSTSGGHSSQILAE
FT                   LLLDSPLWLVENDRVILRDIGAKKTLGGARVIHLAVPSRGKRQPAYLAWLTALAQATSD
FT                   REVLDLHLAQGPVSVRTFSWARQLTDNEMAALLAATDTVVAGDIALSHPHAQQAQQTLL
FT                   HVLALYHQQHGDQLGLGRARLRRMALPTLDEGVVFRLIDNLLAEGALHNTRGWLHLPEH
FT                   GLAFTEQEQIGWQQAAPYFVDDPWWVRDLAAELQAAEGEMRSLLRKAAQLGYITAVVTD
FT                   RYYLSQRIEQLADLVRELDSRQGSVSAADFRDRLGIGRKLAIQILEFFDRSGFTRRRGN
FT                   GHILRDSGLFSATGS"
FT   gene            complement(50214..50678)
FT                   /pseudo
FT                   /locus_tag="YPDSF_0041"
FT   gene            50967..51083
FT                   /locus_tag="YPDSF_0042"
FT   CDS_pept        50967..51083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0042"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38468"
FT                   /protein_id="ABP38468.1"
FT                   /translation="MTELEMEKKLLNNGFTAKNITHMRKIISRDDQQKGACP"
FT   gene            complement(51105..52313)
FT                   /locus_tag="YPDSF_0043"
FT   CDS_pept        complement(51105..52313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0043"
FT                   /product="transposase for the IS285 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38469"
FT                   /protein_id="ABP38469.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(52636..53217)
FT                   /locus_tag="YPDSF_0044"
FT   CDS_pept        complement(52636..53217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0044"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38470"
FT                   /protein_id="ABP38470.1"
FT                   /translation="MECYHLSKQDSMLSLKQAKVYISAKIEEHDKVIGYVIDGIAVIVG
FT                   GLQMVAGSGILLGSIASGNIVGIIVGAHLILNGASSLSEGVQRLRGNKNTTGFMQDAYM
FT                   GTAEFFGFERKTGMLAYYAADLTTSFYGVIKLSLKPDAWRLYKYIPSDYYRKINSMSKL
FT                   ALTIQGVKATNKIRVIGSTYLDDNSEYERK"
FT   gene            complement(53296..53481)
FT                   /locus_tag="YPDSF_0045"
FT   CDS_pept        complement(53296..53481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0045"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38471"
FT                   /protein_id="ABP38471.1"
FT                   /translation="MPHKKRSEQMDIGLSLQERNNKYFYAMAKIEADKLINLSRRVSFN
FT                   NIKDVFLRVKFENDIK"
FT   gene            complement(53927..55156)
FT                   /locus_tag="YPDSF_0046"
FT   CDS_pept        complement(53927..55156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0046"
FT                   /product="multidrug translocase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38472"
FT                   /protein_id="ABP38472.1"
FT                   /translation="MQTSFSPATRLGRRALLFPLCLVLFEFAAYIANDMIQPGMLAVVA
FT                   EFNASVEWVPTSMTAYLAGGMFLQWLLGPLSDRRGRRPVMLAGVAFFVVTCLAILLVNS
FT                   IEQFIAMRFLQGIGLCFIGAVGYATIQESFEEAVCIKITALMANVALIAPLLGPLAGAA
FT                   LIHVAPWQTMFVLFAVLGAISFAGLWRAMPETASLKGEKLSVANMWRDYKQVLANRRFL
FT                   CGSLALGFASLPLLAWIAQSPVILISGEQLSTFEYGILQVPIFGALIIGNLTLARLSGK
FT                   TSIPQLIRYGAGPMIVGLMIAAGSTLYSSHAYLWMTAGLSLYAFGIGLANAGLVRLTLF
FT                   ASDISKGTVSAAMGMISMMIFTLGIELAKVAYLWGDSRGFNLFNLMSGLLWLGLVMVFI
FT                   RRQPEAVATE"
FT   gene            complement(55629..56414)
FT                   /locus_tag="YPDSF_0047"
FT   CDS_pept        complement(55629..56414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0047"
FT                   /product="transposase for insertion sequence IS1661"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38473"
FT                   /protein_id="ABP38473.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            complement(57176..57934)
FT                   /locus_tag="YPDSF_0048"
FT   CDS_pept        complement(57176..57934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0048"
FT                   /product="glycerol-3-phosphate repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38474"
FT                   /protein_id="ABP38474.1"
FT                   /translation="MKQTQRHDAIIELVRLQGYVSTEELVEHFAVSPQTIRRDLNELAD
FT                   QNKIHRHHGGAALPSSSVNAAYNDRKVMWSEEKARIAQRVASQIPDGATLFIDIGTTPE
FT                   AVAHALMNHKGLRVVTNNLNVATLLTAKEDFRLILAGGEVRTRDGGIIGEATLDFISQF
FT                   RLDYGILGISGIDMDGSLLEFDYHEVRTKRAIIENSRCVMLVTDHSKFGRNAMVNLGNM
FT                   NLIDYLFTDQQPPASVMKIIEQHEVQLELC"
FT   gene            complement(57969..58805)
FT                   /locus_tag="YPDSF_0049"
FT   CDS_pept        complement(57969..58805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0049"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38475"
FT                   /db_xref="GOA:A4TGR2"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGR2"
FT                   /protein_id="ABP38475.1"
FT                   /translation="MTRVIVISNLRLAQAFVDYMATHHVALEIRPDAQGVEIWLADDEQ
FT                   LSAVQHELEQFLLDPLNPRYQAASWQAGNVNSNLPYQRFSYLQTLRSQAGPLTLSVMVL
FT                   CIAIYILMLITGDMAVMSWLAWPYNSSQYLQIWRWVSHAFLHFSLLHILFNLMWWWYLG
FT                   GQMEKRLGTSKLLVLTIVSAVFSGWGQSLFSGANFGGLSGVVYALMGYVWLTGERAPER
FT                   GISLPRGLMAFSVLWLIAGYFDILGLSIANAAHVSGLIIGLLMAFWDTRNSARTVQ"
FT   gene            complement(58823..59152)
FT                   /locus_tag="YPDSF_0050"
FT   CDS_pept        complement(58823..59152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38476"
FT                   /db_xref="GOA:A4TGR3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGR3"
FT                   /protein_id="ABP38476.1"
FT                   /translation="MEQFEAISVEQAYLRWKEGKTALVDIRDPQSYEAGHAPGAFHLTN
FT                   SSLHTFMQQTDFDQPVMVMCYHGNSSKGAAQYLLQQGFDVVYSIDGGFEAWARSYPQDI
FT                   TSESR"
FT   gene            complement(59527..62238)
FT                   /locus_tag="YPDSF_0051"
FT   CDS_pept        complement(59527..62238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0051"
FT                   /product="maltose regulon positive regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38477"
FT                   /db_xref="GOA:A4TGR4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR023768"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGR4"
FT                   /protein_id="ABP38477.1"
FT                   /translation="MLIPSKLSRPVRLQNTVVRDRLLVKLSSAANYRLTLINCPAGYGK
FT                   TTLIAQWAADQSNLGWYSLDESDNQSERFATYLIAAIQLATGGHCSKSEALSQKHQYAN
FT                   LSALFSQLFIELSNWDGPLYLVIDDYHLITNDAIHEAMRFFLRHQPENLTLIILSRTLP
FT                   SLGIANLRVRDQLLELGMQQLAFNHHEAQQFFECRLSSPLEQGDSSRLCDEVEGWVTAL
FT                   QLIALSSRQPNSSAQKSAKRLAGLNASHLSDYLVDEVLDQVDSKARAFLLRCSVLRSMN
FT                   DALIVRLTGEDNGQQLLEELERQGLFIHRMDDSAEWFCFHPLFATFLRQRCQWELALEL
FT                   PELHHAAAEGWMALGYPAEAIHHALAAGDVGMLRDILLQHAWSLFHHSELALLEQCLTA
FT                   LPYPLLVQNPELALLQAWLAQSQHRYSEVNTLLEQAELAMQERKIPVDEILRAEFGALR
FT                   AQVAINAGKPDEAEKLATDALKYLPMAHYYSRIVATSVTGEVHHCKGELARALPMMQQT
FT                   EQMARRHEAYHYALWALLQQSEILIAQGFLQAAYETQEKAFELIREQHLEQLPMHEFLL
FT                   RIRSQVLWSWSRLDEAEEAARKGVEILANYQPQQQLQCLAMLAKCSLARGDLDNANVYI
FT                   QRCEALQHGSQYHLDWITNADKPRVIHWQMTGDKVAAASWLRQTEKPGMADNHFLQGQW
FT                   RNIARVQIILGRFDEAEVVLDELNENARRLRLTSDLNRNLLLSNTLYWQTERKGEAQKA
FT                   LIESLTLANRTGFISHFVIEGEAMAQQLRQLIQLNALPELEQHRAQRILKDINQHHRHK
FT                   FAHFDEIFVDKLLTHPQVPELIRTSPLTQREWQVLGLIYSGYSNDQIANELDVAATTIK
FT                   THIRNLYQKLGVAHRQEAVQQAQRLLQMMGYV"
FT   gene            62556..64961
FT                   /locus_tag="YPDSF_0052"
FT   CDS_pept        62556..64961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0052"
FT                   /product="Glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38478"
FT                   /protein_id="ABP38478.1"
FT                   /translation="MSQPMLKKDDFLAALTRQWQRFGLTSAQQMTPYQWWEAVSAALAE
FT                   QLSAQPAPSKPKNVQRHVNYISMEFLIGRLTANNLINLGWYDTVDALLAEQQVKLSDLL
FT                   EQETDPALGNGGLGRLAACFLDSMATVEQPATGYGLNYQYGLFRQSFRECKQQEAPDNW
FT                   QRESYPWFRHNAALAVDVGFGGNLVKQADGRQLWRPAFTLRGEAWDLPVLGFRNGVTQP
FT                   LRLWQATHQHPFDLTLFNDGKFLLAEQNGVEAEKLTKVLYPNDNHLAGKRLRLMQQYFQ
FT                   CACSVADILRKHHLAGRKLAELPDYEVIQLNDTHPTIAIPEMLRVLLDEHQLSWDAAWA
FT                   ITSKTFAYTNHTLMPEALECWDEKLVRSLLPRHFVIIKQINAQFKKLVNKQWPGNDEVW
FT                   AKLAVHHNKQVRMANLCVVSGFAVNGVAQLHSDLIIKDLFPEYYQLWPNKFHNVTNGIT
FT                   PRRWLKQCNPALSGLIDDTLKVEWANDLDVLQDLEPYAEDPAFRQRYQQIKYDNKVKLA
FT                   HYVKRVMGLVINPDAIFDVQIKRLHEYKRQHLNLLHILSLYRQIRDNPALDIAPRVFLF
FT                   GAKAAPGYYLAKNIIYAINQVADKINNDPIVKDRLKVVFIPDYRVSVAELMIPAADVSE
FT                   QISTAGKEASGTGNMKMALNGALTVGTLDGANVEIAEQVGDENIFIFGHTVDQVKAILA
FT                   KGYQPKKYVKADPHLKSILDELASGAFSQGDKQAFDMMLHSLLEGGDPYLVLADFASYC
FT                   QAQKQIDALYRDKDEWTRRAILNTARVGMFSSDRSIRDYQQRIWQAKR"
FT   gene            64974..67070
FT                   /locus_tag="YPDSF_0053"
FT   CDS_pept        64974..67070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0053"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38479"
FT                   /protein_id="ABP38479.1"
FT                   /translation="MDRKSLDQAATLAGIAASYINAHGKPQATLAETKEQLLAAMGRSL
FT                   GAHDTQTANTPLPVVKVFTFGSPMQLPMAGSGDYHWQLQTENGELHQGRISAKKTLTLP
FT                   ASLPLGYHRLILEQDLQQWQCSIIVAPKRCYEPDALLQGKKLWGACVQLYTLRSEHNWG
FT                   IGDFGDLKQMLEQVGERGGSFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDINRV
FT                   EEFQQSEAAQRWWHQAETQQALAKSRESEWVDYPLVMQLKLTALRLSFPLFTARKAKDA
FT                   QVQAFRHFVEQGGSSLHQQAVFDALHAHLSEHDPMMWGWPVWPEKYRDGHSSAVADFCR
FT                   EHADEVTFYLWLQWLAASQFDDCFQSSQQRKMPIGLYRDLAVGVAEGGAETWCDRELYC
FT                   LKASVGAPPDILGPLGQNWGLPPMDPHVMVARAYQPFIDLLRANMTSCGALRIDHVMAL
FT                   LRLWWIPYGHTADQGAYVKYPVDDLLAVLALESQRHHCMVIGEDLGTVPVEIVGKLRDS
FT                   GVYSYKVLYFEHDSENIFRAPQSYPVQAMATITTHDLPTLRGYWQADDLTLGNKLGLYP
FT                   DQQILKQLYLDRERAKQGLLEGLHRYDCVPKKVGHKAALLSMSPVLNRGLQRYVADSAS
FT                   ALLGLQPEDWLDMAAPVNIPGTTDEYPNWRRKLSASLEEIFADSQINRLLKDLDKRRKN
FT                   VSVG"
FT   sig_peptide     64974..65048
FT                   /locus_tag="YPDSF_0053"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.508 at
FT                   residue 25"
FT   gene            complement(67399..67974)
FT                   /locus_tag="YPDSF_0054"
FT   CDS_pept        complement(67399..67974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38480"
FT                   /db_xref="GOA:A4TGR7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGR7"
FT                   /protein_id="ABP38480.1"
FT                   /translation="MITITDAAQSHFAKLLANQEEGTQIRVFVINPGTPTAECGVSYCP
FT                   PDAVEATDTELKFEQLSAYVDELSVPYLQDAEIDFVTDQLGSQLTLKAPNAKMRKVDDS
FT                   APLMERVEYVLQSQINPQLAGHGGRVTLMEITPEGLAILQFGGGCNGCSMVDVTLKEGI
FT                   EKELLQKFPELKGVRDLTEHQRGEHSYY"
FT   gene            complement(68034..68735)
FT                   /locus_tag="YPDSF_0055"
FT   CDS_pept        complement(68034..68735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38481"
FT                   /protein_id="ABP38481.1"
FT                   /translation="MLTTVSQCWLCQQPLYHNRHGICCYCQRHLPVLPPCCPCCGLPST
FT                   STFLRCGRCLIAPPRWHHMTFVGDYAPPLSGLIKQLKFGGAPQLAPVLARLLLLRWLRH
FT                   WRETQCRKSDKAIKPQRIVSVPLHHWRCWRRGYNQTDLLARPLAHWLGCDYTPLTLQRI
FT                   HATPPQQQLTAAQRRKNVRGIFRCAESVRGQHIALLDDVVTTGSTLNEIAHLLWAQGIA
FT                   SLQIWSVCRTL"
FT   gene            68801..69598
FT                   /locus_tag="YPDSF_0056"
FT   CDS_pept        68801..69598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0056"
FT                   /product="biotin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38482"
FT                   /protein_id="ABP38482.1"
FT                   /translation="MATGYYCMKQLYWYTCGEGDCDLVLLHGWGLNSGVWHCIIDRLAP
FT                   HFRLHLVDLPGYGRSQDYGAMSLADMAERVAQQAPKQALWLGWSMGGLVASQIALSQPE
FT                   CVRGLITVSSSPCFTARDEWPGIKPEVLAGFQHQLSDDFHRTVERFLALQTLGTESSRQ
FT                   DARLLKSVVLQHQMPDVEVLTGGLAILRTADLRTALAGFTLPFMRVYGHLDSLVPRKVA
FT                   SLLDSAWPQTQSVVMQGAAHAPFISHPNDFAKLILNFAEENKK"
FT   gene            69768..70037
FT                   /locus_tag="YPDSF_0057"
FT   CDS_pept        69768..70037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38483"
FT                   /protein_id="ABP38483.1"
FT                   /translation="MKLLKNMAVALVISGLSFAAIAAKEITKQEAEANNYEKIGTVSTT
FT                   GEATSPMDVKKALSKLADEKGGKYYVIIAEREKGKFDADAEVYK"
FT   sig_peptide     69768..69836
FT                   /locus_tag="YPDSF_0057"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.888 at
FT                   residue 23"
FT   gene            complement(70175..70432)
FT                   /locus_tag="YPDSF_0058"
FT   CDS_pept        complement(70175..70432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38484"
FT                   /db_xref="GOA:A4TGS1"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR023732"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGS1"
FT                   /protein_id="ABP38484.1"
FT                   /translation="MASLLQLRDAIALNGSAEASQLSRQLAIPLPLVNAMLEKLTAMGK
FT                   IERIELDHSGCLTGSCKSCPEGHQHCNTVIYQLKEPHAHQ"
FT   gene            complement(70468..72783)
FT                   /locus_tag="YPDSF_0059"
FT   CDS_pept        complement(70468..72783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0059"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38485"
FT                   /protein_id="ABP38485.1"
FT                   /translation="MKALTIGLIGNPNAGKTTLFNQLTGARQRVGNWAGVTVERKEGHF
FT                   NTAQHQVTLVDLPGTYSLTTISEQTSLDEQIACHYILSGEADLLINVIDAVNLERNLYL
FT                   TLQLLELGIPCIVALNMLDIAESQHIEIDINTLSKKLGCPVIPLVSTRGRGIDELKNSI
FT                   DQFQPATCRALVSYPPILLSEVDKLVAAMSDALPMQQRRWLALQILEGDIYSLNRAGVA
FT                   PSMVEQARQQLREQQHEDPALIIADARYQSIAHLCEAVGNSQQAEPNRLTQALDSVILN
FT                   RWLGVPIFLFVMYLMFVLAINIGGALQPIFDIGSSAIFIQGLQWVGHTLHFPPWLTIFL
FT                   AQGVGGGINTVLPLVPQIGMMYLFLSFLEDSGYMARAAFVMDRLMQALGLPGKSFVPLI
FT                   VGFGCNVPSIMGARTLDAQRERLITIMMAPFMSCGARLAIFAVFAAAFFGQDGASIVFS
FT                   LYLLGIAVAILTGLVLKYTIMRGEASPFVMELPVYHVPHLKSLLLQTWQRLKGFVLRAG
FT                   KVIVIASIFIGGLNSFSFNGKPVDSINDSALASVSKVLTPLLMPMGIHADNWQATVGLV
FT                   TGAMAKEVVVGTLNTLYTAEQINNDPFDAENFNLLDELAGAVDETWQGLKDTFSLSVLA
FT                   NPIEASKGDGEMTTGSMGMMSSKFGSSISAYSYLIFVLLYVPCVSVMGAIARETSRGWM
FT                   TFSILWGLNVAYSLATLFYQAATFRDHPQESLSIIVLVIVVNALILFGLRRARSRVTVR
FT                   LQNSEPANCCRSSGSNCH"
FT   gene            complement(72875..73102)
FT                   /locus_tag="YPDSF_0060"
FT   CDS_pept        complement(72875..73102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0060"
FT                   /product="hypothetical ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38486"
FT                   /protein_id="ABP38486.1"
FT                   /translation="MHLIPQRSYKIIGFSPEISPAYRQKLLSLGMLPGSSFNVVRLAPL
FT                   GDPIQIETRRVSLVVRKKDLDLLTLDLQPQ"
FT   gene            complement(73626..76001)
FT                   /locus_tag="YPDSF_0061"
FT   CDS_pept        complement(73626..76001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38487"
FT                   /protein_id="ABP38487.1"
FT                   /translation="MNEPLSRIIASELQARPEQVISAIRLLDEGNTVPFISRYRKEVTG
FT                   GLDDIQLRQLESRLGYLRELEDRRQTILKSIEDQGKLTDQLAGAINATLSKTELEDLYL
FT                   PYKPKRRTRGQIAIEAGLEPLAERLWQDPQQDPEHTALAYVDADKGVADTKAALDGARY
FT                   ILMERFAEDATLLAKVRQYLWKNAHLVSKVVEGKEQEGAKFRDYFDHHEPIAQVPSHRA
FT                   LAMFRGRNEGVLQLALDPDPQFDEPPRESQGEQIIINHLDLRLNNAPADGWRKAVVNWT
FT                   WRIKVLLHLETELMSTLRERAEDEAINVFARNMQDLLMAAPAGMRATMGLDPGLRTGVK
FT                   VAVVDATGKLVAFDTIYPHTGQAAKAAAVVAALCIKHQVELVAIGNGTASRETERFFVE
FT                   LQQQYPAVTAQKVIVSEAGASVYSASELASQEFPDLDVSIRGAVSIARRLQDPLAELVK
FT                   IDPKSIGVGQYQHDVSQSQLAKKLDAVVEDCVNAVGVDLNTASVPLLTRVAGLTRMMAQ
FT                   NIVNWRDENGRFRNREQLLKVSRLGPKAFEQCAGFLRINHGDNPLDASTVHPEAYPVVE
FT                   RILAATEQALQDLMGNANALRNLNARDFTTERFGVPTVTDILRELEKPGRDPRSEFKTA
FT                   TFAEGVETLNDLTPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLADKFVDDPHKVV
FT                   KAGDIVKVKVMEVDLQRKRIALTMRLDEQPGETHSRRSNNGTGSERTNNDNRGVNRPHN
FT                   DAKGHNAPNRAPAKGRSDSSSAGNSAMSDALAAAFKKR"
FT   gene            76535..77050
FT                   /locus_tag="YPDSF_0062"
FT   CDS_pept        76535..77050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0062"
FT                   /product="transcription elongation factor GreB"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38488"
FT                   /protein_id="ABP38488.1"
FT                   /translation="MAKSNYITREGWQALDRELHYLWREERPVVTQAVSEAAAMGDRSE
FT                   NAEYIYGKKRLREIDRRVRFLAKRLEVLKIVDPDPRQEGKVFFGAWVRVENEQEEQRIF
FT                   RLVGPDEFDPAKKWISIDSPVARALIGKQVDDEVTVQTPNGEATYWILEIRYRPFDEDR
FT                   PFNEDIDN"
FT   gene            77186..77905
FT                   /locus_tag="YPDSF_0063"
FT   CDS_pept        77186..77905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0063"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38489"
FT                   /protein_id="ABP38489.1"
FT                   /translation="MQENHKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLT
FT                   RESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIP
FT                   KPFNPRELLARIRAVLRRQANELPGAPSQEEAIIAFGKFKLNLGTREMFREDEPMPLTS
FT                   GEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYI
FT                   QTVWGLGYVFVPDGNKA"
FT   gene            77902..79254
FT                   /locus_tag="YPDSF_0064"
FT   CDS_pept        77902..79254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0064"
FT                   /product="osmolarity sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38490"
FT                   /protein_id="ABP38490.1"
FT                   /translation="MKWWRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQ
FT                   FNKVLAYEVRMLMTDRLQLEDGTLLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQH
FT                   YKFLSDQMAQQLGGPTDVRVEVNKNSPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRY
FT                   TLAIMLLAVGGAWLFIRIQNRPLVELEHAALQVGKGNIPPPLREYGASEVRSVTRAFNQ
FT                   MAAGVKLLSDDRTLLMAGVSHDLRTPLTRIRLATEMMSEDDAYLSESINKDIEECNAII
FT                   EQFIDYLRTGQEMPTEPSDLNSVLGEVIAAESGYERVIETDLAEGEVLVDIHPLSIKRA
FT                   LTNMVVNAARYGNGWIKVSSGKELQRAWFQVEDDGPGIKPEDLKHLLQPFVRGDSARST
FT                   SGTGLGLAIVQRIIDAHAGSLEIGTSKRGGLRIRAYIPLPLDVKPKPPAVA"
FT   sig_peptide     77902..77994
FT                   /locus_tag="YPDSF_0064"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.519 at
FT                   residue 31"
FT   gene            complement(79409..81028)
FT                   /locus_tag="YPDSF_0065"
FT   CDS_pept        complement(79409..81028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0065"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38491"
FT                   /db_xref="GOA:A4TGS8"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGS8"
FT                   /protein_id="ABP38491.1"
FT                   /translation="MSVKGITPQELAAYGIHNVSEIVYNPSYDLLFEEETKPTLEGYER
FT                   GTLTTTGAIAVDTGIFTGRSPKDKYIVRDAITQDTVWWADQGKGKNDNKPLSQEIWNHL
FT                   KGLVTEQLSGKRLFVVDTFCGANADTRLQVRFITEVAWQAHFVKNMFIRPSDEELARFE
FT                   PDFIVMNGAKCTNPQWKEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLL
FT                   PLKGIASMHCSANVGEKGDVAIFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFE
FT                   GGCYAKTIKLSEEAEPDIYHAIKRDALLENVVVLADGTVDFNDGSKTENTRVSYPIYHI
FT                   DNIVKPVSKAGHATKVIFLTADAFGVLPPVSRLTANQTQYHFLSGFTAKLAGTERGVTE
FT                   PTPTFSACFGAAFLSLHPTQYAEVLVKRMQAVGAQAYLVNTGWNGTGKRISIKDTRAII
FT                   DAILNGEIDKAETFTLPIFDLAVPMALPGVNPDILDPRDTYADKAQWQEKAEDLAKRFA
FT                   TNFDKYTDTPAGAALVSAGPKI"
FT   gene            complement(81225..82106)
FT                   /locus_tag="YPDSF_0066"
FT   CDS_pept        complement(81225..82106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0066"
FT                   /product="heat-shock chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38492"
FT                   /db_xref="GOA:A4TGS9"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGS9"
FT                   /protein_id="ABP38492.1"
FT                   /translation="MSNHDQLHRYLFANHAVRGELVSVNETYQQVLANHDYPPAVQKLL
FT                   GEMLVATSLLTATLKFDGDITVQLQGGDGPLTLAVINGNNRQEMRGVARVKGEISDDST
FT                   LQEMVGNGYLVITITPAQGERYQGVVALEGETIAACLENYFMQSEQLPTRLFIRTGHVA
FT                   DKAAAGGMLLQVLPAQERNEDEFDHLAQLTATIKAEELFTLPANEVLYRLYHQEEVTLY
FT                   EPQNVSFRCTCSRQRCADALVTLADDDVTEMLEQDGNIDMHCEYCGNHYLFDAVDIATL
FT                   KNGNSASSEQIH"
FT   gene            complement(82269..82676)
FT                   /locus_tag="YPDSF_0067"
FT   CDS_pept        complement(82269..82676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0067"
FT                   /product="heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38493"
FT                   /protein_id="ABP38493.1"
FT                   /translation="MKDKISPAESVRLDKWLWAARFYKTRAIARDMVDGGKVHYNGQRS
FT                   KPSKLVELHAEIRLRQGNDERTVRVLALHSQRRGAEEAQTLYEETEASIANREKVAQAR
FT                   KLNALTMPHPDRRPDKKERRNLIKFKQGEPE"
FT   gene            complement(82705..83385)
FT                   /locus_tag="YPDSF_0068"
FT   CDS_pept        complement(82705..83385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38494"
FT                   /protein_id="ABP38494.1"
FT                   /translation="MPPDFNWQEIDTVLLDMDGTLLDLAFDSHFWLKLVPETLSQRRGI
FT                   PLEQAHKIIHDEYNAVQHTLNWYCFDYWRERLDLDIYAMTTDIGSRARLRQDTVPFLSG
FT                   LRQHGLQTILLTNAHPHSLAVKIEHTALDQHLDLLLSTHTFGYPKEDQRLWQAVTQHTG
FT                   LNPARTLFVDDSEAILDAAQTFGIRYCLGVENPDSSCADKTFHRHPAINDYRKLLPALQ
FT                   LRCE"
FT   gene            complement(83529..85676)
FT                   /locus_tag="YPDSF_0069"
FT   CDS_pept        complement(83529..85676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0069"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38495"
FT                   /protein_id="ABP38495.1"
FT                   /translation="MSTIVLILALLLTSLIAVGLLWWLRFRRPHPITAALPFVKLTHRK
FT                   LTPEERVSIENYLRNQQNKHGFNTQPAFDSHALAASTSSTPMLVLTPQSDNVYSVTRAI
FT                   TRYGVASDEPNKWRYYLDSIEVHLPSAWEQYITQDNDVELIQTQTIPLVISLNGHTLNN
FT                   HQSENTYQPILPSVSKNASIRKEDSEHIELLNIRKETPEEYALHGPNGLKEACAICIAL
FT                   LLLFFALSGPTVTLPWLVIVAVSLTCWACWYLFRPLSEKDLREVHCLNGTPKRWGLFGE
FT                   SNQGQINNISLGIVDLIYPAHWGPYFVHDLGKKTHIDIYLNRQVVRQGAFLSLHDEMKM
FT                   FPLQRWGKNLTLIVGSLLVLVLLLIYVPLGLPLKLSVAWLQGAQSQQVTSVAALDKMPL
FT                   RIGDMLKAQGNGMCYVPPNIQNTRGFVFTPFDCSGIYWNTASPLPQPESETIEKAAALV
FT                   ETINKQLHPQGSDASVNPKLATAIEKSGMILLDDFSDIVLKTQALCSENTDCIRLKNAL
FT                   VNLGNAKNWSALVKRAQSGNLEGMNVLLRPISADVLENLINTAASSFVYRETHLATEAL
FT                   NSPPPGGFLITSDEGKQLVNHPAPTLPLFDYSALEQWRELQRLSALLLDTPFKAEGIIT
FT                   NITTDANGTRHIALHSEPDIVTLGRYLATSLLLLVLIFCLVVNMVLLIQRAMKNRRRMD
FT                   NIQRYYDDCFNQTLTPPPFLR"
FT   sig_peptide     complement(85617..85676)
FT                   /locus_tag="YPDSF_0069"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.859 at
FT                   residue 20"
FT   gene            86263..86808
FT                   /locus_tag="YPDSF_0070"
FT   CDS_pept        86263..86808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0070"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38496"
FT                   /protein_id="ABP38496.1"
FT                   /translation="MKHLQKPKILKIETVACSRLFNVEAVELEFSNGVQRIYERMRPSN
FT                   REAVMIVPVIGNDLLLIREYAVGIEEYELGFPKGLIDPGEGVLEAANRELMEEVGYGAE
FT                   RFDFLAKLTMAPSYFSSKMNIVIAHGLYPQSLEGDEPEPLPQVRWPIANMMALLNEADF
FT                   REARNVSALFLAHTFLNQ"
FT   gene            complement(86944..89499)
FT                   /locus_tag="YPDSF_0071"
FT   CDS_pept        complement(86944..89499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0071"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38497"
FT                   /protein_id="ABP38497.1"
FT                   /translation="MKFVKYFLILAVCCILLGAASIFGLYKYIEPQLPDVATLKDIRLQ
FT                   TPMQVYSAEGELIAQFGEKRRIPLTLNQIPPEMVHAFIATEDSRFYDHHGVDPVGILRA
FT                   VSIAMLSGRASQGASTITQQLARNFFLSPERTLMRKIKEAFLAIRIEQMLTKDEILELY
FT                   LNKIYLGYRAYGVGAAAQVYFGKEVHELTLSQIAMIAGLPKAPSTFNPLYSHDRAVARR
FT                   NVVLLRMLDEKYITQAQYDQARSEELVANYHVPQIAFSAPYLAEMVRQEMIKRYGENAY
FT                   TDGYQVYTTITRKLQLAAVDSLRANVLAYDMRHGYRGPSNVLWKVGESAWSREQIIDSL
FT                   KALPVYGPLLPAVVTEADAAQATAMLADGSNVTLPMVGIRWARPFKSDNAQGPVPKKAT
FT                   DVVQPGQQIWVRKVDDNWWLAQVPDVNSALVSIDPNNGAIKALVGGFDFNQSKFNRATQ
FT                   ALRQVGSNIKPFLYTAAMDKGLTLATILNDLPITRWDSGAGTDWRPKNSPPTYDGPIRL
FT                   RQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGFPAQNIVHSESLALGSASFTPLQLVRG
FT                   YAVLANGGYLVDPYFITKITDDVGNVLFETKPKVVCDNCNLPVIYGDTQRSVVLSDDNI
FT                   ENVATSQNQNASNVPMPELEQVTPAQTTLNSEQQYAPHVISTPLAFLMRDALNSNIFGE
FT                   PGWMGTGWRAGRDLKRKDIGGKTGTTNSSKDAWFSGYGPDTVTSVWIGFDDHRRNLGRS
FT                   TASGAIPDQISGAEGGAKTAQPAWNDFMKVALEGLPEKQVPPPPGIVSVVIDKQTGKLS
FT                   NGGPGSRSEYFIDGTQPTEHTVHEVGTTLMDNGQTHELF"
FT   sig_peptide     complement(89416..89499)
FT                   /locus_tag="YPDSF_0071"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.448 at
FT                   residue 28"
FT   gene            89619..90515
FT                   /locus_tag="YPDSF_0072"
FT   CDS_pept        89619..90515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38498"
FT                   /protein_id="ABP38498.1"
FT                   /translation="MYSQYWQVGLDIQMEAIRALAVIRRRNGWQLRYWWHKILPSGVLR
FT                   EGILHQPDILSEQLKLLRKQLPRHISLRIALPAQRILQHTIHVPDRRLREPERDGFIKA
FT                   SASRLFPVNSQALALDYCRETVASSELLITAARQSEVQQWQACLEQAGLSSQVIDIAPC
FT                   ALRYMATATGLSGPYWLVHRLANEWLWVSSSDMPFHSGVVAIETECRTQENDIRLLSAL
FT                   LAQLNMRGAGEDGAPLPVYYSSVVKESLPENTRSWSPLTAFAHYQPPLPALPAAFTLAG
FT                   GLAVRAADSLSAAGAGY"
FT   gene            90515..91120
FT                   /locus_tag="YPDSF_0073"
FT   CDS_pept        90515..91120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0073"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38499"
FT                   /protein_id="ABP38499.1"
FT                   /translation="MYQVNFLPWRIARQQARYRFWRNTMLIQGIGLALYLVVVLMQARS
FT                   EHKHRQGTAAALSQQQAALSQRQQQVQQAMAQLQRIKQHIQRYHQAHQPARGYSILLQQ
FT                   LSQQIPERCWLMALRQQGDVLSFEVISRDYATINAFLAMLGRQPLLVNVSLQGITQQDE
FT                   GGFRFVVHASWRDENHHVEGHHAEGHDIDGHHVAGDYE"
FT   gene            91068..91694
FT                   /locus_tag="YPDSF_0074"
FT   CDS_pept        91068..91694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0074"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38500"
FT                   /protein_id="ABP38500.1"
FT                   /translation="MQKAMISTVIMWQGTMNKSLQRCMDRPGWQLCLWQWFFLSLLGVI
FT                   AYGGLLRPTWQQRSEAIAEVTKLQQHVEQQVSALAQLPSQVLIRQQINTLLSEKAWWQK
FT                   PEILLAHQVGETIMPFGGQVIRWQRYSGSEEAVVENAIAFRRWEATLRVSFYGLYHLFG
FT                   QLSEIRSPVLVKVISLIGDGNALTVKLILTEYLTDDLGDFDVQDK"
FT   gene            91660..92088
FT                   /locus_tag="YPDSF_0075"
FT   CDS_pept        91660..92088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0075"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38501"
FT                   /protein_id="ABP38501.1"
FT                   /translation="MTWVILMFKINSYKINSYIAVLAMGLAATRLLVIGLLPSSIFASP
FT                   HLANIERDPFQAVLATSCDSERERLTGWKLHGVVSGGGYQSAWIQRPDATWQRLTLGMR
FT                   LVSEWQVTQISAQWVDFQYENPETPCSGLSVTFSLFQQ"
FT   sig_peptide     91660..91791
FT                   /locus_tag="YPDSF_0075"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.842 at
FT                   residue 44"
FT   gene            complement(92091..92480)
FT                   /locus_tag="YPDSF_0076"
FT   CDS_pept        complement(92091..92480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0076"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38502"
FT                   /protein_id="ABP38502.1"
FT                   /translation="MTGPPLRVRGNEALLDEALFGEILLDETLFDKTLFDEVLFDEALF
FT                   DNLLSDKWLLEERLCDGTPMSKRHPINKLINPLERFKCLFLPGKYTKLKFVRLHHQVLN
FT                   CLPAAGIKIVISLLPFNADHHQTIH"
FT   gene            92287..93639
FT                   /locus_tag="YPDSF_0077"
FT   CDS_pept        92287..93639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0077"
FT                   /product="membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38503"
FT                   /protein_id="ABP38503.1"
FT                   /translation="MGVPSHSRSSNSHLSDSKLSNSASSNSTSSNSVLSNNVSSSNISP
FT                   NNASSSNASLPRTRSGGPVTLEFQDAPVSVILQALADYRQLNLITTTGVGGNLSLRLIE
FT                   VPWEQALAIILRMGRLKAEREGTVMMVFTEQEIQERQQRTKQQAAPEALANLTLALQYA
FT                   NAEQVADSLDPLQGGLLSPLGSVVADKRTNTLLIRDTPASLALLKNWLIEMDLPLQQVQ
FT                   LSAHIVTISSEDLQELGVRWGMGEGKGNTALRINDFNVNLPLPNSAASVGFHVARIGGR
FT                   LLELELSALEQENQVDIIASPRLITSHQQTASIKQGSDIPYTVSRGKKEAAAIEFKEAV
FT                   LGMEVTPKILRNGKIILDLKISQNMPGITIKRGESEMLLIDKQEIKTQVTVNDGETIVL
FT                   GGIFQQKKRQSVNKVPLLADIPLLGAMFRQDTQQQSRRELVIFITPKLISA"
FT   gene            93988..94509
FT                   /locus_tag="YPDSF_0078"
FT   CDS_pept        93988..94509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0078"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38504"
FT                   /db_xref="GOA:A4TGU1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGU1"
FT                   /protein_id="ABP38504.1"
FT                   /translation="MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGA
FT                   DVGWVFDVEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLE
FT                   TTIEKQLARTQRDKKRPLLQVDEPPREVLEALAKERNPLYEEIADVTIRTDDQSAKVVA
FT                   NQIINMLESN"
FT   gene            94566..95654
FT                   /locus_tag="YPDSF_0079"
FT   CDS_pept        94566..95654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0079"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38505"
FT                   /db_xref="GOA:A4TGU2"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGU2"
FT                   /protein_id="ABP38505.1"
FT                   /translation="MEKITVTLGERSYPITIAAGLFNDPASFKPLKAGDQVMLVTNQTL
FT                   APLYLDSLRAVLEHGGIKVDQVILPDGEQYKSLSVMEQVFSALLEKPHGRDTTLVALGG
FT                   GVVGDLTGFAAACYQRGVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASV
FT                   VVDLNCLKTLPPRELASGLAEVIKYGIILDAAFFDWLENNIDALLALDMSALAYCIRRC
FT                   CELKADVVAADEREESGARALLNLGHTYGHAIEAEMGYGVWLHGEAVAAGMVMAAQTSR
FT                   RLGQLSVSDVERIKKLLLRAGLPVCGPKEMAPESYLPHMMRDKKVLAGELRLVLPTAIG
FT                   KSEIRGGVAHDMVLASIADCRP"
FT   gene            95908..96897
FT                   /locus_tag="YPDSF_0080"
FT   CDS_pept        95908..96897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0080"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38506"
FT                   /protein_id="ABP38506.1"
FT                   /translation="MDDLKLDDDLKPDSSDRRPTRSRKSPTGPKLAVSRQHMMIGIGIL
FT                   VLLLIIIAIGSALKAPTEHEASQQNPNVNAARDINLSDSSPLTSGNNSQPSIANNTSDG
FT                   HDASGVKNTAPPQDISAPPISPTPTEAAIPPSANSTTQRIELPGNMSDALSQTQGQVDT
FT                   LSQNISDAHTSTLPTAAATVAPSKGAKVPATRETITQPVQKQATKQPAVNHKNTATVAV
FT                   PPATSGTPKSGAASSRALSSAPSSHYTLQLSSASRSDTLNAYAKQQNLTDYHVYETKRD
FT                   GKPWYILVSGNYASSAEAKKAITTLPADVQAKKPWVKPVQQVQQDLKK"
FT   gene            96981..97796
FT                   /locus_tag="YPDSF_0081"
FT   CDS_pept        96981..97796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0081"
FT                   /product="DNA adenine methylase Dam"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38507"
FT                   /protein_id="ABP38507.1"
FT                   /translation="MKKNRAFLKWAGGKYPLVDDIRRHLPAGDCLIEPFVGAGSVFLNT
FT                   EFESYILADINNDLINLYNIVKLRTDDFVRDARVLFTGDFNHSELFYQLRQEFNASTDA
FT                   YRRALLFLYLNRHCYNGLCRYNLSGEFNVPFGRYKKPYFPEAELYWFAEKSQNAVFVCE
FT                   HYQETLLKAVQGAVVYCDPPYAPLSATANFTAYHTNNFGIADQQNLARLAYQLSTESKV
FT                   PVLISNHDTELTRNWYHQAASLHVVTARRTISRNILGRSKVNELLALYS"
FT   gene            98099..98776
FT                   /locus_tag="YPDSF_0082"
FT   CDS_pept        98099..98776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0082"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38508"
FT                   /protein_id="ABP38508.1"
FT                   /translation="MKKYLIAPSILSADFARLGEDTAKVLAAGADIVHFDVMDNHYVPN
FT                   LTIGPMVCKALRDYGITAPIDVHLMVKPVDRIVPDFAKAGATYITFHPEASEHVDRTLQ
FT                   LIKESGCKAGLVFNPATPLSYLDYVMDKLDVILLMSVNPGFGGQSFIPETLNKLRQVRK
FT                   LIDDSGYDIRLEVDGGVKVENIRQIAAAGADMFVAGSAIFNQPDYAAVIDAMRNELAMA
FT                   ANG"
FT   gene            98736..99467
FT                   /locus_tag="YPDSF_0083"
FT   CDS_pept        98736..99467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0083"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38509"
FT                   /protein_id="ABP38509.1"
FT                   /translation="MPCAMNWRWRLMVKFKAIRGVAFDLDGTLVDSAPGLARAIDMALA
FT                   HQGLPAAGEALVSTWIGNGADVLVERALHWAGREHNAQLVAQTRELFDHYYAKTVEQGS
FT                   QLFPQVKATLAQLAANGLPIGLITNKPTPFVAPLLTSLGISDYFSVIIGGDDVVVKKPH
FT                   PAPLYLLLGKLGLHAREMLFVGDSRNDIMAAQAAGCPCIGLTYGYNYGEAIATSHPDCV
FT                   LAHFADLLPAIGLPSLKDQEV"
FT   gene            99469..100509
FT                   /locus_tag="YPDSF_0084"
FT   CDS_pept        99469..100509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0084"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38510"
FT                   /protein_id="ABP38510.1"
FT                   /translation="MSEPMVLSKPTVSSKPIVFSGAQPSGELTIGNYMGALRQWVQMQD
FT                   DYDCIYCIVDLHAITARQDPALLRKRTLDTLALYLACGIDPKKSTIFVQSHVPEHSQLS
FT                   WALNCYTYFGELSRMTQFKDKSARYAENINAGLFDYPVLMAADILLYQTNQVPVGEDQK
FT                   QHLELSRDIASRFNNLYGDIFKIPEPFIPKAGARVMSLQDPTKKMSKSDDNRNNVIELL
FT                   EDPKSVVKKIKRAMTDSDEPALIRYDVEKKAGVSNLLDILSGVTGQSIPELEAQFTGQM
FT                   YGHLKGAVADAVSGMLSELQERYRTYREDEALLQDVMREGAAKARARAQVTLAKVYEAI
FT                   GFVAQP"
FT   gene            complement(100628..102049)
FT                   /locus_tag="YPDSF_0085"
FT   CDS_pept        complement(100628..102049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0085"
FT                   /product="uroporphyrinogen-III C-methyltransferase /
FT                   precorrin-2 dehydrogenase"
FT                   /EC_number="2.1.1.107"
FT                   /EC_number="1.3.1.76"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38511"
FT                   /db_xref="GOA:A4TGU8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGU8"
FT                   /protein_id="ABP38511.1"
FT                   /translation="MDYFPIFCQLQHKACLLVGGGEIAERKARLLLDAGALVTVNACEF
FT                   APQFHHWADQGQLSLISGEFVPELLADKWLVIAATDQLSVNALVYQSANQQRIFCNVVD
FT                   DPKRTSFIMPSIIDRSPIMIAVSSGGKAPVLARLLREKLEALLPQHLGQLAQLAGNLRQ
FT                   RVKQHFTVMTERRRFWEKLLTHDRLAQSLANNDHVQADQHVEQLFSAPLTDRGEVVLVG
FT                   AGPGDAGLLTLKGLQQIQQADVVVYDRLVSDEVMNLVRRDAERIFVGKQSGHHCVPQEQ
FT                   INQILLQQAQSGKRVVRLKGGDPFIFGRGGEELEELAGYGIPFSVVPGITAASGCSAYS
FT                   GIPLTHRDHAQSVRLVTGHAKKEGQLDWANLAAEKQTLVFYMGLSQAGEIQQQLIQHGM
FT                   PATTQVALVENGTSRHQRVVSGELSQLALLSQQVSSPSLIIVGSVVSLREKLNWFSSRH
FT                   HDDQPKVTECVAHVG"
FT   gene            complement(102137..102943)
FT                   /locus_tag="YPDSF_0086"
FT   CDS_pept        complement(102137..102943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0086"
FT                   /product="nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38512"
FT                   /protein_id="ABP38512.1"
FT                   /translation="MYTDTINKCAANAARIVKLAKESPLGFWIGSAMAGAYVGLGIILI
FT                   FTLGNLIDPALRPLVMGATFGLALTLVIIAGSELFTGHTMFLTFGVKAGTIKSSQMWAV
FT                   LPQTWLGNLLGSVFVALLYYYGGGNLLSVDTSLVHTAALAKTTAPAMTLFFKGVLCNWL
FT                   VCLAIWMAIRVEGAAKFIAIWWCLLAFIASGYEHSVANMTLLALSWFGHHSEAYTLSGI
FT                   GHNLLWVTLGNTLSGAVFMGLGYWYATPRAQRPQPATINAPHSAKS"
FT   gene            complement(103122..103448)
FT                   /locus_tag="YPDSF_0087"
FT   CDS_pept        complement(103122..103448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0087"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) small
FT                   subunit"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38513"
FT                   /protein_id="ABP38513.1"
FT                   /translation="MSQWIPLCPLNDILPGSGVCGLIKQQQVAVFRPYADEQVFAISNI
FT                   DPFAQASVLSRGLIAEHQGELWVASPLKKQHFRLRDGFCLEDEDRSVTHYDVRVRDGMV
FT                   QVNA"
FT   gene            complement(103445..105991)
FT                   /locus_tag="YPDSF_0088"
FT   CDS_pept        complement(103445..105991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0088"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) large
FT                   subunit precursor"
FT                   /EC_number="1.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38514"
FT                   /protein_id="ABP38514.1"
FT                   /translation="MSKIKIAIIGNGMVGHRFIEDLLDKADKDQFDITVFCEEPRIAYD
FT                   RVHLSSYFSHHTAEELSLVREGFYEKQGVKVLVGERAITINRAEKVIHSNSGRSLYYDK
FT                   LVMATGSYPWIPPIKGSEGQDCFVYRTIEDLNAIEACTRRSKRGAVIGGGLLGLEAAGA
FT                   LKSLGVETHVIEFAPVLMAEQLDPMGGDQLRQKIERMGVRVHTGKNTQEIVHSGQNSRK
FT                   TMLFADGTQLEVDFIVFSTGIRPQDKLANQCGLATARRGGIAINDYCQTSDPDVYAIGE
FT                   CASWQERTFGLVAPGYKMAQVAADHLLGRENAFLGADMSAKLKLLGVDVGGIGDAHGRT
FT                   EGARSYVYLDESKEIYKRLVVSADNKTLLGAVLVGDTTDYGNLLQLALNNITLPENPDS
FT                   LILPAHAGNKPTIGVDSLPDSAQICSCFDVTKGDIIRAIGQGCQTVAALKSATKAGTGC
FT                   GGCIPLVTQVLNAELSKQGIEVNNHLCEHFAYSRQELYHLIRVEGIKTFTELREKYGKG
FT                   YGCEVCKPTVGSLLASCWNEYVLEPQHTPLQDTNDNFLGNIQKDGTYSIIPRSPGGEIT
FT                   PDGLLVVGQIAKEYNLYTKLTGSQRIGMFGAQKDDLPAIWARLIDAGFETGHAYAKALR
FT                   MAKTCVGSTWCRFGVGDSVGFGVALEHRYKGIRAPHKIKFGISGCTRECAEAQGKDVGI
FT                   IATENGWNLYVCGNGGMKPRHADLLAADLDEETLMRYLDRFMMFYIRTADKLQRTSVWL
FT                   ESLEGGIRYLQLVILEDKLGINDQLEAEIARLRDKVACEWKATVENPAAQVRFAHFINS
FT                   SLRDPNVQVVREREQHRPARPDERIPVRVLELEDNA"
FT   gene            106313..107611
FT                   /locus_tag="YPDSF_0089"
FT   CDS_pept        106313..107611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0089"
FT                   /product="cytosine deaminase"
FT                   /EC_number="3.5.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38515"
FT                   /protein_id="ABP38515.1"
FT                   /translation="MAGQSVPNYSLTTVNNVRRIGLAGLWQITIAEGKISLIQPQPEQS
FT                   LTGQGVLDAQGGLALPPFIEPHIHLDTTQTAGQPSWNQSGTLFEGIERWAERKARLTRE
FT                   DVKQRAWQTLKWQIANGIQHVRTHVDVSDPHLTALSAMLEVKEEVSPWVDMQIVAFPQE
FT                   GILSYPDGAALLEEALRLGADAVGAIPHFEFTREYGVESLHIAFALAQKYQRLVDVHCD
FT                   ETDDEQSRFIETVAALALRENMGARVTASHTTAMHSYNGAYTSRLFRLLKLSGINFVAN
FT                   PLVNIHLQGRFDTYPKRRGITRVKEMLAAEINVCFGHDDVFDPWYPLGTANMLQVLHMG
FT                   LHICQLMGYEQINDGLNLITTHSAKTLNLADYGLQPGNRANLIILPAENGFDALRRQVP
FT                   VSYSIRHGVVIAKTQPAESRIYLGQEEIVDFRR"
FT   gene            complement(107696..108880)
FT                   /locus_tag="YPDSF_0090"
FT   CDS_pept        complement(107696..108880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0090"
FT                   /product="conserved integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38516"
FT                   /db_xref="GOA:A4TGV3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023528"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGV3"
FT                   /protein_id="ABP38516.1"
FT                   /translation="MNNSNRIRLTWISYLSYALTGALVIVTGIVMGNIAEYFNLPIASM
FT                   SNTFTFLNAGILISIFLNAWLMEIIPLKRQLVFGFILMLIAIAGLMVGHNLMIFSISMF
FT                   IFGVVSGITMSIGTFLVTHMYEGRQRGSRLLFTDSFFSMAGMIFPIAAAMLLARHIEWY
FT                   WVYACIGLLYVGIFVLTLCSEFPVLGHKATDQSKPVVKEKWGVGVLFLAIAALCYILGQ
FT                   LGFIQWVPEYATKTFNMNISQAGQLVSNFWISYMIGMWIFSFILRFFDLQRIVTVLAAM
FT                   ATLAMYLFVSTDNPAYLSYYILALGFVSSAIYTTLITLGSLQTKVSSPKLVNFILTCGT
FT                   VGTMLTFVVTGPIVANNGVHAALETANGLYLAVFILCLALGFFTKHRSHGHVTH"
FT   sig_peptide     complement(108782..108880)
FT                   /locus_tag="YPDSF_0090"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.923 at
FT                   residue 33"
FT   gene            109366..111426
FT                   /locus_tag="YPDSF_0091"
FT   CDS_pept        109366..111426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0091"
FT                   /product="membrane receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38517"
FT                   /protein_id="ABP38517.1"
FT                   /translation="MISGKNKVCKKKLLACAVTSAISAFASNAIASNAIADTTSLAAMN
FT                   RSAINISSTHNSNKKLNDADVITVTAPLYSPLVVVTSPKVPRQPVPASDGTDYLRTIPG
FT                   FSLVRNGGTNGDVVFRGMFGSRLKILTDGAEILGTCPSRMDAPTSYISPESFDLLTVVK
FT                   GPQSVLWGPGVSAGTILFERERPHFDQSGVKGNASVLAGSNGRWDKNLDASLGNEQGYL
FT                   RMMGNQSRAADYKDGNNVRVPSQWDKWNADMALGWTPDTDTLLELSVGKGNGEARYGGR
FT                   GMDGSQFLRESLAARVEKSNIGEVLDKIEAKINYTYVDHIMDNKTLRTPPMMAMSSNLD
FT                   RRMLGGRVMGTWLWQDLKLDAGTDMQTNTHRKNKQGNWDKNARFMNNGVFGELTWAASE
FT                   QNKLISGARLDRHQVTNYTRAGEPTRSATLPAAFMRVEHNLANAPVMLYAGLGHTERFP
FT                   DYWELFSPKFGPAGSTSAFEGVKSEKTTQIDIGGQYSGEQFRGWLSAYIGRVNDFILFK
FT                   YDPKNLRISQADNINATIMGGEMGMEYALTPYWKADASLAYAWGENTRDNRPLPQIPPL
FT                   EARLGLTFEAGDWSSSALWRLVNSQHRVAINEGNVVGKDFSSSAGFGVLSANVAYKVNK
FT                   QVKLSSGIDNLLNKAYSEHLNLAGNSGFGYSVNTPLNEPGRTLWAKLNLTF"
FT   sig_peptide     109366..109461
FT                   /locus_tag="YPDSF_0091"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.801 at
FT                   residue 32"
FT   gene            complement(111539..112525)
FT                   /locus_tag="YPDSF_0092"
FT   CDS_pept        complement(111539..112525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0092"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38518"
FT                   /protein_id="ABP38518.1"
FT                   /translation="MVTLEDVAVLAGVSRATVSRVVNGDTNVKALTREKVEQAVAVLGY
FT                   TPHPAARALASSQSNTLGLVTTSYRGGFFGALMDFVQTETESQGKQLLVTQGRDNADKE
FT                   WLAIQRLYNLRCDGLILHVRFLSDERLRQLAAANRPFVLLDRLVPDLEARCVTFDHHHA
FT                   SQMATQVLIDAGHRDIACISGSSQRQSSVLRIQGFLDAMQLAGLEPVACLEGVYDLESG
FT                   YLRADEILKQPRLPTAIYCCNEEMAIGALLAINKHGLQVPQDISLICYDSGERAPFVCP
FT                   ALTSVHFPIVEMAQYATQLLIDPLIPAVNFPPAIIMRDSVMPPKTAC"
FT   gene            complement(112774..112887)
FT                   /pseudo
FT                   /locus_tag="YPDSF_0093"
FT   gene            complement(112875..114080)
FT                   /pseudo
FT                   /locus_tag="YPDSF_0094"
FT   gene            114596..115165
FT                   /locus_tag="YPDSF_0095"
FT   CDS_pept        114596..115165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0095"
FT                   /product="peptidyl-prolyl cis-trans isomerase A"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38519"
FT                   /protein_id="ABP38519.1"
FT                   /translation="MFKRTLVTFIALCSLSAVAPAALAAGEPHVLLTTSAGNIELELNS
FT                   QKAPISTQNFVDYVNNGYYNNTIFHRVIPGFMIQGGGFTADFKEKTPKTPIKNEADNGL
FT                   RNLRGTISMARTADKDSATSQFFLNVADNAFLDHGQRDFGYAVFGKVVKGMDVVEKISQ
FT                   VQTENVGPYQNVPVKPITILSAKVLP"
FT   sig_peptide     114596..114670
FT                   /locus_tag="YPDSF_0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 25"
FT   gene            115491..117032
FT                   /locus_tag="YPDSF_0096"
FT   CDS_pept        115491..117032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38520"
FT                   /protein_id="ABP38520.1"
FT                   /translation="MSNTLLIGKALVTEKTQPASRDLVILSALANRHGLITGATGTGKT
FT                   VTLQKMAEQFSRIGVPVFLADVKGDLSGIGAEGVNSEKLQARLAAIDVTDWQPQACPIV
FT                   PWDIFAEKGHPIRATISDLGPLLLGRLLDLNDVQSGVLQLVFKIADDNGLLLLDMKDLR
FT                   AIVQYVGDNAKQFRTQYGNITSASIGAIQRGLLTLEEQGANQFFGEPMLDIHDLMQTDS
FT                   HGQGVINLLAADRLINQPKLYAIFLLWLLAELFEQLPEVGDVEKPKLVFFFDEAHLLFT
FT                   DAPAALVDKVEQVVRLIRSKGVGIYFVTQNPLDIPDKILGQLGNRVQHALRAFTPRDQK
FT                   AVKAAAQTMRPNPAFSAEQVITELGVGEALISFLDEKGRPNVVERAMVIAPQSKMGALD
FT                   AAARNHAINHSPLYGRYEEMIDRESAYEKLSAGGFSTMGRAAEGEPSVPQQPTNQQGSG
FT                   GGLMGGLNDLLFGSSGPRGGKRDGIVQTAAKSMARDLGRQILRGVLGSITGGRKR"
FT   gene            117275..117850
FT                   /locus_tag="YPDSF_0097"
FT   CDS_pept        117275..117850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0097"
FT                   /product="aminodeoxychorismate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38521"
FT                   /protein_id="ABP38521.1"
FT                   /translation="MLLLIDNYDSFTYNLYQYFCELGTEVMVKRNDELQLTDIEQLAPS
FT                   HVVISPGPCTPNEAGISLAVIRHFADKLPILGVCLGHQALGQAFGARVVRARQVMHGKT
FT                   SAICHSGQGVFRGLNQPLTVTRYHSLVIATDSLPGCFELTAWTERGGEMDEIMGIRHRT
FT                   LPLEGVQFHPESILSEQGHQLLDNFLKN"
FT   gene            117983..119200
FT                   /locus_tag="YPDSF_0098"
FT   CDS_pept        117983..119200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0098"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38522"
FT                   /protein_id="ABP38522.1"
FT                   /translation="MTDKLAVNRNTFDQVILPVYAPAQFIPVKGKGSRVWDQQGTEYID
FT                   FAGGIAVTALGHCHPALVSALHQQGETLWHTSNVFTNEPALRLAQKLIAATFADRVFFA
FT                   NSGAEANEAAFKLARHYAIERHSPYKTKIIAFHNAFHGRTLFTVSVGGQPKYSDGFGPK
FT                   PADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITSATPEFLQGVRALCDQHNALL
FT                   VFDEVQSGMGRSGKLFSYMHYGVTPDILTTAKALGGGFPISAMLTTEEIASVMTVGTHG
FT                   TTYGGNPLACAVAEAALDVINTPEVLNGIEQRHGLFVQALQSINSKYDVFSDIRGMGLL
FT                   IGAELTAKYRGQAREFLAAAAANGLMILNAGPDVLRLAPSLVIELEDIQQGMARLEKAM
FT                   ASVIKG"
FT   gene            complement(119426..121546)
FT                   /locus_tag="YPDSF_0099"
FT   CDS_pept        complement(119426..121546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0099"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38523"
FT                   /protein_id="ABP38523.1"
FT                   /translation="MKWQRLIYHPEVNYALRQTLVLCLPAALGFAIGDLRLGLMFSLIP
FT                   ACCNIASLDTPHQHFFRRLIIGGVLFTLSSFLTQQLLLWHIPLPVIMLGLALIVGVSGT
FT                   ISPLNGRLLPAALIAAIFSLSMVGRAPIWQAPLLCAVGTLWYGVFNWLWFRLCKDQPIR
FT                   EPLSQLYHLLADYCDAKYSRLTQHLEPEKAIPPLLDRQQGMMDKVNQLYQQFNLLHNTT
FT                   KKEQKRLLGLFQMALDLQEHITAALNQPEEMQDLIKKTPIEAVTQSNAQIISAQMRAIA
FT                   DDILYHRRTVEHFTAGVPLAELETIAQQNPDNPVAQFCYYHISHITQILSDRRPLYNRD
FT                   LMSSQLSQPFWPALVSYLSFKSSALRDAARIGVTLAVGSYIGVLINLPKPYWILLTIML
FT                   VMQNGYNATRVRIHHRALGTLVGLILAAGLLHLQMTEITTLGIMLLITLLSYLVQRKNY
FT                   GLAVVGRTITAVYILQLLTGEGANFLVPRLLDTLIGCALALGSALWLWPQWQSGLLRKN
FT                   AHQALEAYQTILRLLLTPHPDITQLDYERFNVNKASNTVLSSLNQAMQEPGFNSKYLAD
FT                   MRLWATHSELIVCHINEMTTLIRENPLTEVDSPSTGGHTLMSTKLAASYLQLCEMAIQL
FT                   CQQRLESDNLEDNDSVVQIPDMAPDTQASELERNLRRVLSHLNVMHTVSAMAWQQQPHH
FT                   GIWRSRKLRDNT"
FT   gene            complement(121632..122264)
FT                   /locus_tag="YPDSF_0100"
FT   CDS_pept        complement(121632..122264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0100"
FT                   /product="cAMP-regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38524"
FT                   /protein_id="ABP38524.1"
FT                   /translation="MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVK
FT                   GSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFR
FT                   QLIQVNPDILMRLSSQMANRLQITSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDG
FT                   MQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR"
FT   gene            122600..123007
FT                   /locus_tag="YPDSF_0101"
FT   CDS_pept        122600..123007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38525"
FT                   /protein_id="ABP38525.1"
FT                   /translation="MQARVKWVEGLTFLGESASGHQVLMDGNSGDKAPSPMEMLLMSAG
FT                   GGSAIDVVSILQKGRNNVRDCEVKLTSERREEAPRLFTQINLHFIVSGKGLTDKVVERA
FT                   VDLSAEKYCSVALMLGKAATITHSFEVREVA"
FT   gene            123079..123510
FT                   /locus_tag="YPDSF_0102"
FT   CDS_pept        123079..123510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0102"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38526"
FT                   /protein_id="ABP38526.1"
FT                   /translation="MKYLILGGYTVVANKNKISVACGAISLFVVASFSLFFSLTHYFNF
FT                   FKMNDEVHFSWAVSLLLSGSPLLFYLSVVSGGYIIGYEKIYNDRVGKILAYIAVLGMVF
FT                   SLFFSFYVDSSLKEAGYLKCERKSFIAPNKYVIDLKLCR"
FT   gene            complement(123688..124557)
FT                   /locus_tag="YPDSF_0103"
FT   CDS_pept        complement(123688..124557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0103"
FT                   /product="phosphoribulokinase 1"
FT                   /EC_number="2.7.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38527"
FT                   /protein_id="ABP38527.1"
FT                   /translation="MSTKHPVIAVTGSSGAGTTTTSLAFRKIFQQLDIRAAQIEGDSFH
FT                   RYTRPEMDAAIRKARDQGRHISYFGPEANDFGQLEQSVAEYSKHGTGRSRKYLHTYDEA
FT                   VPYNQIPGTFTPWEPLPEPTDVLFYEGLHGGVVTEHHDVAKHVDLLVGVVPIVNLEWIQ
FT                   KLVRDTGERGHSREAVMDSVVRSMDDYINYITPQFSRTHINFQRVPTVDTSNPFAAKAI
FT                   PSLDESFVVIHFRGLDHIDFPYLLAMLQGSFISNINTLVVPGGKMGLAMELIMAPLVQQ
FT                   LLEGKQIA"
FT   sig_peptide     complement(124483..124557)
FT                   /locus_tag="YPDSF_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.794) with cleavage site probability 0.765 at
FT                   residue 25"
FT   gene            complement(124706..124942)
FT                   /locus_tag="YPDSF_0104"
FT   CDS_pept        complement(124706..124942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38528"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGW5"
FT                   /protein_id="ABP38528.1"
FT                   /translation="MIIPWQQVDSETLDNLLEAFVLREGTDYGEHERSLTEKVADVRRQ
FT                   LVSGEAVLVWSELHETINIMPRGSFRAGAEEQQ"
FT   gene            complement(124939..125919)
FT                   /locus_tag="YPDSF_0105"
FT   CDS_pept        complement(124939..125919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38529"
FT                   /protein_id="ABP38529.1"
FT                   /translation="MHETFRPLAGASNPHLQTLLPRLVRRHVQLSPYWQRLELPDGDFI
FT                   DLAWSENPELAREKPRVVLFHGLEGNFYSPYAHGLLRAWQAAGWLGVVMHFRGCSGEPN
FT                   RKSRIYHSGETEDANFFLHWLQETYGQVPTAAVGISLGGNMLACYLAKKGKNSGLRAAV
FT                   VVSAPLMLEPCADRMDQGFSRVYQRYLLNQLKLNATRKLLQYPNSLPVNLFQLKKLRRV
FT                   RDFDDAITAKIHGFNDAGDYYRRCSALPLLPQIRVPLLIIHAKDDPFMTAEVIPNIETL
FT                   PDNIDYQLTEHGGHVGFVGGSLKHPQMWLEQRIPAWLSPYLEQQS"
FT   gene            126021..126623
FT                   /locus_tag="YPDSF_0106"
FT   CDS_pept        126021..126623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0106"
FT                   /product="ABC-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38530"
FT                   /protein_id="ABP38530.1"
FT                   /translation="MELSLFLSMVGFLWVAAITPGPNNMLLTSTGANFGFMRSIWLMLG
FT                   IMLGMQSMLLLVAFGVGSLILIYPSLHLALKILGSLYLLWLAWKIATSAYEKLDTNVAP
FT                   AKPLRLYQGWLLQFLNPKAWLMGLGSVASFSMAGAAYNHSILMISLGMFMVNLVAGIIW
FT                   LGFGTLIGRLLGSRRAWFTFNISMGLLTAACVLLIWH"
FT   gene            126826..127887
FT                   /locus_tag="YPDSF_0107"
FT   CDS_pept        126826..127887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0107"
FT                   /product="taurine-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38531"
FT                   /protein_id="ABP38531.1"
FT                   /translation="MAITFSSATLAASRRSFLQLRTILLASLLPASLLLATSAQAVDVI
FT                   VAYQTSAEPAKVAQADNSFAKLSGANADWRKFDSGSSVVRALASGDVQIGNIGSSPLAV
FT                   AASQNVPIEVFLLASQLGSSEALVVKKEIKTPQDLIGKRIAVPFISTAHYSLLAALKHW
FT                   GIKPGQVTILNLQPPAIAAAWQRGDIDGAYVWAPAVSELAKTGTVLTDSAQVGQWGAPT
FT                   LDVWVVRKDFAKAHPEVVTAFARSALAAQAAYLNNPEQWLQNQAHLAPLSRLSGVPTEQ
FT                   VPALVKGNTYLPVAEQITQLGQPVDQAIRDTAEFLKQQGKIPQVASDYRDFVTDRFVKE
FT                   IQATPQSQATPQS"
FT   sig_peptide     126826..126951
FT                   /locus_tag="YPDSF_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 42"
FT   gene            127896..128663
FT                   /locus_tag="YPDSF_0108"
FT   CDS_pept        127896..128663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0108"
FT                   /product="taurine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38532"
FT                   /protein_id="ABP38532.1"
FT                   /translation="MLNVSGLWAEYQGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLN
FT                   LIAGFMTPSAGVITLDNIPVSGPSAERGVVFQNEGLLPWRDVVSNVEFGLQLAGMSKEQ
FT                   RRVTALKMLNRVGLAGFEHHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFT
FT                   REQMQELLLTIWRDTGKQILLITHDIEEAVFLASELLLLSPGPGQVVERLSLNFGQRYA
FT                   EGEPCRAIKSDPEFIARREDVLGKVFQQREVLI"
FT   gene            128660..129514
FT                   /locus_tag="YPDSF_0109"
FT   CDS_pept        128660..129514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0109"
FT                   /product="taurine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38533"
FT                   /protein_id="ABP38533.1"
FT                   /translation="MSLHSTLRNQAINLPAADAPKKTPRRLPANQTLWISIATLASVVA
FT                   LWWAVTALQLIGPLFLPAPQQVLHQLWTIASPQGFMDATLWQHLAASLGRIFVALLAAV
FT                   VLGVPTGIAMGLNSNVRGVLDPLIEIYRPVPPLAYLPLMVIWFGIGETSKILLIYLAIF
FT                   APVTLAAVAGVRSVAHVRVRAARALGASRWQVLWFVVLPSALPEILTGIRIGLGVGWST
FT                   LVAAELIAATRGLGFMVQSAGEFLATDVVIAGISVIAIIAFGMELSLRAIQRRLTPWYG
FT                   EQQ"
FT   gene            129511..130359
FT                   /locus_tag="YPDSF_0110"
FT   CDS_pept        129511..130359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0110"
FT                   /product="taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38534"
FT                   /protein_id="ABP38534.1"
FT                   /translation="MNERLIVTPLGPHIGALVENINIAHPLGDSQFEQLYHVLLKHQVL
FT                   FFRNQPITPLQQRDLAGRFGDLHIHPVYPHTQECEEIIVLDTADDNPPDNDNWHTDVTF
FT                   IETPPLGAILAAKQLPTTGGDTLWSSGIAAYDALSAPFKQLLAGLQAEHDFTKSFPEHK
FT                   HRTTPEEHQRWLQGKEKNPPLLHPVIRTHPVSGRQALFVNEGFTTRIIGLSDKESEALL
FT                   GFLFAHTTKPEFQVRWRWQQDDVAIWDNRVTQHYANADYLPQRRVMHRATILGDRPVFR
FT                   P"
FT   gene            complement(130372..130863)
FT                   /pseudo
FT                   /locus_tag="YPDSF_0111"
FT   gene            complement(130775..131353)
FT                   /pseudo
FT                   /locus_tag="YPDSF_0112"
FT   gene            complement(131446..132435)
FT                   /locus_tag="YPDSF_0113"
FT   CDS_pept        complement(131446..132435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0113"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38535"
FT                   /protein_id="ABP38535.1"
FT                   /translation="MNSVDISVIVPVYNCANYLTDLLDSLRSQTGVSLEIIAVNDGSTD
FT                   HSLALLEQVAHIDSRLVIINQQNQGLSEARNVGIAKAKGNWVAFADGDDWLAPHALSTW
FT                   LQQVKQQKLDVLIGNGYQFSSNPERKPVTPLLGQQPWGATLNGQQWIILSVKQKEWPHY
FT                   AWLQLIRRDVISTHQLQFIRDMLHEDILWTTQLALVAQRIGFCATPFYGYRTNPDSITN
FT                   SPSMQALLRRANSYVDIINALVKIAASTKPPVRDALLSHANQESGHLLGLLRKKLPASP
FT                   QRTALAIRFITLGLRPALFRGVTNLHELWRAIRCSFLMGSYARQKRAE"
FT   gene            complement(132570..134492)
FT                   /locus_tag="YPDSF_0114"
FT   CDS_pept        complement(132570..134492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0114"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38536"
FT                   /protein_id="ABP38536.1"
FT                   /translation="MIVFSSLQIRRGTRVLLDNATATINPGQKVGLVGKNGCGKSTLLA
FT                   LLKGELSADGGNVTFPNNWALAWVNQETPALDIPAIEYVIDGDREYRQLEAELQAANEK
FT                   NDGHAIATVHGKLDAIHAWTIQSRAASLLHGLGFSQEKLQQPVRSFSGGWRMRLNLAQA
FT                   LVCRSDLLLLDEPTNHLDLDAVIWLEKWLKSYTGTLVLISHDRDFLDPIIDKILHIEQQ
FT                   TLNEYTGNYSSFERQRATKLSQQQSMYQHQQEKVAHLQSYIDRFRAQATKAKQAQSRIK
FT                   MLERMELIAPAHVDNPFHFSFRTPESLPDPLLRMDKVSAGYGENTVLQSIKLNLVPGSR
FT                   IGLLGRNGAGKSTLIKLLAGTLEPQSGEIALSKGIKLGYFAQHQLEFLRADESPLQHMS
FT                   RLAPKESEQQLRDYLGGYGFQGDQVTDPTARFSGGEKARLVLALIIWQRPNLLLLDEPT
FT                   NHLDLDMRQALTEALIDFEGALVVVSHDRHLLRSTTDDLYLVHDGKVEQFDGDLEDYQQ
FT                   WLVDSQRQQSQQDNPAKELSGNSAQQRKDQKRRDAEFRTQTQPLRKQIMTLEKQMDKLS
FT                   TELAAIEAQLADSALYDIARKADLTQCLLQQTQVKSKLEETEMQWLDVQEQLEILTKEF
FT                   SDADI"
FT   gene            134743..135291
FT                   /locus_tag="YPDSF_0115"
FT   CDS_pept        134743..135291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38537"
FT                   /db_xref="GOA:A4TGX4"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023947"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGX4"
FT                   /protein_id="ABP38537.1"
FT                   /translation="MLQPPKVLLLYAHPESQDSVANRVLLQPVQQLEHVTVHDLYAHYP
FT                   DFFIDIHHEQQLLRDHQVIVFQHPLYTYSCPALLKEWLDRVLARGFANGVGGHALTGKH
FT                   WRSVITTGEQEGTYRIGGYNRYPMEDILRPFELTAAMCHMHWINPMIIYWARRQKPETL
FT                   ASHAQAYVQWLQSPLTRGL"
FT   gene            135295..137103
FT                   /locus_tag="YPDSF_0116"
FT   CDS_pept        135295..137103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0116"
FT                   /product="potassium-efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38538"
FT                   /db_xref="GOA:A4TGX5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR020884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGX5"
FT                   /protein_id="ABP38538.1"
FT                   /translation="MEGTGLLTAVLVFLFAAVVAVPIAQRLGIGAVLGYLIAGIAIGPW
FT                   GLGFIRDVDEILHFSELGVVFLMFIIGLELNPAKLWQLRRSIFGVGAGQVVITAAVLGA
FT                   LLYFTQFAWQAAVIGGVGLAMSSTAMALQLMREKGMNRNEGGQLGFSVLLFQDMAVIPA
FT                   LALIPILAGNEGGANDWVKIGLKIAAFAGMLIGGRYLLRPLFRYIVASGVREVFTAAAL
FT                   LVVLGSALFMDALGLSMALGTFIAGILLAESEFQHELEIAIEPFKGLLLGLFFISVGMA
FT                   LDLGVLFTHLLDVLLGVLALVFIKSAILYGLARVFGLRRSVRLQFAGVLSQGGEFAFVL
FT                   FSAAFSQRVLNAEQLALLLVVVTLSMMTTPLLMQVIDRILVRRYNAQEESDEKPFVEDN
FT                   DPQVIIVGFGRFGQVIGRLLMANKMRITVLERDVSAVSMMRKYGYKVYYGDATELELLR
FT                   AAGAEKAKAIVITCNEPEDTMALVHLCQQHFPNLHILARARGRVEAHELLQNGVKDFTR
FT                   ETFSSALELGRKTLLELGMHPHQAYRAQQHFRRLDMRMLRELMPQHHGDVAQISRIKEA
FT                   RRELEDIFQREMLHESRQLDGWDEYE"
FT   sig_peptide     135295..135357
FT                   /locus_tag="YPDSF_0116"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.858 at
FT                   residue 21"
FT   gene            137119..137340
FT                   /locus_tag="YPDSF_0117"
FT   CDS_pept        137119..137340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38539"
FT                   /protein_id="ABP38539.1"
FT                   /translation="MTITLNKTVTRKRFIAGAVCPQCNALDTLALWREDQVEVVECVKC
FT                   GHHQRQTDEQVNKHVRPHEQVIGIFPPE"
FT   sig_peptide     137119..137196
FT                   /locus_tag="YPDSF_0117"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.817 at
FT                   residue 26"
FT   gene            137435..138022
FT                   /locus_tag="YPDSF_0118"
FT   CDS_pept        137435..138022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0118"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38540"
FT                   /protein_id="ABP38540.1"
FT                   /translation="MKVTKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLIAGL
FT                   ENALEGHEAGDSFDVRVNADEGYGSYDENLVQRVPKDVFMGVDELEVGMRFLADTDQGP
FT                   VPVEITAVEDEHVVVDGNHMLAGQDLNFHVEVVAVREATEEELQHGHVHGEHDHHHEHG
FT                   DGCCGGHGHDDHEHEHEHGKGGCGKSGGCGCH"
FT   gene            complement(138243..138461)
FT                   /locus_tag="YPDSF_0119"
FT   CDS_pept        complement(138243..138461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38541"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGX8"
FT                   /protein_id="ABP38541.1"
FT                   /translation="MEQSLLEQRLEMLESRLAFQEVTIEELNLIVTEHQMEMTKLREHL
FT                   RLLTDKLRESQSSMLASPSEETPPPHY"
FT   gene            138776..139576
FT                   /locus_tag="YPDSF_0120"
FT   CDS_pept        138776..139576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0120"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38542"
FT                   /protein_id="ABP38542.1"
FT                   /translation="MKSLFKVTLLATAMTLTLNTSTVFAADATSPVVTNSAFKNNDQQS
FT                   AYALGASLGRYMDNSLKEQEKLGIKLDKDQLIAGVQDAFANKSKLTDEEIEKTLQNFEA
FT                   RVKASAQAKMEQDAKENADKGAKYRDTFAKEKGVKKTASGLLYKVENAGTGDAPKDSDT
FT                   VVVNYKGTLADGTEFDNSYKRGEPLSFRLDGVIPGWTEGLKQIKKGGKITLVIPPELAY
FT                   GKAGVPGIPANSTLIFDVELLDVKAAAKADAQEQQPAVDTKAKK"
FT   sig_peptide     138776..138853
FT                   /locus_tag="YPDSF_0120"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            139830..140552
FT                   /locus_tag="YPDSF_0121"
FT   CDS_pept        139830..140552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0121"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38543"
FT                   /protein_id="ABP38543.1"
FT                   /translation="MSNSLLCSETSELDLLDERPFSQTDHEILKSYEVVVDGLAMLIGG
FT                   HCEIVLHSLEDLKNSAVRIANGEHTGRQIGSPITDLALRMLHDMAGADSSVSKAYFTRA
FT                   KSGVLMKSVTIAIRNRDQRVIGLLCINMNLDVPFSQIIQTFMPPETQEVPSSVNFASSV
FT                   DDLVAQTLEFTIEEVNADRNVSNNAKNRQVVLNLYEKGIFDIKDAINQVAERLNISKHT
FT                   VYLYIRQFKSGDLVGHER"
FT   gene            140552..140947
FT                   /locus_tag="YPDSF_0122"
FT   CDS_pept        140552..140947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38544"
FT                   /db_xref="GOA:A4TGY1"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGY1"
FT                   /protein_id="ABP38544.1"
FT                   /translation="MSALKYCLLVTGPAYGTQQASSAYQFAQAVVGAGHHLVSIFFYRE
FT                   GVLNANQLTAPASDEFDLVRAWQQLAAEQAVTLNVCVAAALRRGITDQHEAEQLNLAAA
FT                   NLQPGFTLSGLGALAEATLTCDRMVQF"
FT   gene            140947..141312
FT                   /locus_tag="YPDSF_0123"
FT   CDS_pept        140947..141312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38545"
FT                   /db_xref="GOA:A4TGY2"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR037450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGY2"
FT                   /protein_id="ABP38545.1"
FT                   /translation="MARKRIAFIFTQGPHGSSAGREGLDALLATSALSEDIGVFFISDG
FT                   VLQLLPQQQPEKILARNYIATFGVLPLYDVENCYLCERSLQQRGLSKMADWILDVTVLS
FT                   PADLRRELGTYDVVLTF"
FT   gene            141332..141619
FT                   /locus_tag="YPDSF_0124"
FT   CDS_pept        141332..141619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38546"
FT                   /db_xref="GOA:A4TGY3"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR023526"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGY3"
FT                   /protein_id="ABP38546.1"
FT                   /translation="MLYTVSHSPYHCDLSALLRLATSEDDILLLQDGVIAALKESETLK
FT                   LLLNNPASLFVLEDDVIARGLVGQISDNATLISYTHFVDLTLRHQQQLAW"
FT   gene            141757..142131
FT                   /locus_tag="YPDSF_0125"
FT   CDS_pept        141757..142131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0125"
FT                   /product="SSU ribosomal protein S12P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38547"
FT                   /db_xref="GOA:A4TGY4"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGY4"
FT                   /protein_id="ABP38547.1"
FT                   /translation="MATINQLVRKPRSMKVAKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   SGVKDRKQSRSKYGVKKQKA"
FT   gene            142228..142698
FT                   /locus_tag="YPDSF_0126"
FT   CDS_pept        142228..142698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0126"
FT                   /product="SSU ribosomal protein S7P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38548"
FT                   /db_xref="GOA:A4TGY5"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGY5"
FT                   /protein_id="ABP38548.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAEAIVYT
FT                   ALETLAQRSGKDFLEAFEVALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWI
FT                   VDAARKRGDKSMALRLANELSDAAENKGSAVKKREDVHRMAEANKAFAHYRW"
FT   gene            142792..144900
FT                   /locus_tag="YPDSF_0127"
FT   CDS_pept        142792..144900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0127"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38549"
FT                   /db_xref="GOA:A4TGY6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGY6"
FT                   /protein_id="ABP38549.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWSGMAKQFEPHHVNIIDTPGHVDFTIEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLRVVGQLKSRLG
FT                   ANPVPLQLAIGAEEKFTGIIDLVKMKAINWNEADQGVTFEYEEIPADMAELAAEWHQNL
FT                   VESAAEASDELMDKYLGGEELTEEEIKKALRQRVLKSEIILVTCGSAFKNKGVQAMLDA
FT                   VIEYLPAPTDVESINGILDDGKDTPAVRHSDDKEPFSALAFKIATDPFVGNLTFFRVYS
FT                   GIVNSGDTVLNSVKSQRERLGRIVQMHANKREEIKEVHAGDIAAAIGLKDVTTGDTLCD
FT                   PNNPIILERMEFPEPVISVAVEPKTKADQEKMGMALGRLAKEDPSFRVWTDEESGQTII
FT                   AGMGELHLDILVDRMRREFNVEANVGKPQVAYRETIRETVKDVEGKHAKQSGGRGQYGH
FT                   VVIDMSPLPPGGVGYEFVNEIVGGSIPKEFIPAVDKGIQEQLKSGPLAGYPVVDVKVRL
FT                   HYGSYHDVDSSELAFKLAGSIAFKEGFKRAKPVLLEPIMKVEVETPEDYMGDVMGDLNR
FT                   RRGIIEGMEDTATGKTVRVKVPLSEMFGYATDLRSQTQGRASYSMEFLEYAEAPSNVAK
FT                   AVIEARGK"
FT   gene            144973..146157
FT                   /locus_tag="YPDSF_0128"
FT   CDS_pept        144973..146157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0128"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38550"
FT                   /db_xref="GOA:A4TGY7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGY7"
FT                   /protein_id="ABP38550.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRELLSAYDF
FT                   PGDDLPVVRGSALKALEGEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREDIERGQVLAKPGSIKPHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNINMIVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   gene            146360..146818
FT                   /locus_tag="YPDSF_0129"
FT   CDS_pept        146360..146818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0129"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38551"
FT                   /protein_id="ABP38551.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            146994..147200
FT                   /locus_tag="YPDSF_0130"
FT   CDS_pept        146994..147200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0130"
FT                   /product="bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38552"
FT                   /protein_id="ABP38552.1"
FT                   /translation="MSLFMYVCLCNAVSDKVIRKAVRQHQPHTVKQLRQLVPIGSDCGK
FT                   CIRQAREILIEELANIPEMNDVA"
FT   gene            147279..147752
FT                   /locus_tag="YPDSF_0131"
FT   CDS_pept        147279..147752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0131"
FT                   /product="bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38553"
FT                   /protein_id="ABP38553.1"
FT                   /translation="MKGDKKIIAHLNKLLGNELVAINQYFLHARMFKNWGLMRLNDKEY
FT                   HESIDEMKHADKYIERILFLEGIPNLQELGKLNIGEDVEEMLKSDLALELSGATDLREG
FT                   IAYADSIHDYVSRDLLKEILVDEEEHIDWLETELSLIDRLGIQSYSQAQLAKD"
FT   gene            148166..148477
FT                   /locus_tag="YPDSF_0132"
FT   CDS_pept        148166..148477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0132"
FT                   /product="SSU ribosomal protein S10P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38554"
FT                   /db_xref="GOA:A4TGZ1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGZ1"
FT                   /protein_id="ABP38554.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            148510..149139
FT                   /locus_tag="YPDSF_0133"
FT   CDS_pept        148510..149139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0133"
FT                   /product="LSU ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38555"
FT                   /db_xref="GOA:A4TGZ2"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGZ2"
FT                   /protein_id="ABP38555.1"
FT                   /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKSLENDGY
FT                   RAVQVTTGAKKANRVTKPEAGHFAKAGVEAGRGLWEFRLPEGQEFTAGQEISVEIFADV
FT                   KKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAG
FT                   HMGDERVTVQSLDVVRVDAERNLLLVKGAVPGATGGNLIVKPAVKA"
FT   gene            149156..149761
FT                   /locus_tag="YPDSF_0134"
FT   CDS_pept        149156..149761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0134"
FT                   /product="LSU ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38556"
FT                   /db_xref="GOA:A4TGZ3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGZ3"
FT                   /protein_id="ABP38556.1"
FT                   /translation="MELVMKDAPGALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARAGSVKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLIIVEKFSVEAPKTKLLAQKLKDMALEDVLIVTGELDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFDKVVMTADAVKQVEEMLA"
FT   gene            149758..150060
FT                   /locus_tag="YPDSF_0135"
FT   CDS_pept        149758..150060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0135"
FT                   /product="LSU ribosomal protein L23P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38557"
FT                   /protein_id="ABP38557.1"
FT                   /translation="MIREERLLKVLRSPHVSEKASAAMEKNNTIVLKVAKDATKAEIKA
FT                   AVQKLFEVEVEDVNTLLVKGKSKRHGQRVGRRSDWKKAYVTLKEGQNLDFIGGAE"
FT   gene            150077..150901
FT                   /locus_tag="YPDSF_0136"
FT   CDS_pept        150077..150901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0136"
FT                   /product="LSU ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38558"
FT                   /db_xref="GOA:A4TGZ5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGZ5"
FT                   /protein_id="ABP38558.1"
FT                   /translation="MAIVKCKPTSPGRRHVVKVVNPELHKGKPYAPLLEKLSKSGGRNN
FT                   NGRITTRHIGGGHKQHYRLVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLKAGDQIQSGVDAAIKAGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGAYVQ
FT                   IVARDGSYVTLRLRSGEMRKVQADCRATLGEVGNAEHMLRVLGKAGASRWRGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSKK"
FT   gene            150916..151194
FT                   /locus_tag="YPDSF_0137"
FT   CDS_pept        150916..151194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0137"
FT                   /product="SSU ribosomal protein S19P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38559"
FT                   /db_xref="GOA:A4TGZ6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGZ6"
FT                   /protein_id="ABP38559.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPIRTWSRRSTVFPNMI
FT                   GLTIAVHNGRQHVPVFVSDEMVGHKLGEFAPTRTYRGHAADKKAKKR"
FT   gene            151209..151541
FT                   /locus_tag="YPDSF_0138"
FT   CDS_pept        151209..151541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0138"
FT                   /product="LSU ribosomal protein L22P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38560"
FT                   /db_xref="GOA:A4TGZ7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGZ7"
FT                   /protein_id="ABP38560.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALETLTYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   gene            151559..152257
FT                   /locus_tag="YPDSF_0139"
FT   CDS_pept        151559..152257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0139"
FT                   /product="SSU ribosomal protein S3P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38561"
FT                   /db_xref="GOA:A4TGZ8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGZ8"
FT                   /protein_id="ABP38561.1"
FT                   /translation="MGQKVHPNGIRLGIVKAWNSTWYANTKEFADNLDSDFKVRQFLTK
FT                   ELAKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIA
FT                   EVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEPAAQ
FT                   PKKQQRKGRK"
FT   gene            152270..152680
FT                   /locus_tag="YPDSF_0140"
FT   CDS_pept        152270..152680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0140"
FT                   /product="LSU ribosomal protein L16P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38562"
FT                   /db_xref="GOA:A4TGZ9"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TGZ9"
FT                   /protein_id="ABP38562.1"
FT                   /translation="MLQPKRTKFRKMHKGRNRGLAQGTDVSFGEFGLKACGRCRLTARQ
FT                   IEAARRAMTRAIKRQGKVWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLFE
FT                   MAGVPEETAREAFKLAAAKLPVGTTFVTKTVM"
FT   gene            152680..152871
FT                   /locus_tag="YPDSF_0141"
FT   CDS_pept        152680..152871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0141"
FT                   /product="LSU ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38563"
FT                   /db_xref="GOA:A4TH00"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH00"
FT                   /protein_id="ABP38563.1"
FT                   /translation="MKAQELREKSVEELNTELLNLLREQFNLRMQAASGQLQQTHLLKQ
FT                   VRRNVARVKTLLTEKAGA"
FT   gene            152871..153125
FT                   /locus_tag="YPDSF_0142"
FT   CDS_pept        152871..153125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0142"
FT                   /product="SSU ribosomal protein S17P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38564"
FT                   /db_xref="GOA:A4TH01"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH01"
FT                   /protein_id="ABP38564.1"
FT                   /translation="MTDQIRTLQGRVVSDKMEKSMVVAIERVVKHPIYGKFIRRTTKLH
FT                   VHDENNECGIGDVVEIRECRPLSKTKSWTLVRVVEKAIL"
FT   gene            153306..153677
FT                   /locus_tag="YPDSF_0143"
FT   CDS_pept        153306..153677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0143"
FT                   /product="LSU ribosomal protein L14P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38565"
FT                   /db_xref="GOA:A4TH02"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH02"
FT                   /protein_id="ABP38565.1"
FT                   /translation="MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGIGDIIKITIKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNSEQPIGTRIFGPVT
FT                   RELRNEKFMKIISLAPEVL"
FT   gene            153688..154002
FT                   /locus_tag="YPDSF_0144"
FT   CDS_pept        153688..154002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0144"
FT                   /product="LSU ribosomal protein L24P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38566"
FT                   /db_xref="GOA:A4TH03"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH03"
FT                   /protein_id="ABP38566.1"
FT                   /translation="MAAKIRRDDEVIVLTGKDKGKRGKVKNVLSSGKVIVEGINLVKKH
FT                   QKPVPALNQPGGIVEKEAAIQVSNLALFNATTGKADRVGFRFEDGKKVRFFKSTSETIK
FT                   "
FT   gene            154017..154556
FT                   /locus_tag="YPDSF_0145"
FT   CDS_pept        154017..154556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0145"
FT                   /product="LSU ribosomal protein L5P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38567"
FT                   /db_xref="GOA:A4TH04"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH04"
FT                   /protein_id="ABP38567.1"
FT                   /translation="MAKLHDYYKDEVVKQLMSQFGYDSVMQVPRVEKITLNMGVGEAIA
FT                   DKKLLDNAAADLAAISGQKPFITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLI
FT                   TIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSD
FT                   DEGRALLAAFKFPFRK"
FT   gene            154570..154875
FT                   /locus_tag="YPDSF_0146"
FT   CDS_pept        154570..154875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0146"
FT                   /product="SSU ribosomal protein S14P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38568"
FT                   /db_xref="GOA:A4TH05"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH05"
FT                   /protein_id="ABP38568.1"
FT                   /translation="MAKQSMKAREVVRVKLANKYRAKREELKAIISGVNSSDEDRWDAV
FT                   LKLQSLPRDSSPSRQRNRCNQTGRPHGFLRKFGLSRIKVRETAMRGEIPGLKKASW"
FT   gene            154909..155301
FT                   /locus_tag="YPDSF_0147"
FT   CDS_pept        154909..155301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0147"
FT                   /product="SSU ribosomal protein S8P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38569"
FT                   /db_xref="GOA:A4TH06"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH06"
FT                   /protein_id="ABP38569.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEGF
FT                   IEDFKIEGDTKPVLELALKYFQGKAVVESIQRISRPGLRIYKKKDELPKVMAGLGIAVI
FT                   STSKGVMTDRAARQAGLGGEIICYVA"
FT   gene            155316..155849
FT                   /locus_tag="YPDSF_0148"
FT   CDS_pept        155316..155849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0148"
FT                   /product="LSU ribosomal protein L6P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38570"
FT                   /db_xref="GOA:A4TH07"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH07"
FT                   /protein_id="ABP38570.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELTRTVHSAVEVKQ
FT                   EENTLTFAPREGAVDGWAQAGTTRALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVN
FT                   LALGFSHPVDHELPAGITAECPTQTEIVLKGADKQVIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
FT   gene            155859..156212
FT                   /locus_tag="YPDSF_0149"
FT   CDS_pept        155859..156212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0149"
FT                   /product="LSU ribosomal protein L18P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38571"
FT                   /db_xref="GOA:A4TH08"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH08"
FT                   /protein_id="ABP38571.1"
FT                   /translation="MDKKAARIRRATRARRKLKELGATRLVVHRTPRHIYAQVIAPNGS
FT                   EILVAASTVEKAINEQLKYAGNKDAAAAVGKTIAERALEKGITKVSFDRSGFQYHGRVQ
FT                   ALADAAREAGLQF"
FT   gene            156227..156730
FT                   /locus_tag="YPDSF_0150"
FT   CDS_pept        156227..156730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0150"
FT                   /product="SSU ribosomal protein S5P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38572"
FT                   /db_xref="GOA:A4TH09"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH09"
FT                   /protein_id="ABP38572.1"
FT                   /translation="MSHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRAMINVALNNGTLQHPVKGAHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIAALEDMKSPEMVAAKRGKSVEE
FT                   ILGK"
FT   gene            156916..157350
FT                   /locus_tag="YPDSF_0151"
FT   CDS_pept        156916..157350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0151"
FT                   /product="LSU ribosomal protein L15P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38573"
FT                   /db_xref="GOA:A4TH10"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH10"
FT                   /protein_id="ABP38573.1"
FT                   /translation="MRLNTLSPAEGAKHAPKRVGRGIGSGLGKTAGRGHKGQNSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSELALVEGDVIDLNTLKAANVVGIQ
FT                   MEFVKVILSGEVNRAVTLRGLRVTKGARAAIEAAGGKIEE"
FT   gene            157358..158689
FT                   /locus_tag="YPDSF_0152"
FT   CDS_pept        157358..158689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0152"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38574"
FT                   /protein_id="ABP38574.1"
FT                   /translation="MAKQPGLDFQSAKGGLGELKRRLLFVIGALIVFRIGSFIPIPGID
FT                   ATVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPALAE
FT                   IKKEGEAGRRKISQYTRYGTLVLAIFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVS
FT                   LVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIAHTIEQARQGDLHFLLLLL
FT                   VAVLVFAVTFFVVFIERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFAS
FT                   SIILFPATIASWFGGGTGWNWLTTISMYLQPGQPLYVLLYASAIIFFCFFYTALVFNPR
FT                   ETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLIGAMYITFICLIPEFMRDAMKVPF
FT                   YFGGTSLLIVVVVIMDFMAQVQTLMMSSQYESALKKANLKGYNR"
FT   gene            158987..159343
FT                   /locus_tag="YPDSF_0153"
FT   CDS_pept        158987..159343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0153"
FT                   /product="SSU ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38575"
FT                   /db_xref="GOA:A4TH12"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH12"
FT                   /protein_id="ABP38575.1"
FT                   /translation="MARIAGINIPDQKHTVIALTAIFGIGKTRSQAICVAAGIAEHVKI
FT                   SELSEEQIEKLRDEVAKYVVEGDLRREVTLSIKRLMDLGTYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            159360..159749
FT                   /locus_tag="YPDSF_0154"
FT   CDS_pept        159360..159749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0154"
FT                   /product="SSU ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38576"
FT                   /db_xref="GOA:A4TH13"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH13"
FT                   /protein_id="ABP38576.1"
FT                   /translation="MAKAPIRARKRVRKTVSDGVAHIHASFNNTIVTITDRQGNALGWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            159780..160400
FT                   /locus_tag="YPDSF_0155"
FT   CDS_pept        159780..160400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0155"
FT                   /product="SSU ribosomal protein S4P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38577"
FT                   /db_xref="GOA:A4TH14"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH14"
FT                   /protein_id="ABP38577.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQPPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGRLDNVVYR
FT                   MGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAE
FT                   QREKPTWLEVDAVKMEGVFKRIPERTDLSADINEHLIVELYSK"
FT   gene            160426..161415
FT                   /locus_tag="YPDSF_0156"
FT   CDS_pept        160426..161415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0156"
FT                   /product="DNA-directed RNA polymerase alpha chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38578"
FT                   /db_xref="GOA:A4TH15"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH15"
FT                   /protein_id="ABP38578.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNK
FT                   SGIGPVTAADITHDGDVEIVKPQHVICHLTDENASINMRIKVQRGRGYVPASARIHSEE
FT                   DERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAAT
FT                   ILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
FT   gene            161456..161845
FT                   /locus_tag="YPDSF_0157"
FT   CDS_pept        161456..161845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0157"
FT                   /product="LSU ribosomal protein L17P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38579"
FT                   /db_xref="GOA:A4TH16"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH16"
FT                   /protein_id="ABP38579.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDNVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAASQAEVVAAE"
FT   gene            162292..162717
FT                   /locus_tag="YPDSF_0158"
FT   CDS_pept        162292..162717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0158"
FT                   /product="MerR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38580"
FT                   /protein_id="ABP38580.1"
FT                   /translation="MLKIGQLAKLADVTPDTIRYYEKQGMMDHGERTDGGYRLYTDQDL
FT                   QRLRFIRYAKQLGFTLDTIAELLSIRIDPDHHTCQESKSIVDSRLSDVEGKIRELERMR
FT                   DSLKRLSEACCGTSHATTYCSILEALEQGATEELIKV"
FT   gene            162805..163005
FT                   /locus_tag="YPDSF_0159"
FT   CDS_pept        162805..163005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38581"
FT                   /protein_id="ABP38581.1"
FT                   /translation="MTTYRHTKGKIKDNALEALLHDPLFRQRIEKNSKGKGSYQRKEKY
FT                   AKGSNWEASGKQSIDFLLLAF"
FT   gene            complement(163115..163528)
FT                   /locus_tag="YPDSF_0160"
FT   CDS_pept        complement(163115..163528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0160"
FT                   /product="mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38582"
FT                   /db_xref="GOA:A4TH19"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH19"
FT                   /protein_id="ABP38582.1"
FT                   /translation="MSFMKEFREFAMRGNVVDLAVGVIIGAAFGRIVSSLVADIIMPPL
FT                   GLLLGGVDFKQFHFVLRAAEGTIPAVVMNYGTFIQSIFDFVIVALAIFSAVKLMNKLRR
FT                   EKAEEEPATPPAPTTEEILLAEIRDLLKAQHTK"
FT   gene            complement(163667..165043)
FT                   /locus_tag="YPDSF_0161"
FT   CDS_pept        complement(163667..165043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0161"
FT                   /product="trk system potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38583"
FT                   /protein_id="ABP38583.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITVVDIDSGRLRQLQDKFDL
FT                   RVVQGYGSHPRVLREAGAEDADMLVAVTNSDETNMIACQIAYSLFNTPNRIARIRSTEY
FT                   IREADKLFLPEAVPIDHLISPEQLVIDYIYKLIEYPGALQVVNFAEGKVSIAAVKAYYG
FT                   GPLVGNALSSLREHMPHIDTRVAAIFRQDRPIRPQGSTIIEAGDEVFFVAASQHIRAVM
FT                   SELQRLEKPYKRIMIVGGGNVGAGLALRLEKDYSVKLIERDQQRAAELAEMLHDTIVFY
FT                   GDASDQELLAEEHIEQVDVFIAITNDDEANIMSAMLAKRMGAKKAMVLIQRSAYVDLVQ
FT                   GSVIDIVISPQQATISALLGHVRKADIVSVSSLRRGVAEAIEAIAHGDESTSKVVGRMV
FT                   EDIKLPPGTTIGAIVRGDEVIIANSNSIIKQGDHVIMFITHKKFVPDVERLFQPSPFFL
FT                   "
FT   gene            complement(165099..166388)
FT                   /locus_tag="YPDSF_0162"
FT   CDS_pept        complement(165099..166388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38584"
FT                   /db_xref="GOA:A4TH21"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023541"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH21"
FT                   /protein_id="ABP38584.1"
FT                   /translation="MKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQKNISDKDRALLQ
FT                   ELCFGTLRVLPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVE
FT                   GATVLKRPQLKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQ
FT                   ILDANNQRPPMWLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCAVNHLPG
FT                   FELGWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQ
FT                   RLSRVKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWL
FT                   RRDRDISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHPEAQLT
FT                   ETGTTAAPGKQNLPHPEDGDGFFYAKIIKK"
FT   gene            complement(166482..167429)
FT                   /locus_tag="YPDSF_0163"
FT   CDS_pept        complement(166482..167429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0163"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38585"
FT                   /db_xref="GOA:A4TH22"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH22"
FT                   /protein_id="ABP38585.1"
FT                   /translation="MSDSLRIIFAGTPDFAARHLGALLSSQHKIVGVFTQPDRPAGRGN
FT                   KLTPSPVKILAEHHGIPVFQPKSLRPEENQHLVADLNADIMVVVAYGLILPAAVLAMPR
FT                   LGCINVHGSLLPRWRGAAPIQRSVWAGDEKTGITIMQMDIGLDTGAMLHKIECAIQPED
FT                   TSATLYDKLAQLGPQGLLITLQQLAAGTALAEVQNETQATYAEKLSKEEAKLDWTLSAT
FT                   QLERCIRAFNPWPVSYFIVDEQPIKVWQAQVLPAGEDAEPGTIIHADKHGIQVATADGV
FT                   LNITQLQPAGKKAMSAADLLNSRREWFIPGSQLV"
FT   gene            complement(167454..167966)
FT                   /locus_tag="YPDSF_0164"
FT   CDS_pept        complement(167454..167966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0164"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38586"
FT                   /db_xref="GOA:A4TH23"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH23"
FT                   /protein_id="ABP38586.1"
FT                   /translation="MSVLQVLHYPDERLRKIAAPVKEVNGEIQRIVDDMFETMYAEEGI
FT                   GLAATQVDVHQQIIVIDISENRDQRLVLINPELLEKSGETGIEEGCLSIPEQRALVPRA
FT                   EKVKIRALDRDGKPFELETDGLLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKMA
FT                   KLNARAN"
FT   gene            168101..169222
FT                   /locus_tag="YPDSF_0165"
FT   CDS_pept        168101..169222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38587"
FT                   /protein_id="ABP38587.1"
FT                   /translation="MLAAELWLRMTQVKGLGVVKRSALAKRLLASGDIHPGRLAAYGLD
FT                   SQQCHQFAQLSPRYIADTLEWLSDPNHHLLTYGEPGYPPRLVHIAGAPLVLFVSGELDV
FT                   LYRPQIAMVGSRHFSHYGEQWGRYFASELARTGLVITSGLAVGIDGICHQAALNIQGRT
FT                   IAVLGSGLENIYPQRHSRLAKEIEYQGGALVSEFLTTALPIAAHFPRRNRIISGLSDAV
FT                   LVVEATLKSGSLITARYAMDQGRDVFALPGPLGSASSEGTHWLIQQGAYLATSVKDVSE
FT                   QVSGSLQWLSLPEEVIISSPQEQVELPFADVLANVGDEVTPVDVVAERAGQPVQDIASK
FT                   LLELELAGWIAAVPGGYVRIRRAGHVRRSNLLI"
FT   gene            169194..169667
FT                   /locus_tag="YPDSF_0166"
FT   CDS_pept        169194..169667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38588"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH25"
FT                   /protein_id="ABP38588.1"
FT                   /translation="MFDVLIYLFETYMHNEPEMLVDQDKITDDLADAGFYREDINNALN
FT                   WLEVLADLQEGQKAPYLYTADPQALRIYTVEECRRLGAACRGFILFLEQIQVLQFDARE
FT                   MVIDRIMALDSPEIDLEDLKWVVLMVLFNIPGYENAYKQMEELLFEVNDGYLH"
FT   gene            169687..170247
FT                   /locus_tag="YPDSF_0167"
FT   CDS_pept        169687..170247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0167"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38589"
FT                   /protein_id="ABP38589.1"
FT                   /translation="MAYIEGVMTKKVITKDNGSCPECGSALVIRSGGHGPFLGCSHYPD
FT                   CQYIRPLKAQADGHVVKTLEGQPCPECGSDMMLRQGRFGMFIGCSQYPQCDHTEVIDKP
FT                   DETSIDCPQCGQGKLLQRKSRFGKVFHACNRYPDCQFTLNQPPIAGKCGYCHYPLLIEK
FT                   RTARGIKRICASKLCGKAVASES"
FT   gene            170249..170821
FT                   /locus_tag="YPDSF_0168"
FT   CDS_pept        170249..170821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38590"
FT                   /db_xref="GOA:A4TH27"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH27"
FT                   /protein_id="ABP38590.1"
FT                   /translation="MNQQENNFVLADIVRALRQEEVIAYPTEAVFGLGCDPDSEKAVNT
FT                   LLALKQRPWQKGLILVAANYAQLEPYINDSMLNEIQRETLFSTWPGPITWVIPARVETP
FT                   QWLTGCFDSLAVRVSNHPLVQQLCAEYGKPLVSTSANLSGHEPCRTEEEVRIQFGPSLP
FT                   VLSGHVGGRLNPSEIRDALTGKRFRQG"
FT   gene            170830..171651
FT                   /locus_tag="YPDSF_0169"
FT   CDS_pept        170830..171651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0169"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38591"
FT                   /db_xref="GOA:A4TH28"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH28"
FT                   /protein_id="ABP38591.1"
FT                   /translation="MDQKFAVFGNPISHSKSPRIHTLFSEQTGIEHRYGKVLAPSEAFE
FT                   NTLVSFFADGAQGANITTPFKERAYDQCDELTDRASLAGAVNTIKRLEDGRLLGDNTDG
FT                   IGLLSDLERQNLIRTTDHILLVGAGGAARGVILPLLSYGCTVVVTNRTHTRAQQLAKVF
FT                   NHIGDIDVCEMSELAGQRFDLVINATASGLHGEVPNLPAAILTSQTRCYDMFYQAGTTP
FT                   FLAWAQRLGLADYADGLGMLVGQAAHAFKLWHGVMPEITPVLAQLRSELGK"
FT   gene            complement(171706..172248)
FT                   /locus_tag="YPDSF_0170"
FT   CDS_pept        complement(171706..172248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38592"
FT                   /protein_id="ABP38592.1"
FT                   /translation="MCDSIRPYLHHSPTLGKRVMIDRSSVIIGNVILGDDVSVWPLVAI
FT                   RGDVNQVIIGARSNIQDGSVLHVTHQSEHNPEGYPLIIGEDVTIGHKAMLHGCTIGNRV
FT                   LVGMGSILLDGTIIEDDVMIGAGSLITPGKRLVSGYLYVGSPAKQIRPLTPLELEGLLY
FT                   SAGNYVRWKDDYLAESK"
FT   gene            172828..174343
FT                   /locus_tag="YPDSF_R0001"
FT   rRNA            172828..174343
FT                   /locus_tag="YPDSF_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            174446..174522
FT                   /locus_tag="YPDSF_R0002"
FT                   /note="tRNA-Ile2"
FT   tRNA            174446..174522
FT                   /locus_tag="YPDSF_R0002"
FT                   /product="tRNA-Ile"
FT   gene            174574..174649
FT                   /locus_tag="YPDSF_R0003"
FT                   /note="tRNA-Ala2"
FT   tRNA            174574..174649
FT                   /locus_tag="YPDSF_R0003"
FT                   /product="tRNA-Ala"
FT   gene            174868..177774
FT                   /locus_tag="YPDSF_R0004"
FT   rRNA            174868..177774
FT                   /locus_tag="YPDSF_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            177774..178006
FT                   /locus_tag="YPDSF_R0005"
FT   rRNA            177774..178006
FT                   /locus_tag="YPDSF_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            178015..178090
FT                   /locus_tag="YPDSF_R0006"
FT                   /note="tRNA-Thr4"
FT   tRNA            178015..178090
FT                   /locus_tag="YPDSF_R0006"
FT                   /product="tRNA-Thr"
FT   gene            178986..179915
FT                   /locus_tag="YPDSF_0171"
FT   CDS_pept        178986..179915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0171"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38593"
FT                   /db_xref="GOA:A4TH30"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH30"
FT                   /protein_id="ABP38593.1"
FT                   /translation="MPIRVPDELPAVSFLRNENVFVMASSRAKTQEIRPLKVLILNLMP
FT                   KKIETENQFLRLLSNSPLQVDIQLLRVDSRESKNTPTEHLNNFYCDFEDIQDQNFDGLI
FT                   VTGAPLGLVDFCDVAYWPQIERIIAWAKEHVTSTLFVCWAVQAALNILYGIPKMTREVK
FT                   LSGIYQHQTLEPLALLTRGFDETFLAPHSRYADFPVEVLQQYTDLDILVSSEEAGAYLF
FT                   ASKDKRVAFVTGHPEYDVDTLAGEYQRDLAAGLNPQVPLNYFPSDDASLRPKASWRSHG
FT                   HLLFANWLNYYVYQITPFDLRHMNPTLD"
FT   gene            complement(180115..180258)
FT                   /locus_tag="YPDSF_0172"
FT   CDS_pept        complement(180115..180258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0172"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38594"
FT                   /protein_id="ABP38594.1"
FT                   /translation="MSLPVKKAEFYGYFSPDRNKNNQLIHKIKNDFHFYGKYFFNLYLS
FT                   YR"
FT   gene            180336..181934
FT                   /locus_tag="YPDSF_0173"
FT   CDS_pept        180336..181934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0173"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38595"
FT                   /protein_id="ABP38595.1"
FT                   /translation="MRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQ
FT                   LLATRASWQQTIDQGALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVIN
FT                   ALNANVKVFMADFEDSLAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLI
FT                   ARVRGLHLPEKHVKWQDEAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAA
FT                   WWSDVFNFTEQRFGLSQGTIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFS
FT                   YIKTLKNHPDRVLPDRQSVTMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEK
FT                   NKLVLDKVRADKELEASNGHDGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPI
FT                   TAAELLEPCSGERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIW
FT                   QWIHHQKSLSNGQTVTKELFRSMLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQD
FT                   ELIDFLTLPGYALLA"
FT   gene            181981..183288
FT                   /locus_tag="YPDSF_0174"
FT   CDS_pept        181981..183288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0174"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38596"
FT                   /protein_id="ABP38596.1"
FT                   /translation="MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECT
FT                   FAQNGAKKLWELLHGGSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTAS
FT                   SMYPDQSLYPVDSVPAVVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGF
FT                   GGVLNAFELMKAMIEAGAAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAAD
FT                   VLGVPTLLIARTDADAADLLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYA
FT                   PYADLVWCETSTPDLALAKRFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDE
FT                   LSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFAS
FT                   HQQEVGTGYFDKVTNIIQGGASSVTALTGSTEEQQF"
FT   gene            183544..185271
FT                   /locus_tag="YPDSF_0175"
FT   CDS_pept        183544..185271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0175"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /EC_number="2.7.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38597"
FT                   /db_xref="GOA:A4TH34"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH34"
FT                   /protein_id="ABP38597.1"
FT                   /translation="MVAKLEQLIAQTILQGFDAQYGRFLEVTAGAQHRFEQADWHAVQQ
FT                   AMKKRIHLYDHHVGLVVEQLKYITDQRHFDVEFLARVKEIYTGLLPDYPRFEIAESFFN
FT                   SVYCRLFKHRDLTPDKLFVFSSQPERRFREIPRPLARDFIPKGDLSGMLQMVLNDLSLR
FT                   LHWENLSRDIDYIVMAIRQAFTDEQLASAHFQIANELFYRNKAAWLVGKLRLNGDIYPF
FT                   LLPIHHNESGELFIDTCLTSKAEASIVFGFARSYFMVYVPLPAAMVEWLREILPGKSTA
FT                   ELYTAIGCQKHGKTESYREYLAFIHQSSEQFIIAPGVKGMVMLVFTLPSFDRVFKVIKD
FT                   QFAPQKEVTQARVLECYQLVKEHDRVGRMADTQEYENFVIDKHRISPELLAELQHEVPE
FT                   KLEDLGDKIVIKHLYMERRMTPLNLYMEQADDQQLKDAIEEYGNAIKQLAAANIFPGDM
FT                   LFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDEMASEPWYSVSPNDVFPEE
FT                   FRHFLCSDRKVRHFFEEMHGDLFQASYWRGLQQRIRDGHVEDVFAYRRKQRFSQRALN"
FT   gene            complement(185391..186233)
FT                   /locus_tag="YPDSF_0176"
FT   CDS_pept        complement(185391..186233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0176"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38598"
FT                   /protein_id="ABP38598.1"
FT                   /translation="MALPIPIKRGKKPKAATQNTPAATGQVQSLTRGLKLLEYISESDG
FT                   NVALTDLAQQAGLPNSTTHRLLTTMQQQGFVRQVGDLGLWTMGAHAFIVGSSFLQSRNL
FT                   LAMVHPMLRRLMDESGETVNLAVLDHSDYQAIIIDQVQCTALMRMSAPIGGKLPMHASG
FT                   AGKAFLSTLPDDQLVQLLHKKGLHAYTQHTRTNPTSLKENLALIRKQGYSFDDEEHALG
FT                   LRCIAACLFDEHHEAFAAISISGPISRITDDRVTELGALVIHAAKEITQSYGGGTGVK"
FT   gene            186448..190143
FT                   /locus_tag="YPDSF_0177"
FT   CDS_pept        186448..190143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0177"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38599"
FT                   /protein_id="ABP38599.1"
FT                   /translation="MVDTVIDNKVKELHQQLAQRILVLDGGMGTMIQSYRLEEADYRGA
FT                   RFADWASDLKGNNDLLVLSKPEVITAIHNAYLEAGADILETNTFNSTSIAMADYQMASL
FT                   SAEINYEAARLARICADEWSARTPEKPRYVAGVLGPTNRTASISPKVNDPAFRNVSFDQ
FT                   LVEAYRESTRALIEGGVDLIMIETVFDTLNAKAATFAVESEFEVMGVLLPVMISGTITD
FT                   ASGRTLSGQTTEAFYNSLRHVKPLSFGLNCALGPDELRQYVAELSRISEYYVSAHPNAG
FT                   LPNAFGEYDLEAKEMAEQIGEWARAGFLNIVGGCCGTTPRHIAAMVNAVAGVPPRPLPD
FT                   IPVACRLAGLEPLTIDANTLFVNVGERTNVTGSARFKRLIKEEKYGEALDVARQQVESG
FT                   AQIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSRWDVIEKGLKCIQGKGI
FT                   VNSISMKEGVDAFIHHAKLVRRYGAAMVVMAFDETGQADTRARKIEICRRAYKILTETV
FT                   GFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEACADIKAELPHALISGGVSNVSFSFRG
FT                   NDPVREAIHAVFLYYAIRNGMDMGIVNASQLAIYDDLSDELRDAVEDVILNRRDDSTER
FT                   LLDLAEKYRDSKSGEVAIQQAEWRGWPVVKRLEYSLVKGITEFIELDTEEARQQADRPI
FT                   EVIEGPLMSGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPYIEASKQKGTTAGKI
FT                   LLATVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPTEKILRTAREEKVDIIGLSGLIT
FT                   PSLDEMVNVAKEMERQGFTLPLLIGGATTSKAHTAVKIEQNYSGSTTYVSNASRSVGVV
FT                   SALLSDTQREAFVAKTRKEYETVRIQHARKKPRTPPVSLQAARNNPTVIDWENYTPPVA
FT                   HKLGVQVVEASIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGEEAKRLLADANALLD
FT                   KLSAEDLLHPKGVVGLFPANSVGDDIEIYRDERRDEVLAISYHLRQQTEKTDFPNYCLA
FT                   DYVAPKSSGKADYFGAFAVTGGLEEDALADAYDAQHDDYNKIMIKALSDRLAEAFAEYL
FT                   HERVRKVYWGFAPNENLSNEELVRENYQGIRPAPGYPACPEHTEKGQIWQLLDVETHTG
FT                   MKLTESYAMWPGASVSGWYFSHPDSKYFAVAQIQRDQVEDYAARKGMPTAEVERWLAPN
FT                   LGYDAD"
FT   gene            complement(190239..192407)
FT                   /pseudo
FT                   /locus_tag="YPDSF_0178"
FT   gene            complement(192373..195147)
FT                   /pseudo
FT                   /locus_tag="YPDSF_0179"
FT   gene            complement(195217..196992)
FT                   /locus_tag="YPDSF_0180"
FT   CDS_pept        complement(195217..196992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0180"
FT                   /product="hemolysin activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABP42277"
FT                   /protein_id="ABP42277.1"
FT                   /translation="MLPVNLTQGQKELRLQINLFGQSISQSDIMIRKRTALWLVLSTGA
FT                   QAETPLAIETPSSINESRQSLQNNAKEINQLVEEKRHQQITQHNTGQSELSRPAPPPAP
FT                   VLPEDTQCLPINGVYIQGITLLTEDDLSELSAIPEQCIHPDNINLLTRELTHIYMDKGY
FT                   ITARIQFIPPDADGKLGLDITEGFVEAIDSTDTGLDGETVFPNMIGKPLNITRLDQGLD
FT                   QANRLPSNKVTVDILPGTLPGGSILKLHNTPSTPWHLTTSMDNYGNKNTGKWLSRNALS
FT                   FDNPLGLSDSVSINISNTVDRPQHNYSRAYSMFYSVPYGALTFSGFGSYAEYRYPMKLQ
FT                   FNTAKLHGETQQHGLRADYVFYRDQSQINGLSAQLTYKRASNYLNEEKIAISSPTLTIF
FT                   ELGLNHLHVLPMGLFNINVSLEQGLPWLGAERSNGPLANYQDSQFTKAKTSITSNHYFA
FT                   LFDDTYLFSNQFYGQYTRDRLPGVEWLSITDSSAIRGFSRNTLSADQGWYLQNTLSRRF
FT                   TLGDATLTPRVGLDTGRLQQKPQGWVSAMGLSAGVSLNYQNATLDIEASRGRLLSGPSK
FT                   INDPTQILARFSYRF"
FT   gene            complement(197473..198858)
FT                   /locus_tag="YPDSF_0181"
FT   CDS_pept        complement(197473..198858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0181"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38600"
FT                   /protein_id="ABP38600.1"
FT                   /translation="MIQVAPQQTRDAPSATVVAKFGGTSVASFDAMSRSADVVLSNPDV
FT                   RLVILSASAGITNLLVALADGSEPEKRADHLEDIRHIQYDIIARLTDSTVIREEIDRML
FT                   ENIAMLSEAASLATSPALTDELVSHGELMSTLLFVELLRQRQVAVEWFDVRKVMRTNDR
FT                   FGRAEPDTSALAELAQTLLAPRIEDAIVVTQGFIGSEGKGRTTTLGRGGSDYTAALLGE
FT                   ALNVSRIDIWTDVPGIYTTDPRVVPAAKRIDKIAFEEAAEMATFGAKILHPATLLPAVR
FT                   SDIPVFVGSSKDPAAGGTLVCNETYNPPLFRALALRRKQTLLTLHSLNMLHARGFLAEV
FT                   FNILARHSISVDLITTSEVSVALTLDTTGSTSTGDSLLTTSLLTELSSLCRVEVEEDLA
FT                   LVAIIGNNLSQACGVGKEVFGVLDPFNIRMICYGASSHNLCFLVPGNDADKVVQTLHYN
FT                   LFE"
FT   gene            199228..200874
FT                   /locus_tag="YPDSF_0182"
FT   CDS_pept        199228..200874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0182"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38601"
FT                   /db_xref="GOA:A4TH39"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH39"
FT                   /protein_id="ABP38601.1"
FT                   /translation="MKNINPSQTAAWKALQQHFEQMKDVTISSLFAKDDQRFNRFSATF
FT                   DDQMLVDFSKNRITSETLEKLQDLAKETDLAGAIKSMFSGEKINRTEDRAVLHIALRNR
FT                   SNTPIVVDGKDVMPEVNAVLAKMKQFCDRVISGDWKGYTGKAITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLNMHFVSNVDGTHIAEALKPLNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLSAAGDPAHVAKHFAALSTNAKAVGEFGIDTNNMFEFWDWVGGRYSLWSAIGLSI
FT                   ALSVGFEHFEQLLSGAHAMDKHFAETPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFPAYFQQGNMESNGKYVDRNGHPVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLI
FT                   PCDFIAPAISHNPLSDHHAKLLSNFFAQTEALAFGKSLEDVEAEFAAAGKTPEQVAHVA
FT                   PFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGVILNIYTFDQWGVELGKQLA
FT                   NRILPELADDQEVTSHDSSTNALINRFKNWR"
FT   gene            201009..201416
FT                   /locus_tag="YPDSF_0183"
FT   CDS_pept        201009..201416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0183"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38602"
FT                   /db_xref="GOA:A4TH40"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH40"
FT                   /protein_id="ABP38602.1"
FT                   /translation="MAKNSRSPWIAKNLQRLLNVGLIMLAAILVVFLVKETIHLGKVLF
FT                   LSNQETSSYMLIEGIVIYFLYFEFIALIVKYFESGYHFPLRYFIYIGITAIIRLIIVDH
FT                   ENPIDTLIYSGSILVLVVTLYLANTERLKRE"
FT   gene            complement(201559..202449)
FT                   /locus_tag="YPDSF_0184"
FT   CDS_pept        complement(201559..202449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0184"
FT                   /product="maltose transport system permease protein MalG"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38603"
FT                   /protein_id="ABP38603.1"
FT                   /translation="MAMVQPKSQRLRLLGTHFLMLCFIALIMFPLLMVIAISLRPGNFA
FT                   TGSLIPDQISWEHWKLALGMSVTHADGSVTPPPFPVMLWLWNSIKIALITAMGIVALST
FT                   TCAYAFARMRFRGKSALLKGMLIFQMFPAVLSLVALYALFDRIGQYMPFIGLNTHGGVI
FT                   FAYMGGIALHVWTIKGYFETIDNSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITTVFLLA
FT                   QRWLVGGLTAGGVKG"
FT   gene            complement(202463..204040)
FT                   /locus_tag="YPDSF_0185"
FT   CDS_pept        complement(202463..204040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0185"
FT                   /product="maltose transport system permease protein MalF"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38604"
FT                   /protein_id="ABP38604.1"
FT                   /translation="MQLSHTELQSRKKKIAWWQSDALKWLVISLLSLFTCYLIVLMYAQ
FT                   GEYLFAIVTLILVSLGLYVFANRRAYAWRYVYPGVAGMGLFVLFPLICTIAIAFTNYSS
FT                   TNQLTFERAQSVLLDRQFQTGKTFTFGLYPSDNQWRLQLTNPDDGSLFISEPFSFEATG
FT                   EQKVMVAPTNTAQTSEPASLRIITQSRQALSSLVAILPDGAELRMSSLRQFSGTKPLYT
FT                   LGADGKELINQQTGVKYWPNPSTGFYQAVNADGQWENEKLSPGFTVSIGWKNFLRVLHD
FT                   EGIQKPFISIFIWTILFSVMSVTFTVAVGMVLACVVQWDSLKGKAIYRVMLILPYAVPS
FT                   FISILIFKGLFNQSFGEINLMLSHLFGIKPAWFSDPITAKSMILIVNTWLGYPYMMILC
FT                   MGLLKAIPDDLYEASAMDGAGPFQNFFRITFPLLIKPLTPLMIASFAFNFNNFVLIQLL
FT                   TNGGPDMIGTSTPAGYTDLLVNYTYRVAFEGEGGQDFGLAAAIATLIFILVGALAILNL
FT                   KASKMNFD"
FT   gene            complement(204227..205438)
FT                   /locus_tag="YPDSF_0186"
FT   CDS_pept        complement(204227..205438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0186"
FT                   /product="maltose-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38605"
FT                   /protein_id="ABP38605.1"
FT                   /translation="MTRSFTKSGIGKTARVLALSALTTLVLSSSAFAKIEEGKLVIWIN
FT                   GDKGYNGLAEVGKKFEKDTGIKVTIEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYA
FT                   QSGLLAELTPSKAFQEKLFPFTWDAVRFNGKLIGYPVAVEALSLIYNKDLVKEAPKTWE
FT                   EIPALDKTLRANGKSAIMWNLQEPYFTWPVIAADGGYAFKFENGVYDAKNVGVNNAGAQ
FT                   AGLQFIVDLVKNKHINADTDYSIAEAAFNKGETAMTINGPWAWSNIDKSKINYGVTLLP
FT                   TFHGQPSKPFVGVLTAGINAASPNKELATEFLENYLITDQGLAEVNKDKPLGAVALKSF
FT                   QEQLAKDPRIAATMDNATNGEIMPNIPQMAAFWYATRSAVLNAITERQTVEAALNDAAT
FT                   RITK"
FT   sig_peptide     complement(205337..205438)
FT                   /locus_tag="YPDSF_0186"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 34"
FT   gene            206026..206262
FT                   /locus_tag="YPDSF_0187"
FT   CDS_pept        206026..206262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38606"
FT                   /protein_id="ABP38606.1"
FT                   /translation="MRLIITLLDQYVEALFNVQPYTQAATPSGATLPLAWRHGAQRESH
FT                   QGTGGNQWVMPGFASTVFLHSDSYEKLFAQAKE"
FT   gene            206266..207375
FT                   /locus_tag="YPDSF_0188"
FT   CDS_pept        206266..207375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0188"
FT                   /product="maltose/maltodextrin transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38607"
FT                   /protein_id="ABP38607.1"
FT                   /translation="MANVTLSSVYKAFGEAVISRDINLEIDDGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEDITSGELLIGGKRMNEVPPSERGIGMVFQSYALYPHLSVAENMSFGLKLAG
FT                   VKKAEIYQRVNQVAEVLQLAHLLDRRPKALSGGQRQRVAIGRTLVSEPDVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLERTMIYVTHDQVEAMTLADKIVVLDAGNIAQVGKPLELY
FT                   HYPANRFVAGFIGSPKMNFLPVKVTAAEPRQVQIELPNHQRVWLPVEGDQVQVGANMSL
FT                   GIRPEHLLPSSASEVTLEGEIQVVEQLGNETQIHIQIPAIRQNLVYRQNDVVLVEEGAT
FT                   FSIGLPPHRCHLFREDGTACKRLYQELGV"
FT   gene            207446..208717
FT                   /locus_tag="YPDSF_0189"
FT   CDS_pept        207446..208717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0189"
FT                   /product="maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38608"
FT                   /db_xref="GOA:A4TH46"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH46"
FT                   /protein_id="ABP38608.1"
FT                   /translation="MITLRKLPIALAVAAGVLSTQAMAVDFHGYARSGIGWTASGGEQQ
FT                   CFQTTGAQSKYRLGNECETYAELKLGQELWKEGDKSFYLDTNVAYSVSQRDDWESTDPA
FT                   FREANVQGKNLIESLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGLETIDLGFGKL
FT                   SVAATRNSESGGSSAWIDNQRENAKYTINNVYDVRLAGLETNPGGSLELGVDYGRADTQ
FT                   EGYSLAPNASKDGVMLTAEHTQSLMGGFNKFVVQYATDSMTSYNTGHSQGTSVNNNGHL
FT                   LRVIDHGAINLAEKWDMMYVALYQDIDLDNNNGNTWYSVGVRPMYKWTPIMSTLLEAGY
FT                   DNVKSQHTGERNGQYKLTLAQQWQAGDSIWSRPAIRVFATYANWDEKWGYSDTTGVAQD
FT                   GTIGTNSRGKNNEVTFGAQFEAWW"
FT   sig_peptide     207446..207520
FT                   /locus_tag="YPDSF_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            208958..209869
FT                   /locus_tag="YPDSF_0190"
FT   CDS_pept        208958..209869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0190"
FT                   /product="maltose operon periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38609"
FT                   /protein_id="ABP38609.1"
FT                   /translation="MKKNLLSLCLVLALGGTAPLAVQAASTISPANVSIAPTISTTTLQ
FT                   QLPWQPLVPPVTQDIQLTAGSPHISQGEVEGAVAAFALPADRGSLEVTLSSLLTDKQLF
FT                   TPSVLVLDEQMRPAAYYPSSYFTYEKAGIMINDRLQGVMKLTPALGQKQIYLLVYTTRD
FT                   DLKKTTQLLDPAKAYAQGVGNAVPDIPDPIVNHSPTGTLRIKVTSEQGMGNIMIGLIQS
FT                   APTSAPVVVGSSIQPVAAPQSEPAKPAAPMLGETENYFNQAIKDAVKAGDVDKALKLLN
FT                   EAEHLGSTSARKTFIGSVKGKG"
FT   sig_peptide     208958..209032
FT                   /locus_tag="YPDSF_0190"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 25"
FT   gene            210208..210618
FT                   /locus_tag="YPDSF_0191"
FT   CDS_pept        210208..210618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38610"
FT                   /protein_id="ABP38610.1"
FT                   /translation="MSDINKQINHANDSHFFCHSMTLNMTGSSLVVEKNPVGNFLKFAM
FT                   NFPNLLLLFSDGTLIKQVERELKTHLICNEFVKNKSKIVTVYITLGNDALLLIYYSNRV
FT                   FYKKSYIKCGDIACMNYTVNEGYLTTEIILWR"
FT   gene            complement(210770..211288)
FT                   /locus_tag="YPDSF_0192"
FT   CDS_pept        complement(210770..211288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38611"
FT                   /protein_id="ABP38611.1"
FT                   /translation="MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFE
FT                   HIVTVPTDPQSGQPSGQRAHKPLRFTVAYNKAVPLLYNALASGEMLPTVELKWYRTSIE
FT                   GKQEHFFTTKLEDATIIDIDCKMPHCQDSTKAEFTQLVRVSLAYRKINWDHTTAGTSGA
FT                   DDWRAPIEA"
FT   gene            211812..212309
FT                   /locus_tag="YPDSF_0193"
FT   CDS_pept        211812..212309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38612"
FT                   /protein_id="ABP38612.1"
FT                   /translation="MSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGV
FT                   REETSIEERQVVSVNKNNFNSVMNEANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFS
FT                   PDNVAKKVPELKKILELREALVALKGPLGNIPAFRSRLQDLLGNEDMREQLLKELDILN
FT                   QK"
FT   gene            212377..213858
FT                   /locus_tag="YPDSF_0194"
FT   CDS_pept        212377..213858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38613"
FT                   /protein_id="ABP38613.1"
FT                   /translation="MPLHEENTVLAAEPASATFLLDEIMSQTRMAPGNDGYDIAKQGVA
FT                   AFISSILDTGTNEEPINKLLVDRMIIELDKKLSAQMDEILHANEFREIESSWRSLKLLV
FT                   DRTDFRENIKINIMHATKEELLEDFEFSPEIIQSGFYKHVYSSGYGQFGGEPTAAIIGN
FT                   YAFNNSSPDMKLLQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAIKDLKSVFEGPAH
FT                   TKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYYEDVSRNHEHFLWGNTAFL
FT                   LASCLTDSFAKYRWCPNIIGPQSGGTVHDLPVHLYEAMGQIQAKIPTEVLITDRREFEL
FT                   AEEGFITLTMRKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFIINRL
FT                   AHYIKVLQREQIGSWKERQDLERELNIWLKQYIADQENPPTDVRSRRPLRSAQIQVLDV
FT                   EGDPGWYQVAMQVRPHFKYMGASFELSLVGRLDKE"
FT   gene            213865..214305
FT                   /locus_tag="YPDSF_0195"
FT   CDS_pept        213865..214305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38614"
FT                   /protein_id="ABP38614.1"
FT                   /translation="MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNE
FT                   VLNSRPGACQSAVDLGVIDLNDATATSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLN
FT                   HGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRYCFNQET"
FT   gene            214305..215531
FT                   /locus_tag="YPDSF_0196"
FT   CDS_pept        214305..215531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38615"
FT                   /protein_id="ABP38615.1"
FT                   /translation="MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLL
FT                   EGFAFLTGNLREKIDDQFPELTHGLLNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVK
FT                   RGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCRDVWLFPMSIREISANSSNEQGIL
FT                   SIHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAELVVNGITIPMPDF
FT                   DFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFSL
FT                   NLYFSQALPPEVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYD
FT                   IFSVDRVDSWLSEKGVPKGRGRALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVI
FT                   MDIFYNVTL"
FT   gene            complement(215421..216206)
FT                   /locus_tag="YPDSF_0197"
FT   CDS_pept        complement(215421..216206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0197"
FT                   /product="transposase for insertion sequence IS1661"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38616"
FT                   /protein_id="ABP38616.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            complement(216260..216565)
FT                   /locus_tag="YPDSF_0198"
FT   CDS_pept        complement(216260..216565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0198"
FT                   /product="insertion element IS1661 DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38617"
FT                   /protein_id="ABP38617.1"
FT                   /translation="MMANRCSAADASAHFNIPNETIIQNWMKRYREGGKEALNPSKTGP
FT                   TMPKDKYEHDSKPFSEMTHAELEKELEYLRAENAYLKKRKALREEKALREQQKKPE"
FT   gene            216826..217569
FT                   /locus_tag="YPDSF_0199"
FT   CDS_pept        216826..217569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38618"
FT                   /protein_id="ABP38618.1"
FT                   /translation="MHRGHGREYTSFESFHHQIEHSQEKTALYYRLRVKNSLFRKGFEH
FT                   YISFVRSDESKLVLAEENVSVSLTCTNRELPLSLRVGDINQLSTDSPSFATFRNITRPS
FT                   VPLYPVLDGGLHWSLLSNMSLNYMSLLDKDALKQILHTYDFPSLHNRQSARASQKKLDA
FT                   IQRIETQPIDRLFRGLPVRGLQTTLWLEQGAFSSEGELYLFSTVLARFFSLYASVNAFH
FT                   LLKVINLDNQECYEWPVQTGQHALM"
FT   gene            217533..218621
FT                   /locus_tag="YPDSF_0200"
FT   CDS_pept        217533..218621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38619"
FT                   /protein_id="ABP38619.1"
FT                   /translation="MAGTDRSTCTDVSVVEDVSGVENVNGVEARPEGQALDVSRYNFFQ
FT                   LVELLNQLAVAWQGAAPVATPANEAIRFKSTASLAFPTRDVIALDTSARGQFELEVSFL
FT                   GLHGSQSPLPGYYLDSLAWEDAQNENRLTDFMNVFNHRLLTLLHQIWRKYRYYICFDNG
FT                   GDDAFSQRMFSLVGLGSEVVRNKLQINHSKMLAYAGLLASPGRAPEVICSLVSHCFNLP
FT                   DITLHSWQLRKVDIAPSQQNRLGTRVKVRGKKYDEKSVLGVNFSIGSRVADRSGKFLLC
FT                   INKLTREQFLSFLPNGANYASLVMFVAFIMRDQFAWDLRLGLAEQQVGGMVLGTEQNSL
FT                   LGWTSILGDPEQKPSVTIGVME"
FT   gene            218747..220063
FT                   /locus_tag="YPDSF_0201"
FT   CDS_pept        218747..220063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38620"
FT                   /protein_id="ABP38620.1"
FT                   /translation="MDKKQPTLSLRVVNSDKLESGKQASSLFHTQGGSVGSDGSHHWSI
FT                   QDQGGNISPSQFAIEWRDGSFCLRMLNGSLNINHSMLTPNSGFVRLQQGDEMTLGNLVI
FT                   KSHISRSAADMIDPLMVSPESLVSSYSNPMDAMMEGEPLASPHHQQDSRLAATVSHNFS
FT                   HDPLRVLETESLTTQGHDAVISDADHSLQQDRYRNPLFSSPLSDTPKDSAMDQAFIDLP
FT                   QISTFLNGKQAGGKPEGLNNQMEQHHVAITPLMRGFDAQLPIRNSQEAHDFLEEAGKTL
FT                   KATIEGLLALQRSQHGLRDKHLRPIEDNPLRLNMDYDTTLNLMFADQKSPVHLSAPAAV
FT                   AESLDNLRLHHQANQQAITQALNTMLEAFSPERLLTRFTHYLRSNERQEQDSAWAWDMY
FT                   KNYYNELASSRQQGFEKLFGEVYEQAYDRALRQGMKDSE"
FT   gene            220063..220608
FT                   /locus_tag="YPDSF_0202"
FT   CDS_pept        220063..220608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0202"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38621"
FT                   /protein_id="ABP38621.1"
FT                   /translation="MNNARGYLLTWALCVVFLLSGCSGAWEATKKVGKVVMDPDIPVGQ
FT                   ATDQPSTVRLTLLSDPDTNPNEKGEAVPTEIVVVYLSENSKLLAADYDQLSSDALEKTL
FT                   GKNYIDHQEYTLLPDQFKALDPIKLEEKNSYLGVIAHYADANRSEWKKIIKIKGIGHNY
FT                   QVLVHVRSNDVDLRKEEE"
FT   sig_peptide     220063..220140
FT                   /locus_tag="YPDSF_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.746 at
FT                   residue 26"
FT   gene            220611..221957
FT                   /locus_tag="YPDSF_0203"
FT   CDS_pept        220611..221957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38622"
FT                   /protein_id="ABP38622.1"
FT                   /translation="MPTKNRVIWREGLFIKPQHFQQQQRHNDYQLQRRIIALQGYSYGF
FT                   SSLILNQELLKLGRIGLTVASGNMADGTVFDIPYQDYSPKPLDVLNCNDAASRDIYLAL
FT                   PMLNDAINEVAGQQGQAPGTLRYREHSDDVRDLHTEGGDVSQLVLAQLAPRLMQGSEDL
FT                   SAYSVLPLCRVKEKRPDGSLILDEEFIPTCTTLSVSTQLKGFMDEVEGTLVERAQLLAK
FT                   RIGSPGQQGIADVAEFMMLQVFNRTQPLFTHLAHQAILHPEAFYHQLVQTCGELRTFTD
FT                   ESRLAGTFPVYNHDNLTDSFQPLFLAMRQALSTVLTPRAISIQLHMQAHGIRVATINDS
FT                   DLLRSADFVLAVRAQIPQEQLRRQFVQQTKITSLEKIRDLVSVQLPGVPLVALSAAPRQ
FT                   LPYHSGYTYFMLDLQSPVWKEIQQSNAIAFHVSGDFPDLDMQFWAIRSS"
FT   gene            221957..222724
FT                   /locus_tag="YPDSF_0204"
FT   CDS_pept        221957..222724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0204"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38623"
FT                   /protein_id="ABP38623.1"
FT                   /translation="MKTDAVTDNTPFPAAEAVTSHRQYQLPLRGESLNAMIDTATPLLG
FT                   MVLRLKDMENQALPDQLYQQVVTDIRAIEQYLQTKGYEPGAIISFRYVLCTFIDETALG
FT                   HGWNTQNGWLQQSLLVHFHNETWGGEKVYVLLERLMGEPKRYQDLLEFIYLCFCLGYRG
FT                   RYKVTSQNGDDFERLFRRLHHQLQQLRGDAPPTVLYQGGGRLNSRYHLSKRLTIKHLLW
FT                   GGVSLLVVIYLFYAIHLHTQSQDILQQLNNLLS"
FT   gene            222735..225329
FT                   /locus_tag="YPDSF_0205"
FT   CDS_pept        222735..225329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0205"
FT                   /product="Clp ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38624"
FT                   /protein_id="ABP38624.1"
FT                   /translation="MIQIDLPTLVNRLNPIARHSLEAAAAHCVSQQEAEITVSQVLLQM
FT                   ISTPLCDVRLILSHAGVEEDELRESLDQRVSGYQAITQAYPSFSPLLVEWLQDSWLLAS
FT                   TEMEHSQLRSGVMLLTLLLSPSRYLVPTANRLLSPINRELLRQNFANWTADSAETPRAE
FT                   KGAEAGNGAEINGDSLLARYASNMTEQARNGELDPVLCRDTEIDLMIDILCRRRKNNPI
FT                   VVGEAGVGKSALIEGLALRIVDNQVPEKLRNSELMTLDLGALQAGAAVKGEFEKRFKGI
FT                   MAEIAQSTTPIILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKK
FT                   YFEKDAALSRRFQLVKVSEPSAQEATIIMRGLRTVYEQAHGVLIDDEALQAAAVLSDRY
FT                   ISGRQLPDKAIDVLDTAAARVAINLTSAPRQVSALKNELYHQGMEIEMLEREQRLSLSR
FT                   PDERLSVLQQQRIEIEQQLIALNTGWEKQQHLLQQIIALRAVLLAQEESATDEQVVNLT
FT                   ALSDELERLQQHQTLVSPHVDKSQIAAVIAEWTGVPLNRLSQSELAVVTELPSYLGQQI
FT                   KGQETAIHCLHQHLLTARADLRRPMGAFLLVGPSGVGKTETVLQIADLLYGGRQYLTTI
FT                   NMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFY
FT                   QAFDKGELADGEGRIIDCKNIVFFLTSNLGYQTIVDHADEPALLNERLYPELSAFFKPA
FT                   LLARMEVVPYLPLGMETLQIIIHGKLNRLDTLLRQRFSADVVIEPEVIDEILLRATRAE
FT                   NGARMLESIIDGALLPPVSLLLLQKVAAGTAISHIRIAVEGNVFTAQVEGAI"
FT   gene            225326..226123
FT                   /locus_tag="YPDSF_0206"
FT   CDS_pept        225326..226123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38625"
FT                   /protein_id="ABP38625.1"
FT                   /translation="MRQRLKSVLALLDNDSTEQLIHRFLTINHHRQRFSALMVSMFNAS
FT                   EGRLDCYHQPDGGMNVALKLDANIEDVNHPLVRVLRNGFPEVWGSLYQGVRIEDDDFRS
FT                   FIQALPTRCGLYALPLFDVHGHACGVIAVFSENIERFADTRGIFSIYCHIFQHRLNKLQ
FT                   EMDQLRSQFNQIRTVFKEQRQREKQLDELLVSLSTSDTHALPGISQDYSKIDSLTTAVE
FT                   TFECAVLTQRQRLYGNDKSRIAASLGLSLRALTYKLAKYRCQL"
FT   gene            226120..226806
FT                   /locus_tag="YPDSF_0207"
FT   CDS_pept        226120..226806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38626"
FT                   /protein_id="ABP38626.1"
FT                   /translation="MNTWLLISSLLFSGGHTDAFWTMGLPPPVAEKEEAGTLALVMRCR
FT                   SENSALVRLDCYDKALSPVNAVDEKRVNAGPAWQRAMNQEKGRTDHSTAFLVTEGEGSN
FT                   PMVLITTPAIGMPPPRPVLMLSCIDNITRLQIALVGPQKESSVTLIIDKAGIIDKTRLD
FT                   AQWFLRENGYLLESSRGLAGIDEIKRLMSAETLTIEGANGAFPRLTFTLSQLTPALKPL
FT                   RNACHW"
FT   sig_peptide     226120..226179
FT                   /locus_tag="YPDSF_0207"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.603 at
FT                   residue 20"
FT   gene            226812..228200
FT                   /locus_tag="YPDSF_0208"
FT   CDS_pept        226812..228200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38627"
FT                   /protein_id="ABP38627.1"
FT                   /translation="MDITSQHPWHVLLQAPLSPEQTAQALADDDPQWEYIDGQMVKLGS
FT                   LAHATLNIDDIQQQAMALLSQKSKDFRLVVHLLRTLQHGGQPDELMLAMSLLTEYVQLF
FT                   WTTAWPQNPLHKRRFAQQILKRFDSASSSFSQRADEAQRENVQGLLAHLAQVWHSREPG
FT                   LAKEVDALRSRYARPPERVIEAVASDEPLSSNTLAAAMAATPVSPSLAIDNTSDRAWRQ
FT                   TLLKMADLLSEQQPDAAIGFRLRRHAVWGALTAPPMAQSDGRTPLAAVSADRTADYLAR
FT                   LANADLPLWHQVEQSLTLAPYWLDGHVLSAQIALQLGYDAVAQAIRDELSVFLARIPAL
FT                   KTLFFTDMTPFLSSESAAWLQQDANHQGRSRTIEQDEIWQCYQQQGLEAALQMINRQPQ
FT                   QSEPRDRFYHQLLSAQLFEKAGLTALAQQHYHSLLLVGQQLQLSEWEPALIALLTEKQR
FT                   QLKP"
FT   gene            228232..231765
FT                   /locus_tag="YPDSF_0209"
FT   CDS_pept        228232..231765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38628"
FT                   /protein_id="ABP38628.1"
FT                   /translation="MKLPFFIRIAKPAIPRLKASIPVVLALMACAALIWVWIYGPEWQL
FT                   GENYPFETLLSRWLVTAVFVLVAVCWLSLKVMRRVQHLEKLQLQTKIQLDDPVSADIEQ
FT                   QNHYLNGWKHQLQRHLNTPEYLYRLPWYMVIGARNSGKSTLIKEGYKLTEISASERLHA
FT                   EDAADLRVRCWLGEQAVIIDPAGVLIEQPTTPIAGKASLNSRLWQSLLSWLIEQRQRQP
FT                   LNGIILTVDLHQMMTANKAQRETYVADIHQRLQEIRLSLHSQVPLYVVFTKMDLLYGFE
FT                   AMYQSLDKAEREAVLGVTFSLNAADPDVWRTELKQFWQQWVAQLNGAMPDMMLNSVDAG
FT                   QRSQLFSFTRQMQGLHDYVVQLLEGILYRGEHAQPLLRGVYLTSAQQRGQMDDIFTQSA
FT                   AVQYHLAPQAFPTWPVSDTTPYFTKALFNQVLLAEPNLAGENGIWLQKTRKRMFIFSGV
FT                   GALAALTLWGYWHYYHQLNYRAGEEVLTQAKTFLSIPPPEGDDRYGNLQLPLLNPIRDA
FT                   TLAYGNYHERSPFLADMGLYQGNNIGPYVESTYLQLLQQRFVPALMSGLLEQLNAAPKG
FT                   SEEKLEILRVMRMLEDGSGRNAALVEQYMSHRWSQQFNGQRELQEQLSSHLNYALKHTD
FT                   WHGARESGDQYAIKSFVPYLRPIQSAQQELSKLSIYQRVYQNLRIKAQDALPPALDLRD
FT                   QIGASFDDIFVSGNDRLLVIPQFLTRSGLQSYFIKQNDQLVDLTVMDSWVLNLTKNVEY
FT                   SEADRKEIHRQVTEQYLGDYTATWRAAMNNLSVSDFEGLPQAISAIEQVISGEQPFRRA
FT                   LQTLSDNTRLPVISDLIPAKEQQELLQKPDYLLLTRINREFSPETAVLVENGDKGSVIQ
FT                   SVYQKLTELHRYLLAIQNSPAPGKAALKAVQLRLDQNNSDPIFEVQQLAKNLPEPLNRW
FT                   VGELAEQAWRVVMMEAIQSLEVEWNETVIKQYQTYLAGRYPFDPHAKQDVPLSEFERFF
FT                   GPKGTLDAFYQQNLKPFVENNLTGGSDGELLIRPDVLQQLAQARKIRDTFFSAQNGLGT
FT                   QFAIEPVLLSGNKRRSVLNLDGQLLDYAHGRSGVVHLVWPNSMRAGVESKLTLVPDESG
FT                   KSPRTLSFSGPWAQLRLINAGELTNVGTNSFDVRFKVDGGEMTYRIFVDESDNPFAGGL
FT                   FSKFSLPDTLY"
FT   sig_peptide     228232..228327
FT                   /locus_tag="YPDSF_0209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.788 at
FT                   residue 32"
FT   gene            231890..232672
FT                   /locus_tag="YPDSF_0210"
FT   CDS_pept        231890..232672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38629"
FT                   /protein_id="ABP38629.1"
FT                   /translation="MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLI
FT                   ESLALTLFRTHGVDLQTAVYYTLARTQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQA
FT                   RSEILEWFNTRVSNQLRQHDFTRDDLRLVYRAERALQLLYDKLQPVELKRVPRIENLLY
FT                   LMQNTAKKLESASDAAKAQQTAAPLKMPPMVYLSVPEAEPVRTAAAAPEPAANIEVRSP
FT                   PRRLNGGRCCGALVPVSCVVYWWRLRFTLPSSNRCNSK"
FT   gene            232579..233202
FT                   /locus_tag="YPDSF_0211"
FT   CDS_pept        232579..233202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38630"
FT                   /protein_id="ABP38630.1"
FT                   /translation="MLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLW
FT                   LNRPDVATYGEQLSTLENLSPLFVLNTADQSVAMARQRWPSDPSQVAESQRWARLVEAR
FT                   IGLAGTDSSYFQLQQRLHALSEKLLEQERSRGSLTISYLKTAVYQMQTELNREIPLEEL
FT                   LRQLAVSADEHQPASPVLIKQIDDRWNALLSRYHHLTQQTNSAR"
FT   sig_peptide     232579..232644
FT                   /locus_tag="YPDSF_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.610 at
FT                   residue 22"
FT   gene            233224..235614
FT                   /locus_tag="YPDSF_0212"
FT   CDS_pept        233224..235614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0212"
FT                   /product="Rhs accessory genetic element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38631"
FT                   /protein_id="ABP38631.1"
FT                   /translation="MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGI
FT                   GDAVGGTAGKRINQAAEVAKTALDAKAKVLDGGVTPTNIVATGPAPTVSGAQMTEMAGG
FT                   IGDAVGGTAGKRINQAAEVAKTALEAKAKVLDGGVTPMNLAAGGAGAGLPDSAAAAVKQ
FT                   PSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDATLF
FT                   IWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVEEII
FT                   TTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGKNTV
FT                   VYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAA
FT                   FSEQSGELQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQP
FT                   GQLFSLYNHPRGDLNHAWQLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRP
FT                   TPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQPWA
FT                   GQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRSKTH
FT                   KGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQSVTVVRNQ
FT                   SNTIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIH
FT                   AKQGDISISTPNAGITITHDGAIVLQGKYIRLAADMIDLNPEE"
FT   gene            235620..236078
FT                   /locus_tag="YPDSF_0213"
FT   CDS_pept        235620..236078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38632"
FT                   /protein_id="ABP38632.1"
FT                   /translation="MPENNINTYCIQEGTLECPEGFTDRTVNLFMKGKPGAAFALNIAR
FT                   DVPEAHEVLSDYVQRQIGILKDNLKKYEVKKHQQIDVGAQHIPGEYVEATYMAETRRVW
FT                   QRQVAIQVGDHMMIFTATNASPFNPQQQATWEQWIHSFAPWAREAGHV"
FT   gene            236071..238935
FT                   /locus_tag="YPDSF_0214"
FT   CDS_pept        236071..238935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38633"
FT                   /protein_id="ABP38633.1"
FT                   /translation="MFEAARVDDKLYHSSALAGFIIGSIIGAAVIFAAAAYAASIVLTG
FT                   GATLVATGFIVGMGVTTLGVVAGGLIRSVGEKIGSMCHHDVGQITTGSKNVKVNSKRAA
FT                   HVELSTVACKDDSAIQRMAEGSSNIFINSKAAVRLEDKTTCDAVVDSASSNVTFGGGRV
FT                   QYLDIKREISDEMRDLSEKLFIVAGLAGGIFGAAKQAGCFGLKCLSKIALGEMAGAAAG
FT                   YGLEKGVGAIAGYFGYPVDVISGQKLLTGEGDDTDFILPGIFPLHWSRIYRSENHHVGA
FT                   LGQGWSLVWERSLRKEDDSIVYQNDEGREIVFPLIKRGERYFSPTEHIWLARTERDTYA
FT                   ISSPFETCFIFEAFSEAGVAKLASLEDLNGHALYFSYDDIGQLKKISTTSGYGVYCQYE
FT                   KGRLVSVACVKGGTPGTLVRYQYNEQHQLVSVTNREGQITRQFGYHGHLINKLADVRGL
FT                   ECRYTWADIGGTPRITHSATNLGEQWQFDYDIDNQQTTLTDLNTGQTACWGYNAQHLIT
FT                   DYRDFDGGKYAFDYNDLNMPVRVVLAGERTLVLVYDALARPIQITDPLKRETHIDYHRN
FT                   SLRVVRRQYPDGQVWKGEYDRTGRLLKENAPDGGVTLYHYPGASSLPERITNAVGAQTH
FT                   LGWERHGQLTEHTDCSGKLTRYEYDIDGHLLTVIDAENHSTHYSYNRLGQPTGIRYADG
FT                   RKEQLRYNAQGLVEQFTDPVGRQLHWRYNLRGQPVSFTDRLQREYRYRYDCHGQMIELD
FT                   NANGGQYHFRWSSGGQLVEEQYPDNLVRRYRYGESGMLMALETTAPTVDDLTVSRQVSF
FT                   DYDAGGRMTQRLTGMSATRYDWDIMDRLLLAERVPTAVGEQAGIVGHGVRLAYDKAGHL
FT                   LTESGDLGAVTYQWDPLHHLAALTLPDGQTLSWLRYGAGHVSAIRHGDTLISEFSRDNL
FT                   HREVSRTQGILTQYRDYDAMGRRL"
FT   sig_peptide     236071..236187
FT                   /locus_tag="YPDSF_0214"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.893 at
FT                   residue 39"
FT   gene            238963..240333
FT                   /locus_tag="YPDSF_0215"
FT   CDS_pept        238963..240333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38634"
FT                   /protein_id="ABP38634.1"
FT                   /translation="MAADLLPRQGDIWRKFSFDTAGELSMATDFIRGEQQYRYDAEGRL
FT                   TDSRERHQLSVAEDFAYDNADNLLNLRKLPFDTVDPLYDTPVANNRLTQWQHYRFEYDA
FT                   WGNMTTRHAGGRMQHFAYDDDNRLLRAWGTGPLGEHDSHYRYDALGRRIHKSVTIKRGA
FT                   EKTTRQTDFIWQGLRLLQEQHTDGNATYIYDPNESYTPLARVDQRHGETESQVYYFHTD
FT                   INGTPLDVTDGEGKHRWSGKYHAWGKVTRQNVSDPRQSTVSRFAQPLRYPGQYSDDETG
FT                   LHYNTFRYYDPEIGRFSTQDPIGLAGGINLYQYGPNPLTWIDPWGWAFGGVDFTGSPDL
FT                   FPVKGSQLNIVEITMQGARGRDFTEAFKLAGISKADATGYTWHHLNDFDPVSGKTTMQL
FT                   VTTSAHEATFPHAGSVSQFEKHFNLPSQSYGSADAVAISHSKGWLKGRIPKALRSGC"
FT   gene            complement(240870..241061)
FT                   /locus_tag="YPDSF_0216"
FT   CDS_pept        complement(240870..241061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38635"
FT                   /protein_id="ABP38635.1"
FT                   /translation="MQDLRPAQYLKYNNIVMAWIQDNGELSLSGEWLTQTGLTGQPLAI
FT                   SVMAGKVIIQFQKMNMLL"
FT   gene            complement(241137..241361)
FT                   /locus_tag="YPDSF_0217"
FT   CDS_pept        complement(241137..241361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38636"
FT                   /protein_id="ABP38636.1"
FT                   /translation="MAKAHSTSGTGINKTPKTERYYTVGYVPQRGKRNPPPAINLKGRW
FT                   LEALGFFSGQPVLITVEHGRLVIQPEIKI"
FT   gene            complement(241443..241850)
FT                   /locus_tag="YPDSF_0218"
FT   CDS_pept        complement(241443..241850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0218"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38637"
FT                   /protein_id="ABP38637.1"
FT                   /translation="MTDVIDEIMQTEEQRRAFGLRLKELRKQQHKTQKEVATRIGLQLS
FT                   QYNKYESGMHIPPADKLITLAELLVTSIDYLLLGSSNETSSIRNTRLLERFKALSQCQP
FT                   EEQETVIKLIDAVIVKHRVESALQPVDPEKK"
FT   gene            242013..242189
FT                   /locus_tag="YPDSF_0219"
FT   CDS_pept        242013..242189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38638"
FT                   /protein_id="ABP38638.1"
FT                   /translation="MQTELNREIPLEELLRQLAVSADEHQPASPVLIKQIDDRWNALLS
FT                   RYHHLTQQTNSAR"
FT   gene            242211..244409
FT                   /locus_tag="YPDSF_0220"
FT   CDS_pept        242211..244409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0220"
FT                   /product="Rhs accessory genetic element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38639"
FT                   /protein_id="ABP38639.1"
FT                   /translation="MFAHDKANNNKTADKTGTVTPTHIVSPEAAPTVSGAQMTEMAGGI
FT                   GDAVGGTAGKRINQAAEVAKTALDAKAKVLDGGVTPLNLAAGGAGAGLPDSAAAALTRL
FT                   VKQPSGLQFTLTTASLPPQTFAVVDFTLSEMLSSPFVLNVGLASADPAVDFAAVLDEDA
FT                   TLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLRRNARIFQQASVE
FT                   EIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAGK
FT                   NTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNW
FT                   AAAFSEQSGELQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFT
FT                   LQPGQLFSLYNHPRGDLNHAWQLLGVQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQT
FT                   WRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEYGRIRLQFLWDRYGQSNDNSSCWIRVTQ
FT                   PWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNIPPGSLPASKTQMAFRS
FT                   KTHQGEGYNEMRFEDAKGGEGLFMHAQKDMSTTVKDNQTTTVEKGNQTVTVEKGDRTVT
FT                   VATGNETTDITQGSLTETIKVRRSTCANFIQVKAEGDAPGTQLYTATEQIKFVVGKSSI
FT                   TLNPDSIILQFSGSTSITLNAANIDAIAPLINLNKDKG"
FT   gene            244412..244834
FT                   /locus_tag="YPDSF_0221"
FT   CDS_pept        244412..244834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38640"
FT                   /protein_id="ABP38640.1"
FT                   /translation="MYYFNEGSLELPEAWRDMTVNVLTSSLDETVGLSFTVSRDTPPWG
FT                   MGFHEFFDREIGSLSRQLNHYQLLHQDTGEVNNHPSVTAEFCWSSEQGRIHQLMTLVDI
FT                   APRVLILTATMVGELTPQQKEHITAIVQTLQINARS"
FT   gene            244879..249417
FT                   /locus_tag="YPDSF_0222"
FT   CDS_pept        244879..249417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0222"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38641"
FT                   /protein_id="ABP38641.1"
FT                   /translation="MTVAQSIGTGYGAAGAQSALRQTALGQQSPARTDYQVSNPNVGNI
FT                   ARASDSLLNVAESQQFNTLVTAGFGMQAIAAGVAGGYVGAKIGNKLGHGIARALNFNQV
FT                   ATEGESPAHLGHPIAHQKKDWGVWGAIGGILLGAAAAALVVVTFGTGLVVIAAAAAAAG
FT                   LIGGIAAATGAALGQYGDNKGVIAEGSANVFFEGQPVARVGDKIQCSDHPSSPPPMIAE
FT                   GAKTVFANQKQIARLGHRTTCDGNINAGCGSLAITQETAYVYEVADSRNPYLRWSAVIL
FT                   SFLPIQKKFEQGFRSLKKPPNTAVNATHNCPTGSDPVDMVSGDYLQVWPVIDIAGVLPV
FT                   RLQRTYRSGDYFTVSGCFGHKWADSWSQHLVVHEDNIDYIDEEGVGLSFFTPENKVQAV
FT                   NLYNLRYELVGERHGELRVFDRSTQQTLHFNQQQQQQRYLSAITDRKGNRIDFRYQQGE
FT                   LISVEHSDGYVLEIDSRGRTIHAVELVTQEKRQKLLQSTFSERGYLVQCQSFQYGTLSH
FT                   EYDPKGYMVRWRDTDSTDVAVRYDISGRVVALKTSTGFFADHFIYHDKERYTIYRDGEG
FT                   GETGYHYNENNLLIKLVDPLGNTTLTDWDLTQKIKETDALGRITRFIYNERGDLTAVIL
FT                   PDETRTEYEYNPSGVVTAFTSSAGDSWQYQYDRQGLLRQVTYPSGQTMSFRYGKKGEVL
FT                   RKIIAEDQVWRYHYDHHGCLSTIIDPKGNSTAVTLDVLGRLFSHQNALGELTRYTHSDA
FT                   HASPAGSVTKMVMPDGVEQAIAYDSEKRIAALTDGAGKTTRYEYGGFDLLTGLIRPDGQ
FT                   RLTFGYDTLTRLNQVTNASGDTYRYTRDRAGQVISETDFTGRTVHYQYDAVGRRIGARY
FT                   PDQRLVRWHYSMQDQVLAQQTWHCDALSSTLVGTVSYGYDGAGRLLSATNADAVVEFDY
FT                   DEAGQLVAERLNGREVRHQWDALNGTPVARQVGELGLTFVYGAQGELTRLQLAGHQPLQ
FT                   LQHDRLGRETVRESAAGFIQACNYTPSGLLAHQAAGRNSALFQQQLIAPESPALHGSAV
FT                   NRSWQYDRAYNVVGMDDGRWGKTQYQYDRNDQVVRADFGGFLPLQEQFSYDVNQNLREH
FT                   RCLPRGAQAVLAQASQQQQAGRVVKRGDSQYRYDAAGRLVEKRSQKDGYRPQLWRYRWN
FT                   EQDQLSELITPTGARWRYGYDAFGRRIRKLRVVDTPPLNEMDAPSTGPATASLAGYAYL
FT                   WSGDQLIEEVPVYADGTVAYEQGIHWLYAPGGLTPMARYAQGKLHYVVADHLGTPRELL
FT                   NEQGKVVWASRLSTWGQAELWRQAANEEDRVSCNLRFAGQYADAESGLHYNRFRYYDGE
FT                   TGQYLCPDPIGLEGGLNPYGYVHNPVSWVDPLGLATCPMREVNGTKIFGKGQKDGTPGH
FT                   DQFSEVIANKLAMSGKFKEVYLNRSYNFANGKGISGRRPDIMAVDMNGKVHAIELASKT
FT                   DMGRKFPSLRTRNQDAMKNLPSIDRGSVIVLEHQYNSSKIKNALDNLISGI"
FT   gene            249426..250220
FT                   /locus_tag="YPDSF_0223"
FT   CDS_pept        249426..250220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38642"
FT                   /protein_id="ABP38642.1"
FT                   /translation="MCTAIAIYGTENIPPETAYEIGMLFFKVIELDITSTGYYKYREDR
FT                   SEEDIDFIEVSLSDLKNELKNKNATSFRFYNESEKSNYWTASFGFSTSDFGGFYHFDAQ
FT                   CALSKNGKEKFIEFIKEFSSKNNFSYGIVYNPDNVADGFYYAEGGNFVQIYQYENPMFF
FT                   EKETGGMYEGQERYKNTMLRMVYPVNVINHHHLDIIIGNVSLKEWISSDEKHGTLEGLN
FT                   NDLWLWTVEDTKLDEVNKYLGEAGVLISWKPPTIKKAPRKLP"
FT   gene            complement(250567..251466)
FT                   /locus_tag="YPDSF_0224"
FT   CDS_pept        complement(250567..251466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38643"
FT                   /protein_id="ABP38643.1"
FT                   /translation="MINVGIFTGYYPYTLSGTIDKIKQAGMGCVQLDLEFTDIDLRRGR
FT                   ITKEKAHQVRNAFRRANIPIVAISAYTNLVHPDPVKRAENIAAVKEILAHARHFGTPYV
FT                   ISETGTYNTDSDWLYDPKNSTEEAYQEFKAIAKELATFAYEHNAVFLVENYVNNIIGSV
FT                   GQVARLMQEVEHPGLGLALDPTNYFDDKNIDAIDETLHNIFNVLESRIKIAHAKDCKKT
FT                   DAIAEKFGGGAAEHNSFRGAGSVELPAAGLGALNYPLYVELLAQKHPNIPLIIEHVDEE
FT                   DIPRAKRFVDEVLMATGS"
FT   gene            complement(251463..252593)
FT                   /locus_tag="YPDSF_0225"
FT   CDS_pept        complement(251463..252593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0225"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38644"
FT                   /protein_id="ABP38644.1"
FT                   /translation="MDTLISQLEHATQPVLPKRRDYRIGIIGAGFIVEHCHLVAYQKAG
FT                   FVPYGITSKEHSQNHRLAETFAIKKVYETWQDMVCDPQIDIIDIAVPPHIQLEIVRFIC
FT                   ESNSAAKHIKGILCQKPLAMSLKDGREIVRLSQQSGIPIAVNSNMRYDPSMRALKYILE
FT                   NQLIGDPVIASIDMRAIPDWQAFLQKYKKLELYAMAIHHIDAFRFLFGDPVKVTAVCRT
FT                   DPRTTFEHIDGITQYTFQYANGLIATSLDDVWAWPGEPCAKNNYINWRVEGSDGLAEGD
FT                   FGWHRREPEYCGSTLKLASRNHPGQWIAPKWERQWFPDAFIGTMANLMCAIEENRPPEI
FT                   SAEDNLGTLACIEACYLSIQQERTVYLNEILLENAK"
FT   gene            252851..253729
FT                   /locus_tag="YPDSF_0226"
FT   CDS_pept        252851..253729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0226"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38645"
FT                   /protein_id="ABP38645.1"
FT                   /translation="MEKNMQRTQVVANWYRESDEFSTLVNYRILRAGHIRAADNFHVRR
FT                   QSVAGHELIFCLNGSGFIRLENNLHEVKKGNLAWLPVRWPHEHFPNKQEPWEILWLRID
FT                   GAKLNNIMQILDVAQQPVFEFTSPETITDIYHRLFDLMQSHTLVADAHCDVLCSQLIYT
FT                   LLENRSFDATKSPVISHRGLGRLIYQIHSHYNDDWDIDKFMQYCQVSKSQLFRLFQETF
FT                   NQSPLRWLKNYRLSQARRLLVETEETISRIAGLVGYNDPLHFSRDFHRSVGLSPSDFRR
FT                   QERQLDNDRHD"
FT   gene            complement(253891..254394)
FT                   /locus_tag="YPDSF_0227"
FT   CDS_pept        complement(253891..254394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0227"
FT                   /product="carbohydrate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38646"
FT                   /protein_id="ABP38646.1"
FT                   /translation="MRPDRILHPELAAALATLGHTDIILVTDAGFPIPPQAKRIDLGFW
FT                   PGTVDVLHILRVLRKEIFVEEVRFASEVRDCHPQLYRDVQTLYTGSGAEFQAASHETLC
FT                   HDLAHQAKVVIRSGSFNPWANFALVASTDPFAWFTDESGVKPLPAYVARRQRILDNVVP
FT                   ELNA"
FT   gene            complement(254400..255329)
FT                   /locus_tag="YPDSF_0228"
FT   CDS_pept        complement(254400..255329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0228"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38647"
FT                   /protein_id="ABP38647.1"
FT                   /translation="MSVFILGSYAKALVMTTDRIPLAGETLIGYDFRQTWGGKGSDMAV
FT                   QAVRLGAEVAYAGVVGDDTFGHEFVGLMQEEGVNIDALTISGELPTGAGLIVKDKEARN
FT                   VIVVDMGANKLFTPALVDSALSQLKQSNVVLTQLEIPLETARYGLQRAKEFGKITILNP
FT                   APARDLRGLDLSAIDYLTPNETEARVALGLPPDDPRSNREIANLLLETGCQYVVMTLGE
FT                   SGSAVFGRNDTQEIPPCIIDVVDSNGAGDSFNAALAVALDEGLPISEAVLFANATAALC
FT                   CMDWETVPSYRYREDVDAFMRSITVKEE"
FT   gene            complement(255486..256187)
FT                   /locus_tag="YPDSF_0229"
FT   CDS_pept        complement(255486..256187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0229"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38648"
FT                   /protein_id="ABP38648.1"
FT                   /translation="MIDFNDPRQVAKAIQFTNVNADLTREGVIKHLNICLEYQFDAAMI
FT                   APCWVYLAKDVLKGSGVRVATTVNFPQANDTTAMKVAIVRELAKEGADEFDFPPNPGFL
FT                   LGGLDELYFNELKEVTHIAHDLGMKVKAMLEFGFITEEAMKIKATRYAYEAGIDWVKQS
FT                   SGWGKGGCAATVEDVQLLKANIQAPCRVKVSGKVNTLEKMKEMFLAGAELVGTSSGPEL
FT                   VKGLTGDINAY"
FT   gene            256658..257239
FT                   /locus_tag="YPDSF_0230"
FT   CDS_pept        256658..257239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0230"
FT                   /product="NAD(P)H-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38649"
FT                   /protein_id="ABP38649.1"
FT                   /translation="MRVISLAGSPRTPSRSAALLNLSQHWLQQQNVEVIPYTLHDFQAD
FT                   DLLRANFNSPDVSAFVAQLATADGLLIATPIYKASFSGALKTLLDLLPERALDHKVVLP
FT                   LATGGSIGHMLAVDYALKPVLTALKAQEVLHGVFVDDSQVVFHGEQVTVSTSATTRLEE
FT                   ALESFYLALGRRKPLASNAVSSSLVQQTAA"
FT   gene            257254..258390
FT                   /locus_tag="YPDSF_0231"
FT   CDS_pept        257254..258390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0231"
FT                   /product="aliphatic sulfonates binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38650"
FT                   /protein_id="ABP38650.1"
FT                   /translation="MSLSFFFRRGFNVHRWLNIGAMAAIITLAFTNTVIAQDNAPAQFR
FT                   IGYQKGSVNLVLAKTHQLLEKRFPDTQISWIEFPAGPQMLEALNVNSIDLGSTGDIPPI
FT                   FAQAAGADLLYVGMEPPKPKAEVILVPENSAINSVAELKGHKVAFQKGSSSHNLLLQAL
FT                   QKAGLKFTDIQPVYLTPADARAAFQQGNVDAWVIWDPYYSAALLQGGIRVLIDGSQLNQ
FT                   TGSFYLASRPYTEANGPFIQQVLEVLTQADALTLSDRAQSITLLANAMGLPEAVIASYL
FT                   DHRPPTAIQPLSQATVAAQQRTADLFFANRLLPVKVDISQRVWQPAGQLSSKPPSSKPS
FT                   SSKPSSSNQSSPSQLPTDQPSIAQTSIEQSSTAKSQTK"
FT   sig_peptide     257254..257364
FT                   /locus_tag="YPDSF_0231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 37"
FT   gene            258409..259557
FT                   /locus_tag="YPDSF_0232"
FT   CDS_pept        258409..259557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0232"
FT                   /product="alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38651"
FT                   /db_xref="GOA:A4TH89"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019911"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TH89"
FT                   /protein_id="ABP38651.1"
FT                   /translation="MSINVFWFLPTHGDGHYLGSSEGARAVDYSYLQQIAQAADRLGFG
FT                   GVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTLAARQAATLDRLSNGRAL
FT                   FNLVTGGDPEELAAEGLHLNHTERYEASAEFTHVWRKVLEGETVDFAGKHIQVKGAKLL
FT                   FPPVQHPRPPLYFGGSSAAAQDLAAEQVELYLTWGEPPEQVKEKIEEVRAKAAAKGRTV
FT                   RFGIRLHVIVRETTEEAWRAANRLIANLDDKTIADAQQAFAGFDSVGQQRMAALHGGKK
FT                   DNLEISPNLWAGVGLVRGGAGTALVGDGPTVAQRIQEYADLGIDTFVFSGYPHLEEAYR
FT                   VSELLFPHLDLATTELPTQRPATQPQGEVVANIYVPQKVSQS"
FT   gene            259566..260363
FT                   /locus_tag="YPDSF_0233"
FT   CDS_pept        259566..260363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0233"
FT                   /product="aliphatic sulfonates transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38652"
FT                   /protein_id="ABP38652.1"
FT                   /translation="MMTISAQRILHRLAPWILPVALVVGWQVAVEAGWLSNRILPAPSA
FT                   VVTAFWALTKSGELWQHLTISSWRALIGFSIGGSIGLVLGVITGLSRWGERLLNSSVQM
FT                   IRNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYLNTYHGIKNIDSGLLEMARSYG
FT                   LSGFRLLTQVVLPGALPSIMVGVRFALGFMWLTLIVAETISANSGIGYLAMNAREFLQT
FT                   DVVVVAIVLYALLGKLADGSAQLLERVWLRWHPAYQQKSGEAQ"
FT   gene            260360..261175
FT                   /locus_tag="YPDSF_0234"
FT   CDS_pept        260360..261175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0234"
FT                   /product="aliphatic sulfonates transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38653"
FT                   /protein_id="ABP38653.1"
FT                   /translation="MTTLTHIPQGTPITLESIGKRYGNRTVLDNLQLRITAGQFVAVVG
FT                   RSGCGKSTLLRLLAGLEAASDGTLLSGNALLSHAKDETRLMFQEARLLPWKKVIDNVGL
FT                   GLRGHWRDEALQVLDTVGLADRANEWPAALSGGQKQRVALARALIHRPRLLLLDEPLGA
FT                   LDALTRIEMQGLIERLWQQHGFTVLLVTHDVSEAIALADRVLLIEEGRIGLDLAIDLPR
FT                   PRRKGSAKLAALEAEVLERVLSPPQGIEASRQGIKASRQGTATSRRVAN"
FT   gene            complement(261794..261997)
FT                   /locus_tag="YPDSF_0235"
FT   CDS_pept        complement(261794..261997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0235"
FT                   /product="DNA-damage-inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38654"
FT                   /protein_id="ABP38654.1"
FT                   /translation="MANAKALGLDLSTVIRMVVNRLAVNAELPIDLLQPNQETLQAIRD
FT                   LENGVEVYRVDSVDALKRDLGW"
FT   gene            262451..263806
FT                   /locus_tag="YPDSF_0236"
FT   CDS_pept        262451..263806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0236"
FT                   /product="xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38655"
FT                   /protein_id="ABP38655.1"
FT                   /translation="MSSSNPQAQPKGTLDAFFKLSERGSNVRQEVLAGLTTFLAMVYSV
FT                   IVVPSMLGKAGFPPTAVFVATCLVAGLGSLLMGLWANLPMAIGCAISLTAFTAFSLVLG
FT                   QQISIPVALGAVFLMGVLFTIISVTGIRSWILRNLPMGVAHGTGIGIGLFLLLIAANGV
FT                   GLVIKNPIEGLPVALGAFTSFPVIMTLLGLAVIFGLEKLRVPGGILLVIVAISVIGLIF
FT                   DPSVTYQGLFAMPSLADANGDSLIFSLDIMGALQPVVLPSVLALVMTAVFDATGTIRAV
FT                   AGQANLLDKDGQIISGGKALTTDSVSSIFAGLVGAAPAAVYIESAAGTAAGGKTGLTAT
FT                   VVGILFLLILFLSPLSYLVPAYATAPALMYVGLLMLSNVSKLDFEDFVDAMSGLLCAVF
FT                   IVLTCNIVTGIMLGFSSLVIGRVCSGEWRKLNVGTVIIAVALVAFYAGGWAI"
FT   gene            264155..265804
FT                   /locus_tag="YPDSF_0237"
FT   CDS_pept        264155..265804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0237"
FT                   /product="putative Na(+)/H(+) exchanger protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38656"
FT                   /protein_id="ABP38656.1"
FT                   /translation="MEIFFTILILILVVSLSGVVTRMLPFQVPLPLMQIVCGALLAWPN
FT                   FGLHVNFDPELFLVLFIPPLLFADGWKTPTREFIHHGREILGLALALVLVTIVGIGYLI
FT                   YWMVPGIPLVAAFALAAVLSPTDAVALSGIVGKGRIPKSIMGVLEGEALMNDASGLVAL
FT                   KFAIAVAMGTMIFTVSGATLEFLKVAIGGLLAGVAITWLYSKSLRIMSRWSGDDPATQI
FT                   VLLLLLPFASYLVAEHLGVSGILAAVAAGMTISQSGIIRNAPLAMRLRADSVWSMLEFV
FT                   FNGMVFILLGLQLPGILETSITQAELDPTIQTWNLFADVAIIYGALLLLRFGWLWSMKK
FT                   ISKRVLTKRPLQFSDYTTRELWVASFAGVRGAITLAGVLSIPLFLSDGSAFPSRYQLVF
FT                   IATGVILLSVIIGVIALPPLLRGVVVADKSASREEIRLARAAMAEVAIVSLNKMEERLM
FT                   TSSEENIDSELLKEVSSRVIGTLRRRTGSKDEVENTLLIENLERRFRLTALRAERGELY
FT                   HLRATQKISNETLQKLLHDLDLLEALLIEKEG"
FT   gene            complement(266022..267209)
FT                   /locus_tag="YPDSF_0238"
FT   CDS_pept        complement(266022..267209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38657"
FT                   /protein_id="ABP38657.1"
FT                   /translation="MKSLILLLALLIPASVTANTLSVEPKDTKPALIDSLSATFAIDKI
FT                   AMLKKEKGANESNLYLPFEQTKDGLAILFGDINQDGKIDALVPFTWEGLNGLDQEIPSN
FT                   DWYSYYAIYLQDDQGWKQVGQIPTGTFTTDNQTLLTNIEDGVIYGEIMPRMTDDDPQPQ
FT                   QWVLRAHPEKDNLLVPIPTPQPLANALTLNLSKKRPLTRNALVTAFGEPINIGDNYFLV
FT                   DGDCVGHPDWKYYQYPGAAFNVSQNDNSVGVSHFIGIPDNLSLVLGDLTITQKTSAHQL
FT                   IKALSQNDSFTVSRTSTDLRTDLGQSSPYFDDANDIFALRLPYYIAGFEAWAKKNEARE
FT                   VPNDEEADTFTRQFYFTTTIGVAPIQNSPTRLMFYFLGDKMVALSVIYDDGQVCI"
FT   sig_peptide     complement(267153..267209)
FT                   /locus_tag="YPDSF_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 19"
FT   gene            complement(267361..268350)
FT                   /locus_tag="YPDSF_0239"
FT   CDS_pept        complement(267361..268350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0239"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38658"
FT                   /protein_id="ABP38658.1"
FT                   /translation="MYRYRVMSLCVTHSHLTHNDRVHMIKPQKFHISLLHPRYWLTWFG
FT                   LGVLFLLVQLPYPLLNKLGVWLGRTSMRFLKRRVSIARRNLELCFPDMDKQVLEQTIIG
FT                   NFESLGMGLLETGMAWFWSDTRIQRWFSVSGLENLKRAQQGKRGVLVIGVHFMSLELGG
FT                   RVMGQCQPMMAMYRPHNNKVMELVQTWGRMRSNKAMLDRRDLRGMVRALKQGEAVWFAP
FT                   DQDYGPRGSVFAPLFAVEHAATTSGTFMLARLAKPALLPLVLLRKKEGRGYDLLIQPAL
FT                   EDYPIDDEIAAASYMNKVIEKEIMRAPEQYLWLHRRFKTRPIGEPSLY"
FT   gene            269088..270077
FT                   /locus_tag="YPDSF_0240"
FT   CDS_pept        269088..270077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0240"
FT                   /product="periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38659"
FT                   /protein_id="ABP38659.1"
FT                   /translation="MKFNLALLNVCIVSACMLFTTQTLAAEKKHEIAVVAKVTGIPWFT
FT                   RMEVGVNEAAKKLNVNAYQVGPATPDPAQQVKVIEDLIAKNVDAIIVVPNDAKVLEPVL
FT                   KKAQEKGIVVLTHESPDQRIGQWDVETIDSEKYAQANMDELAKAMGNKGGYAIYVGSLT
FT                   VPLHNAWADYAIKYQKEKYPEMFEVTPRLPVAENIDKSYSTTLDLMKTYPQMKGIIGFG
FT                   SLGPIGAGQAVAKKRAKDQIAVVGIAMPAQAAPYLMRGDIKKALLWDPKDAGFAVVEIA
FT                   NQLLNGQKVTEDLTIDGLGKADVDSKNGVIRFNKILEVTKDNAKTLGF"
FT   sig_peptide     269088..269165
FT                   /locus_tag="YPDSF_0240"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            270281..271777
FT                   /locus_tag="YPDSF_0241"
FT   CDS_pept        270281..271777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0241"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38660"
FT                   /protein_id="ABP38660.1"
FT                   /translation="MTQATAFITLENISKRFPGVLALDGVNLTLNKGEVHCLAGQNGCG
FT                   KSTIIKVISGVYQPEKGASILIDGKLLHQLTPQLSFYYGVQVIYQDLSLFPNLTVAENI
FT                   AVHRYLPGGDFWVKRKSMRERALAAMQRVGVTLDLDKKVEQLSIADRQLVAICRAIAAD
FT                   ARLVIMDEPTASLTSQEVKGLLNVVRDLKSQGICVVFVSHRLDEVMEVADRISVMRDGK
FT                   WVGTWQASELDSHELAFLMTGQRFTYRPLPPLAAKAAPLLEIRKLSRGEQFRNIDLTLH
FT                   QGEIVSITGLLGAGRTELCLSLFGMTQPESGEIFVAGEPVRFRHNRDAIRHGIGYVSED
FT                   RLTQGLIMEQSIYDNTIVSVFDQLHTRSGLLDHSKAAALVNKLVQDLNIKVSDTALPVK
FT                   TLSGGNAQRIAIAKWVATQPRILILDSPTVGVDIANKEGIYHIAKALAEQGMAVLMICD
FT                   EIPEAYYNSHRVLVMRKGELIAEFYPHQCTEQQIAEVVNG"
FT   gene            271770..272759
FT                   /locus_tag="YPDSF_0242"
FT   CDS_pept        271770..272759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0242"
FT                   /product="branched-chain amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38661"
FT                   /protein_id="ABP38661.1"
FT                   /translation="MDKLKLRQLTGHHEFYLGLLVLLLAIGLSVQSPEFLTLGNLTDVA
FT                   TSYAILGILACGLFVVLIAGGIDISFPAVTAIAQYVMASWVITQGGSFPLALVMAMAVG
FT                   LLLGLINGLLVYWLKVPAIIITIATLNLFYGLLVYFTNGTWLYGFPDWFMTGINWFSFE
FT                   GSDGYDYGLTLPLLCLAGTIIFTGVMMNYTRLGRQIFAMGSNKDAASRLGINIFRLHLY
FT                   VYGYMGILAGVAAVVQAQISQSVAPNSLMGFELTVLAAVVLGGTSMSGGRGSLTGTVLG
FT                   VMLLAFLQNGLTLLSVSSYWHTVFSGVIILVSISTTAWNEKRKLLREH"
FT   gene            272761..273714
FT                   /locus_tag="YPDSF_0243"
FT   CDS_pept        272761..273714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0243"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38662"
FT                   /protein_id="ABP38662.1"
FT                   /translation="MTWLNRTIPDDRIIRLQLLILIAVMLVFSLTLGQRFFSLGNFQSM
FT                   SSQLPILGMLALGMGLTMLTGGINLSIIAGANACSLVMAAIIVSHPGQPAFLLLALVAG
FT                   LLVAVAIGTLNGVLISVIGVSPILATLGTMTLITGLNILLSNGDVISGFPPVIQYIGSG
FT                   DIVGIPVAMILFLLVAAGLWVLLEHTTLGRSIYLVGSNEQATRFSGVNTHRVQIAVYIL
FT                   SALLGWGAAILMMAKFNSAKAGYGESYLLVTILASVLGGINPDGGFGRIIGLILALVVL
FT                   QLLESGLNLLGVSSYLTMALWGGVLILFIALQNRKA"
FT   gene            273733..275370
FT                   /locus_tag="YPDSF_0244"
FT   CDS_pept        273733..275370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0244"
FT                   /product="carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38663"
FT                   /protein_id="ABP38663.1"
FT                   /translation="MASYFIGVDVGTGSARAGVFDLQGRMVGQASREITMFKPKADFVE
FT                   QSSENIWQAVCNAVRDAVNQADINPIQVKGLGFDATCSLVVLDKEGNPLTVSPSGRNEQ
FT                   NVIVWMDHRAITQAERINATKHPVLEFVGGVISPEMQTPKLLWLKQHMPNTWSNVGHLF
FT                   DLPDFLTWRATKDETRSLCSTVCKWTYLGHEDRWDPSYFKLVGLADLLDNNAAKIGATV
FT                   KPMGAPLGHGLSQRAASEMGLIPGTAVSVSIIDAHAGTIGILGASGVTGENANFDRRIA
FT                   LIGGTSTAHMAMSRSAHFISGIWGPYYSAILPEYWLNEGGQSATGALIDHIIQSHPCYP
FT                   ALLEQAKNKGETIYEALNYILRQMAGEPENIAFLTNDIHMLPYFHGNRSPRANPNLTGI
FT                   ITGLKLSTTPEDMALRYLATIQALALGTRHIIETMNQNGYNIDTMMASGGGTKNPIFVQ
FT                   EHANATGCAMLLPEESEAMLLGSAMMGTVAAGVFESLPEAMAAMSRIGKTVTPQTNKIK
FT                   AYYDRKYRVFHQMYHDHMRYQALMQEGA"
FT   gene            275367..275972
FT                   /locus_tag="YPDSF_0245"
FT   CDS_pept        275367..275972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0245"
FT                   /product="phosphosugar isomerase/binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38664"
FT                   /protein_id="ABP38664.1"
FT                   /translation="MSQNKEWLAASDAWMIYSRELAALKENVDQQVWLQVLDALAECRG
FT                   KIAVTGVGTSGIAARKVAHMLACVEQPAIYLNATDAAHGDLGFLGAQDIIILISRGGNS
FT                   DELTRLLPTLQRKQVKIISVTENEQSAIAQVSALVLKTHVKQEIDPLNMLATTSIVLVL
FT                   ALFDAICACLMARTGFSKETLLAVHPGGDVGMVLRKQQ"
FT   gene            complement(276162..277016)
FT                   /locus_tag="YPDSF_0246"
FT   CDS_pept        complement(276162..277016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0246"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38665"
FT                   /protein_id="ABP38665.1"
FT                   /translation="MMKDNEYQPPKIWTENNASGGVWSKINRPTAGARYEADLPVGKHP
FT                   LQLYSMGTPNGQKVTILLEELLALGEKGAEYDAHLIRISEGEQFSSGFVSINPNSKIPA
FT                   LMDYSSTPPVRVFESGAILLYLADKFGHFLPKSHAARTEALNWLFWLQGAAPYLGGGFG
FT                   HFYHYAPVKIEYAIDRFTMEAKRQLDLLNTQLKTHEYIAGDEYTIADIAIWPWYGSLVL
FT                   GLQYEAGEFLDVKSYPHLIRWTETIAKRPAVQRGRIVNRTWGAPEEQLPERHDAADFDR
FT                   LIK"
FT   gene            277267..278613
FT                   /locus_tag="YPDSF_0247"
FT   CDS_pept        277267..278613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38666"
FT                   /protein_id="ABP38666.1"
FT                   /translation="MHMSKFRLVLLASSIAFSTSSWAQAVEVPAVLAGHAVLPVKSTVA
FT                   TPSDAPTDLQQSGKYTSGQRVSALGSVAAKSADRLTGIGLPISGQPLQGHSGIKHMPDG
FT                   TYWVLTDNGFGSKANSPDAMLYLNHYNIDFKNGNVTPLQTVFLHDPDKKVPFHIINEST
FT                   EKRYLTGSDFDPESFQFADDALWIGDEFGPYLIKADLNGKVLAVFETQVDGNVVKSPDN
FT                   PTLTLPGAPDGKQNFQVARSKGFEGMAVSPDGSKLYPMLEGALWDGEKFENIDGKRYLR
FT                   VLEFDVKNQAWTGRSWQYVLEDNQNAIGDFNLIDANHGLVIERDNGEGTADKACAAGAP
FT                   TDKCFSQIAKFKRVYKIAFSDDNVGKPVEKVSYIDLLNIKDPQNLARKPLNNGVLTFPF
FT                   FTIENVDVVDASHIIVGNDNNFPFSSSRQPNEADDNEFILLDVKALLSQ"
FT   sig_peptide     277267..277338
FT                   /locus_tag="YPDSF_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 24"
FT   gene            complement(278720..279895)
FT                   /locus_tag="YPDSF_0248"
FT   CDS_pept        complement(278720..279895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38667"
FT                   /protein_id="ABP38667.1"
FT                   /translation="MKKLIKRLEIIKSGIELEDDDIIRHQLPYLKSETQDPVLVFIVMA
FT                   IEQGKFTQALDAIATWLGSKQGVIQWQDIELAACKLELKALEEQLSELIDKRNERIQLL
FT                   DDFNDLYLVRLGPLMKQILNLRRQLAESTLRKAEAEARRRERDYRNCQQYISQAIDELI
FT                   SLKQRWLALPSISNDTIEIRNRIQQQTELITALLAEIKELENSFCTRNTESTRKAREEA
FT                   KEKYERYQEQQTDAEQRLDNDRKLSSEQRQDLKRLWRQASRLCHPDLVADAFKEKAHQL
FT                   MVQLNQARQRGDFPAIHALLESLKQGLEPLMASDLIDDLERLRRKISDVRTQIDAILHE
FT                   IDALKGEESWRLATSLPDKDKWFKEQENVLSKTLNILERQVEEASRVLYEA"
FT   gene            280300..280758
FT                   /locus_tag="YPDSF_0249"
FT   CDS_pept        280300..280758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0249"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38668"
FT                   /protein_id="ABP38668.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(280941..281153)
FT                   /locus_tag="YPDSF_0250"
FT   CDS_pept        complement(280941..281153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0250"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38669"
FT                   /protein_id="ABP38669.1"
FT                   /translation="MSNKMTGLVKWFDAGKGFGFITPADGSKDVFVHFSAIQSNDFKTL
FT                   DEGQNVEFSIENGAKGPAAVNVIAL"
FT   gene            complement(281413..281625)
FT                   /locus_tag="YPDSF_0251"
FT   CDS_pept        complement(281413..281625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0251"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38670"
FT                   /protein_id="ABP38670.1"
FT                   /translation="MSNKMTGLVKWFDAGKGFGFITPADGSKDVFVHFSAIQSNDFKTL
FT                   DEGQNVEFSIENGAKGPSAVNVIAL"
FT   gene            281870..282067
FT                   /locus_tag="YPDSF_0252"
FT   CDS_pept        281870..282067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38671"
FT                   /protein_id="ABP38671.1"
FT                   /translation="MVFSSDFMGYVLHLMWINNLLRQLNACGNLCNIFGGGRAYHHFVT
FT                   HISPKPTHMIGGLRAISLRL"
FT   gene            complement(282158..282625)
FT                   /locus_tag="YPDSF_0253"
FT   CDS_pept        complement(282158..282625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0253"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38672"
FT                   /protein_id="ABP38672.1"
FT                   /translation="MNKLAIAVALAATVLSGCANNTASGDTFTASQARQVQTVTYGSIV
FT                   SARPVTIQGGNNNNVAGAIGGAVVGGFLGNTIGGGRGNSLATAGGAVAGGVAGQGIQSA
FT                   MNRSEGVQLEIRRDDGSNIVVVQAQGPTRFSAGQRVIIASDRSGTVTVSPR"
FT   sig_peptide     complement(282548..282625)
FT                   /locus_tag="YPDSF_0253"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.557 at
FT                   residue 26"
FT   gene            283101..283913
FT                   /locus_tag="YPDSF_0254"
FT   CDS_pept        283101..283913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38673"
FT                   /protein_id="ABP38673.1"
FT                   /translation="MSASHENYRIFAIKYAHHHRLTRDNFLGGDPHDGPMPIDYFVWAI
FT                   VGTTRTIMVDTGFDAAMAHQRGRTITHCIEDGLSQLGIDAGKIEDVIISHMHYDHAGNH
FT                   GLFPNARFHLQDREMAFCTGRCMGHHGLSQAFDVEDVKAMVGRLFAGRLQFHHGDAEIA
FT                   PGISVQRVGGHTDGLQIIRVHTARGWVVLASDATHFYANIQQRRPYPILYNVGDVLEGY
FT                   NTLYRWADSFDHIIPGHDPMVLQRYPAGTPETAAWIAQVDVAPLTQWT"
FT   gene            283978..284868
FT                   /locus_tag="YPDSF_0255"
FT   CDS_pept        283978..284868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0255"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38674"
FT                   /protein_id="ABP38674.1"
FT                   /translation="MKQLQRIGFIGLGKMGTPMVQRLVKAGFELYLCDADITKVQILTA
FT                   ELNAESLTVDNAASLDALITMLPNSEAVEQVLLGSDGISGWVAQLSQAAVVIDMSSSDP
FT                   ERSRRLAILLAVWELDYLDAPVSGGVKKAQNGTLSILIGGEDRVLKSCYTALAAMGEQI
FT                   LFVGPAGSGHAAKALNNYVSATGLLATIEALHVAQRFGIEPEVMTEVLNTSTGRSNTSE
FT                   NKVRQFMLNGSYASGFTLQLMNKDLHIARNLAQRLNYPMRLGMHCVDVWDEVSRRATPM
FT                   ADHTEMYRLLIDKEP"
FT   gene            285046..285441
FT                   /locus_tag="YPDSF_0256"
FT   CDS_pept        285046..285441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0256"
FT                   /product="gamma carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38675"
FT                   /protein_id="ABP38675.1"
FT                   /translation="MVAQDRFERGFHNRKVVLGAEHVETSWGNSDEFNRPVQKLITEYC
FT                   WGEVWGDPALTFKTRSMLNIGILTAMGQHHELSLHVKGALRNGVTREEIRAVLLQTVVY
FT                   CGAPVALAAFRIASAAIKAYDDEIADS"
FT   gene            285595..286959
FT                   /locus_tag="YPDSF_0257"
FT   CDS_pept        285595..286959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0257"
FT                   /product="metabolite transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38676"
FT                   /protein_id="ABP38676.1"
FT                   /translation="METLSADSAITAAENDPLRDVKRKNAIKGAFFSEFIDMFDIYLPV
FT                   IVLPPVLFYFQPPNLSSSTANILASLVFITTLLGRPIGALLFGIMADRIGRRMASIYSV
FT                   SGFGVVTFLIALIPGYETLGIASYLLLVLLRFIDGIFLGGGYTGAIPLALEYSKKEQRG
FT                   FVGGLILSGFPAAYVAINLVAMLMFALIPLDGLYSPYAQWGWRIPFVIGGLLAGFLALY
FT                   YVFNVTESEVWQQGSSKKRAREKQPLSTLVSGQSGRNLWQVLLMMSGFWLTQNLITLFL
FT                   PTGLLINTLNMRGLQVTSILLVTYCVLFFSYIGMGMLGQKIGRRRFFMIAGPLIATMGS
FT                   ALLYVLSHGDGLSFSTVMLLVCLLAVVVTSPWGVIITYINEHFATGVRATGFGVGFSLS
FT                   VIIPSFYAFYMDWLSVVVPFELTAVVLLALGGMIGTVGAIMGPETKEVDFTSSAG"
FT   gene            287049..287711
FT                   /locus_tag="YPDSF_0258"
FT   CDS_pept        287049..287711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0258"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38677"
FT                   /protein_id="ABP38677.1"
FT                   /translation="MLAGMGVIKPETLRYQVENVLRQAIMSGRFTPGERLIERELCETL
FT                   GVSRTSIREALRRLEAEKLVSIVPHKGPIVAIISRQEAAELFALRGLLEGFAAREFAQR
FT                   ATDVAIVHFAQAIQALRMAGMTKDRAKVLKAKTDLYDVLLDNCGNGLVKETLTSLHSRI
FT                   NLLRATSLMDPQRLPVSINEIDDLYQALKARDPDAAERHVANAKEVALRILEETNAT"
FT   gene            287777..288253
FT                   /locus_tag="YPDSF_0259"
FT   CDS_pept        287777..288253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38678"
FT                   /protein_id="ABP38678.1"
FT                   /translation="MNTENKKLSTLIGKIHTIAKSRLAAGYEDRNGINEHQVTPCHHAL
FT                   TLLGGDDFAESYLPFLRNVNGFDLNGVRLFGYFDDKGDERDLRKQLADLKAFPELFPDA
FT                   FNDWVLIGETDTDILIFNKKNGSYENRDRIGLDRLNESYDDIVGLLISLMPLIE"
FT   gene            complement(289007..289303)
FT                   /locus_tag="YPDSF_0260"
FT   CDS_pept        complement(289007..289303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0260"
FT                   /product="DNA-binding protein Fis"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38679"
FT                   /db_xref="GOA:A4THB7"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THB7"
FT                   /protein_id="ABP38679.1"
FT                   /translation="MFEQRVNSDVLTVATVNSQDQVTQKPLRDSVKQALKNYFAQLNGQ
FT                   DVSDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
FT   gene            complement(289328..290293)
FT                   /locus_tag="YPDSF_0261"
FT   CDS_pept        complement(289328..290293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38680"
FT                   /protein_id="ABP38680.1"
FT                   /translation="MRIGHFQLTNCLIAAPMAGITDRPFRALCHGMGAGMAVSEMLSSN
FT                   PEVWRTDKSRLRMVHVDEPGIRNVQIAGNDPDEMAAAARINVASGAQIIDINMGCPAKK
FT                   VNRKLAGSALLQHPDLVKQILSAVVNAVDVPVTLKIRTGWSPEHRNCIEIAQLAENCGI
FT                   QALTIHGRTRSCLFNGEAEYDSIRAVKQTVSIPVIANGDITDPHKARAVLDYTGADALM
FT                   IGRAAQGRPWIFREIQHYLDTGELLPPMPLGEVQRLLDGHIRELHDFYGPGKGFRIARK
FT                   HVSWYLQEHAPNDQFRRTFNAIEDASEQLEALEAYFENLA"
FT   gene            complement(290859..291773)
FT                   /locus_tag="YPDSF_0262"
FT   CDS_pept        complement(290859..291773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0262"
FT                   /product="LSU ribosomal protein L11P methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38681"
FT                   /protein_id="ABP38681.1"
FT                   /translation="MAPIPALERIAMPWIQLKLNTTGNQAESLGDVLVESGAVSVTFQD
FT                   THDNPVFEPLPGETRLWGDTDVIGLYDAETDMADVVAMLECHPQIGKGFIHKIEQLEDK
FT                   DWEREWMDNFHPMRFGERLWICPSWRDVPDPTAVNVMLDPGLAFGTGTHPTTALCLQWL
FT                   DSLDLNGKTLIDFGCGSGILAIAALKLGAARAIGIDIDPQAIQASRDNAQRNGVSERLE
FT                   LYLAKDQPAELSADVVVANILAGPLRELAPLISVLPTTGGHLGLSGVLATQAAGVAQAY
FT                   EDKFILDPVAEKEEWCRITGIKK"
FT   gene            complement(291816..293270)
FT                   /locus_tag="YPDSF_0263"
FT   CDS_pept        complement(291816..293270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0263"
FT                   /product="sodium/pantothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38682"
FT                   /protein_id="ABP38682.1"
FT                   /translation="MQTDVVLPLVGYLVLVFGLSIYAYTRRQTGNFLNEYFIGNRSMGG
FT                   FVLAMTLTATYISASSFIGGPGAAYKYGLGWVLLAMIQLPAVWLSLGVLGKKFAILARR
FT                   YNAVTLNDMLYARYQSRLLVWLASISLLVAFVGAMTVQFIGGARLLETAAGIPYDTGLL
FT                   IFGISIALYTSFGGFRASVLNDALQGLVMLIGTILLLVAVIHAAGGLHKAVETLQHIDP
FT                   ALVSPQGGDQILDVPFMASFWILVCFGVIGLPHTAVRCISYRDSKAVHRGIILGTIVVA
FT                   ILMFGMHLAGALGRAVLPDLKIPDQVIPTLMITVLPPFAAGIFLAAPMAAIMSTINAQL
FT                   LQSSATIVKDLYLNLWPAELKNERKLARISSLSTLILGLLLLLAAWRPPEMIIWLNLLA
FT                   FGGLEAVFLWPLVLGLYWERANAHGALSAMIVGAVCYTVLASFDIKIAGLHPIVPSLTL
FT                   NLLAFYIGNLFGDRARARHPAIVSAD"
FT   gene            complement(293260..293502)
FT                   /locus_tag="YPDSF_0264"
FT   CDS_pept        complement(293260..293502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0264"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38683"
FT                   /protein_id="ABP38683.1"
FT                   /translation="METRFLQANKEARWAFGLTLAYLAGWIITAYLPGNLPGMSGLPAW
FT                   FEAACIALPLLFIVLCILMVRLIFRDIPLEDDDAN"
FT   gene            complement(294860..296209)
FT                   /locus_tag="YPDSF_0265"
FT   CDS_pept        complement(294860..296209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0265"
FT                   /product="biotin carboxylase"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38684"
FT                   /protein_id="ABP38684.1"
FT                   /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSVADRDLKHVLLA
FT                   DETVCIGPAPSVKSYLNIPAIISAAEITGAVAVHPGYGFLSENADFAEQVERSGFIFIG
FT                   PRAETIRLMGDKVSAISAMKKAGVPCVPGSDGPLSDDTTKNKAFAKRIGYPVIIKASGG
FT                   GGGRGMRVVRHDKDLEESINMTRAEAKAAFNNDMVYMEKYLENPRHIEVQILADGQGNA
FT                   IYLAERDCSMQRRHQKVVEEAPAPGITSEMRRYIGERCAKACMEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHTVTEMITGIDLIKEQLRIAAGQPLSIKQDEVKVHGHAVECRIN
FT                   AEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLITYGENRDVAI
FT                   ARMKNALAELIIDGIKTNVELQQRIMNDENFQHGGTNIHYLEKKLGLQET"
FT   gene            complement(296221..296730)
FT                   /locus_tag="YPDSF_0266"
FT   CDS_pept        complement(296221..296730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0266"
FT                   /product="biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38685"
FT                   /protein_id="ABP38685.1"
FT                   /translation="MMGIIATHKEYGITLMDIRKIKKLIELVEESGISELEISEGEESV
FT                   RISRAPAAPNYPMMQQPYAFAAPQQQPALAAAVAPAPVAEAAPAAISGHIVCSPMVGTF
FT                   YRTPSPDAKAFVEVGQKVSVGDTLCIVEAMKMMNQIEADKSGTVKAILVENGQPVEFDE
FT                   PLVVIE"
FT   gene            complement(296843..297295)
FT                   /locus_tag="YPDSF_0267"
FT   CDS_pept        complement(296843..297295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0267"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38686"
FT                   /db_xref="GOA:A4THC4"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THC4"
FT                   /protein_id="ABP38686.1"
FT                   /translation="MSDKFHILLLNGPNLNLLGTREPEKYGYTTLAEIVSQLEIQAQGM
FT                   DVALSHLQSNAEHALIDSIHQARGNTDFILINPAAFTHTSVALRDALLGVQIPFIEIHL
FT                   SNVHAREPFRHHSYLSDIAVGVICGLGADGYNFALQAAVNRLSKSN"
FT   gene            complement(297558..298178)
FT                   /locus_tag="YPDSF_0268"
FT   CDS_pept        complement(297558..298178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0268"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38687"
FT                   /db_xref="GOA:A4THC5"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THC5"
FT                   /protein_id="ABP38687.1"
FT                   /translation="MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQH
FT                   FTGRMALKLLLATLLVSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSN
FT                   IGLLGHELINRPYLTLGIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPI
FT                   HYLWSVKTLSPWPIIYAVMAALLLLLRYKLLLPRYKKFRQWFR"
FT   sig_peptide     complement(298068..298178)
FT                   /locus_tag="YPDSF_0268"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.485 at
FT                   residue 37"
FT   gene            complement(298178..299260)
FT                   /locus_tag="YPDSF_0269"
FT   CDS_pept        complement(298178..299260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38688"
FT                   /protein_id="ABP38688.1"
FT                   /translation="MHNTFTHTKNNTQAKNSGSQTKSNAVSLNKPRKLTEADVTPESIF
FT                   YQRRKVLQALGITAATLALPASAQADLLAWFKGNEPPKAPSGKPLTFTPSAAYHPDLAL
FT                   TPEDKVTGYNNFYEFGLDKADPAANAGTLKTEDWQIKIDGDVVKPMTLDMDYLMKCFPL
FT                   EERIYRLRCVEAWSMVVPWIGFELGKLLKLAEPTSNARYVAFQTLYAPDQMPGQKNRFI
FT                   GGGLDYPYVEGLRLDEAMHPLAFMVVGVYGKTLPPQNGAPLRLMTPWKYGFKSIKSIVH
FT                   IRLTRDQPPTTWNLSAPNEYGFYANVNPHVDHPRWSQATERVIGSGGILDVKRQPTLLF
FT                   NGYAEQVASLYRGLDLRKNF"
FT   gene            complement(299483..300460)
FT                   /locus_tag="YPDSF_0270"
FT   CDS_pept        complement(299483..300460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0270"
FT                   /product="zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38689"
FT                   /protein_id="ABP38689.1"
FT                   /translation="MRALILEQIEGRTTAEVRQISASQLPAGNVTVDVNWSSLNYKDAL
FT                   AITGQGKIIRQFPMVPGIDFAGTVHSSEDPRFHIGQSVLLTGWGVGENHWGGLAEQARV
FT                   NGDWLVPMPDGLDARKAMIIGTAGFTAMLCVMALEDGGVTPKSGEVVVTGASGGVGSTA
FT                   IALLSALGYQIAAISGRDSNSDYLKNLGAQRILPRSDYLDASRPLEKQLWAGAIDTVGD
FT                   SMLAKILAQMNYNGTVAACGLAGGYNLPTTVMPFILRNIRLQGVDSVMTPQPRRLQAWQ
FT                   RLQKILPESFYQQASQAITLADTPTIAARLLANEVTGRTLVKVR"
FT   gene            300861..302774
FT                   /locus_tag="YPDSF_0271"
FT   CDS_pept        300861..302774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0271"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38690"
FT                   /protein_id="ABP38690.1"
FT                   /translation="MRFTTKLSAFMTLLVVLAMCLVLLGSTISFFYLCQKKMEQRLQSI
FT                   VTAYDQSLLLQPINKKREWLPLMMQTLGVVDVSVKNSTSTLYQLHIPAVYTPWNSHSRY
FT                   RQMVLPLLHQPGTEMHFNYIDPLGSYARSIYAAAILSLVVVIALTLLLSFRWLRDQTVG
FT                   QEKLERRARRILNGEREHAVRSEDYEWPPCASRAIDHLLSELMEVRAERNRVDTLIRTF
FT                   AAQDAQTGLSNRQFFDNQLTTQLEETGVHGVVMMVQLPDFEALNETHDQQQVQELMSSL
FT                   VNLLSTFVARYPSALLARYLNSDIAILLPHKTLKDADVMAAQLVNAVRTLPEPHIIDRE
FT                   SLLHIGIVAYRSGESVEQIMDNAGQATKSAALYGGNGWYVFDTQVPERGRGSVKWRTLL
FT                   EQTLASGGPRLYQKPVITVDGKISHREIISRIYDGEQELLAAEFMPLVQLLGLGERYDR
FT                   QKIDKIIPLLSLWPDETLAFSISVDSLLHRPFQRWLRDTLLQCKKSDRMRIIFELAEAD
FT                   VCQHIEEIRQMVRLLRGVGCKVMASQAGLTVVSTSYIKSLQVEMIKLHPGVVRSINFRY
FT                   ENQLFVESLTGACAGTQTKVFAAEVRTREEWQTLQEKGVYGGQGNFFAPPTPLNSGKKK
FT                   YS"
FT   sig_peptide     300861..300938
FT                   /locus_tag="YPDSF_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 26"
FT   gene            303111..304154
FT                   /locus_tag="YPDSF_0272"
FT   CDS_pept        303111..304154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0272"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38691"
FT                   /protein_id="ABP38691.1"
FT                   /translation="MFKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDR
FT                   AGSPKSVAAVGHDAKQMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFM
FT                   RPSPRVLVCVPVGATQVERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGSMV
FT                   VDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHSI
FT                   GSAYPGDEVLEIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPE
FT                   LASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHG
FT                   GDLFSEE"
FT   gene            304358..305353
FT                   /locus_tag="YPDSF_0273"
FT   CDS_pept        304358..305353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0273"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38692"
FT                   /protein_id="ABP38692.1"
FT                   /translation="MKPIFSRGPSLQLRLFFAIIAAIVLVIADSRLGTFVKIRTYMDTA
FT                   VSPFYFLANGPRKILDNVSDTLATREQLELENRALRQELLLKNTDLQLLGQFKQENNRL
FT                   RELLGSPLRQDEQKMVTQVMSSGTDPYSDHVVIDKGSNSGVYEGQPVISDRGVVGQVVA
FT                   VSKFTSRVLLICDASHALPIQVLRNDIRVIAAGSGCSDDLLLEHLPSNTDIRVGDVLVT
FT                   SGLGGRFPEGYPVAVVSSVKVDNQRAYTVIQARPTADLQRLRYLLLLWGADRNGDMPMP
FT                   PDEVRRVANERLAPMMSKVLPSADAMGPPAPAASTPAGATPGVVTPGVSP"
FT   gene            305350..305838
FT                   /locus_tag="YPDSF_0274"
FT   CDS_pept        305350..305838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0274"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38693"
FT                   /protein_id="ABP38693.1"
FT                   /translation="MNRYSSHGRWVIWLSFLIAMVLQIMPWPEQIYMFRPSWLALVLIY
FT                   WVMALPHRVNVGTGFILGLIMDLILGSTLGVRALAFSIIAYLVAFKFQLFRNMALWQQA
FT                   LIVMLLSLTMDVVVFWSEFLVINVAFRPEVFWSSVVNGILWPWLFLLMRKIRRQFSVQ"
FT   gene            305846..306445
FT                   /locus_tag="YPDSF_0275"
FT   CDS_pept        305846..306445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0275"
FT                   /product="inhibitor of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38694"
FT                   /protein_id="ABP38694.1"
FT                   /translation="MPMTALYLASASPRRRELLALLDLPFEVLKTEVEEQRHPGESAQV
FT                   YVQRLAQDKARAGVAVAPQDLPVLGADTIVVLNGQVLEKPRDKEHAQQILSALSGQKHQ
FT                   VMTAVALADRQNMLSAMVVTDVTFRVLSPLEISDYIATGEPMDKAGAYGIQGKGGCFVR
FT                   AIAGSYHAVVGLPLVETHELLSHFIAQRNVRGIHDS"
FT   gene            306435..307904
FT                   /locus_tag="YPDSF_0276"
FT   CDS_pept        306435..307904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0276"
FT                   /product="RNAse G"
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38695"
FT                   /protein_id="ABP38695.1"
FT                   /translation="MTAELLVNITPSETRVAYIDGGILQEIHIEREAKRGIVGNIYKGR
FT                   VSRVLPGMQAAFVDIGLDKAAFLHASDIMPHTECVAGDEQKNFNVRDIAELVRQGQDLM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVLMPGAAHVGVSQRIESEAERERLKKTVAAYCD
FT                   EQGGFIIRTAAEGIGEEELSADAAFLKRLWTKVQERKKRNITKYKLYGEMALAQRVLRD
FT                   FAGAALDKIRVDSKLTYDLLVEFTREYIPEMTDKLELYTGKQPIFDLYDVENEIQRSLE
FT                   RKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNIEATQAIARQLRMRNL
FT                   GGIIIIDFIDMSNEDHRRRVLHSLEQALSKDRVKTSINGFSQLGLVEMTRKRTRESIEH
FT                   VLCHECPTCRGRGTVKSVETVCYEILREIVRVHHAYDSDRFLVYASPAVGEALKGEESH
FT                   ALAEVEIFVGKQVKVQIEPLYNQEQFDVVMM"
FT   gene            307998..311921
FT                   /locus_tag="YPDSF_0277"
FT   CDS_pept        307998..311921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38696"
FT                   /protein_id="ABP38696.1"
FT                   /translation="MRRLPKIMFATGATIIVVVALLVSALRMMLPLINEYRPQIVAKIQ
FT                   SVSGIPLDVGFMQGTWETFGPTLELRDIRAQMPKADLQVQRVTLALDVWQSLLHWRWQF
FT                   RDLTFYQLQLDLHTTLDATQNNGSNLETGNVHNIFLRQLDRFDLRNSRISFLTPSGPRA
FT                   ELEIPQLTWLNSSTRHRAEGQISLSTINGQHGVVQVRMDLHDNQGILNNGTVYMQADNI
FT                   DLKPWISRWLQNNTGLDNAEFSLAAWLSIKSGEVYRGNVLLSQGQANWTVGSNSHQLSV
FT                   DNFVLEGRRQGNGWQIDAPVLNLKTDGQAWPKGRLSALWLPENTQFIGPEQRQELRIRA
FT                   SNLQLERIGPLLPTLSPFTPELLARWADLQPQGYVDALALDIPISQPETTRFQAKWHDV
FT                   SWQYWGQLPGVNHFDGELSGSARLGRLNINLKNSLLPYGDLFRAPLEVSQASGALNWRI
FT                   DDKGWALWSDQLDVQAKSLWGNGSFYYMQPNQKPSQLNQAQPWLKILAGIRLYDATDAW
FT                   RYFPVSLMGEKLADYLTEALQGGQVDNATLVYNGNPHDFPYKNKEGQFQVYVPLRNAVF
FT                   QFQPDWPALDNLAIDLNFLNEGLWMNAPHTLLGKVIGSNISAIIPDYLKEKLYVDADVL
FT                   GEGRDVHDYFTATPLKDSVAETLDELQVGGKISGRLHLDIPLEEESITHASGEVTLNNN
FT                   SLLVKPLQSQLENINGKFRFYDGNLESETLSANWYGQPLTVNFTTKEQPKDFLVNVGLQ
FT                   GDWLPAKLPGVPDSLAKMLSGSANWQGKVAVKLPQHGKPDYQVDVSADLKKVSSHLPSP
FT                   LDKNSGQALPLHVQVNGGLEAFTLSGSAGNNNAFNSQWLLQGEKVELARAIWQTDSKKI
FT                   PSLPDDKALVFKLPAIDGERWLALLAPELATAASPFAASFSSPSATSSTQPKIKGSKTN
FT                   VILPKRLTLQTPELLVGGQAWHQLTLQADPLPSGMKITAKGQEVDGSLLMADYGPWHAD
FT                   LNYLYYNPQWGSREANNPLAQAVSQEPTVLQKPQPPSGISFSDWPALQLRCKACWILGQ
FT                   NIGRVNADLTPKGSALILTNGLIEAGNGRANITGQWQQDRAGDKTTLNIGLNGPRIDET
FT                   LSFFGLTTLIKNASFAINADLNWRGVPWEPQINTLSGTLKGRLGKGQLTDLGGGRAGQL
FT                   LRLVSFDALLRKLQLDFSDTFSRDFAFDSIRSTATLKNGVMSTNDLVIDGLAADIAMNG
FT                   KVDLVKRQIAMEAVITPELSATVGVATAFAINPIVGAAVFAASKILGPLWSKVSLIRYQ
FT                   ITGSLDQPTIHEVLRQLKENEAP"
FT   sig_peptide     307998..308075
FT                   /locus_tag="YPDSF_0277"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.576 at
FT                   residue 26"
FT   gene            311918..312787
FT                   /locus_tag="YPDSF_0278"
FT   CDS_pept        311918..312787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0278"
FT                   /product="carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38697"
FT                   /protein_id="ABP38697.1"
FT                   /translation="MKNANVALLQLCSGENTRDNLAQIEQQIKQLNAGIKLVMTPENAL
FT                   LFANAASYRHHAEHHNDGPLQQEVREMARRYGVWIQVGSMPMVSRESPDLITSSSLLFD
FT                   DQGELKARYDKIHMFDVDINDIHGHYRESDTYQPGQQLTVVDTPVGRLGMTICYDLRFP
FT                   GLFQALRAQGAEIISVPAAFTKMTGEAHWETLLRARAIENQCVILAAAQVGRHGATRRT
FT                   WGHTMAVDAWGKIIGHNPDAVAALKVRIETAGLKTIRNQMPVMQHNRFQATLEPTLNKP
FT                   LLNKPPSN"
FT   gene            312799..314244
FT                   /locus_tag="YPDSF_0279"
FT   CDS_pept        312799..314244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0279"
FT                   /product="modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38698"
FT                   /protein_id="ABP38698.1"
FT                   /translation="MSLSFVSEQLLTANKLNHQDLFSVLGQLTERRLDYADLYFQSSYH
FT                   EAWVLEDSIIKDGSYNIDQGVGVRAVSGEKTGFAYADQITLNALQQSAHAARSIVRDTG
FT                   NGKVHTLGEIAYQALYPLLDPLQSLSREDKIALLHRVDKVARAADKRVQEVSASLTGVY
FT                   EQILVAATDGTLAADVRPLVRLSVSVLVEDNGKRERGACGGGGRFGYDYFLETVDGEVR
FT                   ADNFANEAVRMALVNLSAIAAPAGAMPVVLGAGWPGVLLHEAVGHGLEGDFNRRGSSVF
FT                   SGQMGKLVASELCTVVDDGTMQGRRGSLAIDDEGVPGQYNVLIENGILKGYMQDKLNAR
FT                   LMGVAPTGNGRRESYAHLPMPRMTNTYMLAGQSTPEDIIASVEYGLYAPNFGGGQVDIT
FT                   SGKFVFSTSEAYLIEKGKITHAVKGATLIGSGIEAMQQISMVGNDLALDKGVGVCGKEG
FT                   QSLPVGVGQPTLKLDNLTVGGTA"
FT   gene            complement(314447..317305)
FT                   /locus_tag="YPDSF_0280"
FT   CDS_pept        complement(314447..317305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0280"
FT                   /product="insecticidal toxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38699"
FT                   /protein_id="ABP38699.1"
FT                   /translation="MSTSLPTQLCANTPALTIHDNRGLAIRTLAYNRRDHNETVDELIS
FT                   RNRYNASGQLIASRDPRLEVDNFRYQYSLSGVPLRTDSVDSGSTLQLADSAGRTVLTLD
FT                   AHHTRRWVEYETGEHSLGRPLSYHEQAKGGLKTVTDRFFYATNSEQDKNCNLNGQCVRH
FT                   YDSAGLQALISQSIIGVPLQQQRRLLTNPKGPVDWFGEKENWGARLSEQPFVSHSTTDA
FT                   LGQLLTQTDAKGHIQRMAYNRAGQLIGSWLTIKNSAEQVILRSLTYSAAGQKLREESGN
FT                   GVITEYRYEPQTQRLIGIKTTRPAKKDRPTRLQDLRYDYDPVGNILAIHNDAEATRFYR
FT                   NQKIVPETTYRYDALYQLIEATGREADTNGIQNSQLPALASLNDSNQFVNYTRSYHYDR
FT                   AGNLLKIQHTGASQYSTHITVSDSSNHGIQQQDGIIARDIRSQFDAAGNQQQLQPGQPL
FT                   RWNSRNQLQQVEPVPRNDGISDSESYLYDGSGRRVAKISLHKTHNAIQTRSVIYLAGLE
FT                   LRGQHNDNNLTESFQVITVGAAGRAQVRVLHWESGQPVDIVNDQLRYSFDNHLGSALIE
FT                   LDSDGDIISQEEYYPFGGTAVLASRNTVEAKYKTVRYSGKERDATGLYYYGYRYYQPWL
FT                   GRWLSADPAGTIDGLNLYRMVRNNPIRWRDNNGLLTEEQINMYVNLFSNIGLKNDDELK
FT                   SELLKYGLSEEEQNQIYLNMLRPMQSGSSSSLFSFPSESSSSSGSTQSVDSGYLSPVRN
FT                   YHFFEDIKLATMHRPYPKKQASSDTITYSAEDLTEASPIKILIGLDLTSKNTQPYKSAL
FT                   AEKGIKYITKEKYEITDFFEEGGLSTEQIDLTVNKILKLQKKDLVGIHCGAGNGRSGVI
FT                   ASALSINKQYTTDKINSFDVTHSLRGSILKDTQTYQVDTVTAKAVGIIREINPKAVERN
FT                   QDVISLYRYSHFLYTRKHTTSL"
FT   gene            complement(317330..320287)
FT                   /locus_tag="YPDSF_0281"
FT   CDS_pept        complement(317330..320287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0281"
FT                   /product="insecticidal toxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38700"
FT                   /protein_id="ABP38700.1"
FT                   /translation="MWSALAWRWCAVMLTGSQRYAFCNDRFHNRKITRLRNNFMPNILP
FT                   TDLCANTPTLAIHDNRGFAIRTLAYNRRDHNETIGELISRNRYNASGQLIASRDPRLEV
FT                   DNFRYQYSLSGVPLRTDSVDSGSTLQLADSAGRTVLTLDAHHTRRWVEYETGEHSLGRP
FT                   LSYHEQAKGGLKTVTDRFFYATNSEQDKSGNLNGQCVRHYDSAGLQALINQSIIGVPLQ
FT                   QQRRLLTNPKGPVDWFGEKENWGARLSEQPFVSHSTTDALGQLLTQTDAKGHIQRMAYN
FT                   RAGQLIGSWLTIKNSAEQVILRSLTYSAAGQKLREESGNGVITEYRYEPQTQRLIGIKT
FT                   TRPAKKDRPTRLQDLRYDYDPVGNILAIHNDAEATRFYRNQKIVPETTYRYDALYQLIE
FT                   ATGREADTNGIQNSQLPALASLNDSNQFVNYTRSYHYDRAGNLLKIQHTGASQYSTHIT
FT                   VSDSSNHGIQQQEGITARDIRSQFDAAGNQQQLQPGQPLRWNSRNQLQQVEPVPRNDGI
FT                   SDSESYLYDGGGSRVVKTSLHKTHNAIQTRSVIYLAGLELRSQYNGNNLTEDFQVITVG
FT                   AAGRAQVRVLHWERGQPVDIVNDQLRYSFDNHLGSALIELDSDGDIISQEEYYPFGGTA
FT                   VLASRNTVEAKYKTVRYSGKERDATGLYYYGYRYYQPWLGRWLSADPAGTIDGLNLYRM
FT                   VRNNPVGLMDGDGLMTDKLLAKHEANFAKKNISSMAELKSEIEKLGLLPADSKQLFLHL
FT                   NGGESDDEPSGSSGSSGSSGSSEILENTSPHKIKNFHFISEINLATMPRPYYKDFSSTE
FT                   DMLESAERLKAYGSIDTLLTLDLTSEDIPEFTSILADKGINYIAEKQYEIIDYFSEDEL
FT                   SSENIDRIVNMIKTIQNNNHKVGIHCAAGNGRSGLIATAMIINKKYTQSRINSFEEKNK
FT                   LKEIIDKNKNEINVDAITYDAMKLVRKTNPFAGERTTDIKAAREYSRYLYSKQNR"
FT   gene            complement(320371..320739)
FT                   /locus_tag="YPDSF_0282"
FT   CDS_pept        complement(320371..320739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38701"
FT                   /protein_id="ABP38701.1"
FT                   /translation="MLPMISLSTLFGLGKSMMLLAGVVAIVWGVQASRTLDRLNQENVQ
FT                   LTTQLARIGQINQQLTQHIQATTVQLKQAQEQERLEGEKSSELQKRLRLAQKGNRCAEE
FT                   PVPAAVIRMQQQSFSDGK"
FT   sig_peptide     complement(320641..320739)
FT                   /locus_tag="YPDSF_0282"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.475 at
FT                   residue 33"
FT   gene            complement(320727..321128)
FT                   /locus_tag="YPDSF_0283"
FT   CDS_pept        complement(320727..321128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0283"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38702"
FT                   /protein_id="ABP38702.1"
FT                   /translation="MMNDKPTFRLSQISEHNLHHVHPDLVLIVRRALTLSHIDFRVIEG
FT                   IRTPERQRQMVLNGHSKTMNSRHLTGHAVDLAPMVNNRIPWDDWHAFVHVAKAMEQAAK
FT                   AMELPLQWGGDWKNFRDGPHFELPRECYP"
FT   gene            complement(321141..321443)
FT                   /locus_tag="YPDSF_0284"
FT   CDS_pept        complement(321141..321443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0284"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38703"
FT                   /protein_id="ABP38703.1"
FT                   /translation="MHVQVPIDDFFITWVIIGTFSAWGGLVRYIVDQNNEYEEWSWVGV
FT                   LCQVIVSAFTGLIGSLFTLETGSSRYITFAIAGLFGAMGNTALKHLWQRFFSHSK"
FT   gene            complement(321577..326067)
FT                   /locus_tag="YPDSF_0285"
FT   CDS_pept        complement(321577..326067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0285"
FT                   /product="insecticidal toxin complex"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38704"
FT                   /protein_id="ABP38704.1"
FT                   /translation="MENSKQQVAVAPLSLPKGGGAITGMGDSLGPIGPSGMATLTLPLP
FT                   ISAGRGYAPSLTLSYSSGSGNGPFGLGWQLGTMAIRRRTNAQVPRYDEYDEFLAPNGEV
FT                   MVVAADPQGSIERTEQSLNGEQFSVIRYLPRIEGNFHRIEYWRPRTNNSQAPFWLVHSS
FT                   DGQKHCLGYSAAARIADPLHPEHIAEWLLEESVSLSGEHIGYQYQAEDEQGIDEPSIYK
FT                   AEKQNHPAASAQRYLKRVVYGNRQAAYELYCLTQQPAPTSWLFSLIFDHGEYSNIAEQV
FT                   PVIIKGKSWNFRQDAFSHFNYGFEVRTRRLCQQVLMYHNLSALKGDEPDAQATLVSRLR
FT                   LHYQHDAYATQLVGCQQLAHEPDGTKRSLPPLEFDYQDFSTRDALGWQPLTDWAEFNYQ
FT                   YQMVDLNGEGMPGMLYQDSGHWIYRPPVRQPGTADGITFGAAQRLPSLPAMRENAMLMD
FT                   INGDGKLDWVISQPGLAGYFSRDPDLSRDPDLSWTQFIPLSTLPAEYFHPQAQLVDLAG
FT                   SGLSDLALVGPKSVRVYTNLCDSFAAATQVAQDDDITLPLPGVHFTELVAFSDVMGSGQ
FT                   QHLVRIRHNSVTCWPNLGHGRFGHPLSLPGFNQPVEQFNPLAIYLADIDGSGTIDLIYA
FT                   TTSQLLIYRNQSGNRFAEPLAIALPTGIRFDNSCQLSLADIQGLGVASIMLSVPHPTTQ
FT                   HWRYDFVASKPYLLCTTNNNMGAESQLLYRSSVQFWLDEKAQAAKQGRSLACQLPFPIH
FT                   LLAQTTQFDEITGNSLSQTARYFHGFYDGVQREFSGFGRVDTLDTDTSAQGSAAERTAP
FT                   TKSSRWFHTGRAGNETLWQSEYWQGDDQAYSLLPTRLTKFINNTQGDELLSELDDNQTF
FT                   WLHRALKGSLLRSELYGLDDSELATQPYSVNSSRYQVRQIQSSADGISSPVALPMVLEQ
FT                   LSYHYERIAQDPQCSQQIVLRCNEYGHPLHSVTINYPRRDKARISPYSWLAKEHWDSHF
FT                   DEQQQQLRITESQQSYHHEISDKFYVLGLPAGQRSDVLTYPDNFVPTAGIHWEELQQPE
FT                   GLLGTKAERTFTAQQQVFYTSDTIPGLVAYSQQAEFDDQTLVALDELLPANERKQQLIK
FT                   AGYQIAPRLFARTGETDIWVAQSGFTDYGDASRFYRPISQRSTQLVGKTILEWDATCCA
FT                   VSDIILADYSITHAEYDYRFITPYLLIDINDNQHYIELDALGRVTSSRFAGTEIDPQTN
FT                   KVIETGFPSIAEQPFSAPNSVDKALSLENTRIPVAQFSVYQPQSWMISLQLDDIEIWIR
FT                   ANNITPEYLFQNHILIDNYYLCPLALRRWGRQNNLLITEGVGLTLKNPMRQPPHILTVV
FT                   VDNYFSASEPQQHQQTLAFSDGFGRVLLSARRVETGPSYSFDPENGLLVDDKGNLVQLE
FT                   VDQRWAVSGRTEYDNKGLPRRRYQPYFFDNWIWLYIANNRTLKEAYADTHIYDPLGREI
FT                   KVITAKGYLRRTHYFPWFVISEDENDTASEITPNP"
FT   gene            complement(326124..329717)
FT                   /locus_tag="YPDSF_0286"
FT   CDS_pept        complement(326124..329717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0286"
FT                   /product="toxin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38705"
FT                   /protein_id="ABP38705.1"
FT                   /translation="MPTSTVLNKINESRRDALVNYYLAKNVSGDEKIKTAEQLYQYLLL
FT                   DTKIGHEVKTSPIAEAISSLQIYINRCVDGEENDLHEKNISTHFSSDNFLHGWNSYNKR
FT                   YARWAGKEKLMYYAADYIDPTLRYNKTELFNTFEQSINNSRLTEKSVKSALQSYLISYE
FT                   KLAQIDTIKELYVENIKTHFFLGKTRESPCQYYWRSGEQLSNDSHHLRWSEWKKVNCNI
FT                   NGTEEKFFINLSWHRSSLYIDWINKFSIRTDKDETTEKYHYNRVYKNDDNTWSELIINM
FT                   DIGFKLSTSTEVITLPPFFVNQGDPNAKEEVENLFLTNGTSIKRIESRLHGYINGHIKI
FT                   LCNDDGISFEIAEKLINGDNGTIGEVKIIENEKIISTINNEKGENKKINLIDKFEIRIF
FT                   PYNELVASTIVFNRIKPEEKIIDELDDKISLLSPNSLPLKEKFQTSVDELLSYNTQKNN
FT                   VKLNAFNGSYGIYLWELFFHIPLLASMRFLNEQRFDLAQHWLKYLFNSAGYRDGNGNLL
FT                   KEGDNILYWNILPLQQDTAWDKNTLIQATDDPDVIAMQDPMQYKLAIFMRTLDLIISQG
FT                   DQAYRQLERDTLAEAKIHYIQASQLLGPRPNLNSSHQWENIKLAEESRQLENSHFLPPY
FT                   NELLLSYWDKLEIRLYNLRHNLNLDGQPLHLPLFATPVDPKALQRQHGAGNGINSSEQI
FT                   ATAQTSLYRFPLLIERAKSAVSAVIQFGNSLQSVLERQDNEAMTLLFQQQQQKVLQHTK
FT                   DIQNNNIQVLQASLEATDSLKSAAEQRRKHYKELLDNGISSDEQLAINIRIASAALNGE
FT                   SLVPLGLSAVLDTAPNVFGLADGGSRWGAISQAVGWGMQSMAMALETTAGVRDAKANYS
FT                   RRAQEWTLQKDQADKDIEQLAHQYTSVQEQLNMAQKQLNLAELEQGHADALYQMQSTRF
FT                   TGKELYNWMAGRLSGLYFQLFDATQPLCLMAKAALEKEVDKAKTDGLFIRSGWNDLYQG
FT                   LLAGEDLQLNLQKLENVWLMEEQRALEVERTVSLAQHYQQLSDHKFNLAEIVTGYMAQD
FT                   KDQKTGNEQDFVELKNGTLITSLSIKGLNLVEDYPETMHLGDIRRIKQISVSLPALLGP
FT                   YQDVQATLDYAGENTHLAKGCTALAISRGMNDSGQFLLDFNDGKYLPFEGIDISDKGTL
FT                   VLRFPNATSKQKLLLQSLSDIILHIRYTIRS"
FT   gene            complement(329758..332259)
FT                   /locus_tag="YPDSF_0287"
FT   CDS_pept        complement(329758..332259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0287"
FT                   /product="insecticidal toxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38706"
FT                   /protein_id="ABP38706.1"
FT                   /translation="MQDNIDHTASVIADTDNTIHQQAKAEERHRQAVRRATQLRNDPVL
FT                   SGINKLAFSVAPKILQPEARTDLSLAEGIPERANEYADPASIQSLFSPGRYLCELYHVA
FT                   KELHEDGNKLHIDKRRPDLQELVLSNSNMNQEVSSLEILLNVLQTNAPLAKLAKDTEAH
FT                   ANDVSFTLPYDDNLTVINAILEDKAISLREIAALLAENNDPWANPITPALVQEQLGLNP
FT                   ASYALIDIKSPLDDNSAKRLAHATQLSVEQLQWLNKNAIESSSDKDSPLRPEILTIISE
FT                   YRRLHQRYGLSVDPFIAIINAVNTTHTNENKTSFFQQIFSTLDVDAGFNFLDQGSWEVI
FT                   IRKALGITAEELLRIAKYCFGKSSISNVKMNSKKFSQLYRMAMIPRTLGVSFSQAEYLW
FT                   QLYSHPDENIMEKIAQGNALTIIDAIIVLENTLQWMSEQKLDITTLQAMLTKQYSTTAT
FT                   PELFNFLSNIYQTLGKQVYSESLKPNLYRSLANGFHLKANVVAGLVNWLAKNDSEFTLE
FT                   RFWQNISMTFAEEPSLHQLEIHQPLLIQCQKLSQYVLIAQWAELSEQEIALILLPNGID
FT                   NRGSAPSPSITLLKLLSEFKLCQQEAKVSQSELFDIMQQLITDTNEKQEKLRNSADKVI
FT                   RSIAKSIGSINNSMDDIDSTISIRNGSATLFPPEHPMYKALKLEVSNLEKSKIQLEGKK
FT                   KEEEIKLEQAKDNIQSLINNWDSEIIIRLADAYHWDINIANSIFILIFGEKINFTFHYE
FT                   NRNDYHYEEHYGYRFEQKPMYSFDKKLTNGFGSILLLKNHIYIAEKLKIHPGTIIKIKN
FT                   YIFDDKSNELENIANKLRVNL"
FT   gene            332239..332334
FT                   /locus_tag="YPDSF_0288"
FT   CDS_pept        332239..332334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38707"
FT                   /protein_id="ABP38707.1"
FT                   /translation="MVDIILHNLPLYLGTLAWDVKQQVLTMCLLK"
FT   gene            complement(332495..333361)
FT                   /locus_tag="YPDSF_0289"
FT   CDS_pept        complement(332495..333361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0289"
FT                   /product="lysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38708"
FT                   /protein_id="ABP38708.1"
FT                   /translation="MFISKNLLVFFTTVQEGSLTNAAVKLFTTPPPMSRSLKILEEELG
FT                   FKLFTRTTSGLKLTLEGAAFYQEIYPTYVRLTEITKNYKKNKNGIINIATYQLNSDHAG
FT                   VICDYFIKKGNFNIELRENIGDISQMDIVISTKEIKGYDFDTELTASCEIKLLYASHLN
FT                   DLPDRVEYLKKLPFIQSSIFCSSCCFKRFSHNLIQQGYSGNVLRIDDARVRHEIIKKGA
FT                   GISLSTNYFFDKKKISHSTEISFISDINFDITYYIYFKSSVINKEFFIQYITNNSLLQW
FT                   QKAEKKH"
FT   gene            complement(333622..334533)
FT                   /locus_tag="YPDSF_0290"
FT   CDS_pept        complement(333622..334533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0290"
FT                   /product="lysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38709"
FT                   /protein_id="ABP38709.1"
FT                   /translation="MERLKQMSVFAKVVECGSFTAAARRLENSVSSISQTVSKLENELN
FT                   VKLLNRSTRRIGLTEAGRIYYQGCRRMLQEVQQVHEQLYAFNNTPTGTLRIGCSSTMAQ
FT                   NVLATMTADMLKAYPGLSVNLVAGIPAPDLIADGLDVVIRVGALQNSGLFSRRLGAMPM
FT                   VVCAAKSYLSQYGTPAKPSDMANFSWLEYNVRPDSNFELIAPEGITTQISPQGRFVTND
FT                   SQTMIRWLKAGAGIAYTPLMWVIEEIKRGEVEILFKHYHSDPRPVYALYTEKDKMPLKV
FT                   QVCIDYLTEYFKRVADVYQDYR"
FT   gene            334836..335039
FT                   /locus_tag="YPDSF_0291"
FT   CDS_pept        334836..335039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0291"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38710"
FT                   /db_xref="GOA:A4THE8"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THE8"
FT                   /protein_id="ABP38710.1"
FT                   /translation="MSLLPVMVIFGLSFPPIFLELLISLALFFVVRRILQPTGIYEFVW
FT                   HPALFNTALYCCLFYLTSRLFS"
FT   gene            335047..335982
FT                   /locus_tag="YPDSF_0292"
FT   CDS_pept        335047..335982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0292"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38711"
FT                   /db_xref="GOA:A4THE9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR022871"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THE9"
FT                   /protein_id="ABP38711.1"
FT                   /translation="MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTA
FT                   DVVAIAPDVSGLLTEVPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEK
FT                   QRESSRRHRLGIQALSQEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEG
FT                   WVTNLNVHAGEFINRGATAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRIL
FT                   HGTVDSISAGVTNSSSSADSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTT
FT                   ATVVITGPNDRDPHQASPMTKLMHRLREFG"
FT   sig_peptide     335047..335139
FT                   /locus_tag="YPDSF_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.978 at
FT                   residue 31"
FT   gene            335984..337939
FT                   /locus_tag="YPDSF_0293"
FT   CDS_pept        335984..337939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0293"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38712"
FT                   /db_xref="GOA:A4THF0"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="InterPro:IPR023706"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THF0"
FT                   /protein_id="ABP38712.1"
FT                   /translation="MTHPSFIRLRFAFKLSFAIVAALFLGFHLQLETPRWSVLTAAIVS
FT                   AGPAFAAGGEPFSGAIRHRGWLRIIGTFIGCIGGLVIIVLTIRAPVLTLMLCCLWAGIC
FT                   TWISSLVRVENSYAFGLAGYTALIIIVTTGETPLLTPQFAVERCSEIVLGIVCAVMADL
FT                   LFSPRSIKQDIDRLVDKVLVDQYRLLQLCIQPAEKSEIDRAWNELVKNTTSLNGMRSYL
FT                   MMESSRWQRCNRRLQVLHTESLALITQACETYLVMSNHPEVISAELKTMLSEPAQTPAE
FT                   IHQQMKKLRQFIAASHSEAIPHTISSWVGAATRYLLLSKGIQTNSSINQVEEDILAGDA
FT                   PVKPISAEGHHAMINGLRTGIATAIGGLFWLWTGWTSGAGCMVMIAVVTSLAMRTPNPR
FT                   RMALDFLVGVIIALPIGALYFMFIIPSTQQSMLLLCISLGVLAFIIGIEVQKRRLGSLG
FT                   TLASTINIIVLSNPMIFNVRQFLDSALGQIVGCFVSLIVLLLIRDNAKDRTGRTLLNRF
FT                   VYSAVSALTTNKTKRGENHLPALYQQLNQLLMMFPADIDKYRLALTLIIAHQRLNRTEI
FT                   PVNAELSAFHKQIRSTAERVITVNNDQKRRYYFARLLQELDQYQQKLVDYQAADAVIRP
FT                   VKRLTEMLRKYQSALI"
FT   sig_peptide     335984..336139
FT                   /locus_tag="YPDSF_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.916 at
FT                   residue 52"
FT   gene            338206..339339
FT                   /locus_tag="YPDSF_0294"
FT   CDS_pept        338206..339339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0294"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38713"
FT                   /protein_id="ABP38713.1"
FT                   /translation="MPAQNPLQHQRQHDGIYHIGYFVGGKWSQAQEQFDVYNPATGELV
FT                   ARVAKSGKQETEAAIKAASEAFPAWRKTPAKQRAEILQRWYLLIMEHQQSLAELMVSEQ
FT                   GKPLKEALVEVAYAASFIQWFSEQAKRANGEIIPSAKEGARILATREPIGVVAAITPWN
FT                   FPLAMLTRKLGPALAAGCTGLIKPANNTPLSAFALLALAEQAGVPAGVLNGVVGDTHAI
FT                   SDAIMASSDVRKISFTGSTNVGKTLMRNAAATMKRISMELGGNAPYIVFDDADLEAAVA
FT                   GAMACKFRNAGQVCVCVNRFYIQDAIYDEFVNRLAAEVKKLKVGNGMDKDVNMGPLINL
FT                   AGLEKVEEHVKDALEKGGRLLAGGIAMRWAVISSSQR"
FT   gene            339336..339674
FT                   /locus_tag="YPDSF_0295"
FT   CDS_pept        339336..339674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0295"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38714"
FT                   /protein_id="ABP38714.1"
FT                   /translation="MIADANEQMKVASEETFGPLAACFRFSTEAEVIQRANNTPFGLAA
FT                   YFYTQNLQRVFRVSEALESGMIGVNECSVSTELAPFGGVKESGLGREGSVLGLDEFMEV
FT                   KTLHLGNL"
FT   gene            339869..340342
FT                   /locus_tag="YPDSF_0296"
FT   CDS_pept        339869..340342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0296"
FT                   /product="ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38715"
FT                   /protein_id="ABP38715.1"
FT                   /translation="MNKRLMAILGAVLLLIAGAWQGIDGVTVRDIGSSAELERPALSAS
FT                   AATESLTQHQKVVKYLQTHHRLPDFYLTKKQAREQGWDAQKGNLCDVLPGKAIGGDRFS
FT                   NRERQLPDAKGRHWREADVNYRCGRRGSDRLLYSNDGLIYLTQDHYKHFIRME"
FT   sig_peptide     339869..339928
FT                   /locus_tag="YPDSF_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.515 at
FT                   residue 20"
FT   gene            340347..340628
FT                   /locus_tag="YPDSF_0297"
FT   CDS_pept        340347..340628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0297"
FT                   /product="ribonuclease inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38716"
FT                   /protein_id="ABP38716.1"
FT                   /translation="MVKVVFDFNHIPDLPAFYRAFSQNFALSEDFGANLDALWDVVTGE
FT                   IALPVEIEFVHFSRRHQRRFAAIVLLLEEAEEELAGRLHFNVVDEHIV"
FT   gene            complement(340740..341288)
FT                   /locus_tag="YPDSF_0298"
FT   CDS_pept        complement(340740..341288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38717"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THF5"
FT                   /protein_id="ABP38717.1"
FT                   /translation="MNKQPEDWLDDVPENKNDDDDEIIWVSKSEIKRDAEALKDLGTEL
FT                   VDLGKNALERIPLDEDLLAAIELAQKIKKEGRRRQLQLIGKMLRARDVEPIQTALDKLK
FT                   NRHNQQISLFHKLETLRDRLIAEGDEAIPTVLELYPDADRQQLRSLVRNAQKEQAANKP
FT                   PKSFRQIFSYLRELAEKKQ"
FT   gene            341469..342809
FT                   /locus_tag="YPDSF_0299"
FT   CDS_pept        341469..342809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0299"
FT                   /product="Putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38718"
FT                   /protein_id="ABP38718.1"
FT                   /translation="MKVVTQVAEQRKTLEQAVAQALELARVGSDAAEVAVSKTTGISVS
FT                   TRFGEVENVEFNSDGALGITVYHQQRKGSASTTDLNPDAVARTVQAALDIARYTSPDPY
FT                   AGPADKSLLAFDAPDLDLFHPGDLDAEQGILLAARAEQAALQADKRITNTEGGSFNSHY
FT                   GIKVFGNSHGMLQSYCSSRHSLSSSVIAEHNGDMERDYAYTIGRRMEDLATPEWVGEEC
FT                   ARRTLSRLSPRKLPTMQSPVLFAAEVATGLFGHLVSAISGGNIYRKSTFLLDHLGQQIL
FT                   PEWLTIEEHPHLLRGLASTPFDSEGVRTLQREIVKDGVLQTYLLTSYSARKLGLQSTGH
FT                   AGGIHNWRIAGQGQDFAGMLKQLDKGLVVTELMGQGVSTVTGDYSRGAAGFWVENGEIQ
FT                   YPVSEITIAGNLKDMLRNIVSVGSDIETRSNIQCGSVLLPVMKIAGE"
FT   gene            343094..343702
FT                   /locus_tag="YPDSF_0300"
FT   CDS_pept        343094..343702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38719"
FT                   /protein_id="ABP38719.1"
FT                   /translation="MIVMPSTYSPATIAREFKVIHEFELSSMKYGVIFDKNVPKAAIIR
FT                   MNTESFNGIPRHRIIAALDLVAKQELGENVISVQRFWQDSALFQVEGMVVEQGARGKGL
FT                   ATLLYEELVVKCGVILMSDNKQYEAGKALWQKIAQESDKLAVFILDSDVGQFYPYCGDR
FT                   VPYNGKGIPEEKIWSLHPDTTKWGVVLVAENREKISQYC"
FT   gene            343910..344296
FT                   /locus_tag="YPDSF_0301"
FT   CDS_pept        343910..344296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0301"
FT                   /product="cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38720"
FT                   /protein_id="ABP38720.1"
FT                   /translation="MGKTLMALITAALLSTSSLVMAASVADDMETIAEHYGKVLKADST
FT                   AVIKQDLQAMRVAAVDAQKGIPTKLKSKVEDSPEMKDFRHGMDVLIGEIDGALALADQG
FT                   KLDEAKQAAQDFKDTRNTYHKKYR"
FT   sig_peptide     343910..343978
FT                   /locus_tag="YPDSF_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 23"
FT   gene            complement(344520..344930)
FT                   /locus_tag="YPDSF_0302"
FT   CDS_pept        complement(344520..344930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0302"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38721"
FT                   /protein_id="ABP38721.1"
FT                   /translation="MTKPTITINELDAERLDALLAQPAFAGSVVATALNEELDRAEILP
FT                   PNEIPADVVTMNSRVRFLDLNSQEEHIRTLVYPASLKDSNEQLSVMAPLGAALLGLHVN
FT                   DEISWKLPGGDETRITVLELLYQPESAGEYHR"
FT   gene            complement(345283..346950)
FT                   /locus_tag="YPDSF_0303"
FT   CDS_pept        complement(345283..346950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0303"
FT                   /product="trehalose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38722"
FT                   /protein_id="ABP38722.1"
FT                   /translation="MNNPIPWWQHGVIYQIYPKSFQDSTGNGYGDLAGVAQRLDYLQKL
FT                   GVDAIWLTPVYVSPQVDNGYDVADYCAIDPAYGTLDDFKRLVAGAHQRGIRIIMDMVFN
FT                   HTSTEHAWFKASQDRNSPYRQFYIWRDGDGGDGSLPNNWRSKFGGHAWQWHAASGQYYL
FT                   HLFAPEQADLNWEHQPVRDELKKVCEFWADLGVDGLRLDVINLVSKQQDFPNDLDGDGR
FT                   RFYTDGPRIHEFLQELSRDVFQPRRLMTVGEMSSTRLEHCQRYAALGGDELSMTFNFHH
FT                   LKVDYLNGEKWSLMPPNRVELKHIFNQWQQGMHNRAWNALFWCNHDQPRIVSRFGHEGA
FT                   LRLPAAKMLAMVLHGMQGTPYIYQGEEIGMTNPNFTDITQYRDVESLNMFAELSVAGRE
FT                   PDELLAILAAKSRDNSRTPMQWDSSDNAGFSQGTPWIAPCSNYHEINVNAALADADSVF
FT                   YAYQYLIALRKQYDIFTFGDYQDLCPQHPDLWCYLRSWQGKQLLVVANLSEEPQRWQPE
FT                   GLTLDGNWQLLMSSYDQSAFQPQDMILRGYEGIYWVCE"
FT   gene            complement(347045..348460)
FT                   /locus_tag="YPDSF_0304"
FT   CDS_pept        complement(347045..348460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0304"
FT                   /product="PTS system, trehalose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38723"
FT                   /protein_id="ABP38723.1"
FT                   /translation="MGKVKQQDIDQLIVLVGGRENIATVSHCITRLRFVLKDPSIASPK
FT                   EIENLSMVKGCFTNAGQFQVVIGPEVDDYYKALIAKIGQSEVDKEQTKLAARQNMTWFE
FT                   RGISHFAEIFFPLLPALISGGLILGFRNVIGDIPMSEGKTLAQMYPAWQTIYDFLWLLG
FT                   EAIFFYLPVAICWSTVKKMGGTPVLGIVLGITLVSPQLMNSYLLGQQLPDVWNFGWFTI
FT                   EKVGYQAQVIPSILAGLALGWIETNLKRIIPAYLYLVVVPVVSLLLAVFLAHTLIGPFG
FT                   RMIGDGVAWGVKAVMTGSFAPVGAALFGFLYAPLVITGVHQTTLAIDMQMVQSMGGTPV
FT                   WPLIALSNIAQASAVLGIIIISRKINEREISVPAAISAYLGVTEPAMYGINLKYRFPML
FT                   CAMIGSALAGLICGLTGVMANGIGVGGLPGILSIQPQFWGIYAVAMLVAIVVPLALTIL
FT                   VYKRKERRGELPV"
FT   gene            complement(348871..349824)
FT                   /locus_tag="YPDSF_0305"
FT   CDS_pept        complement(348871..349824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0305"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38724"
FT                   /protein_id="ABP38724.1"
FT                   /translation="MQNRLTIKDIARMSGVGKSTVSRVLNNEGSVSPQTRERVEAVIRQ
FT                   HGFTPSKSARAMRGQSDKVVGIIVSRLDSPSENQAVRTMLPLFYQQGYDPILMESQFDT
FT                   TLVSEHLHILQQRHVDGVILFGFSGLTAEMLAPWQEKMVVLAREYRGFSSVCYDDEGAI
FT                   YLLMDKLRQAGHRHISYIGVQSSDATTGMRRYQAYLDYSQQHGLTPMVALGELSYQSGF
FT                   QLAPQVITPQTSALVCASDTIAMGVSKYLQQQEREQPPIQVCGIGNTPLLHFLFPDTLT
FT                   IELGYGRAGVKAAQQLLDQLSNSQPIQQIIIPGQLV"
FT   gene            complement(350058..350534)
FT                   /locus_tag="YPDSF_0306"
FT   CDS_pept        complement(350058..350534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38725"
FT                   /protein_id="ABP38725.1"
FT                   /translation="MKLRTWLLIPIICSPFFWGSTAIAKNGVAIPLPDKRVAVLSEGDL
FT                   ESASVGTYSVAIFKNDTFLDFIAGGVFSRDGSIFQDNGKPRVEFTDINGDGNKELIVSQ
FT                   LTAGSGNYLRVDAFSLGPDSINKVLSIQSDTKSDYISLLKELCEICLPIDAPPH"
FT   sig_peptide     complement(350460..350534)
FT                   /locus_tag="YPDSF_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.976 at
FT                   residue 25"
FT   gene            complement(350833..351219)
FT                   /locus_tag="YPDSF_0307"
FT   CDS_pept        complement(350833..351219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38726"
FT                   /protein_id="ABP38726.1"
FT                   /translation="MLRAIKTKLAPAAIGPYVQGVDLGSMIMTSGQIPIDPKTGLVADD
FT                   IAAQARQSLENVKAIVEAAGLKVADIVKTTVFVKDLNDFSIVNATYEAFFTEHSAPFPA
FT                   RSCVEVARLPKDVKIEIEAIAVRR"
FT   gene            complement(351357..351824)
FT                   /locus_tag="YPDSF_0308"
FT   CDS_pept        complement(351357..351824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0308"
FT                   /product="aspartate carbamoyltransferase regulatory chain"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38727"
FT                   /db_xref="GOA:A4THG5"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THG5"
FT                   /protein_id="ABP38727.1"
FT                   /translation="MMTQDYKLQVEAIKCGTVIDHIPAQIGFKLLSLFKLTATDQRITI
FT                   GLNLPSKRSGRKDLIKIENTFLTEQQANQLAMYAPDATVNRIDNYEVVKKLTLSLPERI
FT                   DAVLTCPNSNCISHNEPVDSSFTVKAQRGEISLKCKYCEKEFDHLTVLHAD"
FT   gene            complement(351833..352768)
FT                   /locus_tag="YPDSF_0309"
FT   CDS_pept        complement(351833..352768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0309"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38728"
FT                   /db_xref="GOA:A4THG6"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THG6"
FT                   /protein_id="ABP38728.1"
FT                   /translation="MANPLYHKHIISINDLSRDELELVLRTAASLKKTPQPELLKHKVI
FT                   ASCFFEASTRTRLSFETSIHRLGASVVGFSDSSNTSLGKKGETLADTMSVISTYVDAIV
FT                   MRHPQEGASRLAAQFSGNVPIVNAGDGANQHPTQTLLDLFTIQETQGRLDNINIAMVGD
FT                   LKYGRTVHSLTQALAKFNGNHFFFIAPDALAMPAYILQMLEEKEIEYSLHESLEEVVPE
FT                   LDILYMTRVQKERLDPSEYANVKAQFILRSSDLTGARDNLKVLHPLPRIDEITTDVDKT
FT                   PYAYYFQQAGNGIFARQALLALVLNAELAL"
FT   gene            complement(353106..353378)
FT                   /locus_tag="YPDSF_0310"
FT   CDS_pept        complement(353106..353378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0310"
FT                   /product="phosphocarrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38729"
FT                   /protein_id="ABP38729.1"
FT                   /translation="MTVKQTVEIKNKLGMHARPAMKLFELVQSFDAEVMLRNDSGTEAE
FT                   ASSVIALLMLDSAKGRQIEVEATGVDEIQALAAVIELFNSGFDED"
FT   gene            complement(353375..354361)
FT                   /locus_tag="YPDSF_0311"
FT   CDS_pept        complement(353375..354361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38730"
FT                   /db_xref="GOA:A4THG8"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THG8"
FT                   /protein_id="ABP38730.1"
FT                   /translation="MIVANTPAARKRVGSAPTTPRFVAGMQVPNYGDKRQRDTKGSDYM
FT                   VLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPQLASTLADRNISAAVSIDVRNM
FT                   PESPEVFEHAMTQLPDSFSPQLLFLDADRNTLIRRYSDTRRLHPLSAKNLSLESAIDEE
FT                   SDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKRERELTMVFESFGFKHGIPIDAD
FT                   YVFDVRFLPNPHWDPKLRPMTGLDKPVISFLDRHTEVHNFIYQTRSYLEQWLPMLETNN
FT                   RSYLTVAIGCTGGKHRSVYVAEQLADYFRARGKNVQSRHRTLEKRKQ"
FT   gene            complement(354535..355017)
FT                   /locus_tag="YPDSF_0312"
FT   CDS_pept        complement(354535..355017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0312"
FT                   /product="nitrogen regulatory IIA protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38731"
FT                   /protein_id="ABP38731.1"
FT                   /translation="MTNDPALQLSSVLNIESTKSSVHCSSKKRALEIISELAAKQLNLP
FT                   SQVVFDAVLTRERMGSTGIGSGIAIPHGKLEEDTLRAVGVFIRLEQPIAFDAIDNQPVD
FT                   LLFALLVPADQCKTHLHTLSLVAKRLADKTVCRRLRSAQSDDELYQIITELPPEIA"
FT   gene            complement(355135..355308)
FT                   /locus_tag="YPDSF_0313"
FT   CDS_pept        complement(355135..355308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0313"
FT                   /product="SSU ribosomal protein S30P / sigma 54 modulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38732"
FT                   /protein_id="ABP38732.1"
FT                   /translation="MVLSVEKVKQIAEATVHVNGGELHASSEQEDMYAAIDILVDKLAR
FT                   QLNKHKDKLKQH"
FT   gene            complement(355315..355422)
FT                   /locus_tag="YPDSF_0314"
FT   CDS_pept        complement(355315..355422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0314"
FT                   /product="sigma N modulation factor"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38733"
FT                   /protein_id="ABP38733.1"
FT                   /translation="MQLNITGHHVEITEALREFVTTKFAKLEQYFDRIN"
FT   gene            complement(355446..356879)
FT                   /locus_tag="YPDSF_0315"
FT   CDS_pept        complement(355446..356879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0315"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38734"
FT                   /protein_id="ABP38734.1"
FT                   /translation="MKQGLQLKFSQQLAMTPQLQQAIRLLQLSTLELQQEIQLALESNP
FT                   LLEQTDLHEEIDAKETVDSESLDTREALEQKDMPEELPLDATWDEIYTAGTPSGMGNDY
FT                   SDDELPVYQGETTQTLQDYLMWQVDLTPFTETDAAIATSIVDAVDDTGYLTVPLEDILE
FT                   SMGDENVALDEVEAVLKRIQHFDPIGVAARNLRECLLVQLSQYAKDTPYLAEARLIVSE
FT                   YLDLLGNHDFRMMIRLSRLKEDTLKEAIALIQSLDPRPGQSINTGESEYVIPDVLVRKE
FT                   KGIWTVELNADSIPRLKVNQQYAAMGNSVRNDSDGQFIRSNLQEAKWLIKSLESRNETL
FT                   LKVARCIVEQQVEFFEKGAEFMKPMVLADIAQAVDMHESTISRVTTQKFLHSPRGIFEL
FT                   KYFFSSHVNTDSGGEASSTAIRALVKKLVAAENPAKPLSDSKLTTLLCEQGIMVARRTV
FT                   AKYRESLSIPPSNQRKQLV"
FT   gene            complement(356941..357666)
FT                   /locus_tag="YPDSF_0316"
FT   CDS_pept        complement(356941..357666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0316"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38735"
FT                   /protein_id="ABP38735.1"
FT                   /translation="MATLIAEKLAKTYKGRKVVEDVSLNVKSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVQRDAGRIVIDDEDISLLPLHERARRGIGYLPQEASIFRRLSVFNNLMAVLE
FT                   IRKDLSAEQREERAEELMEEFHINHLRDSLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVIDIKKIIKHLRDSGLGVLITDHNVRETLDVCERAYIVSQGHLIAHGTPQ
FT                   DILADEQVKRVYLGEEFRL"
FT   gene            complement(357673..358218)
FT                   /locus_tag="YPDSF_0317"
FT   CDS_pept        complement(357673..358218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38736"
FT                   /protein_id="ABP38736.1"
FT                   /translation="MKSKNKISHLLLACSLLAASLSAFALTGDTEQPAEVKSDKQTLDM
FT                   ETNTVTFIDNVVIKQGTIEIKADKVVVTRPGGDQSKMIIEGFGNPVTFYQMQDSGKPVK
FT                   GHGQKLRYEIANDFVVLTGDAYLEQLDSNIKGDRITYLVKKQQMEAFSDKGKRVTTVLL
FT                   PSQLQDKGPAASGQKKSK"
FT   sig_peptide     complement(358141..358218)
FT                   /locus_tag="YPDSF_0317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.922 at
FT                   residue 26"
FT   gene            complement(358202..358765)
FT                   /locus_tag="YPDSF_0318"
FT   CDS_pept        complement(358202..358765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38737"
FT                   /protein_id="ABP38737.1"
FT                   /translation="MSKTRRWITLVLALIALALIGWNMSGFNQQGAPVVADDNEPSSQS
FT                   QHTVTTVFNPVGQLNYKLVAEEVQNFSAKELTWFTKPVMTLFGDNAVATWTVRADRAKL
FT                   TDDKMLYLYGHVEVDSLTADAQLKKIRTDNAQVNLITQDVASDDEVTLFGIGFTSEGMR
FT                   IRGNLRDKTAELIEKVKTSYEIQK"
FT   sig_peptide     complement(358670..358765)
FT                   /locus_tag="YPDSF_0318"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.447 at
FT                   residue 32"
FT   gene            complement(358762..359325)
FT                   /locus_tag="YPDSF_0319"
FT   CDS_pept        complement(358762..359325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38738"
FT                   /protein_id="ABP38738.1"
FT                   /translation="MSNTAYIDTCYGPVADDVIQRAANIRLLICDVDGVMSDGLIYMGN
FT                   QGEELKAFNVRDGYGIRCLITSDIDVAIITGRRAKLLEDRANTLGITHLYQGQSDKLVA
FT                   YHELLATLQCQPEQVAYIGDDLIDWPVMAQVGLSVAVADAHPLLLPKAHYVTRIKGGRG
FT                   AVREVCDLILLAQDKLEGATGLSI"
FT   gene            complement(359434..360507)
FT                   /locus_tag="YPDSF_0320"
FT   CDS_pept        complement(359434..360507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38739"
FT                   /protein_id="ABP38739.1"
FT                   /translation="MLRKAWSESNQHTYSVKDDGNTNIGRILSMSTFDLQPGVDFQQAG
FT                   KQVLQIEREGLAQLDQYINEDFSRACEAIFRCHGKVVVMGMGKSGHIGCKIAATFASTG
FT                   TPAFFVHPGEASHGDLGMITPQDIVLAISNSGESNEILTLIPVLKRQKILLICMSSNPE
FT                   STMGKAADIHLCINVPQEACPLGLAPTTSTTATLVMGDALAVALLKARGFTQEDFALSH
FT                   PGGALGRKLLLRISDIMHTGTEIPTVSPDASLRDALLEITRKSLGLTVICDDSMRIKGI
FT                   FTDGDLRRVFDMGIDLNNAKIADVMTRGGIRVPPNILAVDALNLMESRHITALLVADGD
FT                   QLLGVVHMHDMLRAGVV"
FT   gene            complement(360531..361505)
FT                   /locus_tag="YPDSF_0321"
FT   CDS_pept        complement(360531..361505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0321"
FT                   /product="sodium/calcium exchanger protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38740"
FT                   /protein_id="ABP38740.1"
FT                   /translation="MFLAITLLIIGLVLLVYGADRLVYGAAVLSRSFGVPPLIIGMTIV
FT                   GIGTSLPELIVSVTAALNGQTDMAVGNVLGSNITNLLLIVGGAALIRPLIVRSEILRRE
FT                   LPLMLVVTALCGFLLADNHLSRGDGVILLLAAAAFIVLMLKIARLAHAEGNDILTREQL
FT                   SELPQDSSTTVALLWLVLAFIILPLSAKMIIDNATVIARVAGVSELVIGLTVIAIGTSL
FT                   PELATFIAGALKGENDIAVGNIIGSNIFNIVIVLGVPALLSPGEINPEAFQRDYWVMLA
FT                   VSVVFTLLCLGRKHRIGHLAGALLLCGFITYLAVLFFAPISAL"
FT   sig_peptide     complement(361449..361505)
FT                   /locus_tag="YPDSF_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.768) with cleavage site probability 0.742 at
FT                   residue 19"
FT   gene            361770..362588
FT                   /locus_tag="YPDSF_0322"
FT   CDS_pept        361770..362588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0322"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38741"
FT                   /protein_id="ABP38741.1"
FT                   /translation="MKQLASNVMNLIEIRGMSFTRGERLIFADINMTVPRGKVTAIMGP
FT                   SGIGKTTLLRLIGGQLAPDTGEIWFDGDNIPALSRQRLYDVRKKMSMLFQSGALFTDLT
FT                   VFENVAFPLREHSRLPEELLHSTVMMKLEAVGLRGAANLMPAELSGGMARRAALARAIA
FT                   LDPELIMFDEPFVGQDPITMGVLVKLIDELNHALGVTCVVVSHDVPEVLSIADYAYIVA
FT                   DQHVIAEGTPEQLQTNSDMRVRQFLDGIADGPVPFRFPAGDYKTELLYPK"
FT   gene            362806..363588
FT                   /locus_tag="YPDSF_0323"
FT   CDS_pept        362806..363588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0323"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38742"
FT                   /protein_id="ABP38742.1"
FT                   /translation="MLVKSLASLGRRGINVCASFGRAGLMLFNALVGRPEPRKQWPLLI
FT                   KQLYSVGVQSLLIIVVSGLFIGMVLGLQGFLILTTYSAEASLGMMVSLSLLRELGPVVT
FT                   ALLFAGRAGSALTAEIGLMKATEQISSLEMMAIDPLRRVVAPRFWAGLISMPLLTAIFV
FT                   AVGIWGGSVVGVDWKGIDSGFFWSAMQNAVEWRTDLLNCLIKSLVFALTVTWIALFNGY
FT                   DAVPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGN"
FT   gene            363593..364150
FT                   /locus_tag="YPDSF_0324"
FT   CDS_pept        363593..364150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0324"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38743"
FT                   /protein_id="ABP38743.1"
FT                   /translation="MQTKKSEVWVGMFILIAILAVIFLCLKVADIKSVGNQPTYRIYAN
FT                   FDNIGGLKNHSPVKIGGVVVGRVAEITLDTKNYTPRVAIDIQQRYNHIPDTSSLAVRTS
FT                   GLLGEQFLALNVGFEDPEMGTSILKDGGTIQDTKSALVLEDLIGQFLYKSSGDSPAVSE
FT                   TAPATETAAPQAAVPSLPAQHP"
FT   gene            364163..364786
FT                   /locus_tag="YPDSF_0325"
FT   CDS_pept        364163..364786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38744"
FT                   /protein_id="ABP38744.1"
FT                   /translation="MFKRLFMVALLAIAPLVHAVDQSNPYRLMDEAAKKTFTRLKNEQP
FT                   KIKQNPDYLRTIVREELLPFVQIKYAGALVLGSYYKDATPAQREAYFNAFGKYLEQAYG
FT                   QALALYHGQTYDVAPDQPLGDANIVAIRVTILDPSGRPPVRLDFQWRKNSQTGNWQAYD
FT                   MIAEGVSMISTKQNEWASILRQKGVDGLTQQLLSAAKQPITLDK"
FT   sig_peptide     364163..364222
FT                   /locus_tag="YPDSF_0325"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            364822..365124
FT                   /locus_tag="YPDSF_0326"
FT   CDS_pept        364822..365124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0326"
FT                   /product="anti-sigma B factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38745"
FT                   /protein_id="ABP38745.1"
FT                   /translation="MAGELSWQSLQETLVLQGELDRETLLPLWQQRETLLADKSRIDVS
FT                   QLQRVDSSGLALLVHFRELQSQRGHSLEIIGISNRLATLIELYNLQQIIPVETAS"
FT   gene            365262..365525
FT                   /locus_tag="YPDSF_0327"
FT   CDS_pept        365262..365525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0327"
FT                   /product="BolA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38746"
FT                   /protein_id="ABP38746.1"
FT                   /translation="MNLMDTNEIKDVLMNALALQEAHVTGDGSHFQVIVVGELFADMNR
FT                   VKKQQAVYAPLMEYIADNRIHALSIKAYTPQEWQRDRKLNGF"
FT   gene            365679..366941
FT                   /locus_tag="YPDSF_0328"
FT   CDS_pept        365679..366941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0328"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38747"
FT                   /db_xref="GOA:A4THI5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THI5"
FT                   /protein_id="ABP38747.1"
FT                   /translation="MDKFRVQGRTRLSGEVTISGAKNAALPILFAALLAEEPVELQNVP
FT                   KLKDIDTTIKLLSQLGTKIERNNGSVFVDASAVNEFCAPYDLVKTMRASIWALGPLVAR
FT                   FGQGQVSLPGGCAIGARPVDLHITGLEQLGAEIKLEEGYVKASVNGRLKGAHIVMDKVS
FT                   VGATVTIMSAATLAEGTTVIENAAREPEIVDTANFLNTLGAKISGAGTDRITIEGVTRL
FT                   GGGVYRVLPDRIETGTFLVAAAISGGKVVCRQTRPDTLDAVLAKLREAGADIEVGDDWI
FT                   SLDMQGKRPKAITFRTAPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHVPELI
FT                   RMGAHAEIESNTVICYGVEQLSGAQVMATDLRASASLVLAGCIAEGVTIVDRIYHIDRG
FT                   YERIEDKLRALGAKIERVKGE"
FT   gene            complement(367122..368273)
FT                   /locus_tag="YPDSF_0329"
FT   CDS_pept        complement(367122..368273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0329"
FT                   /product="protease"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38748"
FT                   /protein_id="ABP38748.1"
FT                   /translation="MLCPPNSCYSPFHPFIYALNLMFLKLLRSIILGLIVAGILLVALP
FT                   MLRSPGYLFSGKSNNVNEEVPTSYNQAVRRAAPAVVNVYNRSLSATQQGLAIRTLGSGV
FT                   IMSDKGYILTNKHVINDAEQIIVAMQNGRISEALLVGSDNLTDLAVLKIDATNLPVIPI
FT                   NINRTPHIGDVVLAIGNPYNLGQTVTQGIISATGRIGLSSSGRQNFLQTDASINQGNSG
FT                   GALVNTLGELMGINTLSFDKSNNGETPEGIGFAIPTALATKVMEKLIRDGRVIRGYIGI
FT                   TGEEYPPFNANDNGSDRVHGIKVKKVSPDGPAAQAGIHVGDIILNVNNKPATSVIETMD
FT                   QVAEVRPGTTIPVLLLRNGQQIAVQITITELDQNEMLTTQAAD"
FT   gene            368436..368894
FT                   /locus_tag="YPDSF_0330"
FT   CDS_pept        368436..368894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0330"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38749"
FT                   /protein_id="ABP38749.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(369011..370384)
FT                   /locus_tag="YPDSF_0331"
FT   CDS_pept        complement(369011..370384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0331"
FT                   /product="protease"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38750"
FT                   /protein_id="ABP38750.1"
FT                   /translation="MKKTSLLLSALAISVGLGLASVPMVSAAALPAAVAGQTLPSLAPM
FT                   LEKVLPAVVSVHVSGSQAQQQRLPEEFKFFFGPNAPSGKESSRPFEGLGSGVIINAEKG
FT                   YILTNNHVINNADKIRVQLNDGREYDAKLLGRDEQTDIALLQLTDAKNLTAIKIADSDN
FT                   LRVGDFAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGALVN
FT                   LDGELIGINTAILAPGGGNIGIGFAIPSNMAQNLSQQLIEFGEVKRGLLGIRGSEMTAD
FT                   IAKAFNIDAQRGAFVSEVLPKSAAAKAGIKPGDVLISVDGKKISSFAELRAKVGTTGPG
FT                   KTIKIGLLREGKPLEVSVTLDNSSSTSTSAENLSPSLQGASLSNGELKDGSKGIKVDSV
FT                   TKGSPAAQSGLQKDDVIIAVNRERVKDIAELRKAIEAKPAVIALNIVRGEDNIYLLIR"
FT   sig_peptide     complement(370301..370384)
FT                   /locus_tag="YPDSF_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.679 at
FT                   residue 28"
FT   gene            complement(370655..371059)
FT                   /locus_tag="YPDSF_0332"
FT   CDS_pept        complement(370655..371059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0332"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38751"
FT                   /protein_id="ABP38751.1"
FT                   /translation="MTWEYALIGLVVGVVIGAVAMRFGNRKLRQQQVLQNELEKSKTDL
FT                   EEYRQELVGHFARSAELLDNMARDYRQLYQHMAKSSNNLLPDLPLQDNPFRYRLTESEA
FT                   DNDQAPVKLPPRDYSEGASGLLRPEHQNRD"
FT   gene            371283..372410
FT                   /locus_tag="YPDSF_0333"
FT   CDS_pept        371283..372410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38752"
FT                   /protein_id="ABP38752.1"
FT                   /translation="MQQSSPITLYQQALDAGGYQPDDVQRRAVARLETIYQALNQYQNV
FT                   PAASASLRNRLGRLFGKPARRPPVSPVQGLYMWGGVGRGKTWLMDLFFHSLPGERKLRL
FT                   HFHRFMLRVHQELTELQGHENPLEIVADGFKAQTDVLCFDEFFVSDITDAMLLATLLEA
FT                   LFARGITLVATSNIPPDNLYHNGLQRGRFLPAIALIKQHCEVMNVDAGIDYRLRTLTQA
FT                   NLYLTPLNSQTEQAMAAIFVKLAGKEGGKATVLEVNHRPLPAICVAEGVLAVDFHTLCE
FT                   EARSQLDYIALSKRYHTVLLHNVRCMAARDENTARRFLALVDEFYERRVKLIIAAEASM
FT                   FEIYSGERLKFEYQRCLSRLQEMQSEEYLSLPHLP"
FT   gene            372723..373151
FT                   /locus_tag="YPDSF_0334"
FT   CDS_pept        372723..373151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0334"
FT                   /product="LSU ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38753"
FT                   /db_xref="GOA:A4THJ1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THJ1"
FT                   /protein_id="ABP38753.1"
FT                   /translation="MKTFTAKPETVKRDWYVVDASGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNAEKVAVTGNKRTDKIYYHHTGFVGGIKQATFEEMIARRPERVIEIA
FT                   VKGMLPKGPLGRAMYRKLKVYAGTEHNHAAQQPQVLDI"
FT   gene            373166..373558
FT                   /locus_tag="YPDSF_0335"
FT   CDS_pept        373166..373558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0335"
FT                   /product="SSU ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38754"
FT                   /db_xref="GOA:A4THJ2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THJ2"
FT                   /protein_id="ABP38754.1"
FT                   /translation="MAENQYYGTGRRKSSSARVFLKPGSGKIVINQRSLEVYFGRETAR
FT                   MVVNQPLELVDMVTKFDMYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFV
FT                   TRDAREVERKKVGLRKARRRPQFSKR"
FT   gene            373932..374573
FT                   /locus_tag="YPDSF_0336"
FT   CDS_pept        373932..374573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0336"
FT                   /product="stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38755"
FT                   /protein_id="ABP38755.1"
FT                   /translation="MAVAANKRSVMTLFSGPTDIFSHQVRIVLAEKGVSVEIEQVEADN
FT                   LPQDLIDLNPYRTVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGSSRLMMH
FT                   RIEHDWYSLLYKIEQGNAQEAEAARKQLREELLSIAPVFNETPFFMSEEFSLVDCYLAP
FT                   LLWRLPVLGIEFTGAGSKELKGYMTRVFERDAFLASLTEAEREMHLKTRS"
FT   gene            374579..375094
FT                   /locus_tag="YPDSF_0337"
FT   CDS_pept        374579..375094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0337"
FT                   /product="stringent starvation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38756"
FT                   /protein_id="ABP38756.1"
FT                   /translation="MEMSDMSPRRPYLLRAFYEWLIDNQLTPHLVVDVTRPGVSVPMEF
FT                   ARDGQIVLNVAPRAVGNLELSNDDVRFNARFGGVPRQVTVPIAAVMAIYARENGSGTMF
FT                   EPEAAYDADADGNFEGIEGKENETAPTESLMLVTDDTRVEQDDDNSPDDKPPQPPRSGG
FT                   RPALRVVK"
FT   gene            complement(375247..375732)
FT                   /locus_tag="YPDSF_0338"
FT   CDS_pept        complement(375247..375732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38757"
FT                   /protein_id="ABP38757.1"
FT                   /translation="MKFHLPFIVGGLLAMSSSAFAMSLNYQEVGYNIEARGARAVVAEL
FT                   EKSGQLPAVENNIKLGDDNWIAMAPKLASAGNPKFTEGVKSALSSALIYNPAAVLKAVS
FT                   GSKILTLSDVCTAPIDVKDSEAKANFQQRASRTLLTIKNSDMAGPRDSCLAELKKLS"
FT   sig_peptide     complement(375667..375732)
FT                   /locus_tag="YPDSF_0338"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            complement(376173..377591)
FT                   /locus_tag="YPDSF_0339"
FT   CDS_pept        complement(376173..377591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0339"
FT                   /product="glutamate synthase (NADPH) small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38758"
FT                   /protein_id="ABP38758.1"
FT                   /translation="MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSETQAKAQAD
FT                   RCLSCGNPYCEWKCPVHNYIPNWLKLANEGRIMEAADLAHQTNSLPEVCGRVCPQDRLC
FT                   EGSCTLNDEFGAVTIGNIERYISDKAIAMGWKPDMSHVHPTGKRVAVIGAGPAGLACAD
FT                   VLARNGVQAVVFDRHPEIGGLLTFGIPAFKLEKEVMIKRRKIFSEMGIEFQLNTEVGKD
FT                   ITMEALLKDYDAVFLGVGTYQSMRGGLENEEANGVYDALPFLIANTKQLMGYEATAHEP
FT                   YINMQGKRVVVLGGGDTAMDCVRSSIRQGATDVVCAYRRDEVNMPGSKREVKNAREEGV
FT                   EFKFNLQPLSIEVNSNGKVCGVRMVRTQLGAPDAQGRRMAEQIPGSEHVLPADAVVMAF
FT                   GFRPHSMEWLAAHDVKLDKQGRVIAPESTDNAFQTSNPKIFAGGDIVRGSDLVVTAIAE
FT                   GRKAADGIMNYLEV"
FT   gene            complement(377601..382058)
FT                   /locus_tag="YPDSF_0340"
FT   CDS_pept        complement(377601..382058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0340"
FT                   /product="glutamate synthase (NADPH) large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38759"
FT                   /protein_id="ABP38759.1"
FT                   /translation="MLYDQSQERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAI
FT                   LADGKTGDGCGLLLQKPDHFFRMVAEERGWRLAKNYAVGMMFLSQDEELAKASRRIVEE
FT                   ELQNETLSIVGWREVPTNPDVLGEIALSSLPRIEQIFVNAPAGWRSRDMERRLFVARRR
FT                   IEKRISDKDFYACSFSNLVTIYKGLCMPADLPRFYLDLADLRLESAICLFHQRFSTNTV
FT                   PRWPLAQPFRYLAHNGEINTIAGNRQWAKARAYKFKTPLIPDLQDAAPFVNETGSDSSS
FT                   LDNMLELFLSGGMDLIRAMRLLVPPAWQNNPDMDTDLRAFFDFNSMHMEPWDGPAGIVM
FT                   SDGRYAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKGRVGPGELMVID
FT                   TRSGKILHSAETDNDLKSRHPYKEWMEKNVKRLVPFEDLPEEQVGSRQLDDSQLETYQK
FT                   QFGYSNEELDQIIRVLGENGQEATGSMGDDTPFAVLSSGPRIIYDYFRQQFAQVTNPPI
FT                   DPLREAHVMSLATSIGREMNVFCEAEGQAHRLSFKSPILLYSDFQQLTTLEGEHYRADR
FT                   LDLTFNPAENDLEQAVLSLCDEAERKVRDGAVMLVLSDRAIAPNRLPVPAPMAVGAIQT
FT                   RLVDKSLRCDANIIVETASARDPHHFAVLLGFGATAIYPYLAYESLAKLVDSQAIDKKY
FT                   RDVMLNYRNGINKGLYKIMSKMGISTVASYRCAKLFEAVGLHRDLSDLCFQGVVSRIGG
FT                   ASFSDFQQDLQNLSKRAWLKRKPLDQGGLLKFVHNGEYHAYNPDVVSTLQKAVHSGEYS
FT                   DYQAYAKLVNERPIATLRDLLAIKPQGTPIPVDQVEPAESLFKRFDTAAMSIGALSPEA
FT                   HESLAIAMNSLGGFSNSGEGGEDPARYGTNKVSRIKQVASGRFGVTPAYLVNADVIQIK
FT                   VAQGAKPGEGGQLPGDKVTPYIAKLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQV
FT                   NPKAMISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLSSVKYAGCPWELGL
FT                   VETQQALVANGLRHKIRLQVDGGLKTGVDIVKAAILGAESFGFGTGPMVALGCKYLRIC
FT                   HLNNCATGVATQDEKLRRDHYHGLPERVVNYFHFIARETREIMAELGVSQLVDLIGRTD
FT                   MLLELDGISAKQNKLDLSPMLKTATPHPGKALYCTESNPPFDKGLLNKELLSQAEPYIE
FT                   AKQSKTFYFDIRNTDRSVGAALSGAIATKHGDQGLATDPIKAYFSGTAGQSFGVWNAGG
FT                   VELMLTGDANDYVGKGMAGGRIAVRPPVGSNFRSHEASIIGNTCLYGATGGKLFAAGRA
FT                   GERFAVRNSGAITVVEGIGDNGCEYMTGGIVCVLGRTGINFGAGMTGGFAYVLDEDGEF
FT                   RKRVNPELVEVLDVEQLAIHEEHLRGLITEHVQLTGSSRGEEILANWPEWVTKFALVKP
FT                   KSSDVKALLGHRSRSAAELRVQAQ"
FT   gene            382860..383804
FT                   /locus_tag="YPDSF_0341"
FT   CDS_pept        382860..383804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38760"
FT                   /protein_id="ABP38760.1"
FT                   /translation="MTGSAKIMQLQQLVNMFGADLQRRYGEKIHKLTLHGGFSCPNRDG
FT                   TLGRGGCTFCQVASFADEQMQQQSITQQLAIQAKKANRANRYLAYFQAYTSTYAEVNAL
FT                   AAMYQQALCEADIVGLCVGTRPDCVPDAVLDLLSSYQQQGYEVWLELGLQTANDKTLKR
FT                   INRGHDFACYQQTARRARARGLKVCCHLIVGLPGEDRAQGRETLEKVVTTGVDGIKLHP
FT                   LHIVEGSTMAKAWRAGRLTALALEDYVLTAGEMIRHTPAEVVYHRISASARRPTLLAPL
FT                   WCENRWTGMNELNNYLLQHGVQGTAIGDAYCYR"
FT   gene            384068..386404
FT                   /locus_tag="YPDSF_0342"
FT   CDS_pept        384068..386404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0342"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38761"
FT                   /protein_id="ABP38761.1"
FT                   /translation="MKQIRVLAQYYVDLMVKLGLVRFSLLLASALVLLAMVVQMAVTFV
FT                   LRGSVETLDLVRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSRLVDKLEVMRHRDLEL
FT                   NKQLTENITQLNQEIVEREKAEKAHLQVVDKLKEEMGHREQAQIELGQQSALLRSFLDA
FT                   SPDLVYYRNEDNEFSGCNRAMELLTGKSEKQLVGLTPKDVYAPDIAEKVMETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRVGKRHGLMGFGRDITERKRYQDALENASR
FT                   DKTTFISTISHELRTPLNGIVGLSRILLDTELDAEQLKYLKTIHVSAITLGNIFNDIIE
FT                   MDKLERRKVQLDNQPVDFTGFMADLENLSGLLVQPKGLKFIMEPQLPLPEKVIADGTRL
FT                   RQILWNLIGNAVKFTQQGKIVVRVRREGNDRLIFEVEDSGMGIPEDEQDKIFAMYYQVK
FT                   DRNGGRPATGTGIGLAVSKRLAQSMGGDITVKSTQGVGSCFTLTIKAPAVQEASNAPSG
FT                   DDMPLPALHVLLVEDIELNVIVARSVLEKLGNSVDVAMNGHDALAMFNPEDFDLVLLDI
FT                   QLPDMSGLDIARQIRAEYGKQSLPPLVALTANVLKDKKEYLDAGMDDVLSKPLSVPALT
FT                   AMIKQFWDSKPSSAVQKQEHKVMQTHESLLDTTMLEQYIDLVGPQLIHQSLEMFEQMMP
FT                   GYLAVLDSNMTARDQKGITEEAHKIKGAAGSVGLRHIQQLAQQIQTPTLPAWWDNVQDW
FT                   VDELKLEWRNDVQVLREWAAEVEKK"
FT   sig_peptide     384068..384193
FT                   /locus_tag="YPDSF_0342"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.902 at
FT                   residue 42"
FT   gene            386646..387206
FT                   /pseudo
FT                   /locus_tag="YPDSF_0343"
FT   gene            387188..387298
FT                   /pseudo
FT                   /locus_tag="YPDSF_0344"
FT   gene            387295..388020
FT                   /locus_tag="YPDSF_0345"
FT   CDS_pept        387295..388020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0345"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38762"
FT                   /db_xref="GOA:A4THK0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THK0"
FT                   /protein_id="ABP38762.1"
FT                   /translation="MISVRRGFSQLWYWGKRGVIGIIALWMAGILIFAFLPVPFSMVMI
FT                   ERQLGAWLTGDFAYVAHSDWVPMDEISPYMALAVMAAEDQKFPDHWGFDVGAIESALSH
FT                   NQRNQKRIRGASTLSQQTAKNVFLWDGRSWVRKGLEVGLTAGIELIWTKRRILTVYLNI
FT                   AEFGNGIFGVEAAARHFFNKPASKLSASEAALLAAVLPNPLRFKVNAPSGYVISRQQWI
FT                   LRQMHQLGGKTFLQENTLD"
FT   gene            complement(388227..388802)
FT                   /locus_tag="YPDSF_0346"
FT   CDS_pept        complement(388227..388802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38763"
FT                   /protein_id="ABP38763.1"
FT                   /translation="MKVGYIFAMLFSTLLLQGCVGAVVVGSAAVATKTATDPRTIGTQV
FT                   DDGTLEARVVNALSKDKEIKSQTRFVVTAYQGKVLLTGQTPSAELSNRAKQIASGVDGV
FT                   TEVYNEMRLGKPVDLSTASMDTWITTKVRSQLLTSDSVKSSNVKVTTENGEVFLLGLVT
FT                   QQEAQSAAQIASKVSGVKHVTTAFTIVK"
FT   sig_peptide     complement(388734..388802)
FT                   /locus_tag="YPDSF_0346"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.225 at
FT                   residue 23"
FT   gene            complement(388813..389403)
FT                   /locus_tag="YPDSF_0347"
FT   CDS_pept        complement(388813..389403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0347"
FT                   /product="DnaA-interacting protein DiaA"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38764"
FT                   /db_xref="GOA:A4THK2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR023070"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THK2"
FT                   /protein_id="ABP38764.1"
FT                   /translation="MLERIKGCFTESIQTQIAAAEALPDAISCAAMALVQSLLNGNKIL
FT                   CCGNGTSAANAQHFAASMINRFETERPSLPAIALNADNVVLTAITNDRLHDEVYAKQVR
FT                   ALGQAGDVLLAISTRGNSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQLDVEIRI
FT                   PSHRGARVQELHMLTVNCLCDLIDNTLFPHQND"
FT   gene            complement(389674..390027)
FT                   /locus_tag="YPDSF_0348"
FT   CDS_pept        complement(389674..390027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38765"
FT                   /db_xref="GOA:A4THK3"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THK3"
FT                   /protein_id="ABP38765.1"
FT                   /translation="MSQRDTGAHYENLARRHLERAGLVFQAANVAFRGGEIDLIMRDGD
FT                   AWVFVEVRFRRNDLFGGAAASITPRKQQRLHLAAAVWLAQRGASFATTSCRFDVVAITG
FT                   NQLEWLPNAFNTD"
FT   gene            complement(390111..392180)
FT                   /locus_tag="YPDSF_0349"
FT   CDS_pept        complement(390111..392180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38766"
FT                   /protein_id="ABP38766.1"
FT                   /translation="MQKLLLDRVDSLFHPNYRFNIEHLEKNITGYSMLSSTFVRSKAGL
FT                   VPVILAALILAACTGDAPQTPPPVNIQDEASANSDYYLQQLQQSSDDNKADWQLLAIRA
FT                   LLREAKVPQAAEQLSTLPANLSDTQRQEQQLLAAELLIAQKNTPAAADILAKLEATQLS
FT                   ANQKVRYYQAQIAANQDKATLPLIRAFIAQEPLLTDKAHQDNIDGTWQSLSQLTPQELN
FT                   TMVINADENVLQGWLDLLRVYQDNKQDPELLKAGIKDWQTRYPQNPAAKNLPTALTQIS
FT                   NFSQASTAKIALLLPLSGPAQVFADAIQQGFTAAQNGSAVTASVPVTPNVTESSPTDTA
FT                   AVVSDDTPATLPAPVPPPVVTNAQVKIYDTNTQPLAALLAQAQQDGATLVVGPLLKPEV
FT                   EQLSATPSTLNILALNQPEASNNSPNICYFALSPEDEARDAAHHLWEQQKRMPLLLVPR
FT                   GALGERIAKAFADEWQKQGGQTVLQQNFGSTTELKQSINSGAGIRLTGTPVSVSNVAAA
FT                   PASVTIAGLTIPAPPIDAPVVSTSSSGNIDAVYIIATPSELTLIKPMIDMATSSRSKPA
FT                   LFASSRSYQAGAGPDYRLEMEGIQFSDIPLMAGSNPALLQQASAKYANDYSLVRLYAMG
FT                   IDAWALANHFSEMRQIPGFQVKGVTGDLTASSDCVITRKLPWLQYRQGMVVPLA"
FT   gene            392147..393046
FT                   /locus_tag="YPDSF_0350"
FT   CDS_pept        392147..393046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0350"
FT                   /product="tetrapyrrole methylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38767"
FT                   /protein_id="ABP38767.1"
FT                   /translation="MNQHDRAVISASTLYVVPTPIGNLGDITHRALEVLKGVDLIAAED
FT                   TRHTGLLLQHFAINARLFALHDHNEQQKADQLLAKLQEGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGIRVVPLPGACAAITALSAAGLASDRFCYEGFLPAKTKGRKDTLQALIEEP
FT                   RTLIFYESTHRLLESLQDMVTVLGPQRYVVLARELTKTWESIHGAPVGELLAWVKEEET
FT                   RRRGEMVLIVEGHKVQSDDALPADALRTLALLQKELPLKKAAALAAEIHGVKKNALYKY
FT                   ALEQQQGDVETEEDDIQQ"
FT   gene            393066..393440
FT                   /gene="rnpB"
FT                   /locus_tag="YPDSF_R0007"
FT   misc_RNA        393066..393440
FT                   /gene="rnpB"
FT                   /locus_tag="YPDSF_R0007"
FT                   /product="RNA component of RNaseP"
FT   gene            complement(393983..394687)
FT                   /locus_tag="YPDSF_0351"
FT   CDS_pept        complement(393983..394687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38768"
FT                   /protein_id="ABP38768.1"
FT                   /translation="MITCRTAEQCGQADFGWLQARYTFSFGHYFDPTLLGYASLRVLNQ
FT                   EVLAPGAAFQPRTYPQVDILNLILQGEAEYRDSLGNHVHAKTGDALLFSPQQGVSYSEH
FT                   NLSANKSLTRIQLWLNACPERESAPTQHQRLSTRPVQLLASPAGEQGSLQLRQQMWIHH
FT                   LALAAGEQQKMPLHGHRAYLQSIHGTVDATGPQTGTSQRLTCGDGAFVEEEQHLVIKAI
FT                   TPLRALLIDLPV"
FT   gene            394949..395842
FT                   /locus_tag="YPDSF_0352"
FT   CDS_pept        394949..395842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0352"
FT                   /product="lysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38769"
FT                   /protein_id="ABP38769.1"
FT                   /translation="MARDRALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQKL
FT                   EEELDVVLFDRSGHRTKFTNVGRMLLERGRVLLEAADKLTTDAEALARGWETHITIVSE
FT                   ALSPAWKLFPLIDKLALKANTQVSILTEVLAGAWERLEQGRADIVIAPDMHFRASSEIN
FT                   SRKLYKVTSVYVASPDHPIHQEPEPLSELTRVKYRGIAVADTARERPVITVQLLDKQQR
FT                   LTVSTIEDKRRALLAGLGVATMPYEMVEKDIAAGRLRVIGPEYSREADIIMAWRRDSMG
FT                   EAKSWCLREIPKLLGK"
FT   gene            complement(395973..396959)
FT                   /locus_tag="YPDSF_0353"
FT   CDS_pept        complement(395973..396959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38770"
FT                   /protein_id="ABP38770.1"
FT                   /translation="MGQLINGVWKDVWYDTQSTGGHFKRSTAQFRNWVTTDGQAGPQGK
FT                   GGFNAEAHRYHLYVSLACPWAHRALLMRTLKGLESLISVSVVHPLMQENGWTFSSDFPA
FT                   ATGDALYHLDYLYQLYLRAAPDYSGRVTVPVLWDKQQQTVVSNESADIIRMFNNAFDDV
FT                   GAKAGDYYPTALRNDIDDINGWVYDQVNNGVYKAGFATTQEAYDEAVGTLFSALDRLEQ
FT                   ILGQHRYLTGNQLTEADLRLWTTLVRFDPVYVTHFKCDKRRISDYPNLYGFLRDIYQMP
FT                   GIAETVDFAHIRTHYYRSHGTINPYGIISIGPQQNLLEPHDRANRFV"
FT   gene            complement(397045..397440)
FT                   /locus_tag="YPDSF_0354"
FT   CDS_pept        complement(397045..397440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0354"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38771"
FT                   /protein_id="ABP38771.1"
FT                   /translation="MNKLQDTGLLVARILMPIIFIVAGYGKMGDAYAGTQQYMQAMGVP
FT                   GFFLPLTILLEFGGGLAILFGFLTRTTSLFIAGFTLLTAFIFHTDFTDSTNQLMFMKNL
FT                   SIAGGFLVLAMAGPGGFSIDRLLGKKW"
FT   gene            complement(397744..398028)
FT                   /locus_tag="YPDSF_0355"
FT   CDS_pept        complement(397744..398028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38772"
FT                   /protein_id="ABP38772.1"
FT                   /translation="MSRHQLALEKEALLREIQQQRLDLADSAARWVEVTAPFDRGWAQI
FT                   VSMRKYLIAGGSLVALYSVRHPSKLLRWSRRAVSTWSTLQLFRRTFLSR"
FT   gene            complement(398025..398420)
FT                   /locus_tag="YPDSF_0356"
FT   CDS_pept        complement(398025..398420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38773"
FT                   /protein_id="ABP38773.1"
FT                   /translation="MAEQPRTQGPAKGVLDTVHRIATIVVGIVETRVRLAVIELEEEKA
FT                   TLVQLLMMAGITLLLTAFGLMSLLVLVIWAIDPAYRLVALGTTTAVLLILALIGVIWTL
FT                   TKVRHSTLLGSTRKQLETDRELLEKDH"
FT   gene            complement(398423..398728)
FT                   /locus_tag="YPDSF_0357"
FT   CDS_pept        complement(398423..398728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0357"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38774"
FT                   /protein_id="ABP38774.1"
FT                   /translation="MPQDKTSEHLRAELKSLADTLEEVLQSSTDKPKAELDKLRAKAES
FT                   ALKDTRVRLSETSDKIAAQTKEIADKADNYVHDNPWTGVGIGAAVGVVLGVLLSRR"
FT   gene            complement(398733..398879)
FT                   /locus_tag="YPDSF_0358"
FT   CDS_pept        complement(398733..398879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38775"
FT                   /protein_id="ABP38775.1"
FT                   /translation="MLNAEFLLFFGFLCQKNIDNMVKFSKVLPINLIKNPLCYIFTSVM
FT                   LKE"
FT   gene            complement(398883..399263)
FT                   /locus_tag="YPDSF_0359"
FT   CDS_pept        complement(398883..399263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38776"
FT                   /protein_id="ABP38776.1"
FT                   /translation="MLLRRSLLLALPLITFCGFATAASDNECDIKAKEIQQQIDYAKQH
FT                   GNTRRAAGLETALKEVKTHCTEESLQAERQKKIRQKQHNVTERQQELKEAQQKGDAGKI
FT                   AKQQKKLAEAQAELQQAQSQQH"
FT   sig_peptide     complement(399195..399263)
FT                   /locus_tag="YPDSF_0359"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            complement(399489..399878)
FT                   /locus_tag="YPDSF_0360"
FT   CDS_pept        complement(399489..399878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0360"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38777"
FT                   /db_xref="GOA:A4THL5"
FT                   /db_xref="InterPro:IPR026574"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THL5"
FT                   /protein_id="ABP38777.1"
FT                   /translation="MINFRGRFGRPLWHYLVLPVVLLLLAVILLTPMIVQTESTLKIRP
FT                   NQQGLSLPDGFYLYQHLNGRGIHIKSIIPENDSLVVSLEFPEQQMQAIEVLQDVLPAGY
FT                   AIVASESKKRHRLLPVFRSNQQNLG"
FT   sig_peptide     complement(399765..399878)
FT                   /locus_tag="YPDSF_0360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.921 at
FT                   residue 38"
FT   gene            complement(399875..400573)
FT                   /locus_tag="YPDSF_0361"
FT   CDS_pept        complement(399875..400573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0361"
FT                   /product="DedA-family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38778"
FT                   /protein_id="ABP38778.1"
FT                   /translation="MDIIKELLHALWAQDYETLADPSLVWAIYLLLFVILFLENGLLPA
FT                   AFLPGDSLLILVGVLIAKGAMSFPVTLVVLTTAASLGCWVSYIQGRWLGNTKVVQGWLS
FT                   HLPAHYHQRAHNLFHRHGLSALLVGRFLAFVRTLLPTIAGLSGLDNARFQFFNWMSGLL
FT                   WVLILTTMGFAFGKTPVFLRYEDEVMFVLMLLPLALLVIGLFGSLYVLWRKKNATPAKV
FT                   SHDNKKGKSE"
FT   gene            complement(400851..401432)
FT                   /locus_tag="YPDSF_0362"
FT   CDS_pept        complement(400851..401432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0362"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38779"
FT                   /protein_id="ABP38779.1"
FT                   /translation="MATLFYLVALGAKRKYMRWLFALFITVSCWASLVSGNMLLPPHST
FT                   PSGAALSALSTVYSDNHCASYSLSSFHALSAKLRLQNQDVSPQLRLVGVSVKKTAIKNR
FT                   LSAAQFTGSANLSLLNNTWPAAYFAISRSHRADDIYKQPRQSLSLVNYSNWIFHAATQQ
FT                   NRVGGWKESNTQYSGMLTYHHYDAMVFMLA"
FT   gene            complement(401633..402427)
FT                   /locus_tag="YPDSF_0363"
FT   CDS_pept        complement(401633..402427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0363"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38780"
FT                   /protein_id="ABP38780.1"
FT                   /translation="MEFTETRRLYQQLAAELKRRIEAGVYPVGDKLPAERYISEEMNVS
FT                   RTVVREAIIMLEVEGYVEVRKGSGIHVMSNQQKHLVTNQGIEFDTAGPFELLQARQLIE
FT                   SNIAEFAATQVTRQDIVQLIEIQKHARQEDRFRDSQWDLKFHVQVALATQNTAMATIVE
FT                   KMWSQRTHNPYWIKLHEHIDDVSIESWCEDHDKILEALIRKDPHASKLAMWQHLENTKQ
FT                   MLFRATTDDFEFNVDRYLFTENPVVHLDNLMNNSKVPISSKN"
FT   gene            complement(402690..403232)
FT                   /pseudo
FT                   /locus_tag="YPDSF_0364"
FT   gene            complement(403245..403994)
FT                   /pseudo
FT                   /locus_tag="YPDSF_0365"
FT   gene            404739..406148
FT                   /locus_tag="YPDSF_0366"
FT   CDS_pept        404739..406148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0366"
FT                   /product="D-glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38781"
FT                   /db_xref="GOA:A4THL9"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THL9"
FT                   /protein_id="ABP38781.1"
FT                   /translation="MSQFLTEDFLLDTEFARRLYHDYAKDQPIFDYHCHLPPEQIAENY
FT                   RFKNMYDIWLKGDHYKWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWT
FT                   HLELRRPFGITGKLLSPATSEEIWQRGNELLAQDPFSARGIMQQMNVKMVGTTDDPIDD
FT                   LRHHKAIAADGSFNIKVLPSWRPDKAFNIEAAGFNDYMQRLEAAADTSISRFADLCVAL
FT                   NKRMDHFAAHGCKVSDHALDVVVYGEADETTLDAILARRLAGNQPSTEEIAQFKTAVLL
FT                   FLSGEYHRREWVQQYHIGALRNNNSRMFNLVGPDIGFDSINDQPLAQPLSRLLDAQGLR
FT                   NALPKTILYCLNPRDNEVIGTMVGNFQGEGEAGKMQFGSGWWFNDQKDGMQRQMTQLAQ
FT                   LGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVADGEAPADIALLGAMVKNICF
FT                   DNAQQYFAIEL"
FT   gene            406347..407798
FT                   /locus_tag="YPDSF_0367"
FT   CDS_pept        406347..407798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0367"
FT                   /product="tagaturonate reductase"
FT                   /EC_number="1.1.1.58"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38782"
FT                   /db_xref="GOA:A4THM0"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023668"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THM0"
FT                   /protein_id="ABP38782.1"
FT                   /translation="MQTLNRRDFPGRSHPDKIIQFGEGNFLRAFVDWQIDLLNEHTDLN
FT                   AGIVVIRPIDTDFPPSLSTQDGLYTAVIRGLNEQGEAVRESRLIRSVNREINIYRQFDD
FT                   YLALARDANIRFMFSNTTEAGIAWNEADQFSDAPPSSFPAKLTRLLFERFEHFDGAADK
FT                   GWVLLPCELIDYNGEALRELVLRYASHWQLPAAFTHWLTENNTFCSTLVDRIVTGYPRD
FT                   EVAALQTELGYQDSFLDTAEYFYLFVIQGPQGLAQELRLDQLDLNVRIVDDIKPYKERK
FT                   VAILNGAHTALVPVAYLSGLDTVGQTMDDAQISRFVEKTITEEIVPVLDLPEDELLSFS
FT                   QAVLSRFRNPFIQHQLLSIALNGMTKFRTRILPQLLTYQQQKGQLPPRLTFALAALIAF
FT                   YRGEREGQTYPLQDDAHWLERYSTLWNGVKHGDIALAELVNRVLSDANHWGQDLTAVPQ
FT                   LANQVTEQLQTILSRGMRAAVAAYS"
FT   gene            407809..409299
FT                   /locus_tag="YPDSF_0368"
FT   CDS_pept        407809..409299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0368"
FT                   /product="D-altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38783"
FT                   /protein_id="ABP38783.1"
FT                   /translation="MQNIIKIHPLDNVAVALQDLAADERIESGEFSVKLAQPVVRGHKF
FT                   ALTAIELGQMIVKYGLPIGHALTLIQPGEHIHSQNAKTNLSDLDEYEYQPEFSSLPPQM
FT                   ADRDVQIYRRPKGDVGIRNELWIIPTVGCVNGIARQIQQRFLKETQDAEGIDGVYLFSH
FT                   PFGCSQLGQDHENTRTMLQNMVRHPNAGAVLVIGLGCENNQVDVFQTTLGKVDEERVRF
FT                   MVCQQHDDEVEAGLEHLHALYQVMRHDRREPGQLSELKFGLECGGSDGLSGITANPLLG
FT                   RFSDYVITNGGTSVLTEVPEMFGAERILMSRCRDEATFEKTVSMVNDFKQYFIAHDQPI
FT                   YENPSPGNKAGGITTLEEKSLGCTQKAGQSQVVDVLKYGERLQRPGLNLLSAPGNDAVA
FT                   TSALAGAGCHMVLFSTGRGTPYGGFVPTVKLATNSELAAKKPHWIDFDAGKLIHGTSMD
FT                   TLLNEFVDLIVEIANGKPARNEVNDFRELAIFKSGVTL"
FT   gene            409452..409982
FT                   /locus_tag="YPDSF_0369"
FT   CDS_pept        409452..409982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0369"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38784"
FT                   /protein_id="ABP38784.1"
FT                   /translation="MTFYWFAQAVGVLAFFVGITMFFNRDERRFKQQLSVYSAIIGCHF
FT                   FLMGASAAGSSALLNSLRTLISTKTRSSRVMVVFIILTLALGIWRMQHAVEILPIFGTV
FT                   ISTWALFRTSGLTTRSVMWISTACWFIHNVWLGSIGGSLIEGSFLLLNGFNIIRFRRLQ
FT                   LQGIDPFEIEKKA"
FT   gene            complement(410100..410558)
FT                   /locus_tag="YPDSF_0370"
FT   CDS_pept        complement(410100..410558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0370"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38785"
FT                   /protein_id="ABP38785.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(410759..412078)
FT                   /locus_tag="YPDSF_0371"
FT   CDS_pept        complement(410759..412078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0371"
FT                   /product="symporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38786"
FT                   /db_xref="GOA:A4THM4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THM4"
FT                   /protein_id="ABP38786.1"
FT                   /translation="MKGINGQNILNFTWEEALLEAMEKTQSVFIRFIVNGSLVKQILIG
FT                   LVAGIVLALVSTPAAIAVGLLGSLFVGALKAVAPVLVLMLVIASIANHKKGQKTSIRPI
FT                   LFLYVLGTFSAALVAVVVSFIYPSTLILVAESADITPPSGIVEVLHGLLNSIIANPIHA
FT                   LLNANYIGILAWAVGLGIALRHAADTTKALINDMSDAVTLVVRVVIRFAPLGIFGLVAS
FT                   TIAATGFGALQLYAQLLVVLIGCMLLVALVVNPLIVYWKIRRNPYPLVFACLRESGVTA
FT                   FFTRSSAANIPVNMEMCKKMNLNEDTYSISIPLGATINMAGAAITITVLTLAAVHTLGI
FT                   TVDLPTALLLSVVAAICACGASGVAGGSLLLIPLACSMFGIPNDVAMQVVGVGFIIGVL
FT                   QDSAETALNSSTDVLFTAAVCQAEDAKLANPDPLAAGKSV"
FT   gene            complement(412550..413545)
FT                   /locus_tag="YPDSF_0372"
FT   CDS_pept        complement(412550..413545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0372"
FT                   /product="MocA-family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38787"
FT                   /protein_id="ABP38787.1"
FT                   /translation="MIRFAVIGTNWITARFVDAAHESGKMKLVAVYSRKLDQAQTFGDD
FT                   YHVTDCFDNLEALAASDLIDAVYIASPNALHYSQAKLFLSHKKHVICEKSLASNLAEVE
FT                   SLIACAHQHQVVLFEAFKTAYLPNFIQLQQALPRVGKLRKAFINFCQYSSRYQRYLNGE
FT                   NPNTFNPAFSNGSIMDIGYYCLASALALWGEPKSVWASASLLPSGVDAHGTVSLNYGDF
FT                   DVIIIHSKVSQSDIPSEIQGEDGSLVIESISECLSVAFTPRGSHSQDLTQPQHINTMLY
FT                   EAEAFARLVENNRVDHDGLHLSLLTSRIQTEIRRQTGVIFPADTQYPAAS"
FT   gene            complement(413763..414272)
FT                   /locus_tag="YPDSF_0373"
FT   CDS_pept        complement(413763..414272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38788"
FT                   /protein_id="ABP38788.1"
FT                   /translation="MSVLTYLQGYPEHLQTQVRQLITEQRLGNVLRQRYPQPHDYNTDK
FT                   TLYHYTIELKNQYLRNAQPLSKVAYDNKIQVMKHALGLHTAISRVQGGKLKSKAEIRVA
FT                   TVFKNAPEAFLKMIVVHELAHLKEKDHNKAFYNLCCHMEPQYHQLEFDTRLYLTHLDLF
FT                   GSIYAY"
FT   gene            complement(414511..417504)
FT                   /locus_tag="YPDSF_0374"
FT   CDS_pept        complement(414511..417504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0374"
FT                   /product="autotransporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38789"
FT                   /protein_id="ABP38789.1"
FT                   /translation="MKNSNRSPKNISRNFKHHKETSLSSKNKSPIATCVAAALFIFGSS
FT                   SVIANPDHEGIVVGKSILNKKQSAVNAIINEGNSLVLTDSASAEHTAVNTGSIFTLKED
FT                   STADITSVTGGFFSLSGSSKANINTVLSGGWLEVNDDASITETTISSDIEKKSTVRLYQ
FT                   DGSATKTTVGDNGILYVSGDSRAEETHVTKGGKLIVYSESQGPTLKNTQIAGTLTLKSD
FT                   VTLEGKTEFVSSATIKTTGHLIDNQGQLIFNSDKDIVIEAMIDGQGSLTKENPLTTLTL
FT                   SSAGDAWVASYVYSGETHINAGNLKLANTHFFGSPISGNPNTRLILEKSTLDTTVQGSS
FT                   VFIDKHSIWNMLGDSNIHHLDILDSGRHDLNNPGKTGNQLIINGDYFSDNGTLIFHSQL
FT                   AGDDSVTDHILIKGNTGGHTNVRVINVNGEGNKTDSGIQLIEVRGISDGEFSQVGRITA
FT                   GAYEYRLGRGKDELSKNWYLSSDITDYSSDGVPEAELPGILVLKSDNAAVFSAKLADYA
FT                   LQAVGGVVDSFTQPETSPPSNTPELTVPDPKRANAAAFSAKLADYALQTVGGVVDSFTQ
FT                   PETSPPSNTPELTVPDPKRANAEAFSAKLADYALQAVGGVVDTFTSPEQTEQTEQTTAT
FT                   PDSTPKSTDSAVKPASTPKPTDLAVKPANTVISNAKTAAPKRQTLVHTPENGSYIANIA
FT                   MARNLFTTRLEDRTSHYLYKDIVTGQWQPTSMWMHTQGGRSQFGHTVEQLNIKGNYYSV
FT                   QLGGDIAQWATNEQGSGRIGMLAGLGKATNHSHSKVTSYHSRGAVDGYNLGIYATWFAD
FT                   QQHNTGVYIDTLAQYSWFNNAVNGQDKAEEKYKSSGFTTSIESGYTFNLANSDQLSYFI
FT                   QPNAQITWAGINAQTHKTADGAVVSYRNNGHFITRIGAKAYLQTHDTLNTKFTPFVAVN
FT                   WIHQNQNTGTTISGQGIDNKIQNSTEFNVGVESQIDQQLHIWANINHQIGRYNYTDTNA
FT                   LVGVKYHF"
FT   sig_peptide     complement(417355..417504)
FT                   /locus_tag="YPDSF_0374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 50"
FT   gene            417973..419160
FT                   /locus_tag="YPDSF_0375"
FT   CDS_pept        417973..419160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0375"
FT                   /product="16S rRNA m(2)G 1207 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38790"
FT                   /db_xref="GOA:A4THM8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THM8"
FT                   /protein_id="ABP38790.1"
FT                   /translation="MSQLDLGTQSLELERFPPQENSNTLQAWEAADEYLLQNIDLSKID
FT                   GRPVLVFNDQFGTLACALHAYRPFSSSDSYMSQLATAHNLRLNHLDESAVTLLSSVDDL
FT                   PEAPKLVVIKIPKALALLEHQLRALRRVVAPDTVIIAGAKSRDVHNSTLQLFEKILGPT
FT                   KTTLAWKKARLIHCEVADIPLADAPETIDWPLPNTDYIIHNHANVFSRNNLDIGARFFM
FT                   EILPYDVTGKIADLGCGNGVVGLIALEQNPLAEMLFVDESYMAVASSELNITVNRPQDL
FT                   SRCEFMVSHGLAGVERESLQLVLCNPPFHQQHAVSDHVAWQMFCDAKRCLKAGGELMIV
FT                   GNRHLDYFHKLKRLFGNCETLDSNQKFMVLKSVKQASSRSEGGGSGSLDMSYSDF"
FT   gene            complement(419276..421297)
FT                   /locus_tag="YPDSF_0376"
FT   CDS_pept        complement(419276..421297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0376"
FT                   /product="2,4-dienoyl-CoA reductase"
FT                   /EC_number="1.3.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38791"
FT                   /protein_id="ABP38791.1"
FT                   /translation="MLAYPHLFTPLDLGFTTLKNRILMGSMHTGLEELPDGPQRLAAFY
FT                   AERAAGGVGLIVTGGIAPNMKGGVYQGASVLNDAAQIPHHQVVTEAVHQAGGKIALQIL
FT                   HAGRYSYQKHPVAPSALQAPINPFVPQALSHEEILQTIADFAHCAQLAKQAGYDGVEIM
FT                   GSEGYLINQFLTARTNQRDDEWGGDFTHRMRFAVEIVRAVRQATGHDFILIYRLSMLDL
FT                   VEEGSNWVEIEQLAQAVEQAGATVINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKV
FT                   NIPLITTNRINDPAVAEQVLADGCADMVSMARPFLADAAFVQKAAQGRADEINTCIGCN
FT                   QACLDQIFDGKLTSCLVNPRACRETEMPELPTDAPKRLAVVGAGPAGLAFAVTAARRGH
FT                   QVTLFDAAAEIGGQFNIAKQIPGKEEFYETLRYFRRQLVLNGVTLQLNTLVQVKQLAEF
FT                   DEVILACGIQPRLPCINGIDHPKVLTYLDVLRDKKPVGQRVAIIGAGGIGFDTAEYLSQ
FT                   SGDSPRFDSTAFSTEWGIDQDLAHRGGLSPAGAKVPPSPRQIFLLQRKASKVGEGLGKT
FT                   TGWIHRTSLAMRGVKMLNSVSYEAIDDKGLHIIRAEQACCLPVDTIIICAGQEPRRELH
FT                   QPLLDMGKTVYLIGGADKAVELDARRAIDQGTRLALAI"
FT   gene            complement(421510..422079)
FT                   /locus_tag="YPDSF_0377"
FT   CDS_pept        complement(421510..422079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0377"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38792"
FT                   /protein_id="ABP38792.1"
FT                   /translation="MLNIDQKYLTNLDESALKKQRIFMRIVAVLLLLGGIFCLINPLAS
FT                   GAALSMVIGILLLLSGIAMIVGMIANRSDNFWPMVAGILLGVAYIVMGYVFITNPAIGM
FT                   ISLAVVLAVLFAFGGVLRLINGFKDLKRPGAWLQILLGVLDLVITYLLVSAGPLMSITM
FT                   VTTLVGIEMLFSSFSCFMVASLFKRS"
FT   sig_peptide     complement(421939..422079)
FT                   /locus_tag="YPDSF_0377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.504 at
FT                   residue 47"
FT   gene            complement(422470..423969)
FT                   /locus_tag="YPDSF_0378"
FT   CDS_pept        complement(422470..423969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0378"
FT                   /product="kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38793"
FT                   /protein_id="ABP38793.1"
FT                   /translation="MANIVTCTTKDGETIQYVDEIIGSGSMKDVYFSPDKSYVVAFYKK
FT                   PQNDQAKERIDMITGRYRQNIFEQSGGEYWKDLFCWPTHVVEHNGKIGIVVPTYQNHFF
FT                   FKYGSKNNDFLGIKGREKEGKWFASANNQNKFLDPRERGNILNYLKVCLLLTRAVRRMH
FT                   AAGLCHSDLSYKNVLIDPEQGHACIIDVDGLVVPGKFPPDVVGTPDFIAPEVVKTSHLL
FT                   KEDPQRILPNITTDRHALSVLIYMYLFYRHPLRGGKIHDMDDEVRDESLAMGERALFIE
FT                   HPTDRSNAVKLNQVKPSSLPWADPQKVPYTIMGPYLTQLFEKAFIDGLHDPSKRPTADE
FT                   WETALVKTVDLIQPCQNTACEQKWYVFSGKTKPVCPYCGTAFKGKLPILNLYSSRKAGS
FT                   YRPDDHRLMVWNGQSLYAWHVNRLIAPNERTSEAQKKRVGYFVFHNDQWWLVNEGITGL
FT                   MSLPDKKTIGIGEKLALTDGAQLVLSTEEGGRLVVVQLVAN"
FT   gene            complement(424001..425734)
FT                   /locus_tag="YPDSF_0379"
FT   CDS_pept        complement(424001..425734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38794"
FT                   /protein_id="ABP38794.1"
FT                   /translation="MDINDNLHQDDLRQDDVYQKVLRLLLDEAGIVLPETELVALKQDT
FT                   AIRSLLNDLLASVSAKAEHLALANNETAIDDRQPLVSLSEEKSHEVIGSEENIVKEPDQ
FT                   HNERLLLAETLSAKTLEPNPPADVLPPIEIHHKVPVEEESWQAMLFSPIEQHANTASSA
FT                   AGTKLLRPGQIPVGMPNPANCPPQYTQPKAKINIANARVGTPFHSDVDISLDNGAKAEI
FT                   LDLSFAKDIGLIFDQATSSLSGTPTESGDIEATVTWSCHSAPYFSTKVLFIVNPDPRSL
FT                   WKILEPPADDHYFKENVDHKLISAPGVNIAAASRRGRSHEHVGSFRDDDFFISSNHDTG
FT                   WNIMLVADGAGSAKNSRKGSQIVTETVGHYLSAQLSGDKGRELKERIINWPPEDQRVVG
FT                   ETFIRQFHHASVIAINNIKNESLIAEETVKSYSTTLLATVSFRTGTELFAAAFWMGDGA
FT                   IAAYGPVGRVRILGTPDSGEYAGQTRFLDVDAVGDPEFSKRVSIGKWTGISHLVLMTDG
FT                   VSDPRFETDNGLQNPQKWDALIAEISPCLNDNPQAAEQLAEWLNFFSPGNHDDRTMVVS
FT                   W"
FT   gene            complement(425734..426363)
FT                   /locus_tag="YPDSF_0380"
FT   CDS_pept        complement(425734..426363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38795"
FT                   /protein_id="ABP38795.1"
FT                   /translation="MNLIAIGLGPSADLNILRQLTENVLLFNDTQEGDFTQFIKWITAS
FT                   VSAHSRSVGEESPPLLNQTDYIVKLAKDDVARAYDENCVTLIGRCSKSRRPYIIKYERP
FT                   AVNLSSLNFKLNINGFNLAGCLPIDEDYFAWSDESVSSQQVNTSELHGTPGCPHCGNGS
FT                   AFAMCNCGKLLCINGADDVICPWCDRGLTFNVDGGGSDFDVIRGRG"
FT   gene            complement(426393..426773)
FT                   /locus_tag="YPDSF_0381"
FT   CDS_pept        complement(426393..426773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0381"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38796"
FT                   /protein_id="ABP38796.1"
FT                   /translation="MRRLPIFFVLDCSESMIGENLKKMNDGLQMIINDLKKDPHALETA
FT                   WISVIAFAGVAKTIVPLVEVVSFYPPRLPIGGGTSLGAALQELTRQIDTQVRKTTEERK
FT                   GDWKPVVYLLTDGRQRMIPPPR"
FT   gene            complement(426875..427576)
FT                   /locus_tag="YPDSF_0382"
FT   CDS_pept        complement(426875..427576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38797"
FT                   /protein_id="ABP38797.1"
FT                   /translation="MPLVSLLILTPLSLILRTTSDMRRLPVYLLIDTSGSMRGESIHAV
FT                   NVGIQAMMSALRQDPYALESVHLSIITYDNQAREYIPLTALENFQFTDITVPSAGGTFT
FT                   GAALECLIHCVDRDIQRSDGDQKGDWRPLVFLMTDSTPSDVYAYGEAIKEVKKRAFGSI
FT                   IACAVGAKAKHEHLKQLTSQVVALETLDSTAFSGFFKWVSASVAAGSSSAGINTGQDNL
FT                   PPPPPEIQLVL"
FT   gene            complement(427515..428156)
FT                   /locus_tag="YPDSF_0383"
FT   CDS_pept        complement(427515..428156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0383"
FT                   /product="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38798"
FT                   /protein_id="ABP38798.1"
FT                   /translation="MSVSLHKGQGVSLRKNEYDLSSVTIGLGWDINEEKKGILGSLFGK
FT                   KEEEYDLDVIAFLCNAQGKVTDLGNVENGKPSLVNGDIIFFNSLRHKSGQIWLTGDNRT
FT                   GAGDGDDEQIIVKLNTLDPKYEKIVFIVQIYNGSKLQQHFGKVQNAFIRAVDAKNIEMA
FT                   RFNLSGGPAFNQQCSMLFAELVRESTGWKLNAIGEPSDSDTFVTHLKNYL"
FT   gene            complement(428189..428827)
FT                   /locus_tag="YPDSF_0384"
FT   CDS_pept        complement(428189..428827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0384"
FT                   /product="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38799"
FT                   /protein_id="ABP38799.1"
FT                   /translation="MRRLPVYLLLDTSGSMTGEPIEAVKNGVQMLLSTLRQDPYALETA
FT                   YVSVITFDSSARQAVPLTDLLNFKLPELVANGTTALGDALSLTAKCIGNEVQKTTADTK
FT                   GDWRPLVFIMTDGSPTDDWRKGLSDFKAARTGVVVACAAGHAVETKVLQEITEIVLQLD
FT                   TADSSSIKAFFKWVSASISVGSQKVESGKKEVIGLDDLPPPPPEVNVVL"
FT   gene            429542..431230
FT                   /locus_tag="YPDSF_0385"
FT   CDS_pept        429542..431230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0385"
FT                   /product="hemolysin activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38800"
FT                   /protein_id="ABP38800.1"
FT                   /translation="MSRFYYSILVAGVLLKIVAIPDASYGAELAPVQQSIHQQERQRAL
FT                   EERLAPPTPDVRLSAPSAFFSRIIFPLETPCFVINRIKISGAEPLPRWLPLQRIADQAQ
FT                   GQCLGAKGINLLMSQMQNRLVDHGYVTTRVLAPQQDLNSGTLALNVVPGKIRGVELTPD
FT                   SNRYVTLFSAFPARAGTLLDLRDIEQGLENLQRVPTVQANMVLIPGSAPGETDIILNWQ
FT                   QRKMWRLAASLDDSGTRSTGRYQGGATLFLDNPLSLSDLFYVSAGGALQRRGDKGTNNL
FT                   TGHYSLPFGYWTAGMTASRYDYYQAVAGLNGDINYRGESENVAFQLSRLLHRNASQKTT
FT                   FTYDVLTRSSKNYINDTEVEVQRRRTSAWRIGLQHRHFISQAILDAGISYQRGTRWFGA
FT                   IPAQEEYFGEATALSKILRLNAQLDIPFVVMAQNLHYNLQYQRQSTNTPLTPQDQFSIG
FT                   GRWSVRGFNGERTLIADRGWWVRNDIGWYLPLPGHELYVGVDYGEVGGRSGAYLLGRHL
FT                   AGSAVGVRGNVLNTRYDLFAGKPLSKPNGFKTDSLAVGFNLNWLY"
FT   gene            431275..441162
FT                   /locus_tag="YPDSF_0386"
FT   CDS_pept        431275..441162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0386"
FT                   /product="adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38801"
FT                   /protein_id="ABP38801.1"
FT                   /translation="MNKNLYRIVFNQARGMLMVVADIAASGRAASSPSSGVGHTQRRRV
FT                   SALSPLSFRLLIALGCISLSAQAAIVADGSAPGNQQPTIISSANGTPQVNIQTPSSGGV
FT                   SRNAYRQFDVDNRGVILNNGRGVNQTQIAGLVDGNPWLARGEASVILNEVNSRDPSQLN
FT                   GYIEVAGRKAQVVIANPAGITCEGCGFINANRATLTTGQAQLNNGQLTGYDVERGEIVI
FT                   QGKGLDSRGQDHTDLIARSVKVNAGIWANELNITTGRNQVDAAHQNINTNAADGRHRPA
FT                   VAVDVANLGGMYAGKIRLIGTETGVGVHNAGEIGASAGDIVITADGMLVNRGQISSAQQ
FT                   LAVNTPSGIENSGVLYGKGNTQLTTAGKLSNSGTVAAAGDTLIRAAEVNSSRNSVLGAG
FT                   IKSDNSAITRGTLDIKARGQLTAQGKNISGTAQTFNANRIDLSGSQTQSGDLTFTTEGG
FT                   DIDLTGANLFANRRLSVSTPSLLRTDKANLFAEQIALDAQALANVGGVITQTGLTDFNL
FT                   NLPGDIDNRDGTLLTRGNFLLQAEHLTSNSQSLLGAGIQSDGKLAPRGDLNVTTRHALI
FT                   AQGKTLTAGTLALSGSRLDLTDSLTQAKYMRLTATEGDIALTGATVMAANTLFADTRQI
FT                   LRSDKAYLTADQINLTAYSLSNVEGRVVQKGSGDFRLDLPGYLDNRGGVLLTKGNLALQ
FT                   AERLTSNSQSLLGAGIQADGSKASKGDLQANTTQALIAQGQNVAAGTMTLSGSRVDLTG
FT                   SQTHASNITITARDGDVTTREATLITPGTLSMTAVANPEQTLNNRGGKLHADNIQLNLA
FT                   KLENSNGEIAAATDLWLRLQSDFIHQAGARLTAGRDLLFNSRGALINQYKLEAGRDMQL
FT                   TALSIRNTSADRNTNADNSSLLAGRGLSLSTDSLFNRGAIYTTGVGQFTVNGNTENIGE
FT                   IYTEQQLTFTATGNLANRGVMQTRGEMQLSAQGDVNNSGMLYSAGDQMRLSIAGNLTNE
FT                   GKLHVANGEMRLLTEGNLDNRGSLYGAGNSDITTQGNAVNTGSVYTQGALQWLTKGSVR
FT                   NSASIAALGDLQLRANDLLSDNQSLMAAGLKADGSRSDSGNLAVSTEQALIAQGQNIAA
FT                   GSLALAGSQIDLTGSQTQANAISLTAKSGDITLTSAVIKAATQLLVTQLAATRSSFIPP
FT                   SSIPPSSTQSSSTQASASPSAWLRTDKASLIADQLTFDVQALSNLGGVIAQTGATDFNL
FT                   NLPGYLDNRGGTILSKGNVAIQAQGLDSDSGSLLGAGVQSDGKLTNAGDLAVTVRQDLI
FT                   AHGQSLAAGAMTLTGSGVDLTGSQTQARGITITANKGDVSTQRANILSLGSLAINAGAN
FT                   AGQTLNNQGGSLQANNIALNLGQLDNRTGKIAASQDLVLGLQSDFNILADSTLQAGRDF
FT                   SFTTHGALTNDGQLLAGRKLSTRSNSLLNNGNIRAVQADLRASGALTNRGEILTRGGLS
FT                   TDANTLFNSGTLIGATATLNARERITNSGPNALIGATDKNGTLALLAPVIENSDTVTRT
FT                   DTAPTTTLLGMGKVILAGGQDNSGNYSSAAQVLNLSGLIESGNDLLVYAKTLTNRRQIL
FT                   TATTDFIVGDTETGAAYWTAENPDIPGGRYTQPPAGGPMNSDYIGTNYTSTVAYNRIDQ
FT                   ISPEAQLLAGGNLTLQVGTLENNWSKVSAQGVIDLTGVTLQQDDWGSQQRLVEQTTSSG
FT                   EYRYRTYKGKLWGIAWGPEMKLRLNNQYASSITAKTLTGSGTVINNTVINNGAAPGAIV
FT                   APRDRDSTGKNIAVEFNGIALTLPRSGLYQLKTDKGDYAPGPEAALSLANISPPSSLDA
FT                   TGQRGVPPPSDDLNRTGLVTPDRAVSGGYLVETHPAFASLNNWKGSDLYLQQLSSDPSV
FT                   IHKRLGDNAYEQRLLRDQVLALTGRTVASDYRSEQAQFEQLFAAGVQYSKAFNLAPGTR
FT                   LSAEQMATLTGNIVLMENRDVAGQTVLVPVVYLAGVKPGDLRANGALIAAENISLTEVQ
FT                   GFANAGAISASNNLQISMAKDITLNNRCGLLQAGNHLQLSTLNSDIDLTSARLNATNLQ
FT                   LDSGRDVILRTASDQYSSGNGAVQRTQTILGPLASLNISNNAVITAQRDFIQQGAGINI
FT                   GKDLQVNTGGDWLLSTVQRSDQISAQYGGGSATSGSLRHLGSEVKVGGALSANVDNLTA
FT                   VGARVNAGTIDVRAQNITLSAATDSLSVTGGSSSKRHTSSVNLYDETLLGSQLNATGDI
FT                   NLQTVNDITLSASAVQTDGALKLAAGGDVTLTSQTEQHDEQRNHTGTKKGLLSSTTTRS
FT                   EEGRSQTLAVGSMLSAGSIDVSSQNIAVAGSSVVADKDIRLRAQENLTVSTAQQSESGS
FT                   QLFEQKKSGLMSTGGIGVFIGTSRQKTTDQTQTVSHVGSTVGSLTGNVRLEAGNQLTLH
FT                   GSDVVAGKDLALTGADVAISAAENSRSQQYTAESKQRGLTVALSGPVGSAVNTAVTTAK
FT                   AAREENTGRLAGLQGVKAALSGVQAVQAGQLVQAQGGGITEMVGVSVSLGSQKSSSQQQ
FT                   QEQTQVSGSALTAGNNLSIKASGSDILIAGSQLKAGGDTRLDAARDVQLLGAANRQKTD
FT                   GSNSSRGGSVGVSVGGSGLSVFANANKGQGNERGDGTFWTETTVDSGGMFSLRSGRDTA
FT                   LTGAQVSAETVKADVGRNLTLQSQQDRDNYDAKQSRASGGISVPVAGGGAAVNLSMSRD
FT                   RLSSQYDSVQAQTGIFAGSGGVDIRVGEHTQLDGAVIASTAAADKNTLDTGTLGFSDIK
FT                   NKAVFTVEHQGGSLSTGGPVGSDLLSNLGGMVLAGLGNGGYAEGTTQAAVSEGTITVRD
FT                   TENQQQNVDDLSRDTGNANGSIGPIFDKEKEQNRLKEVQLIGEIGGQALDIASTQGKII
FT                   ATHAANDKMKAVKPEDIAAAEKQWEKAHPGKAATAEDINQQIYQTAYNQAFNESGFGTG
FT                   GPVQRGMQAATAAVQGLAGGNMGAALTGASAPYLAGVIKQSTGDNPAANTMAHAVLGAV
FT                   TAYASGNNALAGAAGAATAELMAPTIISALGWDKNTLTEGQKQAVSALSTLAAGLAGGL
FT                   TGDSTADALAGGQAGKNAVENNLLGGNEFTHTQFVQKHGADVLSCADNPSNAACQRGIA
FT                   ENKAYIAALATGSVALLPGSSQAMWALGAGTNAGMQYADNGKINPVNSVAAGWINVITM
FT                   GQGWKGTIAWNAAGGALINAINGGDPLTGAITNGTGAGFGYGVGNYVVKPAANTLGKWI
FT                   TGGWNPKFDPNLLKYAEVKGQLGISKEMLPSKIPSAVGNAGGSLSSEFGSSLIQQKKDA
FT                   MEDSK"
FT   gene            441454..441603
FT                   /locus_tag="YPDSF_0387"
FT   CDS_pept        441454..441603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38802"
FT                   /protein_id="ABP38802.1"
FT                   /translation="MNFGKEYGLSLFVSSNKSQGNDRGDGTFWTETQLNSGGTLSLKSG
FT                   RDLL"
FT   gene            441658..441885
FT                   /locus_tag="YPDSF_0388"
FT   CDS_pept        441658..441885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38803"
FT                   /protein_id="ABP38803.1"
FT                   /translation="MSMVVVGSGGSANLSMSRDQLRSNFDSVQEQTEKNAVENNFLSAT
FT                   KNEKLMKALNDQKEDKTLACYTRKNCSRFR"
FT   gene            442430..443185
FT                   /locus_tag="YPDSF_0389"
FT   CDS_pept        442430..443185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0389"
FT                   /product="hemagglutinin/hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38804"
FT                   /protein_id="ABP38804.1"
FT                   /translation="MRRTYKGKLWGIAWGPEMKLRPNNQYASSITAKTLTGSGTVINNT
FT                   VINNGTAPGAIVAPRDRDSTGKNIAVEFNGIALTLPRSGLYQLKTDKGDYAPGPEAALS
FT                   LANISPPSSLDATGPRGVPPPSDDLNRTGLVTPDRAVSGGYLVETHPAFASLNNWKGSD
FT                   LYLQQLSSDPSVIHKRLGDNAYEQRLLRDQVLALTGRTVASDYRSEQAQFEQLFAAGVQ
FT                   YRKAFNLAPGTRLSAEQMATLTGNIVLME"
FT   gene            443249..443413
FT                   /locus_tag="YPDSF_0390"
FT   CDS_pept        443249..443413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38805"
FT                   /protein_id="ABP38805.1"
FT                   /translation="MGARVNAGTIDVQAQNITLSAATDSLSVTGGSSSKRHTAALNLYC
FT                   TPPKFRLAA"
FT   gene            complement(443681..445966)
FT                   /locus_tag="YPDSF_0391"
FT   CDS_pept        complement(443681..445966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0391"
FT                   /product="autotransporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38806"
FT                   /protein_id="ABP38806.1"
FT                   /translation="MNNHKIWRLSAVAVALLISGNSYADQTLHFAQQPHNTGDHTVIAA
FT                   PEVNNFSLADLTANAEGQAVDATNAGALSLRVEPTQGDAQANGVLVTSGTFTNQAQGSI
FT                   TVSASSQDQHAVASGLQATDAYWSTLRNQGSIRATSNSLHGSAEVYGIQAGLAFSDAAG
FT                   DHYGDHMMLSNEGVMQVSATAEQDAFASGIYTNAGNGVVNNGRLDVSAHASAGDARATG
FT                   LHTLSANPGVDPDPWNPANPTHLMSNNGSLSVTASGNNATASAISTEGEGVYIYNNGTL
FT                   IVDAFSESAQGGASAYGIHVLNGSATINSSGRILATATGGSQQQAYEVMADGSVVNIER
FT                   YTLALGNETPWAVSNGGSIVLGNGTQGADLVLMAGQASEGFAYGKEYSLDNLAYDTTSG
FT                   QQSTVGGSIAGLYGITPDIKVIHSGSSSSSLGSAALVYAPDVSHAGVSALAQRSSMEQA
FT                   SNIISSQLHSQLVSNAGCNQKLESADSCVFITPYAGEYRRDPVTSGYSGQRYGVLLGQN
FT                   QHFGDFQLGWHGGYESASTDFNGTSVGRKEEINTLMLGVQGGMKLSESLFIAATSTWFS
FT                   SDTDYSDSNTYYGVGSQNGSYDSSGLYTDVSVGNSWQLNRNYAMTPMVGLTHIWQQRDG
FT                   YTVSSNNKNYDLIDTRYSSYSDHAVALHAGVRLDGRYPLTNETLLKPFFNVGFQQMLYG
FT                   DEITIDQSIPNSPVVGVSTKDKTTQGTFDLGMALVSDNGVSASLQLSGMVNSDRQDFTG
FT                   WANLGWAF"
FT   sig_peptide     complement(445892..445966)
FT                   /locus_tag="YPDSF_0391"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(446026..447021)
FT                   /locus_tag="YPDSF_0392"
FT   CDS_pept        complement(446026..447021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38807"
FT                   /protein_id="ABP38807.1"
FT                   /translation="MKRLLLSALLITPGTLLAADAQELPLLSGGDAPTIKNSNLDLFGV
FT                   SRDFGDIIFIDDDRTVNDSAPKRTRVFTGYEYENIKFSNHPAQLYSTLVFADGSTKITD
FT                   SFSMGYVLRETTIYDGPRNNAFAGSDKSRRDSFMEIQLLPKYINWVNENLSYGAELGYE
FT                   RFTDAKDAPEKQMYHIRPEINLGFGRNFLHLNAELGWIDRTDRGAYIETEPLYLYRVTD
FT                   NFNIGAKAYYHAEDNDYRWRETAIRPLIQYRFANSTYLELRWEIGGIRTHDGSGYNYNN
FT                   YGLYTEIPFNPTISFMADLQYKDQKQHRGNEWSWGDKEDIFAKVGFILNF"
FT   sig_peptide     complement(446965..447021)
FT                   /locus_tag="YPDSF_0392"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 19"
FT   gene            complement(447123..448502)
FT                   /locus_tag="YPDSF_0393"
FT   CDS_pept        complement(447123..448502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0393"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38808"
FT                   /protein_id="ABP38808.1"
FT                   /translation="MINKRKIVLAAILLTVNGGLFAQSVVIDQLKVSEHLYPKGFESEF
FT                   QNNLDFYRDGVGVDEKAKVPYDTIRIEGTEIVKGYYTNTTEVGLYLNILTESVKAGNLQ
FT                   ALQRIKETLTTLEQAPKWNGLFYWPYDIRDGKLVTNPDEIVPAVDNGNLSFALAGVAGA
FT                   FLDSSDADKQEIVQRIEAILDGQKPGWAALYDENKGLLSSGWSTKNNASLGYFVDRKGN
FT                   ESRAAVAWAVLATKDMGAKALPVSAFSKMELYTQRYEINGKQYNPLLTWDGAYFQMMMP
FT                   QIWLNERELMPNYGIVEDHTFIQKVYASKHGIPMVSSSATTDNAYHAFGVPQLSESKVR
FT                   FKNKIDDGYTGTPHAIALSYIVDPAGAISALKKLKQAYPNIESPYGWYDAVDSSGKISK
FT                   NILSLDVGMFVGAFLAKEINADVEKYLQSKGDMELLKEMYQSYVPNNYKPLDGLSSSSL
FT                   H"
FT   sig_peptide     complement(448434..448502)
FT                   /locus_tag="YPDSF_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 23"
FT   gene            448840..449943
FT                   /locus_tag="YPDSF_0394"
FT   CDS_pept        448840..449943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0394"
FT                   /product="transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38809"
FT                   /protein_id="ABP38809.1"
FT                   /translation="MLHNVNKIYPNGMQVLHDINLDIKDGEFMVIVGPSGCAKSTMLRM
FT                   IAGLEEISSGELTIADRKCNDVQPKDRGIAMVFQNYALYPHMTVYENMAFGLKVAKKTK
FT                   AEIAQRVNEAAELLEITDLLQRKPKEMSGGQCQRVALGRAMVRKPAVFLFDEPLSNLDA
FT                   KLRVSMRLRISKLHQQLRESGRPATMIYVTHDQVEAMTMGERVCILRKGKIMQVDRPMN
FT                   VYRHPLNKFVAEFVGSPAMNMFSGRIEEYQEQLVIRCGEYRFPLPADKVAKSRSYLGRE
FT                   IDFGIRPEDISISRADVANALTATVIRVDAMGSDEFIYFNLMGQQAICKRPNPEDEIQI
FT                   NETCHFSFNLDKCHLFDKESEKNILYI"
FT   gene            450026..453379
FT                   /locus_tag="YPDSF_0395"
FT   CDS_pept        450026..453379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38810"
FT                   /protein_id="ABP38810.1"
FT                   /translation="MITKSITNVVHSAQGGVLQFNFMQGNMLKNMLAGDIMLNLFDTPR
FT                   LDMAIANIFLRQLDDSGIVRVTPLLFHNDQLVIYKNAQDEIIWQTTAPDFTAFVTLSFS
FT                   HEQEETYYYSVRVENHSAQALRYDLIYGQDLSLSDAGATKTNESYCSQYLDHKVFSLDK
FT                   YGYTVSSRQNLPQSTGNPLLQLGSFSPAVGFSTDGYQFFAKQYKFSHLPTIVTEPSLEN
FT                   RNYQYEMAYVALQLQPVTLSAGDSADSVFYGFYLSHQPEANIAQAFDVARIRANYRQPQ
FT                   REPATEQASPTQQGYDQRPLSGDKLTAEEIEQLFDGEKQFVEQLDGELLSFFYQEANYV
FT                   TLAEKERHLERPTGHIISSGNNIDFTNPIMNSTHYIYGVFNSHLTLGNTSFNKLLGVNR
FT                   NMLNQFKSSGQRILVQIGGEYRILAMPSAYEVGANFSRWIYKLAEGMIQVRAFASQSEP
FT                   VIQLDIAVSGHSQPLNVIVSHQLIMGNLEEEATVQVERHGDLLQISRTGDDHGPRFSIA
FT                   TRGGFTGVERYVDSDSQGVQYLLLQGQIAQQASIAFGGVLNGVDSRGKWLDFEHERQAY
FT                   HAQYRALLNDFSVSFSAAPQQAQKLNHAMHWFTHNALTHYSSPHGLEQPAGAAWGTRDV
FT                   SQGPIEFFMAMGRYQQVEAILCQTYRHQYLETGTWPQWFMFDEYAQVQQQESHGDIVVW
FT                   PLKALADYLLATDRVALLDTRLSYTSIKQNFAFTGEQETLLQHVQRQIDHIVAHLVPGT
FT                   YLSSYGDGDWDDTLQPANQSLRENMVSGWTIPLTLQTLKTLTKALQAYPQFADFIARIV
FT                   TLTSNMEADYHKYLIKDGVISGFIHFNQGEAEYLLHPTDTTTQIKYRLLPAKRSIISES
FT                   FDKEMAEQHMKIIMDNLMYPDGVRLMDRMAEYKAGKQTYFKRAELSANLGREIGLQYCH
FT                   AHIRFIEALCKMGMAQELYDNLFKTIPVGIQESVPNAELRQANSYFSSSDAKFDDRYQA
FT                   YNNFDQLKTGAVAAKAGWRIYSSGPGIYINQIVSNVLGVRYQAGDLLLDPVISRQFGDV
FT                   TLNYQLYNLPVTLRIYPQQGEFTPKRVLLDGQSLAFTLQDNPYRSGAALIHRQEIEGRL
FT                   TAHSQLEIYL"
FT   gene            453488..454474
FT                   /locus_tag="YPDSF_0396"
FT   CDS_pept        453488..454474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0396"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38811"
FT                   /protein_id="ABP38811.1"
FT                   /translation="MSVTIKDVAKRAKVSISTVSYAINGSPKITEETRLRVLKIAQEMN
FT                   YTANNNAKMLKAKKSGAIGLFFNSWFGPVYSELVRGIEERVHREHYDLVACSLYGGEQS
FT                   TAHKYLRDRSVDGAIILTSSFDDRFLQSVASDVLPIVVLDRELKSPHIYNVLIDNFGGA
FT                   FKAVNALLAKGCRDIYFFSGPEQSYDNQKRLDGFIAALGYHNIQLNRDFIIHSNFTEAD
FT                   AYLKMQALIAAGRVPSAIFSANDEMAIGILRAAKEHNIRVPDDLKVVGFDNIYASSVLT
FT                   PSLTTINHHKYEMGVISANTLLRAIKEETNIDAVTLLPTELIERETL"
FT   gene            454551..455795
FT                   /locus_tag="YPDSF_0397"
FT   CDS_pept        454551..455795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0397"
FT                   /product="sugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38812"
FT                   /protein_id="ABP38812.1"
FT                   /translation="MKILYYIAIAIASLPLMAAERLEIMVPSGSYVSFMRNTVTPEFNK
FT                   LYPEVNLVVSNDEQLDTRMAAGDNPNVYIGVFGYQPAKLAKLGKLAYLDKFPGFAELNE
FT                   RIDPHFLRENFGRTYYIPWNATTQMMIYNKELFAEAGLDPERPPATWDEFLLAAEKISA
FT                   LPPRSDGSKVYGTVFWNDVLSFGSWYWNLLAPMYYNVNQGQYQLLNRYGTDIVFDRPDA
FT                   NMAQFMRTMQQAQRFAPLTMEKSFFSRNIGMWLQFGFGWKATLSSAAERPMVVGQDVAI
FT                   APIPVQTKGDIHYSVLDGRAIMIFKDEARKEQLSWALLNLLMRDDINLQANIALGQLPT
FT                   LKALQDAPYFQSAEAQPFVQQLQHAILSEPFANAMEVANIILANYSKVVLKGEISPEQA
FT                   VATSAQAARQLLNEH"
FT   sig_peptide     454551..454607
FT                   /locus_tag="YPDSF_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.991 at
FT                   residue 19"
FT   gene            455849..456730
FT                   /locus_tag="YPDSF_0398"
FT   CDS_pept        455849..456730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0398"
FT                   /product="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38813"
FT                   /protein_id="ABP38813.1"
FT                   /translation="MKNKNVMMGYLFIAPWIIYFLVFILYPFFLSFQNSFLDINVLSPE
FT                   STQFVGLNNWISVSSDELFWRSLFNVIFNQVIFVLLSFVLAMGMALLLHEITHFGGLFR
FT                   TIMFIPVITSITVAMIIFNFLSSPAGPVQSLLLEWGVLDAPVFWKFERWLPMPLIAVFS
FT                   TWKWFGIQMIIFLGGIAGISKSLYEAADIDGASWRRKTWSITLPLLKPQIIFVMTMNII
FT                   NGMQMFIEVLMNFDLHGGPYNAALTPVLYLYKTGFSDMKMGTASTIGLLLAAVIYIFTM
FT                   LQLKFTQEKEHS"
FT   gene            456730..457548
FT                   /locus_tag="YPDSF_0399"
FT   CDS_pept        456730..457548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0399"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38814"
FT                   /protein_id="ABP38814.1"
FT                   /translation="MRISKKNLLIYSLLIIISLIVLYPFFFMIMNSFKTGSEIINAPNA
FT                   LPKNFSFNGYIQAFYSLNLGRIFLNTLFISVTVTLVNTLLSAMVAYAIVKMNLPGREFW
FT                   IKLILTSMMVPAVLFTIPTYMMLYSWGWVNTFQALIVPGTISAYNIFLLVQFLKQVDNA
FT                   YLEAARIDGAGEFTIFFKVVLPMIRPALATVAILTFMGSWNDFMGPLLYVRDDSLMTLQ
FT                   LALFKFVNDIPTDNLEQLWAMTTMIAVPVVLVFFFLQRNFIKAFTGIGVK"
FT   sig_peptide     456730..456834
FT                   /locus_tag="YPDSF_0399"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.673 at
FT                   residue 35"
FT   gene            457545..458060
FT                   /locus_tag="YPDSF_0400"
FT   CDS_pept        457545..458060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38815"
FT                   /protein_id="ABP38815.1"
FT                   /translation="MMSGKKGFFALVLIILLAYLSAWLMVYQQSKRYFDFAEQRYAAGD
FT                   YILALKGMNKIELYRHDVYSGGYQQVIDDWRHGMLVYRPDFYYQALARSSDLLARASDQ
FT                   QLAEFIATYTEIDTRFVAEAATCLLARYRQRGERASQRTMEEYLAEAFPAHALRTSSQL
FT                   DAGCNTDS"
FT   sig_peptide     457545..457619
FT                   /locus_tag="YPDSF_0400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.477 at
FT                   residue 25"
FT   gene            458111..460294
FT                   /locus_tag="YPDSF_0401"
FT   CDS_pept        458111..460294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0401"
FT                   /product="glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38816"
FT                   /protein_id="ABP38816.1"
FT                   /translation="MSTVYRDATLPIEARIDDLLSQMTLAEKVGQLCQQPMLDYQQHRD
FT                   DYLAGVRAGRWGSRILADTAWAGNAPGENVDPCQLNEIQRAAVEHSRLGIPLLFAREVI
FT                   YGQATVLPIPLAQAASWNPELVQQAYRVIAREAASLGIHWTFAPMLDIARDPRWGRTIE
FT                   TSGEDPWLTAQFAAAVVKGFQGDDLSAADSLMACAKHFVGYAAVEGGRDYDTTELSDNT
FT                   LHNVHLPPFQAAIEAGVGSVMTGFCDFGGTPVTAHGELIRGWLKQQQNFDGLVISDWGS
FT                   IADLTHFGIAQDALRAAELALQAGVDMAMTHEAYEDKLDQLVLQGRIKEALLDDAVRRV
FT                   LRAKFRCGLFERPYVDEEWHKRELRRPEHLALAQRLAEQSIVLLKNRQALLPISRTSVP
FT                   LTLAVIGPHAHSQRQHLGSWCLDGDADQVMSIYQSLCAIAGEVKVITEQSCFSDEMIEC
FT                   AHRADIVILCTGESHRRTGEARNIAELQLPPGQEELIAAVGRTGKPLVVIQCTGRPLPS
FT                   PATEQYADALLYGWQCGSEAGKAIARIIFGEQVPCGKLPMTVPRSTGQIPIYYGRKPLG
FT                   KMRDYREYQPYKDLADTPLYPFGFGLSYTRFTYSDLQLSHESLELGASLRVTMTVTNDG
FT                   AVAGDEVVQCYIRQYVASTTRPQRELKGFQRISLQPGELGEVSFTLGVRELAFYGQHRR
FT                   YAQEPSRISVFVGGDSTTPHQADFTLFENLYTV"
FT   gene            complement(460358..461884)
FT                   /locus_tag="YPDSF_0402"
FT   CDS_pept        complement(460358..461884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0402"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38817"
FT                   /protein_id="ABP38817.1"
FT                   /translation="MMTHAVLTARIAKISLTCSILSWSLLIVGCATDRLDLAPASYTEP
FT                   WTPDGNARASMGGGNFSVPPNPIVAELAQPPTIKSDHAYSLPELIDIAQRQNPDTRIAW
FT                   QQARQAALAVGMGEAIFLPIISASVIGGYQRTTTPLPYAIGNEKDLKTTGSAVIPALAL
FT                   QWLIFDFGQRSALLDAAKQTSYAANVTFNGMHQKLIYDVTRTYFQYGAAQAQSQIAKQT
FT                   LQNSLKIQDAAEERQKKGIATTVEVALARQQVAQSQLRRVVAKGTERDAYQALLGAMGV
FT                   SPSLDIKAAYTEDRALPDGISAPTEKMIQLALSQRPDVLASYAAVEAAKAGIKATEADF
FT                   LPKVYLAGAVAGGDGHFDIQGLPGISPQTSSSSILVGVSVPLYYGGIRAARVKEAESRA
FT                   AVAAEGFKKTQELAVREIVVAADTLRSALESNQAALNLVKTSFISYDAALESYRSGVGT
FT                   ITVANEAANGLLNAQQMSTDAHAASLVAAANLAFVMGKMTNTSPPLELLH"
FT   gene            complement(461889..463790)
FT                   /locus_tag="YPDSF_0403"
FT   CDS_pept        complement(461889..463790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0403"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38818"
FT                   /protein_id="ABP38818.1"
FT                   /translation="MTTVADGTLGGIIRQAKADLAFFPGRVAMAWRVAVLCALMAMIAM
FT                   IYGIPESAISCYLIIFVMKPDGVESMVMAVAITILVSLVVGLVFLLIHFTLEAAPLRMA
FT                   ALIVSSFLFLYLGSASKLGPVGSIIALVIAYVMTLLSNIPMGEVATRGLLYAWLMAVSP
FT                   MLLIIGFNLFFGRAPQTLLRASLAERLSTVAETLRYPNAANMARVGEQLQEGQHEHQQR
FT                   ALFVRIFHLRPSAEAAWLESAVKSSYRLLLVTSALPPTSPEAVRLELAAYCSDAAQAIA
FT                   SGDLAAPPHFAIEDTSDEINEIRNALIALANADNGQDLDAPKSSFFAADALTNPVHQQF
FT                   ALKTTAAALICYLIYTALDWQDIHTAMITCYVAALGTTGETVHKLVLRIIGCLIGALMG
FT                   VLSIIFIIPHMSDIGQLMALVFGCILVAAWVSCGSERIAYAGVQVGLAFLLTVLQGFGP
FT                   STDMGVALDRVLGILLGNLVVYLIFSRLWPVAITDAVHVHISRALKGLTNLAALSPDAR
FT                   PAALREATTVEAEITKAQEELALIPFEPVQFRPSRKECARLQAILAEMGKLCPVLFLPT
FT                   EKSASDVEQLRQLSAGSDAMTLSDEQGQNSGSLRQELSPINLTIQQRIKRLEELLGI"
FT   gene            complement(463774..464823)
FT                   /locus_tag="YPDSF_0404"
FT   CDS_pept        complement(463774..464823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0404"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38819"
FT                   /protein_id="ABP38819.1"
FT                   /translation="MNKQQGSGRKRQLALIVAGVIIIAAAISGWLSVRQTTLNPLSEDA
FT                   ELGASVVHIASSVPGRIISINVEENSKVRRGDLLFSIEPDLYRLQVEQAQAELKMAEAT
FT                   HDTQQRTVVAERSNAAITNEQIVRAQANLKLATQTLARLQPLRPKGYVTAQQVDDAATA
FT                   KHDAEVSLKQALKQSVAAEALVSSTASSEALVVARRAALAIAERELANTQIHAPNDGRV
FT                   VGLTVSAGEFVAPDQAIFTLINTEHWHASAFFRETELKHIKVGDCATVYVMADRQRAIQ
FT                   GRVEGIGWGVSSEDMLNIPRGLPYVPKSLNWVRVVQRFPVRISLEKPPEDLMRIGATAV
FT                   VIVRNDDGC"
FT   sig_peptide     complement(464737..464823)
FT                   /locus_tag="YPDSF_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.646 at
FT                   residue 29"
FT   gene            complement(464833..465168)
FT                   /locus_tag="YPDSF_0405"
FT   CDS_pept        complement(464833..465168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38820"
FT                   /protein_id="ABP38820.1"
FT                   /translation="MNNMTSLRKLRWFFCTCLTTAKQALWRGPLILLSAIALSGCSGAE
FT                   APSFSVVGSYFPYWMACAFIGIITAVIARVLFIRVGIDEVLPWRLLVYVCLALAVAFIC
FT                   SLLLFTR"
FT   sig_peptide     complement(465034..465168)
FT                   /locus_tag="YPDSF_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.875 at
FT                   residue 45"
FT   gene            complement(465165..465365)
FT                   /locus_tag="YPDSF_0406"
FT   CDS_pept        complement(465165..465365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38821"
FT                   /protein_id="ABP38821.1"
FT                   /translation="MENNTLANLTLLEGHPLEDRQLVTQTEKAFRLIMNQKHSGKCSVA
FT                   VVYDDEPSFLVGFSALIEAVQ"
FT   gene            466131..467363
FT                   /locus_tag="YPDSF_0407"
FT   CDS_pept        466131..467363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0407"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38822"
FT                   /protein_id="ABP38822.1"
FT                   /translation="MNTIRRKMRPEFQGLQGGLFSSVKKADVGTAVLDLMANGVDMLCW
FT                   ADPFFPDPVLPEHISQAVIKSMENGSASHYTMPIGNPELKEKIALKLQRYNNLTVEAQR
FT                   NILITPGSDSGLLFAMMPFINNDDEVLIHSPSYPSNFLNVELLGGKPISVELKAENNFQ
FT                   IDIKDFENKITEKTKMVILTNPNNPTGTVLRRESLQAIADFIIAHDLILVVDQAFEDAI
FT                   FDEIEFISIASLPGMWERTVSVFSFSKGMGLSGFRVGYLVADAQIVDVLFGCTVNVVGA
FT                   TNTSSQAGMIAALDEPSFMGEYTQIFERRRKVVFEMMNAIPGVCMVMPESGFLSWIDIS
FT                   KLGTSTFICDYLLQHAHVMVNSGVPYGQGGEGYIRLVHGCYKDDEKLYAVLTRIQQALM
FT                   QLAKEKGICHG"
FT   gene            467356..468465
FT                   /pseudo
FT                   /locus_tag="YPDSF_0408"
FT   gene            468324..468818
FT                   /pseudo
FT                   /locus_tag="YPDSF_0409"
FT   gene            468822..469268
FT                   /locus_tag="YPDSF_0410"
FT   CDS_pept        468822..469268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38823"
FT                   /protein_id="ABP38823.1"
FT                   /translation="MVNMMECITVSDVINVSVEEVWKKISAFDEFSDYHPGAVRSFYLH
FT                   QAADQQGSIRRVEMSDGYVEELLVNIDPKNYHLEYSILKSSFPLDGYSAEIKLIPVTQD
FT                   NRTFIQWNVSFTTTHPSPEALVAEIKNNVLIAGINGLNDYFSKS"
FT   gene            469402..470028
FT                   /locus_tag="YPDSF_0411"
FT   CDS_pept        469402..470028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38824"
FT                   /protein_id="ABP38824.1"
FT                   /translation="MTQDEIIKSWIPMVEFIARTYGENCEVILHDLRDLDKSIVAIKNN
FT                   HITGRQIGGTITDFALKLIHEKSWEERDFIINYKGRIPGKSENIRASTFFIKDEEGEII
FT                   AMLCMNVDLTSLSLAHKIIGNLMFIEEDNKNDEEVLRNTSITDMLHELITDVLKNYPRA
FT                   PSLLIMDEKKEIVKKLNEKGVFYLKGQLLRWRCVLKRQSRQFIVI"
FT   gene            470044..470424
FT                   /locus_tag="YPDSF_0412"
FT   CDS_pept        470044..470424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0412"
FT                   /product="translational inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38825"
FT                   /protein_id="ABP38825.1"
FT                   /translation="MKSVIETKNAPSAIGPYSQAICFNGILYASGQIPINPDTGDLVEN
FT                   DIEKQTRQVLKNIDAVLLQAGTTKDKIVKTTIFITNINNSSQVNDIYADYFKGTIFPAR
FT                   STVEVSALPKGALVEIEVIAGV"
FT   gene            470709..471113
FT                   /locus_tag="YPDSF_0413"
FT   CDS_pept        470709..471113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0413"
FT                   /product="translational inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38826"
FT                   /protein_id="ABP38826.1"
FT                   /translation="MNRRVINPETMYPSVPFGFSHAVEQLSGRTLHIAGQVAWNANGEL
FT                   VGGQDLLAQTQQVLANLKEVLRYAGATPADVVRLRTYVVNHSPANLAAICAQIGAFYEG
FT                   ADPAANSFIGVQALALPELLIEIEATACLG"
FT   gene            complement(471328..471630)
FT                   /locus_tag="YPDSF_0414"
FT   CDS_pept        complement(471328..471630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38827"
FT                   /protein_id="ABP38827.1"
FT                   /translation="MSYILQVDFPYTGPWGNEMTKAMEGLARSIAEEPGLIWKIWTVNE
FT                   TTNEAGGIYLFSDISAAKAYLAMHTARLKSFGIPHVNGKIFLVNEALSQLDRAPI"
FT   gene            complement(471890..472606)
FT                   /locus_tag="YPDSF_0415"
FT   CDS_pept        complement(471890..472606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38828"
FT                   /protein_id="ABP38828.1"
FT                   /translation="MMKCDPVKGTCQLPDFKSTETAVPAIRNGVAVHYIGDPMCSWCWG
FT                   ISPTVSKVMAFCEAEGIEFSMTMGGLRAGGGDPWNTAFKDFLHNEWRHIAQVTGQPFGF
FT                   TLLDAAHFDYDTEPACRAVMTVQLLQTRKNLAPSIALKFFSAIQRKFYVEGKDPKVTDF
FT                   YADICASIGLDFAEFRNLFEYSEARQAVQEAFLRCRQWSVSSFPTLLLESNNKMAPLAT
FT                   GFVTTEQVLSRLRQRI"
FT   gene            472768..473700
FT                   /locus_tag="YPDSF_0416"
FT   CDS_pept        472768..473700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0416"
FT                   /product="LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38829"
FT                   /protein_id="ABP38829.1"
FT                   /translation="MDKFSAMTTFAKVVETGSFTRAADVLALPKARVSQRVSDLERHLG
FT                   VRLLNRTTRSLNLTEDGQAYFAKCQVILQEIDELEGALKGGSVEPRGKLRVEALVSVAR
FT                   WVIAPSLHEFQARYPNISVRLGGSDRISHLLDNGIDCAIRGGHLEDSSQIARHVCDVHL
FT                   GLYAAPAYLEAAGAVTHPQELSVHRRISWFTGQRNPFIWSLQSASDAFELPAEEGLLFD
FT                   DPDVALASCMAGSGICPGAPFAVESWVRAGALVPVLPHWRFKARPIHIIYPSNRHLSAR
FT                   VRCFVDWSLEMMQANTSMRITPWELAERI"
FT   gene            complement(473902..474681)
FT                   /locus_tag="YPDSF_0417"
FT   CDS_pept        complement(473902..474681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0417"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38830"
FT                   /protein_id="ABP38830.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(474681..475703)
FT                   /locus_tag="YPDSF_0418"
FT   CDS_pept        complement(474681..475703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0418"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38831"
FT                   /protein_id="ABP38831.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            476110..476313
FT                   /locus_tag="YPDSF_0419"
FT   CDS_pept        476110..476313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38832"
FT                   /protein_id="ABP38832.1"
FT                   /translation="MLANKLGIIDEYEMEALESGLLLMLYEQLFIEGPLPTTLAFNSIR
FT                   EWHRQWLGNVYTSGQGDYVTLT"
FT   gene            476247..476621
FT                   /locus_tag="YPDSF_0420"
FT   CDS_pept        476247..476621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38833"
FT                   /protein_id="ABP38833.1"
FT                   /translation="MAPPVAGECVHQWAGRLRNANLTKDGFQKQFLARSGELKSLARPE
FT                   LVSYLAECHVEFILIHPFREGNGRLSRLLCDVLAVLAGKGLLDYSLWDEHKAFYFKAIQ
FT                   AGVSGNYSPMMRLVSDILPD"
FT   gene            complement(476618..476776)
FT                   /locus_tag="YPDSF_0421"
FT   CDS_pept        complement(476618..476776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38834"
FT                   /protein_id="ABP38834.1"
FT                   /translation="MTKKTAHSQITKTQIYRAVASSTAIETGVSVQKIEQQLKQNLAQA
FT                   KAVGLAR"
FT   gene            477695..479077
FT                   /locus_tag="YPDSF_0422"
FT   CDS_pept        477695..479077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38835"
FT                   /protein_id="ABP38835.1"
FT                   /translation="MSFNLPGMYLYYLSRDNLAPEEYERIISPHAAWARICREYEFDDS
FT                   HNTSRYLINMREREQRSSPDQPRPGGIREKEKLEKLVFSGDVVMLSDMYGPARLFYING
FT                   EGQLMSTDPHAFRFEGAAKIIKAFDDSVKCRNYQRTGGKPRSTQTRRLKSTTNTIPDRS
FT                   MVTRASDESGRVLSAKWQSVTDSAKTLWEATPFTHDKATTEAARGRIADGAVGTLEGLG
FT                   TLMGPSAQEYMAGAFNPEQAAINKVRQQNQQAAGKAIYDNTKGAVTDAYQRNGLAGAAA
FT                   MVVTASVAELAGTKGLGTVEKVGTLGDVAKLGKAVELEKLEGYLGTYKGQKVLLQNVDV
FT                   VKMDYVRRSTADRNLLRKEFDNGVRKKFLKDIANNPEVVKRLDAFDRSVLAKGVVPDGY
FT                   QVHHKLPLDDSGNNNFDNLVLISTRPEHAAFTTTQKHITKNLTPTGTNIVLWPKPQGII
FT                   YP"
FT   gene            479086..479556
FT                   /locus_tag="YPDSF_0423"
FT   CDS_pept        479086..479556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38836"
FT                   /protein_id="ABP38836.1"
FT                   /translation="MTDIEKAVTTFQAYRAAIGYPKIPPYEGEVIEYDFGRKIESNQPD
FT                   FWTQYHEFLRLSDGLAADGVYFYGIACEGKLIGNRLIDNNDALRDGEMYDESMDGLIAI
FT                   GSSNSDIFVYDTNTHKWESRDRIAIDDINESYDTLAELIDSQLQRINIGDAF"
FT   gene            479583..480038
FT                   /locus_tag="YPDSF_0424"
FT   CDS_pept        479583..480038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38837"
FT                   /protein_id="ABP38837.1"
FT                   /translation="MANLEKAVNEFTRISKSMGYNINPPYTGKLETYDFGRDISPEQPD
FT                   FWKQYGSFLRISNGSFADGCVFYGMSGGEDDAGLIEFNNALNIPDFKDETMTGLIVIGG
FT                   NNTDTFYYDPRTGKWEACDRIGTDRVWESCDSLAELIETQIKMLENG"
FT   gene            480055..480345
FT                   /locus_tag="YPDSF_0425"
FT   CDS_pept        480055..480345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38838"
FT                   /protein_id="ABP38838.1"
FT                   /translation="MTLTEEQKALFDALTQLQRRFVTALLEGANQTEAYRRAGGKAKGD
FT                   GERSKASQLVTNSNVQAFLQSVQHETVNAAIMTYTEALERLTLIDGAHDNS"
FT   gene            480323..480661
FT                   /locus_tag="YPDSF_0426"
FT   CDS_pept        480323..480661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38839"
FT                   /protein_id="ABP38839.1"
FT                   /translation="MGRTTIHDIATFGNYQIGENEEGQPVFQASWKFKDSKDIKPEHLA
FT                   AVAELSTGKDGLKIKLHDPKAAIKQLAGMCGWEAPKKAELTGANGGPIQTSNLTPDEAA
FT                   EAYRKMMG"
FT   gene            complement(480907..480983)
FT                   /locus_tag="YPDSF_R0008"
FT                   /note="tRNA-Met2"
FT   tRNA            complement(480907..480983)
FT                   /locus_tag="YPDSF_R0008"
FT                   /product="tRNA-Met"
FT   gene            complement(481179..483005)
FT                   /locus_tag="YPDSF_0427"
FT   CDS_pept        complement(481179..483005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0427"
FT                   /product="RNA polymerase sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38840"
FT                   /protein_id="ABP38840.1"
FT                   /translation="MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDII
FT                   QMINDMGIQVLEEAPDADDLMLAENTTDTDDDAAEAAAQVLSSVESEIGRTTDPVRMYM
FT                   REMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAGESRLSDL
FT                   ITGFVDPNAEEDIAPTATHVGSELSTEEMDDEDEDDDAEDDNSIDPELARQKFSDLREQ
FT                   YENARMEIKKNGRNHANAAAEILKLSEVFKQFRLVPKQFDYLVNNMRAMMDRVRTQERI
FT                   IMKLCVEQCKMPKKNFVTLFSSNETSDTWFNAAVAMGKPWSEKLKDVSEDVQRSLQKLR
FT                   QIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDL
FT                   IQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKL
FT                   NRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDF
FT                   IEDTTLKLPLDSATSESLRSATHDVLAGLTAREAKVLRMRFGIDMNTDHTLEEVGKQFD
FT                   VTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   gene            complement(483163..484911)
FT                   /locus_tag="YPDSF_0428"
FT   CDS_pept        complement(483163..484911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0428"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38841"
FT                   /protein_id="ABP38841.1"
FT                   /translation="MAGRIPRVFINDLLARTDIIDLIDARVKLKKQGKNYHACCPFHHE
FT                   KTPSFTVNGEKQFYHCFGCGAHGNAVDFLMNYDRLEFVESIEELATMHGLEVPYEAGSG
FT                   TTQIERHQRQSLYQLMESLSAFYQQSLKGQNAKQAREYLKHRGLSEEIIQHFAIGFAPP
FT                   GWDNALKRFGRDGESRTALNDAGMLVTNDTGRTYDRFRERVMFPIRDKRGRVIAFGGRI
FT                   LGDGVPKYLNSPETEIFHKGRQLYGLYEAQVNHPNPTRLLVVEGYMDVVALAQFGIDYA
FT                   VASLGTATTAEHIQLLFRATDNVICCYDGDRAGRDAAWRALETALPYLNDGRQLRFMFL
FT                   PDGEDPDTLVRKEGKDAFEQRMEAAQPLSTFLFETLMPQVDLSSPDGRAKLSTLALPLI
FT                   SQVPGEALRLYLRQQLGNKLGLLDDSQLDKLMPKQIDNANTYQPPQLKRTTMRILIGLL
FT                   VQNPQLATLIPSLQGLEQAKLAGLPLFIELVETCLAQPGLTTGQLLELYRDNKFSQQLE
FT                   TLATWNHMIVEDMVEPTFVDTLASLYDSILEQRQETLIARDRTHGLNAEERKELWSLNL
FT                   ALARKK"
FT   gene            complement(485047..485262)
FT                   /locus_tag="YPDSF_0429"
FT   CDS_pept        complement(485047..485262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0429"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38842"
FT                   /db_xref="GOA:A4THT0"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THT0"
FT                   /protein_id="ABP38842.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTER
FT                   KRAKASAVKRHAKKLARENARRTRLY"
FT   gene            485668..486681
FT                   /locus_tag="YPDSF_0430"
FT   CDS_pept        485668..486681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0430"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38843"
FT                   /db_xref="GOA:A4THT1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THT1"
FT                   /protein_id="ABP38843.1"
FT                   /translation="MRVLGIETSCDETGIAVYDDKAGLLANQLYSQVKLHADYGGVVPE
FT                   LASRDHVRKTVPLIQAALKEANLSAKDIDAVAYTAGPGLVGALLVGATIGRALAFAWGV
FT                   PAVPVHHMEGHLLAPMLEENAPEFPFVALLVSGGHTQLISVTGIGEYLLLGESVDDAAG
FT                   EAFDKTAKLLGLDYPGGPMLSRMAQQGTVGRFTFPRPMTDRPGLDFSFSGLKTFAANTI
FT                   RANGDDDQTRADIARAFEDAVVDTLAIKSKRALDQTGFKRLVIAGGVSANQTLRLKLAD
FT                   MMQKRGGEVFYARPEFCTDNGAMIAYAGMVRLRSNLNSELSVSVRPRWPLSELPKV"
FT   gene            complement(486798..487448)
FT                   /locus_tag="YPDSF_0431"
FT   CDS_pept        complement(486798..487448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0431"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38844"
FT                   /db_xref="GOA:A4THT2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THT2"
FT                   /protein_id="ABP38844.1"
FT                   /translation="MSAIALGMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGATN
FT                   VLRIGGRTAAVAVLLFDILKGMLPVWIAYLLHIPPLYLGLTAIAACLGHIYPVFFHFKG
FT                   GKGVATAFGAIAPIGWDLTGLMTGTWLLTVLLSGYSSLGAIVSALIAPFYVWWFKPQFT
FT                   FPVAMLSCLILMRHHDNIQRLWRGKEGKIWDKLRKKKQKTPAEEAAELEEKED"
FT   gene            487556..487915
FT                   /locus_tag="YPDSF_0432"
FT   CDS_pept        487556..487915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0432"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38845"
FT                   /protein_id="ABP38845.1"
FT                   /translation="MDIVFIEELSVITTIGVYDWEQTIQQKLVFDIEMGWDNRKAAGSD
FT                   DVNDCLSYADISEAVIQHVGSQRFALVERVAEEVAELLLRRFNSPWVRIKVSKPGAVAQ
FT                   AKNVGVIIERGQRLS"
FT   gene            488189..489007
FT                   /locus_tag="YPDSF_0433"
FT   CDS_pept        488189..489007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0433"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38846"
FT                   /db_xref="GOA:A4THT4"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THT4"
FT                   /protein_id="ABP38846.1"
FT                   /translation="MTDMYSLFVAFILGVVEGLTEFLPVSSTGHMIIVGELLGFTGDKA
FT                   KTFEVIIQLGSILAVVVVFWRRLFGLIGIHFGAVPHEGKTNGHLTLGHILLAMIPAVIL
FT                   GLAFHDVIKALFDPKSVMYALVAGGVLLLAAEWLKPKNPKAVGLDDITYRQAFAIGCFQ
FT                   CLALWPGFSRSGATISGGMLVGVNRYAASEFSFILAVPMMIGASGLDLYKSLHFLTLGD
FT                   LPMFAVGFITAFIVALIAIKTFLSLIKRISFVPFAIYRFIVAAVVYWVFM"
FT   gene            complement(489243..490481)
FT                   /locus_tag="YPDSF_0434"
FT   CDS_pept        complement(489243..490481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0434"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38847"
FT                   /db_xref="GOA:A4THT5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THT5"
FT                   /protein_id="ABP38847.1"
FT                   /translation="MNIYLVGGAVRDSLLNLPVTEQDWVVVGATPEQLLKLGYQQVGKD
FT                   FPVFLHPVSHEEYALARTERKSGQGYTGFTCYAAPDVTLEDDLLRRDLTVNAIARSADG
FT                   EFIDPYHGKQDLENRVLRHVSDAFGEDPLRVLRVARFAARFAYLGFTIAPETMSLMSNM
FT                   AQSGELSALTPERVWKETEKALKTQSPHVYFQVLRDCGALAVLFPEIERLFGVPAPEKW
FT                   HPEIDTGIHTLMTLAIAAQLSPEVDIRFAALCHDLGKGLTPKEHWPHHHGHGPAGVKLV
FT                   EQLCQRLRIPNPVRDLAKLVAEYHDLIHTVNKLRPETLLKLFNAIDVWRKPERLEQMIM
FT                   TSEADARGRTGFENNPYPQGDYLRAAFQIANGVSIQEVVASGLQGLAIRDELQRRRQQA
FT                   LAEWKQTQETASI"
FT   gene            complement(490641..491264)
FT                   /locus_tag="YPDSF_0435"
FT   CDS_pept        complement(490641..491264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38848"
FT                   /protein_id="ABP38848.1"
FT                   /translation="MQKLRLICLTILSVSLSWGAQAEEKRYISDELDTYVHSGPGNQYR
FT                   IVGTLKGGDEVTLISVDNGTNYGQIRDSKGKTTWIPLNQLSETPSLRVRVPDLEQQVKT
FT                   LTDKLANIDNSWNQRTAEMQQKVAASDSVISELQKENESLKNQLIVAQKKVNAVNLQLD
FT                   DKQRTIILQWFMYGGGVAGIGLLLGLVLPHLIPSRKKNNRWMNC"
FT   sig_peptide     complement(491196..491264)
FT                   /locus_tag="YPDSF_0435"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 23"
FT   gene            491568..492875
FT                   /locus_tag="YPDSF_0436"
FT   CDS_pept        491568..492875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38849"
FT                   /protein_id="ABP38849.1"
FT                   /translation="MTVEIELKFIATPAAIAALPEWIESQKNQHFPPQTLANIYFDTAD
FT                   KRLRQNDIGLRIRGYDGRYEMTVKTGGKVVGGLHQRPEYNVDIDSDQLDLARFPQDIWP
FT                   EGWAVDLLQAELQPLFRTDFTREKWVITYGESEIELALDQGSISADTLSEPLSEIELEL
FT                   KQGTQGDLLALAAELAKMGGLRQSNLSKAARGYHLAQGNPPRELRPFLVFQPVAKSTVE
FT                   QGMAGGLESILEHWQYHEELWLRGEPAAKTMIIDALAMVRQSLAIFGGLVPRKASTELR
FT                   ALLIALEPQLEPKSVDAALLCYSVDYLKCKLALTSWLITAGWRPFMDAKAQAKFDGSFK
FT                   RFCDIMLSRSAADLKEAFGHNLDDDGYLAQLPRLNRQLIAFQLLSGFYPQSEWHPYIDA
FT                   WFGLQQAIMARQGHWRDTARKEALSQAAFWLNGAVR"
FT   gene            493046..495901
FT                   /locus_tag="YPDSF_0437"
FT   CDS_pept        493046..495901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0437"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38850"
FT                   /db_xref="GOA:A4THT8"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THT8"
FT                   /protein_id="ABP38850.1"
FT                   /translation="MLPLPSELQIQAQSIKQRFSELPAPPDLRDEDIAVLALSDFVSDM
FT                   LLIHPQWLEELHQQPPQPQEWQYYSQWLSQALAGVQDEAALLTALRLFRRRVMVRIAWS
FT                   QVLQTSGTAETLQQLSTLAESMIIAARDWLYQVCCRELGTPCNRQGVPQPLLILGMGKL
FT                   GGGELNFSSDIDLIFAYPENGQTQGGRRELDNAQFFTRLGQRLIKALDQHTIDGFVYRV
FT                   DMRLRPFGDSGPLVLSFAALEDYYQEQGRDWERYAMVKARLMGGADDPYSQELRQMLRP
FT                   FVFRRYIDFSVIQSLRNMKGMIAREVRRRGLKDNIKLGAGGIREIEFITQVFQLIRGGR
FT                   EPRLQERALLPTLQAVAELGLLPEQQVADLSGSYLFLRRLENLLQAIADEQTQTLPNDP
FT                   LNQARLAWGMGYADWAAMSTALENHMQAVRVVFDDLIGDETPDIGEDPSHGLYKSLWQD
FT                   VLEESDLAPLTPHLEEAARRQLLATISGFRHDVDKRTIGPRGREVLDQLMPRLFAEVCP
FT                   RPDANVALSRLILLLLSIVTRTTYLELLVEYHAALKHVIRLCSASPMVASQLARYPLLL
FT                   DELLDPQSLYQPLAPSAYRDELRQYLLRVPEDDEEQQLEALRQFKQAQQLRIAAGDITE
FT                   ALPVMKVSDHLTYLAEAIIDAVIQQAWNQMVARYGQPSHLQQSEGRGFAVIGYGKLGGW
FT                   ELGYSSDLDLVFLLDCPLDVMTDGDRSIDGRQFYLRLAQRIMHLFSTRTSSGILYEVDA
FT                   RLRPSGEAGMLVSTIEAFADYQRNEAWTWEHQALVRARIVYGSPKLHQQFDAIRQQILC
FT                   RHREDPQLQQEVREMREKMRNHLGSKQRDIFDIKADAGGITDIEFIAQYLVLRYAASEP
FT                   RLTRWSDNVRIFESMAHYDIMSPEEAAALTRAYVTMRDEIHHLALQEQSSKVAADSFIA
FT                   EREQVAASWHKWLAANDANVS"
FT   gene            496036..497466
FT                   /locus_tag="YPDSF_0438"
FT   CDS_pept        496036..497466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0438"
FT                   /product="D-beta-D-heptose 1-phosphate adenylyltransferase
FT                   / D-alpha,beta-D-heptose 7-phosphate 1-kinase"
FT                   /EC_number="2.7.7.-"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38851"
FT                   /db_xref="GOA:A4THT9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THT9"
FT                   /protein_id="ABP38851.1"
FT                   /translation="MKVTLPDFRRAGVLVVGDVMLDRYWYGPTCRISPEAPVPVVKVDT
FT                   IEERPGGAANVAMNIASLGAVARLVGLTGIDDAARALICKLSEVRVRCDFVSVPTHPTI
FT                   TKLRVLSRNQQLIRLDFEEGFDGVDPTPIFERIQLALPQIGALVLSDYAKGALNSVQPM
FT                   IQLARKANVPVLIDPKGSDFERYRGATLLTPNLSEFEAVVGRCKNEEELVNRGMQLVAD
FT                   FELSALLVTRSEQGMTLLQLGKPPLHLPTQAKEVFDVTGAGDTVIGVLAAALAAGNSLE
FT                   ESCFLANAAAGVVVGKLGTSTVSPIELENAIRGRAETGFGVMDEQQLKIAVAQARQRGE
FT                   KVVMTNGIFDILHAGHVSYLANARKLGDRLIVAVNSDASTKRLKGEKRPVNPLEQRMVV
FT                   LGALEAVDWVVPFEEDTPQRLIADILPDLLVKGGDYKPHEIAGSEEVWAAGGEVKVLNF
FT                   EDGVSTTNIIQSIKNGRG"
FT   gene            497503..498753
FT                   /locus_tag="YPDSF_0439"
FT   CDS_pept        497503..498753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0439"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38852"
FT                   /protein_id="ABP38852.1"
FT                   /translation="MGGLKQELSLAQGVGLLSTSLLGTGVFAVPALAAMLAGHDSLWAW
FT                   PVLIVLVFPIAIAFAALGRHFPSAGGAAHFVAIAFGPKLGKVTGWLFLSVIPVGLPAAL
FT                   QIAAGFWQAMFGWSDTGLLMVQLVTLLVIWLLGTRSAGSSANLQTVIALLVIALVAAIW
FT                   WQGDIRLSQIPWPALQDVSPPNIFNALAVMFWCFVGLEAFAHLATEFRHPERDFPRALI
FT                   VGLLVAGAVYWGCTVAVLHFQAYGESQVAAASLPGIVVQLFGEHALWIACIIGYLACFA
FT                   SVNIYTQSFARMVWSQSQVRPQSKLARLSAGQTPVNALTAVVGSCLVFALLIYWLALPL
FT                   DLLIVYANGIFVLIYLLCMLAGIRLLSGRARVMSVIGSLLCCVLLVMIGWKSVYALLMF
FT                   ALLWMLMSKPKTQLTQP"
FT   sig_peptide     497503..497604
FT                   /locus_tag="YPDSF_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.941 at
FT                   residue 34"
FT   gene            complement(499078..499359)
FT                   /locus_tag="YPDSF_0440"
FT   CDS_pept        complement(499078..499359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38853"
FT                   /protein_id="ABP38853.1"
FT                   /translation="MIDPKKIEQIARQVHESMPKGIREFGEDVEKKIRLILQSQLTRLD
FT                   LVNREEFDVQTQVLLRTREKLALLEQRVGALEAKFNSAPADHGEKTGE"
FT   misc_binding    499497..499686
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch"
FT   gene            499928..500581
FT                   /locus_tag="YPDSF_0441"
FT   CDS_pept        499928..500581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0441"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38854"
FT                   /db_xref="GOA:A4THU2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4THU2"
FT                   /protein_id="ABP38854.1"
FT                   /translation="MNQTLLSDFGTPVERVERAIDALRNGRGVMVLDDESRENEGDMVF
FT                   AAEAMTLEQMALTIRHGSGIVCLCITDERRQQLDLPMMVTHNSSQFQTAFTVTIEAAEG
FT                   VTTGVSAADRLTTIRKAIADNAKPADLNRPGHVFPLRGQPGGVLSRRGHTEASIDLATL
FT                   AGYKPAGVLCELTNDDGSMAHAPEVIAFAKLHDMPVVTIDDLAAYLQSRAKKAS"
FT   gene            501023..501805
FT                   /locus_tag="YPDSF_0442"
FT   CDS_pept        501023..501805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38855"
FT                   /protein_id="ABP38855.1"
FT                   /translation="MNTFRMPALFLGHGSPMNVLEENSYTQAWRTLGETLPRPKMILAI
FT                   SAHWYTRGTAVTAMEHPRTIHDFGGFPQALFDIQYPAPGSPELAAHIQQLLAPTPVRAD
FT                   TGEWGLDHGSWGVLIKMYPEADIPVVQLSIDGTQPAAYHYELGQKLAALREQGVMIVAS
FT                   GNVVHNLRLGKWQGESSPYPWAESFNQFVRDNLSYQGDDHPLVNFMQHEGAALSNPSPE
FT                   HYLPLLYVLGSWDGKEPVSIPTDEVEMGSLSMLSVQIG"
FT   gene            complement(501966..503126)
FT                   /locus_tag="YPDSF_0443"
FT   CDS_pept        complement(501966..503126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38856"
FT                   /protein_id="ABP38856.1"
FT                   /translation="MKRLAISERPDWREKATEFGFRFHTMHGEPYWCEDAYYEFTLAQI
FT                   EELEETTAELHQMCLQVVEKVINSDQLLTKCRIPKHCWEFVRHSWRSNQPSLYSRLDLA
FT                   YDGKNPAKLLENNADTPTSLYEAAFFQWLWLEDQISAGNLSTDSDQYNSLQEKLIERFV
FT                   ELRDNHGFSLLHLACCQDSEEDRGTVQYLQDCALEAGLPTEFMFMEEIGLGEKGQFTDL
FT                   DNQVISNLFKLYPWEFMFREIFSTKLEDAGVRWLEPAWKSIISNKALLPLLWEMFPNHP
FT                   NLLPAYFAEDDHPPLDHYVIKPLFSREGANIQIVENGKEVAKVDGPYGEEGMIIQQFHP
FT                   LPKFGDSYTLIGSWLVNDQPCGIGLREDRELITQDLSRFYPHIILG"
FT   gene            complement(503136..503822)
FT                   /locus_tag="YPDSF_0444"
FT   CDS_pept        complement(503136..503822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38857"
FT                   /protein_id="ABP38857.1"
FT                   /translation="MMKRTKNINQETFRKSWRSYRLAPVALAVSAVFMLAGCEKTDETV
FT                   SLYQNADDCSQANPSQSAECTTAYNTALQEAVKTAPKYATREDCVAEFGESQCTQAPAQ
FT                   AGMVPTSSSETTAAAPQQSGSMWMPLMAGYMMGRMMGGGASQPLFTSKAPNSPANGKFV
FT                   DASGKNFGAATTGRTMTVPKTALAPKPAVTKTITRGGFGESVAKQSSMQRSAATSSKTT
FT                   TRSMGG"
FT   sig_peptide     complement(503709..503822)
FT                   /locus_tag="YPDSF_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.813 at
FT                   residue 38"
FT   gene            complement(504123..505520)
FT                   /locus_tag="YPDSF_0445"
FT   CDS_pept        complement(504123..505520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0445"
FT                   /product="ABC-transporter outer membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38858"
FT                   /protein_id="ABP38858.1"
FT                   /translation="MKKLLPLLIGLSLAGFSTMSQAENLLQVYKQARDSNPDLRKAAAD
FT                   RDAAYEKINEVRSPLLPQLGLSAGYTHANGFRDASNSPDSNATSGSLKLTQTIFDMSKW
FT                   RALTLQEKAAGIQDVTFQTSEQQLILNTATAYFNVLRAIDSLSYTEAQKQSVYRQLDQT
FT                   TQRFNVGLVAITDVQNARASYDTVLAAEVAARNNLDNALESLRQITGVYYPELASLNVE
FT                   RLKTQRPDAVNNLLKEAEKRNLSLLSARLSQDLAREQIKSAETGYMPTVDLTASSSITN
FT                   TRYSGGTPSSQQVNNDSGQNQIGVQFSLPLYSGGATNSAVKQAQYNFVGASELLESAHR
FT                   NMVQTLRSSFNNISASISSINAYQQVVISNQSSLDAMEAGYQVGTRTILDVLTATTNLY
FT                   QSKQQLADARYNYLINQLNIKSALGTLNMNDLMALNAVLDKPVPTSAAALAPENTTRQT
FT                   VTTPRAQ"
FT   sig_peptide     complement(505452..505520)
FT                   /locus_tag="YPDSF_0445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            505916..506548
FT                   /locus_tag="YPDSF_0446"
FT   CDS_pept        505916..506548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0446"
FT                   /product="MutT-family protein"
FT                   /EC_number="3.6.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38859"
FT                   /protein_id="ABP38859.1"
FT                   /translation="MTSKQSSPVTFDKNDVEIIARESLYRGFFSLNSYRFRHRLFNGEM
FT                   SGEVKREIFERGHAAVLLPYDPQRDEVVLVEQLRIAAIDSAVSPWLLEMVAGMIEEGES
FT                   VEEVARREAEEEAGIQVGRCKPVLSYLASPGGTSERLSIMVGEVDATTASGIHGLAEEN
FT                   EDIRVHVVSREQAYRWVEEGVIDNAASVIALQWLALHHQALRAEWQR"
FT   gene            506582..507007
FT                   /locus_tag="YPDSF_0447"
FT   CDS_pept        506582..507007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38860"
FT                   /protein_id="ABP38860.1"
FT                   /translation="MSKRYTPDFPEMMRLCEINYAQLRRLIPRINEVGESVAYQIKEVS
FT                   YRLTIIESTRYTSVVEIVQTAPAASHWSLPSMVVRLYHDAMVAEVCASQQISRFKASYD
FT                   YPNKKLHQRDEKHQINQFLADWLRYCLAHGAVAVPVC"
FT   gene            507016..507915
FT                   /locus_tag="YPDSF_0448"
FT   CDS_pept        507016..507915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0448"
FT                   /product="Icc-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38861"
FT                   /protein_id="ABP38861.1"
FT                   /translation="MALPADSHNTHNYLVGGRQKQGYHLESLFKLPMASGARVRILQIT
FT                   DTHLFAGEHETLLGVNTFHSYRAVLDAIIAEQHPFDLVVATGDLAQDHSVAAYQNFAKG
FT                   ISRLPVPCVWLPGNHDFQPAMFDALAEAGIAPSKQVLAGEHWQILLLDSQVFGVPYGEL
FT                   SDYQLEWMERCLIAYPERYTLILLHHHPMPSGCTWLDQHSLRNAHMLAAILTRYPRVTT
FT                   LLCGHIHQDLDLDWYGKRLLASPSTCVQFKPHCTNFTLDAVAPGWRYLDLLPDGGLETE
FT                   VHRLDSDEFCPDMDSDGY"
FT   gene            507915..508496
FT                   /locus_tag="YPDSF_0449"
FT   CDS_pept        507915..508496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38862"
FT                   /protein_id="ABP38862.1"
FT                   /translation="MSTLLYIHGFNSSPSSAKATAFKEWLQQHYPHIEMLTPQLPPYPA
FT                   PAAEMLENIVMDKAGQSIGIVGSSLGGYFATWLSQRFGIPAVVVNPAVRPYELLSDYLG
FT                   KNENPYTGQQYVLESRHIYDLKAMQIEKLESPDLLWLLQQTGDEILDYRQAVAYYTPCR
FT                   QTVESGGNHAFIGFDHYFSPIVTFLGLANT"
FT   gene            508598..510493
FT                   /locus_tag="YPDSF_0450"
FT   CDS_pept        508598..510493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0450"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38863"
FT                   /protein_id="ABP38863.1"
FT                   /translation="MTESSYNADAIEVLSGLEPVRRRPGMYTDTSRPNHLGQEVIDNSV
FT                   DEALAGHARRIDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNK
FT                   NYQFSGGLHGVGISVVNALSKRVEVTVRRDSQIYSIAFENGDKVQDLQVIGTCGKRNTG
FT                   TSVHFWPDVSFFDSPRFSVSRLSHLLKAKAVLCPGVEIVFKDQVNNTEQRWCYADGLTD
FT                   YLMEAVNGFITLPEAPFVGSFAGDTEAIDWALLWLPEGGELLTESYVNLIPTMQGGTHV
FT                   NGLRQGLLDAMRDFCEYRNILPRGVKLSADDIWERCAYVLSVKMQDPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQAAEQLAELAISSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCTSQDLSLTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSEDLSQLRYGKVCILADADSDGLHIATLLCALFVRHFRALVRN
FT                   GHVYVAMPPLYRIDLGKEVFYALDEEEKAGVLEQLKRKRGKPNVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLTISDDDIDHTLAVMDMLLAKKRSEDRRNWLQEKGDTAEIEV"
FT   gene            510497..511408
FT                   /locus_tag="YPDSF_0451"
FT   CDS_pept        510497..511408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0451"
FT                   /product="LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38864"
FT                   /protein_id="ABP38864.1"
FT                   /translation="MKVTLEELQAFTSVVDCGSITAAAEQRSQTTSGISRALSRLEQKL
FT                   ATTLLRRTTRRLELTEEGALFLSHARQIIGAVDDAEEQIALRRLKPAGRLRVNAAAPFM
FT                   QHVIVPMITGFRALYPQITLELNTDDLNIDLLEQRTDIAIRIGALRDSTIHARLLGASR
FT                   VRLLASPNYLQRHGTPHIIEALADHSLLGFTQPEFLNQWSLPHLPGGRSSIIPNLAASS
FT                   GETLRLLALQGEGIAELSDFMTREDQLAGRLVEVLADQILETWQPINAVYYRNTQLAAR
FT                   ITCFLDYVSEQIKLQGSHWLRI"
FT   gene            complement(511466..512050)
FT                   /locus_tag="YPDSF_0452"
FT   CDS_pept        complement(511466..512050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0452"
FT                   /product="modulator of drug activity"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38865"
FT                   /protein_id="ABP38865.1"
FT                   /translation="MSNVLIINAMKEFAHSKGALNLTLTNVAADFLRESGHQVKITTVD
FT                   QGYDIESEIENYLWADTIIYQMPAWWMGEPWILKKYIDEVFTDGHGRLYQSDGRTRSDA
FT                   TKGYGSGGLIQGKTYMLSVTWNAPREAFTDPEQFFHGVGVDGVYLPFHKANQFLGMKPL
FT                   PTFMCNDVIKQPDIEGDIARYRQHLAENVNS"
FT   gene            complement(512123..512371)
FT                   /locus_tag="YPDSF_0453"
FT   CDS_pept        complement(512123..512371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0453"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38866"
FT                   /protein_id="ABP38866.1"
FT                   /translation="MSQVTHYSIILRLWNDDHWRQRIGTASSLSISARDSTSSTGLLSQ
FT                   FTINLNRFAFYCLPGALLIFEQQCYALLSIFLWSVNH"
FT   gene            512354..514627
FT                   /locus_tag="YPDSF_0454"
FT   CDS_pept        512354..514627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0454"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38867"
FT                   /protein_id="ABP38867.1"
FT                   /translation="MSDLTHDGAERLPLHTFTENAYLNYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLNNSAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSKYAEVLLGELAQGTVDWVPNFDGTMQEPKMLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNVREIAQAVLALIDKPTTSLDELLEFVQGPDFPTE
FT                   AEIITPRDDIRKIYQNGRGSVRMRAVWKKEDGSAVITALPHQVSGAKVLEQIANQMRAK
FT                   KLPMVEDLRDESDHENPTRLVIVPRTNRVDLDQVMSHLFATTDLERSYRINMNMIGLDN
FT                   RPSVKGLLEILTEWLVFRRQTVRNRLNFRLEKVLKRLHILEGLLIAFLNIDEVIHIIRT
FT                   EDDPKPLLMQRFSISETQAEAILELKLRHLAKLEEVKIRGEQDELAKERDQLQALLASE
FT                   RKLNTLIKKEIQADAAAYGDDRRSPLTERGEAKAMSEHDIVPSEPVTIVLSEMGWVRSA
FT                   KGHDIAPSGLSYKAGDSFRAAARGMSNQPVVFIDSTGRSYALDPLTLPSARGQGEPLTG
FT                   KLTPPPGATIEHVLMAPDSQKLLMASDAGYGFVCTFNDLVAKNRAGKTMITLPENAKVL
FT                   PPLEIYGPDDMLLSITAVGRMLMFPVADLPELSKGKGNKIVSIPAAQAAAGEDRLAWLF
FT                   VLPPQTSITLHFGKRKLTLRPEDLQKFRAERGRKGSPLPRGLQRIDRIDVDAPPRAIAT
FT                   ESEE"
FT   gene            514916..515647
FT                   /locus_tag="YPDSF_0455"
FT   CDS_pept        514916..515647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0455"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38868"
FT                   /protein_id="ABP38868.1"
FT                   /translation="MLLILRTVLAVLYCFLVCVFGSIYCLFSPRNPRHVATFSHLFGRM
FT                   SVLFGITIEQRIPAEAAKYGNCIYIANHQNNYDMVTMSNVVQPGTVTVGKKSLLWVPLF
FT                   GPLYWLTGNLLIDRDNRAKAHSTIAQVVEQVQKRNISIWMFPEGTRSRGRGLLPFKTGA
FT                   FHAAIAAGVPIVPICVSSTNGIKLNRWSNGKVIIEMLPPIDTSGYTKERVRELSEHCRN
FT                   LMLAKIEQLDAEVAQQSVAKK"
FT   gene            complement(515637..515816)
FT                   /locus_tag="YPDSF_0456"
FT   CDS_pept        complement(515637..515816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38869"
FT                   /protein_id="ABP38869.1"
FT                   /translation="MKTTIKPTAKFCLTANNAEGRQNAHDQSRLNQHLKFVAINITAAR
FT                   GRDSLHRKNKYIIF"
FT   gene            515826..517250
FT                   /locus_tag="YPDSF_0457"
FT   CDS_pept        515826..517250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0457"
FT                   /product="cell division protein SufI"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38870"
FT                   /protein_id="ABP38870.1"
FT                   /translation="MSLSRRQFIQAAGLALGAGSLPLRAQASSTQQPQLPVPPLLESRR
FT                   GQPLFLTLQRAHWAFSGNKKAAVWGINGMYLGPTVRVFNGDDVKLIYSNRLTEPVSMTI
FT                   SGLQVPGTLMGGEARMIRPGEDWSPVLPVRQPAANCWYHANTPNRMAPHVYNGLAGMWL
FT                   VEDAVSKAMPLPSHYGVDDFPLIIQDKRLDNFGVPEYNPPAKGGFVGDTLLVNGAQSPF
FT                   VEVSRGWVRLRLLNASNARRYTLQLSDGRPLYVVASDQGFLPAPVAVQQLSLAPGERRE
FT                   VVIDMSQGNEVSITAGESAGIMDRLRGLFEPSSILISTLVLTLKPTGLLPLVTDNLPMR
FT                   LLADQIIEGSVIRSREFQLGDNLPGINGAIWDMNRVDVQAQQGTWERWIIHADMPQAFH
FT                   IQGVSFLVKSVNGAAAMAEDRGWKDTVWVDGTVELWVYFNQVSSPQFPFLFYSQTLEMA
FT                   DRGSAGQLVTVAAPTL"
FT   sig_peptide     515826..515909
FT                   /locus_tag="YPDSF_0457"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.739 at
FT                   residue 28"
FT   gene            517558..519105
FT                   /locus_tag="YPDSF_0458"
FT   CDS_pept        517558..519105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38871"
FT                   /protein_id="ABP38871.1"
FT                   /translation="MSISLIQPERDLFSYQPYWAECYGTAPFLPMSREEMDILGWDSCD
FT                   IIVITGDAYVDHPSFGMAIVGRMLEAQGFRVGIIAQPDWTNKHDFMRLGEPNLFFGVTA
FT                   GNMDSMINRYTADRKLRHDDAYTPDNQSGKRPDRATLVYSQRCKEAYSHVPVLLGGIEA
FT                   SLRRIAHYDYWSDTVRRSVIVDAKADMLVYGNGERPLVEVAHRLAAGEKITDIQDVRNT
FT                   VVMRKTPLPGWSGVDSTRLDKPGRIEAIPNPYGEDLPCATDDISIPEAKPITVRAAKPK
FT                   PWEKTYVLLPSYEKVKADKVLYAHTSRILHHETNPGCARALMQKHGDRYIWINPPAIPL
FT                   STEEMDSVFALPYQRVPHPSYGKSPIPAYDMIRFSINIMRGCYGGCSFCSITEHEGRII
FT                   QSRSEDSIIREIEEIRDKVPGFTGIISDLGGPTANMYMLRCQSPRAEQTCRRASCVYPE
FT                   ICPHMDTNHQPTISLYRRARDLKGIKKILIASGVRYDLAVEDPRYIKELASHMWAVI"
FT   gene            519090..519902
FT                   /locus_tag="YPDSF_0459"
FT   CDS_pept        519090..519902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0459"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38872"
FT                   /protein_id="ABP38872.1"
FT                   /translation="MGGYLKIAPEHTEEGPLSKMMKPGMGSYQRFKELFDTYSKQAGKE
FT                   QYLIPYFISAHPGTEDKDMVNLALWLKKNRFRLDQVQNFYPSPLANSTTMYYTGKNPLA
FT                   KVDYKSEEVVVPKGDRQRRLHKALLRYHDPANWPMLRSALEDMGLQHLIGARRECLVPA
FT                   PTLEEQREARRALRHHTPALTKHTSITRQRQPSNRAPAASAGKKAPTVANGTSSAHSTS
FT                   ANQSTSANQSTSAAHSTLATKKSAGKTGVNKAAVNKPSAGSRGKNRQH"
FT   gene            complement(519924..520757)
FT                   /locus_tag="YPDSF_0460"
FT   CDS_pept        complement(519924..520757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0460"
FT                   /product="aldo/keto reductase family protein"
FT                   /EC_number="1.1.1.274"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38873"
FT                   /protein_id="ABP38873.1"
FT                   /translation="MTMQPLIKLYDGRLMPQLGLGVWQASIQETELAVSKALEVGYRSI
FT                   DTAAIYKNEEGVGKALKAAAVARDELFITTKLWNDDQHNPQQALETSLQKLQLDYVDLY
FT                   LIHWPDPKQDHYVSAWRELVTLKEQGLIRSIGVCNFHIPHLQRLIDETGIAPTVNQIEL
FT                   HPLLQQRQLHAWNATHHIATESWSPLAQGGKGVFDQEIIRKLAQQYNKTPAQIVIRWHL
FT                   DSGLIVIPKSVTPARIRENFEVFDFKLQKEELLAITKLDCGKRLGPDPEVFGSDR"
FT   gene            520904..521113
FT                   /locus_tag="YPDSF_0461"
FT   CDS_pept        520904..521113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38874"
FT                   /protein_id="ABP38874.1"
FT                   /translation="MQTILLWAANHHIAQLIAGEKSESQAKKKIYPKSFGLSAGSDEVR
FT                   ERHQHLCSLKSNGYKQEDWQHDMR"
FT   gene            complement(521176..522333)
FT                   /locus_tag="YPDSF_0462"
FT   CDS_pept        complement(521176..522333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0462"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38875"
FT                   /protein_id="ABP38875.1"
FT                   /translation="MQNFTLHTPTKVLFGTGQIAQLTQEIPADARILITYGGGSIKQNG
FT                   VLDQVHQALKGFDFLEFGGIEPNPTYETLMKAVELCRTEGINFLLAVGGGSVLDGTKFI
FT                   AAAVNYPQDPWHILETTGRDITEALPMGSVLTLPATGSEANNGAVISRRSTGDKQHFFS
FT                   PHVQPLFAVLDPVVTYTLPPRQVANGVVDAFVHTIEQYLTYPVDAKVQDRFAEGLLLTL
FT                   IEEGPKALKDPENYNVRANIMWSATMALNGLIGAGVPQDWATHMLGHELTARHGLDHAQ
FT                   TLAVVLPALLVAKKQQKRAKLLQYAERVWGLREGSEDQRIDAAIEATRHFFESLGVATR
FT                   LSAYKLDGSSIPDLIKKLEEHGMTKLGEHSDITLADSKRIYEAAV"
FT   gene            522731..523624
FT                   /locus_tag="YPDSF_0463"
FT   CDS_pept        522731..523624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0463"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38876"
FT                   /protein_id="ABP38876.1"
FT                   /translation="MVDVIDIQAQMADKIARLAQGDGLTPSTVSGVKILYSTVHQPRTP
FT                   VMYTPSVVIIFQGHKVGYLGSKVFQYDPKNYLILSVPLPFECETFASPEIPLAGISIQV
FT                   DSQMLQDLMMTMGDDELEKPPGNTSGVNSAPLTEEMLCATERLLDVMSIARDARVLGPQ
FT                   IVREILYYVLCGSCGGALQALVNRHGHFNQITKTLRRIENHFADNLSVEQLAAEVNMSV
FT                   SAFHHNFKAVTNTSPLQYLKSYRLHRARMMMLHDGLKASTAAIKVGYESASQFSREFKR
FT                   YFGHTPSEGVAKQRIN"
FT   gene            complement(523716..524378)
FT                   /locus_tag="YPDSF_0464"
FT   CDS_pept        complement(523716..524378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0464"
FT                   /product="DedA-family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38877"
FT                   /protein_id="ABP38877.1"
FT                   /translation="MDVLREILHALWQQDFSKLADPNVIWVIYGILFTTLFLENGLLPA
FT                   SFLPGDSLLLLAGALIAKGVMGFLPTLIILTTAASLGCWLSYLQGRWLGDTSVVKRWLL
FT                   QLPLQYRQRAHTLFVRHGLAALLVGRFLAFVRTLLPTLAGISGLNSIRFQLFNWLSGLL
FT                   WVGSVVGLGFALSHIPLVKQYENQVMTALMILPIVLLLAGLVGTLILVWCKRKSTTE"
FT   gene            complement(524571..525782)
FT                   /locus_tag="YPDSF_0465"
FT   CDS_pept        complement(524571..525782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0465"
FT                   /product="cystathionine beta-lyase"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38878"
FT                   /protein_id="ABP38878.1"
FT                   /translation="MAVNKAIPEKLETALVSAGRSKKFTQGSVNTVIQRASSLVFESVK
FT                   AKKHATINRGNGELFYGRRGTLTHFSLQEAMTELEGGAGCVLYPCGAAAISNAILSFVA
FT                   TGDHVLMTGSAYEPAQSFCDKILSRMNITTTYFDPMIGAGIASLITPKTKVIFLESPGS
FT                   ITMEVQDIPAMVAAIRAVAPDVVIMMDNTWAAGVLFKALDFDIDISIQSGTKYIIGHSD
FT                   AMLGIAVANARCWEQLREDSYLMGQMVDADTAYLASRGLRTLSVRLKQHEKNSIEIANW
FT                   LAERPEVAVVYHPALPGCKGHEFYKRDFNGCNGLFSFELKEELTQQQLENYLDHFTHFS
FT                   MAFSWGGFESLILGYQPKDIRAIRKYDAEGIKGTLFRLHIGLENVQDLQDDLAAGFERI
FT                   QAVK"
FT   gene            526261..527298
FT                   /locus_tag="YPDSF_0466"
FT   CDS_pept        526261..527298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0466"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38879"
FT                   /protein_id="ABP38879.1"
FT                   /translation="MKIAGKESKEISRVQGRVMKGVMVLLLATGLAGHAQAAPGNGSAV
FT                   AATVTAPTAATSTPLPAPEITSVAAIPESTPESVLTSASALTSESIPAPMVQPVTAPVP
FT                   QKLAMDLSVWGMYQNADVVVKGVMIGLVLASIVTWTILFSKGTELFRARRRLRQEHEVI
FT                   GAVTDLDTASERAEDFGQGSVSSLLLHEALNERLLSIESNDNNGIKERTAFRLERRVAA
FT                   IGRQMGKGNGFLATIGAISPFVGLFGTVWGIMNSFIGIAHSQTTNLAVVAPGIAEALLA
FT                   TALGLVAAIPAVVIYNIFARQIGNYRAQVGDVAAQVLLLLSRDLDLASSAEVKSPRHPH
FT                   QLRAG"
FT   sig_peptide     526261..526374
FT                   /locus_tag="YPDSF_0466"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.950 at
FT                   residue 38"
FT   gene            527308..527733
FT                   /locus_tag="YPDSF_0467"
FT   CDS_pept        527308..527733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0467"
FT                   /product="ExbD/TolR-family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38880"
FT                   /protein_id="ABP38880.1"
FT                   /translation="MRMNDSLDESGELHEINVTPFIDVMLVLLIIFMVAAPLATVDIKV
FT                   DLPASSAVPQPRPEKPVFLTVKADNQLYVGDQPVDRETLATALDKVTQSNKETTIFFQA
FT                   DKVVDYETLMSVMDALRKSGYLKVGLVGMEAGSSGAK"
FT   gene            complement(527830..529371)
FT                   /locus_tag="YPDSF_0468"
FT   CDS_pept        complement(527830..529371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0468"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38881"
FT                   /protein_id="ABP38881.1"
FT                   /translation="MITFILEKYEFFIKNRQGAILLSFMALIPVFIGLIFLSFEFSHFI
FT                   QKRAKLSDALEQASLALSTENNYRNDRASNNRNNYLVTSYAQSYLPSERFSQPRVVNTY
FT                   NESLGYTEYNASLQMNYQLALLNSYLKQTPSPTWDVNENGAARKYLSSIAEPIDVVFVT
FT                   DFSGSMDLPFGDIERNNRITKLDELKAIFVKLNNRIFSNDGINTIGFVPFSWGTKRISA
FT                   NGQVSSTYCHFPYSPKKIDGNGHYLQRYTASNLKNIPGLDNLSGIDNLAYGQLDEDKHH
FT                   AILSEIEKKHRDNEIPTKTRDQAKNFLDKAYKVNQISTITKIVEEHIDYKETINSIDRN
FT                   GETIDIPMDDILDPFFCLKETNAKSLNFDPNSKGDINEILNMKAEGGTLASSGILVGNK
FT                   MLTESQNNNKLMIILSDGDDNTQKMSSPHDQKAGIINITQKLITEGMCQKIKDNGIKMV
FT                   FIGIGYVPDNNIIDWEKDCVGTGNFYLAKNAHELEISIERALVVDDEVGRNIPKS"
FT   gene            complement(529410..529982)
FT                   /locus_tag="YPDSF_0469"
FT   CDS_pept        complement(529410..529982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38882"
FT                   /protein_id="ABP38882.1"
FT                   /translation="MFRKNNTLINNQGGAIIVEFAFVTFIIVLFIKLLIAIAEYQSISG
FT                   KLDRLSYSAAGIIRERGRLYPHDPELNQQQVDQLRDLVQRALLNSGVPADNLRMRVETL
FT                   HFNPIEPPGSRQQQIDEHKSLSFSTGDCSPVQPLRGLVALSPLSQSERWVPLYQVTICL
FT                   PPPQRYRDLISVSPLPTLKSSAITIGR"
FT   gene            complement(529966..530439)
FT                   /locus_tag="YPDSF_0470"
FT   CDS_pept        complement(529966..530439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0470"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38883"
FT                   /protein_id="ABP38883.1"
FT                   /translation="MMRDTILRLLPANRGSIAVEFTLIFILFIFMLLLVAETSRLFYTS
FT                   ANLDFALSEAAKTAKNRDAENVLSYQQLFEHNFNRQVTVLGSLINTAPSAELTVNFSHS
FT                   VADLINGNSEENNHTLPLAHYQVRLHYQPIFLPFPQAWVNTLLSREVIFVQEK"
FT   gene            complement(530436..531206)
FT                   /locus_tag="YPDSF_0471"
FT   CDS_pept        complement(530436..531206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38884"
FT                   /protein_id="ABP38884.1"
FT                   /translation="MLKIFNTIIIIPVMIFLLSGCLSQQGLSSQGLSTKEFSYRESILI
FT                   KANNQIGLIKLYRESLKNKEDESIRVKLANAYYLSGDSHSSLYYLQPISHKPNVSIYLL
FT                   QIKNLINEGDNSGATTVLHRLLSIAPHNPEAHNLKGIILANRGDTAGARTAIVQSQALF
FT                   IQEDIARNNIAVISMLDNRYEDAVKILLPDYLSGKRNNLILHNLVFALIKMGDTRYAKN
FT                   IIEAERLSDNADELVLALSQVDSFPQEQSFIREK"
FT   sig_peptide     complement(531120..531206)
FT                   /locus_tag="YPDSF_0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.463 at
FT                   residue 29"
FT   gene            complement(531190..532023)
FT                   /locus_tag="YPDSF_0472"
FT   CDS_pept        complement(531190..532023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38885"
FT                   /protein_id="ABP38885.1"
FT                   /translation="MRIIFFTLLILLGLIIILKVNSRSRRISVYNKINSRENKSKEANN
FT                   DTKDKPTVLSDFIKLPVFLSNILYLKVLIVIFILSILTILAIFNVVNINQKTLLTIGLL
FT                   SIISTLYLPRMIIKNALTKRTNNLLKSLPFFIDITAACVQSGMTIENSLNYTTQKFQTI
FT                   NTDLCLIMSKVTKRAEINGLENAIKELQYYSPAIEMKMFCSTLQYSISFGSTVYEQLTH
FT                   LSQDMREMQLLMTEESISKLSTKLTLPLFLFILIPFVLLVISPSILELLNYVKNI"
FT   gene            complement(532020..532895)
FT                   /locus_tag="YPDSF_0473"
FT   CDS_pept        complement(532020..532895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0473"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38886"
FT                   /protein_id="ABP38886.1"
FT                   /translation="MIYYVVALSGILLLVLNNLKWMKIKRSISNTKKSKAKSTSSITIL
FT                   IKKIFFEWIDYVSTHSKSTPHILLPICSLVIVYYINSTWINVNYSFVFIINIIFIIVLQ
FT                   LKYARSKHYLLFKQDFPEVLLMINMAASSGASINQVLERCGKEIRGPLGQELGLICRRL
FT                   NLGETPETVFYDAYERFHYPEFYFLVTIILLNIQQGGQLKELITRLSQIITKKKTTEQK
FT                   KAVMTAQIRMSVNIISIMPMLFSFLLYLLDPTTIEFVWQHPTGRFIIYYIIISEVIGIL
FT                   IIRKMLGKSL"
FT   gene            complement(532892..534178)
FT                   /locus_tag="YPDSF_0474"
FT   CDS_pept        complement(532892..534178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0474"
FT                   /product="type II secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38887"
FT                   /protein_id="ABP38887.1"
FT                   /translation="MIVPLKIQELMRERMLANIDINKVELLVGDRNKLIGLLSQTFDDL
FT                   FNNNEYNLTTQAQKYIIEMIADEITGFGPLRELMEDDSISDIMVNGPERIFIERYGLLK
FT                   LTDRRFVNNTQLTDIAKRLMQKVNRRIDEGRPLADARLIDGSRINVAISPIALDGTALS
FT                   IRKFSKNKRRLEDLVDMGAMSSDMANFLIIAASCRVNIIISGGTGSGKTTLLNALSKYI
FT                   SEDERVITLEDAAELNLEQPHVVRMETRLAGLENTGQITMRDLVINSLRMRPDRIIIGE
FT                   CRGEETFEMLQAMNTGHNGSMSTLHANTPRDAVARLESMIMMGPVNMPLITIRRNIASA
FT                   INLIVQVSRMNDGSRKIRNISEIMGMEGEHVVLQDIFTFQPASTRDDQGRIQGEFINHG
FT                   LFNRSSVRINADIHNLANELNSVFSTVSK"
FT   gene            complement(534190..535317)
FT                   /locus_tag="YPDSF_0475"
FT   CDS_pept        complement(534190..535317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38888"
FT                   /protein_id="ABP38888.1"
FT                   /translation="MQLILNKDLINKKDNREKSAVVIISTRKGLKDKISEYVRLADIKN
FT                   IKEIDDDIFSAASILIPDNVKGIIIDINENHDINTILDLMKVHTPRDCWCILVGDIDSI
FT                   SIAQQFIERGILYLHIQSQLADLTQNLLKGIQIESDRKAFFISILGCRGGIGTTLLSYQ
FT                   LAHVITQIKKSPTLLLQGNQGSQDLDLITEKKMGEDITGYQKNFDLMRGNERKLSEVNE
FT                   HNNKKHNFIIFDQPIHNARKEKTLDYISNSNCIILLIDHSMMSVRVAKEFIDTLERFKR
FT                   DNRQAIRLFICLNENRPITKDMLTTSDIQSLLGHSIDTAIPYINNAKNSLNSPDYFGRK
FT                   KTKVVELAKQSLGININLSSHTNMWIREKLNKLFK"
FT   gene            complement(535615..536064)
FT                   /locus_tag="YPDSF_0476"
FT   CDS_pept        complement(535615..536064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0476"
FT                   /product="outer membrane secretin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38889"
FT                   /protein_id="ABP38889.1"
FT                   /translation="MNEKKRIRVMLGEEVSSIDKVFNLRGGDSYPSLRIRKANTTVELG
FT                   DGESFILGGLISSTERESLKKIPFIGDVPLLGALFRNAQTQRNQSELVVVATVNLVKPV
FT                   SARQIELPDFMHTSTVERFFNLTNIKDAKRRKQAKEFLQKGGFIK"
FT   gene            complement(536079..536933)
FT                   /locus_tag="YPDSF_0477"
FT   CDS_pept        complement(536079..536933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38890"
FT                   /protein_id="ABP38890.1"
FT                   /translation="MNLYQLKDKKQNIIIFLSIVILYFLFENSANAKQIYLPIGGSHII
FT                   KVQEEIDTVFVSAAKTADYEIVDNNSVIIYAKKEGLAEFTLFNKNHQPISKTRVLVNNT
FT                   INDAYRRIRTEFPDSKIEINKIGESYILTGSAETEEAKDTIASIVGEATASKKEKERET
FT                   SYQSNPEYQGVINKIKLPQANQVNVKLTIVEITKDFTENIGLDWNSIKSAAGAFQFLNF
FT                   NAQSISTLVHAINDEAIAKVLAEPNLSVLSGEYASFLVGGEIPIVSTNQNGISVELKSL
FT                   ALS"
FT   sig_peptide     complement(536835..536933)
FT                   /locus_tag="YPDSF_0477"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.568 at
FT                   residue 33"
FT   gene            complement(536930..537796)
FT                   /locus_tag="YPDSF_0478"
FT   CDS_pept        complement(536930..537796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0478"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38891"
FT                   /protein_id="ABP38891.1"
FT                   /translation="MNRKFLILFSLLIVAIGISGILLNPDKEIPELLTQTEKRKERNIV
FT                   LAQTRHDLTAGTLISKEDYSLQNITVDESSDLVKNDLSHGHRIDGDSIADDRTHDHKLD
FT                   GHLLKNNILAGSYIIDEMLISPDSREFSRLNLKHGEIIYKFYITEKNEYLLNTLNPGDF
FT                   LSFQLLTLETNKTKGMENGIAIDSKSMSSKQRQKYSLNNVIPDMPILSIKTYSPEELSV
FT                   KNNKNNKTEEYSLGYIEVIMKIQDLEFIHTVEKAGEVFLTPKSGDHKRIDLDDIIPTLQ
FT                   TIRELRG"
FT   sig_peptide     complement(537725..537796)
FT                   /locus_tag="YPDSF_0478"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.777) with cleavage site probability 0.521 at
FT                   residue 24"
FT   gene            complement(537848..538270)
FT                   /locus_tag="YPDSF_0479"
FT   CDS_pept        complement(537848..538270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0479"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38892"
FT                   /protein_id="ABP38892.1"
FT                   /translation="MDVIRLSLIVLIVSQLLFVCYSDIRHRIISNKFIISISFNAIIFS
FT                   LVMHHTVSIIIPIVALFIGYIIFHFNVMGGGDVKLITVLLLALTAEQSLNFIIYTAVMG
FT                   GVVMVVGLLINRVDIQKRGVPYAVAITAGFLSSVLI"
FT   gene            538470..538928
FT                   /locus_tag="YPDSF_0480"
FT   CDS_pept        538470..538928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0480"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38893"
FT                   /protein_id="ABP38893.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            539281..541761
FT                   /locus_tag="YPDSF_0481"
FT   CDS_pept        539281..541761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0481"
FT                   /product="outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38894"
FT                   /protein_id="ABP38894.1"
FT                   /translation="MRIIKKIPIAMTTSLIMLSGAVSAIDFNTDAMDANDKQNIDLSHF
FT                   TNVGYIMPGEYRLEINVNNHRIPEQVIAFYARDDEPNSSEVCLPEAVVEQFGLKPDVLQ
FT                   KITFWHEGQCADLRELAGLTTEVDLATSTLAINVPQDWMEYSDSNWVPSSQWDEGIPGF
FT                   LLDYNVNSLFSKPKESGSTRNISLNGTSGLNAGPWRLRGDYQGNYSHNSGEQNSSTSTF
FT                   DWSRIYMYRAIKSLAATLSVGENYFASSLFDTFRYAGASLSSDERMLPPNLRGYAPEVS
FT                   GIARTNAKVTVSQQGRILYQTTVASGPFRIQELSDSVSGRLDVSVEEQDGTVQTFQVET
FT                   AAVPYLTRPGAIRYKTSVGQPSTLNHGTEGPVFASGEFSWGVSNRWSLFGGAIGSGDYN
FT                   AVSVGVGRDLYAFGAISTDITQTRASGLPNQETQSGKSLRVRYAKRFDELNSDISLAGN
FT                   RFFEREFMSMNQYLGTRYFDNDLGRNKEMYTVTASKNFPDIQTNINFSYSYQNYWDQPT
FT                   SNSYSATVSHAFDAFSLKDMTVNLSASRSKNNGVNDDVLYLSFSVPLGNQQTLSYSGQH
FT                   NGQGNNQTVNYSNSSAIDSSYRLSAGVNNSNDNGARGQFSGFYIHRSSIAETSLNVAYA
FT                   QDDFTSTGVSMRGGATVTAKGAALHGPGMSGGTRLMVNTDDIAGVPLEERNIRSNRFGI
FT                   AVLNNINSYYRTDTRIDINQLADDVEVKQSAVEFALTEGAIGYRRFAMMKGEKVLATIS
FT                   LTDSSHPPFGSLVISAKGQELGIVSDDGFTYLSGVEPGETLDVVWSGAKQCQVAIPAVI
FT                   QPQAQILLPCISVN"
FT   sig_peptide     539281..539355
FT                   /locus_tag="YPDSF_0481"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.797 at
FT                   residue 25"
FT   gene            541779..542498
FT                   /locus_tag="YPDSF_0482"
FT   CDS_pept        541779..542498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0482"
FT                   /product="fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38895"
FT                   /protein_id="ABP38895.1"
FT                   /translation="MKKLSLIALTSTVVFTSYTANAAIALDRTRIIYNGQDKSISLNIS
FT                   NENKTLPYLAQAWIENEQQQKVTTPLVATPPVQRVEAGKKSAVRISATPEALKLPQDRE
FT                   SLFYFNLREIPPRSEKSNVMQIALQTKIKLFYRPEGITPATGQIWQEQLVLHKTAQGFR
FT                   LENPTPYYITVVGLAEKGKSSADSNFQPLMVAPKSSAELKSASFTAPVLTYINDYGGRP
FT                   ELSFSCSGSTCRAAKAI"
FT   sig_peptide     541779..541847
FT                   /locus_tag="YPDSF_0482"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.859 at
FT                   residue 23"
FT   gene            542523..542864
FT                   /pseudo
FT                   /locus_tag="YPDSF_0483"
FT   gene            542834..543628
FT                   /pseudo
FT                   /locus_tag="YPDSF_0484"
FT   gene            complement(543840..544919)
FT                   /locus_tag="YPDSF_0485"
FT   CDS_pept        complement(543840..544919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0485"
FT                   /product="periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38896"
FT                   /protein_id="ABP38896.1"
FT                   /translation="MFLYMTYIERKIRHSLFISLGCLGLILSLSGCEPAEETNFHPFPI
FT                   DENHSTSSPWSRTVDTVKGPVTLTHKPARIVSTSITITGTLLAINAPIIASSATEPNTT
FT                   LADNKGFFTQWSDIARARHLIPMYQTEPNIKAVAKMRPDLIIISATGDDSTLELYDQLS
FT                   AIAPTLVINYDDKSWQELTLQLGQATGHEGDAEQVIDKFARRLNEVKQKITLPPQPVSA
FT                   FVYQEVSGSAKLWTENSAQGRLLLELGFTLANVPDTLKDNTHTEHRKDIIQLGGDELAQ
FT                   GLNGKTILLFSGVHSAIDALKSNKFLTNLPAIQHDNVYAAGYDTFRLDYYSANNLLTRI
FT                   ESMFKGKKDSEPTYHESRT"
FT   sig_peptide     complement(544824..544919)
FT                   /locus_tag="YPDSF_0485"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.859 at
FT                   residue 32"
FT   gene            545775..546770
FT                   /locus_tag="YPDSF_0486"
FT   CDS_pept        545775..546770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38897"
FT                   /protein_id="ABP38897.1"
FT                   /translation="MNILSLRGGFFLWMMLISTSSLAINCQRASTPVEYTVCSNEDLHW
FT                   LAQTFNSIYQVLLVKYNTEMVYQQRQTWEKSLNSCTSDSCIQRAYLQGIALMSDVDKNF
FT                   NWDGQWWNITKGNDRGGVIEIHRVTEWGFSLDSRAWSGENMGNFHAEARKTEGVAVVDV
FT                   IENTANCRLLLIPGKDGSLQVHSNGSWGCRISMPKDVFIDGQYVRAEKDPRKAPTLLSI
FT                   GIFSEASVDDAFRNLVGEHYAQFVQSANVYIYTNDLDNQGAKVLSTWVRGAANKRASII
FT                   MYTHTGQYWAAYVAPDKKGQLQIHYFTNVAADKNKRPKTIVEWQQSFIDN"
FT   sig_peptide     545775..545846
FT                   /locus_tag="YPDSF_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.776 at
FT                   residue 24"
FT   gene            complement(546862..547440)
FT                   /locus_tag="YPDSF_0487"
FT   CDS_pept        complement(546862..547440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0487"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38898"
FT                   /protein_id="ABP38898.1"
FT                   /translation="MDKMKIKRAAGLPLLLILTACQTSPLLQSAEINKRATQGKWSFTF
FT                   VTPESQPAQVTYARIVDTADNLHPFNTRDMTQNSPSQMGESGELIHQTSIHFNQTNSPP
FT                   QSMVFCWNSIADKKVYETHLVLPQSVRQSMITPARTGNTTQYKTMLLGLSPGGKVLVWL
FT                   QDEGGPQNNRVPIVNINTLSGDKLAICKS"
FT   sig_peptide     complement(547351..547440)
FT                   /locus_tag="YPDSF_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.823 at
FT                   residue 30"
FT   gene            547443..547565
FT                   /locus_tag="YPDSF_0488"
FT   CDS_pept        547443..547565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38899"
FT                   /protein_id="ABP38899.1"
FT                   /translation="MLSLLLFFIITVTYYYSVYSVYSVYSVLVSGEMLTTEQVS"
FT   gene            complement(547634..549730)
FT                   /locus_tag="YPDSF_0489"
FT   CDS_pept        complement(547634..549730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38900"
FT                   /protein_id="ABP38900.1"
FT                   /translation="MMKHKLYDISRLLKETHIAVPVLLLCVLAMVILPLSPLVLDILFT
FT                   FNILMAVLVLLVSVNSKRPLDFSILPPILLIATLMRLTLNVASTRVVLLNGHEGADAAG
FT                   KVIEAFGQVVIGGNFVVGFVVFIILMIINFVVVTKGAERVSEVSARFTLDALPGKQMAI
FT                   DADLNAGLINQEQASIRRKEVASEADFYGAMDGASKFVRGDAVAGMMILVINVIDGICI
FT                   GIFKYDLSASQSFQQYVLLTIGDGLVAQIPSLLLATAAAIIVTRVSDGGDMTDEVKDQL
FT                   LAKPTILYAAAFVMFILAIVPGMPHLAFLSFTGLLLFAARQQSKKIQQADLNPDFTALN
FT                   PVISDENALSISWDSIPAVEPIGLNLGYKLVTLVDESKGKPLNQRLRGVRQIISESSGV
FT                   LLPEVRVRENFRLKPSQYTININGVRIAGGEVHVDKLMAIPTTQQYGEVDGILATDPTY
FT                   GLAIVWIDPQEKPQALNLGYQVVDCASVVATHVNKVVREHLSELFNYDDITLLHQRLAA
FT                   LSPRLAEDLVTTLNFSQLLKVYRQLLTENVSLKDIVTISTTLLDSVTVTKDALLLTSDV
FT                   RYALRNGIVNSINGDDKDLAVYTINNELENMLLSSLNQAQQAGKVVLDNFPVDPNILTQ
FT                   LQQNLPIIKEQMKAENHQPILLVTPQLRPLISRYARLFCSGLNVLSYNEIPDDMNLNVI
FT                   GVLE"
FT   gene            complement(549717..550850)
FT                   /locus_tag="YPDSF_0490"
FT   CDS_pept        complement(549717..550850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0490"
FT                   /product="flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38901"
FT                   /protein_id="ABP38901.1"
FT                   /translation="MSNSSGEKSEKPTAGKLSKARKKGDIPRSKDVTMAAGLVTSFILL
FT                   SLFLPYYKALVSQSFVSVAQLASQLDDQGALEQFLLANLFIFAKFLATLIPIPLFSMLA
FT                   TLIPGGWNFTPVKLIPDLKKLSPLAGIKRIFSASNGTEVLKMLAKCSIVLYTLYLVVHS
FT                   SLDDLLHLQTLPLEEAITQGFAQYHHILLYFIAIVVVFAAIDIPLSHHLFTKKMKMTKQ
FT                   EVKQEHKNNDGNPEIKSRVRQLQRQYAIGQINKTVPSADVIITNPTHFSVALKYAPEKA
FT                   SAPYIVAKGKDDIALYIRSIAQKHKIEIVEFPPLARAIYHTTKVNQQIPAQLYRAIAQV
FT                   LTYVMQIKSWRSGQASKPVLNTHLGLPKEMQRFHDET"
FT   gene            complement(550850..551623)
FT                   /locus_tag="YPDSF_0491"
FT   CDS_pept        complement(550850..551623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0491"
FT                   /product="flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38902"
FT                   /protein_id="ABP38902.1"
FT                   /translation="MGIDIHAMTAPLFALWLPFVRILSFLHFCPVIRHKAFTRKAKIGT
FT                   ALLLAILITPMISQPVVSGELLSIENLLLAGEQILWGWLFGSMLHLVLAALEAAGQILS
FT                   MNMGLGMAMMNDPTSGASTAVISQIIFTFSVLIFFTLNGHLLFVTILLKSFSSWPIGEA
FT                   INDFSLRSLALSLGWILSSATLLALPTTFIMLIVQGSFGLLNRISPTLNLFSLGFPIGM
FT                   LFGLLCLLLLAINIPDHYLHLTNEILTQFERMKVH"
FT   gene            complement(551630..551902)
FT                   /locus_tag="YPDSF_0492"
FT   CDS_pept        complement(551630..551902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0492"
FT                   /product="flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38903"
FT                   /protein_id="ABP38903.1"
FT                   /translation="MMTTDIAGDIIAMGLHLVLMISIVAIVPSLLIGLLVSIFQATTQI
FT                   NEQTLSFLPRLVMTMLVLIFAGKWMMIKLSDFTVSIFQQAAQLVG"
FT   gene            complement(551904..552674)
FT                   /locus_tag="YPDSF_0493"
FT   CDS_pept        complement(551904..552674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0493"
FT                   /product="flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38904"
FT                   /protein_id="ABP38904.1"
FT                   /translation="MSRSLRAITPVTIISRGLLVGGLLYSPLLLAQEGGITLFNTVQTA
FT                   TGQDYNVKIEILILMTLLGLLPIMMLMMTCFTRFIIVLAILRQALGLQQSPPNKVLTGI
FT                   ALALTLLVMRPVWTKIHQDAVIPFQQDEITLSQALGRAEAPLKNYMLAQTSTKSLDQMM
FT                   AIAQVSGEPQQQDLSVVTPAYVLSELKTAFQMGFMIYIPFLVIDLIVASILMAMGMMML
FT                   SPLIVSLPFKLMLFVLCDGWTLMVGTLTASVQGL"
FT   sig_peptide     complement(552579..552674)
FT                   /locus_tag="YPDSF_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.988 at
FT                   residue 32"
FT   gene            complement(552671..553084)
FT                   /locus_tag="YPDSF_0494"
FT   CDS_pept        complement(552671..553084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0494"
FT                   /product="flagellar switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38905"
FT                   /protein_id="ABP38905.1"
FT                   /translation="MTDQQIELNNDLDFTLALDESAISPTEHFDSVINSPEIINTPEKT
FT                   ATKTDEQKRKMSLFSRIPVTLTLEVASVEIPLSELLTVNNDSVIELDKLAGEPLDIRVN
FT                   GIMFGQAEVVVINEKYGLRIININSQNLGELAL"
FT   gene            complement(553077..553976)
FT                   /locus_tag="YPDSF_0495"
FT   CDS_pept        complement(553077..553976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0495"
FT                   /product="flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38906"
FT                   /protein_id="ABP38906.1"
FT                   /translation="MQSNKVKAKVYNHDPRPDIVSLEINKLGRPHHKIPKIVNSYFSII
FT                   ESEISLYFLKKYRINITLDDIKFQTNCSHKNAKMLTSQMGNIAFDIDRLLLLNILNDYY
FT                   GLSQEKYGLSQEKKTTTTGKLSPLTKTEERLKNKLGLEITDLFLNQPFFGEHLIINNST
FT                   AALIACWSYRIDFFLKDYNKSGFSIFIDAPHIDRLIDTIKTKNEKAVEKNVSLSERQLE
FT                   HLVKKLPVTLTSQLSNINLTLAELMALKEGDIISASLPEYFPVFIGKEALFSAAITENR
FT                   GKLFFSEFNDQPNEMNHD"
FT   gene            554491..555519
FT                   /locus_tag="YPDSF_0496"
FT   CDS_pept        554491..555519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0496"
FT                   /product="sigma-54 transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38907"
FT                   /protein_id="ABP38907.1"
FT                   /translation="MMNINVDVFPKNDHGFVANAPSSVSVFSLARRVAEFNVPVLVTGE
FT                   TGTGKECVAKYIHQKAMGDASPYIAVNCAAIPESMLEAILFGYEKGAFTGAIASVAGKF
FT                   EQANGGTLLLDEIGDMPLALQVKLLRVLQEQEVERLGGHKPIPLDIRIIASTNKDLSVE
FT                   IAEGRFRQDLYYRLSVVPIHILPLRERPEDILPLVKAFINKYQSFLNVKIDITAEAQCE
FT                   LYKYTWPGNVRELENVIQRGIIMSNNGVIELPSLGLPMAQGISSPVGETSLPFSTIQPP
FT                   DGENNIKLRGRLAQYQYIVDLLQRHQGNKSKTAAFLGITPRALRYRLANMREDGIDIEC
FT                   HS"
FT   gene            555536..555916
FT                   /locus_tag="YPDSF_0497"
FT   CDS_pept        555536..555916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0497"
FT                   /product="flagellar hook-basal body complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38908"
FT                   /protein_id="ABP38908.1"
FT                   /translation="MDNIDSINMPRSQSPVMLEMRQMAAMAGSGLEFGTIQPAATNSPF
FT                   FPVEKGANNLSFSQVLNGAIKSVDQLQHVASEKQTAMDMGISDDLTGTMLASQKASVAF
FT                   SAMVQVRNKLTSALDDVMNTAL"
FT   gene            555926..557566
FT                   /locus_tag="YPDSF_0498"
FT   CDS_pept        555926..557566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0498"
FT                   /product="flagellar M-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38909"
FT                   /protein_id="ABP38909.1"
FT                   /translation="MLDKIKQKLSPGQLGENTKTILMSAVALLVTAAIIFSLWRSSQGY
FT                   TALFGSQENIPITQVVEVLEGEAIAYRINPDNGQVLVAENQLGKARILLAAKGITATLP
FT                   IGYELMDKESMLGSSQFIQNVRYKRSLEGELAQSMMALSAVEYARVHLGMSEASSFAIS
FT                   NHADNSASVVLRLRYGQTLSTEQVGAIVQLVAGSIPGMKPANVRVVDQHGELLSQAYQA
FT                   NSEGVPSVKSGTELAHYLQSTTEKNIANLLNSVIGANNYRISVSTQLDMSRIEETAEHY
FT                   GPDPRINDENIQQENSNDDMAMGIPGSLSNQPIPQSQAGQTPAAVSRSQAQRKYIYDRN
FT                   IRHVRYPGYKLEKMTVAVVLNKSLPVLEQWTPEQQEELKRLIEDAAGIDVKRGDSLTIN
FT                   MMAFAVPTLIDEPVMPWWQEPSTFRWAELLGIGLLSLLVLWFGVRPLMKRYSRKGSENL
FT                   PLAISSASADEALDHVDTGVDGAESSPRTENAFSASSLWKSDDLPEQGSGLETKIAHLQ
FT                   QLAQSETERTAEVIKQWINSNERIKSQPE"
FT   sig_peptide     555926..556060
FT                   /locus_tag="YPDSF_0498"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.656) with cleavage site probability 0.558 at
FT                   residue 45"
FT   gene            557538..558581
FT                   /locus_tag="YPDSF_0499"
FT   CDS_pept        557538..558581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0499"
FT                   /product="putative flagellar motor switch protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38910"
FT                   /protein_id="ABP38910.1"
FT                   /translation="MNESNLNLNDDSSVKSDTKGRSRLEQASILLLSIGEEAAAMVMQQ
FT                   LSREEVVCVSQMMSRLHNIKLDQARQALDDFFQDYREQSGINGASRSYLQAILNKALGS
FT                   DIAKSVINGIYGDEIRHRMTRLQWVDTPQLVALIDQEHLQLQAVFLAFLPPDVAAAVLA
FT                   YLDKDRQDDILYRIAKLDDVNRDVVDELDRLIERGVAVLSEHGSKVIGIKQAANIVNRI
FT                   PGNQQQLLDQLGERDEEVLNELKDEMYEFFILSRQSEATLQRLMDLIPMSDWAIALKGT
FT                   EPALRQAIYDVLPKRQIQQLQNATQRTGAVPVSRVEHIRKVIMAQVRELAEAGEIQVQL
FT                   FAEQTME"
FT   gene            558586..559302
FT                   /locus_tag="YPDSF_0500"
FT   CDS_pept        558586..559302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0500"
FT                   /product="flagellar assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38911"
FT                   /protein_id="ABP38911.1"
FT                   /translation="MLIKNTPRAGAVKLRVHQFPPLRKVRQVAPSAADQTLDPAEYQKQ
FT                   LMAGFQEGISQGFDKGLAEGKEEGYQEGVRLGHDDGLKKGRIEGRQSELASFNDVIKPF
FT                   SGYITQLHTYLETYEQRRRDELLQLVEKVTRQVIRCELALQPAQLLTLVEEALAALPMV
FT                   PQQLKVYLNPAEFGRINDVAPEKVQAWGLAADPDMVGGECRIVTETTEIDVGCQHRLDQ
FT                   CIGALHSSFLTEPHHE"
FT   gene            559295..560623
FT                   /locus_tag="YPDSF_0501"
FT   CDS_pept        559295..560623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0501"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38912"
FT                   /protein_id="ABP38912.1"
FT                   /translation="MSESPALDHALKSIENIHLARVAGRLVRVTGLLLESVGCRLAIGQ
FT                   RCRIESVDETFIEAQVVGFDRDITYLMPFKHPGGVLGGARVFPSEQDGELLIGDSWLGR
FT                   VINGLGEPLDGKGQLGGSTPLQQQLPQIHPLQRRAVDTPLDVGVNAINGLLTIGKGQRV
FT                   GLMAGSGVGKSVLLGMITRYTQADVVVVGLIGERGREVKEFIEHSLQAAGMAKSVVVAA
FT                   PADESPLMRIKATELCHAIATYYRDKGHDVLLLVDSLTRYAMAQREIALSLGEPPATKG
FT                   YPPSAFSIIPRLAESAGNSTMTAIYTVLAEGDDQQDPIVDCARAVLDGHIVLSRKLAEA
FT                   GHYPAIDISQSISRCMSQVIGSQQAKAASLLKQCYADYMAIKPLIPLGGYVAGADPMAD
FT                   QAVHYYPAITQFLRQEVGHPALFSASVEQLTGMFPSFAPTDEA"
FT   gene            560627..561064
FT                   /locus_tag="YPDSF_0502"
FT   CDS_pept        560627..561064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38913"
FT                   /protein_id="ABP38913.1"
FT                   /translation="MSDMIDTLQQLQQLRQRSLNQVTSQLTQQKQLCQRYQRNINALNA
FT                   LTLSEEAFPGVSALQMANHAGYQRHIQRLIDWQKQEQALADIEVGNLQTQMQQQARREK
FT                   IVAVVLEQQQEEYQREQGRLAQKNTDALATQCWQRQQAGDI"
FT   gene            complement(561392..561817)
FT                   /locus_tag="YPDSF_0503"
FT   CDS_pept        complement(561392..561817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38914"
FT                   /protein_id="ABP38914.1"
FT                   /translation="MEPTQRVKQLLIDIQEDRKRYIALEKLLIKQRELMIGHKTEALEA
FT                   LNPQLTELYSVLDNTATERRLLMQQLQLPANKEGIHQLLSRLPAHYREHAGALWADLRL
FT                   RAHACHQQNHHNGMLLTQQIALLSSLAEQPTEFLYAG"
FT   gene            complement(561824..562090)
FT                   /locus_tag="YPDSF_0504"
FT   CDS_pept        complement(561824..562090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0504"
FT                   /product="flagellar regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38915"
FT                   /protein_id="ABP38915.1"
FT                   /translation="MEINTHRRRPFVAQPVSTDTVSAVKAIEPIKTVTNNPHYATSDLH
FT                   AQLDAMPEVDSEKVDAAKAAILAGRITLDSAAVARAILNFHGR"
FT   gene            complement(562319..563236)
FT                   /locus_tag="YPDSF_0505"
FT   CDS_pept        complement(562319..563236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0505"
FT                   /product="flagella basal body P-ring formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38916"
FT                   /protein_id="ABP38916.1"
FT                   /translation="MDAHKIRPVLMLKHSCCTKSHHSTQLTCQVYNIIINSIFYFYCSP
FT                   KWKVNFRLSVTFSIRVRHCLQSLLICGALLCANTISAAENNTRKQVYTQALHAATADIA
FT                   QTAKNKNWQGYSVKMNIFIPAEISRYKPCQKALQVALPTAETQHLSRLRYEISCPDGQG
FT                   WEVVATVKPDIYLPIWVAKQTLERGRKVQADDIELKKKNITGVQGGYITDPDEILGLTI
FT                   KRRIRQLQAVIPSQLEQPVLVTRNQHVLMLAAQDGIEAQMLGIAQKNGRKGELIKVKNL
FT                   SSGRVVTATVDGSGRVRMLGLSTP"
FT   gene            563264..563671
FT                   /locus_tag="YPDSF_0506"
FT   CDS_pept        563264..563671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0506"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38917"
FT                   /protein_id="ABP38917.1"
FT                   /translation="MAMQLRLTRAELLSANLANVNTPNFQAKDIDFAAEMQRAKRGNGV
FT                   MAAPDRSSAQMLSTQMSSAQMSSPQMMSSPQIMSSPQIKYRLPYQPSLDGNTVALNVEQ
FT                   AEFSKNALDYQTSLSFLNMKLTGLKQAIEGK"
FT   gene            563674..564099
FT                   /locus_tag="YPDSF_0507"
FT   CDS_pept        563674..564099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0507"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38918"
FT                   /protein_id="ABP38918.1"
FT                   /translation="MSFNQIYRVAGSAMTAQTIRLNTIASNLANAESPAASAATVYKAR
FT                   SPVFSAVYSARTAADPRGVQSAQVQVLDVVEVGGSVQRYEPNHPMANPQGYVFYPAVNV
FT                   VSEMADMMSASRSFETNVEVLNSVKSMQQSVLKLGER"
FT   gene            564102..564758
FT                   /locus_tag="YPDSF_0508"
FT   CDS_pept        564102..564758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0508"
FT                   /product="basal-body rod modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38919"
FT                   /protein_id="ABP38919.1"
FT                   /translation="MQINESRNSANVGNQSPAPEGGLPGGEQLNNQFMTLLVAQIKNQD
FT                   PLNPADGTEFVSQMAQLSQVQATENMAKLLKSNTVQMAKMQTMATANLVGQQVMVEGHE
FT                   ITLGKDPVAGRLTLKQPAPTLLLHITDILGQEKVIDLGKQPAGPVNFTLDPAAAKLQPG
FT                   QYQLSAVSGSGEELIPLEVAGKVNNVRISPQGGAPQLNITGLGEVSYSQITQFGA"
FT   gene            564813..566054
FT                   /locus_tag="YPDSF_0509"
FT   CDS_pept        564813..566054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0509"
FT                   /product="flagellar hook protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38920"
FT                   /protein_id="ABP38920.1"
FT                   /translation="MSFSIANTALNAHTEQLNTISNNIANSATKGFKASRTEFSSMYAQ
FT                   SQPLGVAVSGVSQNISKDGQKEKTGMGLDLAISGGGFFVVRESSGDKAYTRAGMFRSDV
FT                   DGYLVNGQGMKLQGYPADAAGNIQAGIISDLKINNAGVPAKASEQLDFMANLNASVTAP
FT                   SVSVFNPTNEKSYNFTTTSTVYDSLGREHAVAHYFVKSTTPPAGSVASEWAVHHTVDGG
FT                   TATPPLTLQFTDTGALIPGIPAAGSGMKGSAINLHGTFNPAGAADYDIDIDYTGTTQLS
FT                   QGFTTTRNKSDGYTSGVKNAERIESDGSVYATFSNGERVLQGKVVLANFASPSGLVTQN
FT                   GTSWSESNKSGAALLGTPGTGLLGSLESGALENSNVDITAELVGLMTAQRNYQASTKII
FT                   STNDSMMNALFQVL"
FT   gene            566054..566785
FT                   /locus_tag="YPDSF_0510"
FT   CDS_pept        566054..566785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38921"
FT                   /protein_id="ABP38921.1"
FT                   /translation="MDKLLYTAVSGANRSLSQQQIHANNLANSNTQGFRADLEKATATQ
FT                   VMGGGYSSRVAVLSQNAGVDMTPASLQETGRDLDIALKNQGLIAVLSGGREAYTRNGQM
FT                   DVSAEGALTINGLPVLGDGGPIVLPPYSALSIADDGTIAIIPQAGGIKTPEEIERIKLV
FT                   DIPANQLRKNNRGLLVSNRGPAARDETVQVVNKHLESSNVSAISEMIASISLSRQFEAQ
FT                   IKMMKVAEDLAQAGNRMIRGS"
FT   gene            566853..567638
FT                   /locus_tag="YPDSF_0511"
FT   CDS_pept        566853..567638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0511"
FT                   /product="flagellar basal-body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38922"
FT                   /protein_id="ABP38922.1"
FT                   /translation="MNSALWVSKTGLAAQDAKMGAISNNLANVNTDGFKRDRVVFADLF
FT                   YQNQRTPGAPLDQNNTTPSGIQFGSGVQIVGTQKQFTVGNIKVTKGDMDVAITGQGFFQ
FT                   IETADGGIAYTRAGNLTTNADGVLVNAQGMPLIPQIELPTGSKQLHIGKDGTVTATVGG
FT                   ETEPVEVGQITLVNFINPAGLEAIGGNLYRETAASGEAVEGVPGEEAFGQLEQGALEGS
FT                   NVQVVEEMVDMITVQRAYEMNAKMVSAADDMLKFVSQKL"
FT   gene            567673..568338
FT                   /locus_tag="YPDSF_0512"
FT   CDS_pept        567673..568338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0512"
FT                   /product="flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38923"
FT                   /protein_id="ABP38923.1"
FT                   /translation="MKRFLILTPMVLALCGCESPALLVQKDDAEFAPPANLIQPATVTE
FT                   GGGLFQPANSWSLLQDRRAYRIGDILTVILDESTQSSKQAKTNFGKKNDMSLGVPEVLG
FT                   KKLNKFGGSISGKRDFDGSATSAQQNMLRGSITVAVHQVLPNGVLVIRGEKWLTLNQGD
FT                   EYMRVTGLVRADDVARDNSVSSQRIANARISYAGRGALSDANSAGWLTRFFNHPLFPI"
FT   sig_peptide     567673..567747
FT                   /locus_tag="YPDSF_0512"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.370 at
FT                   residue 25"
FT   gene            568352..569527
FT                   /locus_tag="YPDSF_0513"
FT   CDS_pept        568352..569527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0513"
FT                   /product="flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38924"
FT                   /protein_id="ABP38924.1"
FT                   /translation="MFLNRIHFSALMRFFSVSIRFLSVLIKTRHCFVLLGLWLVLPTAS
FT                   AQPLGSLVDIQGVRGNQLVGYSLVVGLDGSGDKNQVKFTGQSMANMLRQFGVQLPEKMD
FT                   PKVKNVAAVAISATLPPGYGRGQSIDITVSSIGDAKSLRGGTLLLTQLRGADGEVYALA
FT                   QGNVVVGGIKAEGDSGSSVTVNTPTVGRIPNGASIERQIPSDFQTNNQVVLNLKRPSFK
FT                   SANNVALALNRAFGANTATAQSATNVMVNAPQDAGARVAFMSLLEDVQINAGEQSPRVV
FT                   FNARTGTVVIGEGVMVRAAAVSHGNLTVNIREQKNVSQPNPLGGGKTVTTPESDIEVTK
FT                   GKNQMVMVPAGTRLRSIVNTINSLGASPDDIMAILQALYEAGALDAELVVI"
FT   sig_peptide     568352..568492
FT                   /locus_tag="YPDSF_0513"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 47"
FT   gene            569537..569830
FT                   /locus_tag="YPDSF_0514"
FT   CDS_pept        569537..569830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0514"
FT                   /product="flagellar protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38925"
FT                   /protein_id="ABP38925.1"
FT                   /translation="MIEAINKSSPVIPGSFVGDLQPQDLEQAAVQFEAVFMRTLLQQMR
FT                   KAAEVLAADDDPFNSKQQRMMRDFYDDKLASTLASQRSSGIANLLIQQLGSK"
FT   gene            569943..571304
FT                   /locus_tag="YPDSF_0515"
FT   CDS_pept        569943..571304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0515"
FT                   /product="flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38926"
FT                   /protein_id="ABP38926.1"
FT                   /translation="MNFIRTAFSGMQATQAHLNATSMNIANMHTPGYSRQRAEQSAIGA
FT                   DGQGGVNAGNGVNVDGIRRLSQQYVVMQEWRANSQQQYYDAGEQYLNAVELMVSNESTS
FT                   LATGLNNFFSSLSAATQLPDSPPMRQQIIESANAMALRFNNVNNFIVQQKKSIGQQRDI
FT                   TVKEINSLTRSIADYNQQILKNRSDGNNINDLLDKQELQIKKLSGLIETQVNQAEDGTY
FT                   RISVKQGQPLVNGAVAAELAVDTSSVDTKITLHFSGATQGMNMSCGGQLGGINDYELTT
FT                   LKKLQDSTQEMAKTVADKFNDQLGKGTDFTGAPGQDLFVFNPSDPNGMLQLSAITAEQL
FT                   ALAAHGKPAGDNSNLFELLDIRKTPVTGMKNVPLDDAATALVGYIAITSNRNHSELENA
FT                   ENTLNQATRYHESFSGVNNDEEAMNLMEYQRAYQSNMKVIATGDKLFSDLLALV"
FT   gene            571333..572256
FT                   /locus_tag="YPDSF_0516"
FT   CDS_pept        571333..572256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0516"
FT                   /product="flagellar hook-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38927"
FT                   /protein_id="ABP38927.1"
FT                   /translation="MRVSTPTMSSTMNRFITQHNEKLEKINKQMMTQQRITLPSEDPIA
FT                   STRLLQINREQANIKQYSSNISGLSNSLTNQTGHVSAINKQLVSIKSSLVSINGNIKSN
FT                   KDIAGVADELNYMLESVVAGLNAKNSEGRYLFAGTASNKQPITFDSAKNKYTYVGNSDN
FT                   RQTGVGEGVKITENVHLQSGFTDTSGDLATLNKLKKLCDNIKKPILPAAVASHTAAIDE
FT                   MMGLIDNASDHMGVTLTELGIRQKHSQLLQKNHEEMELSNATIQENLVGLDLAESYMEL
FT                   MNLMAVTNANYTTFKQINSLSLFNLI"
FT   gene            572268..573281
FT                   /locus_tag="YPDSF_0517"
FT   CDS_pept        572268..573281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38928"
FT                   /protein_id="ABP38928.1"
FT                   /translation="MQVGLNRPQWEVANKTSLPDFDRLQGANSLSLIKKEVDFPESPFI
FT                   SSQPLRYNVQLNRQLTALQRAEGYLHTTERQVAQLQRALQQERAETEIKPLALKTLHWL
FT                   QQRTAMSGNAVDRQLNFVPEQRTEVNFALHGAEQLLQPAESETLLFSLTGNGYNVVAVN
FT                   LPAYASPAQNLLRLNNGLGRLGIHGRLDPQGNAQFHVDEKRWAEIEAHLQVRGGGGRFA
FT                   KESFQPLKLQPEVVLEDRVRDIAAKPQEAKKHLAGIQQAMGQITGQMRKLSEHKRNTGV
FT                   QINSMSSFSAPNSALMAAEALAEKLLQGRSQYAMWANMLTAQGNARSAMVRNLLGG"
FT   gene            complement(573445..573891)
FT                   /locus_tag="YPDSF_0518"
FT   CDS_pept        complement(573445..573891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38929"
FT                   /protein_id="ABP38929.1"
FT                   /translation="MKWLTASNGILLSILGLFLSLAALASSEGKKKPTLADAQLQMGFY
FT                   DLLSQQKEIYDARITATQGGVISTITSPNDNRFIFKGKFTEQTTQNSQLSFSYSPIFFN
FT                   NPTSGRMIEGFLDYLMHNTVFMTPMVVEGQPLLVGQSGIVLGEK"
FT   sig_peptide     complement(573814..573891)
FT                   /locus_tag="YPDSF_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 26"
FT   gene            complement(573872..574918)
FT                   /locus_tag="YPDSF_0519"
FT   CDS_pept        complement(573872..574918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0519"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38930"
FT                   /protein_id="ABP38930.1"
FT                   /translation="MHTIIEKNMNKQSHIVNGWLIDLTSGFITHQETREKKRLGEYQLK
FT                   LINVLLEHAGEILSRDELTNLVWKRRVIGNNSLPNAIHTLRVALGDENKQQRIIQTIPK
FT                   IGYLLDASFCEIIDATKETETAEQTALAQTDDEEIVAPLNGVTLHEAVAASASDIAHSR
FT                   IAETNEEPADTAINAPLPPTQTGPVVMTRQHVTASQRPPWNIFSYWSRVAIALLVLITA
FT                   VAFYRLFPQNKGVSYTAIEQDQEAYSNIRLFQLVDSALSLQQEEKLNQRLKDTLYAINK
FT                   QSKAKSMSINIYYYVSLRRLDFTFSVESQCENKQLGMTIYHWRQNSQLLNNLIYREMER
FT                   KINEMVNC"
FT   gene            575544..576749
FT                   /locus_tag="YPDSF_0520"
FT   CDS_pept        575544..576749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0520"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38931"
FT                   /protein_id="ABP38931.1"
FT                   /translation="MSLSIHTNASAKTAINSLSNEGLANAKSSQRLSTGFRINSPADNA
FT                   AGLQITNRMEKFLNSAGQAKQNIQESIAMLQIADGGLAESVKTLNAMKKLATQAANDTN
FT                   SAADREAIQKEFSELGKELQNALNNTEYNSEKLFADGGKMRKELNFQSGTDAESSLKLD
FT                   LNSVIAELTESVTKPGLKANSGGTAEEKELARLEGLAKDAKSTAATTKSAETTLLVDDA
FT                   TGKGGKGGNASIDIIIPAHKDTTGKDVAEKKIASGTAITPANITSMADAKAYWDKQEIE
FT                   TPKAVNEYVVKHSADSGVMNMQLADKDLAMKADKKLSDVIDAYGAFRATLGANQNRLQS
FT                   SSNNLDNMISNTAQALGSIKDTDFADEMKNHAQSEMLMQSSVMMLKKANAATQLISTLL
FT                   QG"
FT   gene            577308..578504
FT                   /locus_tag="YPDSF_0521"
FT   CDS_pept        577308..578504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0521"
FT                   /product="flagellin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38932"
FT                   /protein_id="ABP38932.1"
FT                   /translation="MSLSIHTNGSAKTAINSLSKAGLANAKSSQRLSTGFRINSPADNA
FT                   AGLQITNRMEKFLNSAGQAKQNIQESIAMLQIADGGLAESVKTLNTMKKLATQAANDTN
FT                   SAADREAIQKEFTELGQELQNALNNTEYNAEKLFADGGKMRKELNFQSGTDANSSLKLD
FT                   LNKVIEELTESVTEERKKVTGTSASATGSLEKQAFDLNEATTKANTALKEAEILQEKIT
FT                   TNLTKTFPASVDIPGYINAKGVPVAHEIIPSGTPINTGHIGKIQTAVAALRATHDTAAK
FT                   TEDEFQAEHSTGGGVMNLLLRNKDRAMEADKKLSDVIDAYGAFRATLGANQNRLQSSSN
FT                   NLDNMISNTTQALGSIKDTDFADEMKNHAQSEMLMQSSVMMLKKANAATQLISTLLQG"
FT   gene            579165..579950
FT                   /locus_tag="YPDSF_0522"
FT   CDS_pept        579165..579950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0522"
FT                   /product="transposase for insertion sequence IS1661"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38933"
FT                   /protein_id="ABP38933.1"
FT                   /translation="MARSTYYYHASKPDGVIDDYADAVKAIGALSRRHAQRYGYRRMTV
FT                   ALRKEGFTLNHKTVRKLMNQHGLLSLIRRKKYRSYRADGGRASDNLLARNFTSEISGLK
FT                   WCTDVTEFRVGAQKLYLSVIQDLFNNEIISWHMSERAALILTCKTLEKALKVKGRKEGL
FT                   MLHSDQGWHYRTPMWRSMLVEAGIRQSMSRKGNCLDNAVMENFFSHLKAEMYHRKKYDS
FT                   ATVLKRDIVEYIHYYNTERISLKTGGMSPAEYRTQVEKQ"
FT   gene            580198..581622
FT                   /locus_tag="YPDSF_0523"
FT   CDS_pept        580198..581622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0523"
FT                   /product="Sodium:galactoside symporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38934"
FT                   /protein_id="ABP38934.1"
FT                   /translation="MSLDSQHLCSLKDEGDKRLKINMNNSGMKIPMKELASYFGYGMGQ
FT                   CFSFGLVGTFILFFYTDIMGISPVAASMIFLIARVWDAIHDPLIAGVMDTINMRRGKFR
FT                   PYLLFTPFLIFLVTVAAFYNIEASLMTKTIYAGVTYILWGTLYALSDIPFWSMSTVMTD
FT                   EPQERAKTATCAMLGVNAGIGATMILFPYISGLFAENSADRGYFAGVVILMVLGVILML
FT                   NGFFNTKERVNVTVTEKVTLKQTFIVVWQNKPLFFILSAFFMNVFSNIVNTFYIFFFTY
FT                   NMGDAELVSVIGLITFTCALACLGTPFLTRHFKKRDLFITLCVLEIIARVGFWFTGYNN
FT                   VVSVMVWLTVITAIFMMTNPLISAMIADTVEYSYYHTGKRCAAITFSGQTFVGKLSVAV
FT                   AGGVSGLILSILGYMPNVAQSTWTLNGLFFCISLLPAVGAVVRILIMRKYKFTEDEHAI
FT                   LREELKQGRFHSSVGK"
FT   gene            complement(581881..584061)
FT                   /locus_tag="YPDSF_0524"
FT   CDS_pept        complement(581881..584061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0524"
FT                   /product="ferric siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38935"
FT                   /protein_id="ABP38935.1"
FT                   /translation="MKHKHLWVLNPCLLVMLTPAAWAEDQLVVSANRSHRSVAEMAQTT
FT                   WVIEGQELEQQVQGGLEIKDILAQLIPGIDVSSQGRTNYGMNMRGRSIMVMIDGVRLNS
FT                   SRSDSRQLDSIDPFNIAHIEVISGATSLYGGGSTGGLINIVTKKGQEGKQVELQIGGKT
FT                   GFNSHNDHDENISAAMSGGTERAFGRFSVSYQRYGGWYDGKGNEVLIDNTQTGLQYSNR
FT                   LDVMGTGTLNIDENQQLQLTTQYFNSESDGKHGLYLGQNFSAVTGTGQASNSAALNSDR
FT                   IPGTERHLINLQYSNTDFWGQDLVAQVYYRDESLTFYPFPTLKDGKVSTIGASQQKTDF
FT                   YGSKLTLNSEPIDSLTLTYGIDLEHESFNANQQFFNLAKAQQSGGMTLENAYNVGRYPS
FT                   YTTTNLAPFLQTRYDINPIFTLSGGVRYQYTENKVDDFVGYAQQQAIASGSATSADPVP
FT                   GGKTDYNNFLFNAGLLAHLTESQQTWFNFSQGFEIPDLAKYYGSGSYTLVNGHYQLQNS
FT                   VNVNDSKLEGIKVDSYELGWRYTGDNLRTQMAGYYSLSDQTISINKTDMTINVLPDKRR
FT                   IYGVEGAVDYFFDNSEWSAGATFNLIKSETKVSGKWQKLTIDAASPSKATAYIGWAPGD
FT                   WNLRVQSQQTFDVSDSKGDKIDGYNTIDFLSSYALPVGKLSFSIENLLDKEYTTVWGQR
FT                   APILYSPTYGSPNLYSYKGRGRTFGVNYSVLF"
FT   sig_peptide     complement(583990..584061)
FT                   /locus_tag="YPDSF_0524"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(584133..585461)
FT                   /locus_tag="YPDSF_0525"
FT   CDS_pept        complement(584133..585461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0525"
FT                   /product="siderophore biosynthesis protein IucD"
FT                   /EC_number="1.14.13.59"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38936"
FT                   /protein_id="ABP38936.1"
FT                   /translation="MNQPLDFIGIGIGPFNLSIAALGSEVSGFNSKFLERKPHFSWHPG
FT                   MMVPDCHMQTCFLKDLVSAVSPTNTYSFLNYLVQHKKFYRFLTTEHRTVSREEFADYLR
FT                   WAASGMSSLEFSQDIQSVDFDDQQRHFVVTTPRNVYHARHVCLGIGKRIKLPDCVTEQN
FT                   DRCFHASEMALRNPDLTGKRVTIVGGGQSGADLFLNIFLAAWGQPKQLNWISRRNNYNA
FT                   LDEAAFANEYFMPEYVESFYTLNDSAKQHMLAEQRMTSDGITSESLLAIYRAMYHQFEV
FT                   LHEKPWARLLPSRSLTNMHTRGNGYQLLTHHHLDQGTETFDTDVVIFATGYQQDRPAFL
FT                   DPLADRLQTTADCQYQVAPDFVLDWQGPRENCLFAVNAGMHSHGIAEPQLSLMAWRSAH
FT                   ILNRALGRTQFDLTSTPAVIQWRSQQSGVPAHPEHPVLNCIDI"
FT   gene            complement(585458..587206)
FT                   /locus_tag="YPDSF_0526"
FT   CDS_pept        complement(585458..587206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0526"
FT                   /product="siderophore biosynthesis protein IucC"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38937"
FT                   /protein_id="ABP38937.1"
FT                   /translation="MITTDYANWQQVNRHMIAKILSELEYERTLHAELHGETGRITLPG
FT                   AVYTFNGKRGIWGWLHIDPATLRCEGVPLAADHMLRQLALVLKMDDSQVAEHLEDLYAT
FT                   LRGDMQLLSARHGMSAEALIALNDDALQCLLAGHPKFIFNKGRRGWGLTALQHYAPEYQ
FT                   GQFRLHWVAAKRGSFIWCVDAEYPLDNLLNSAMDPAERQRFDRRWRECQLNDDWVPVPL
FT                   HPWQWQQKIALHFLPQLAEGELIELGEFGDHYLAQQSLRTLTNVSRRVPFDIKLPLTIY
FT                   NTSCYRGIPGKYISAGPAASRWLQQVFAQDRTLHESGAEILGEPAAGYMLHQTYATLAK
FT                   APYRCQEMLGVIWRENPSCYLREGEHAILMATLMETNNQGHPLIAAYIARSGLSAEAWL
FT                   EQMFRVVVVPMYHLMCCYGVALIAHGQNITLVMKDHAPQRILLKDFQGDMRLVDKDFPQ
FT                   AASLPNVVKDVTVRLSADYLIHDLQTGHFVTVLRFISPLMQACNLSEYRFYQLLAQVLE
FT                   RYMAQHPDLADRFTLFNLFKPQIIRVVLNPVKLTYSEQDGGSRMLPDYLQDLDNPLYLV
FT                   TKELAQ"
FT   gene            complement(587203..588153)
FT                   /locus_tag="YPDSF_0527"
FT   CDS_pept        complement(587203..588153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0527"
FT                   /product="siderophore biosynthesis protein IucB"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38938"
FT                   /protein_id="ABP38938.1"
FT                   /translation="MGPHAKLIHSGGSFYCEHLGKALTLGLGLDGSAVLHLPGPLPPGW
FT                   LVQALDQLFIAAPQLTGIALPYAEWRDAPQAMALFALISSDYVAREIFYQLPLWLGAER
FT                   NRTAGQMQYDTERHLWYPQRPPRPDGEVYRRFDPNIKRTLSFRLPEVDHDAPQFTRWMN
FT                   SPRVDAFWEMSGPLDVQAAYLQRQLDSPYCYPLLGCFDDQPFGYFEVYWAAEDRIGRHY
FT                   RWQPFDRGLHMLVGEENWRGAQYIHSWLRGLTHYLYLDESRTTRVVAEPRIDNQRLFHH
FT                   LPAAGYHTLKEFDFPHKRSRLIMNQRADFFREGTR"
FT   gene            complement(588137..589207)
FT                   /locus_tag="YPDSF_0528"
FT   CDS_pept        complement(588137..589207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0528"
FT                   /product="siderophore biosynthesis protein, IucA familly"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38939"
FT                   /protein_id="ABP38939.1"
FT                   /translation="MHPWQADHLLKQDWCQQLVQQNALHDLGEAGERWLPTSSSRSLYS
FT                   PSNRDMVKFSLSVRLTNSVRTLSVKEAKRGMRLARLAQTPRWQELQARYPTFRVMQEDG
FT                   WAGLRSADFTLQEESLLVLRDNLLFSQPDSQTNVLVTLTQAAPDGGDSLLASAVRRLAA
FT                   RLNLPLQQAAFCWLDAYCQHVLLPLFSTEADYGLVLLAHQQNILVEMQQDLPVGMLYRD
FT                   CQGSGFTQSALPWLAEIGEAEAENSFSEQQLLRYFPYYLLVNSSLAVTAALAAAGFDSE
FT                   ENLMVRVRDALSALRTCAKNTLCLDYVLDSPHWHCKGNFFCYLHDHNENTIVDPAVIYF
FT                   DFVNPLHQGVIHGATR"
FT   gene            complement(589300..589908)
FT                   /locus_tag="YPDSF_0529"
FT   CDS_pept        complement(589300..589908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38940"
FT                   /protein_id="ABP38940.1"
FT                   /translation="MTIPVETLATDVAAQCFLNALIRETQDWQIVPAAGHQPYPQLHIP
FT                   LSSSHAIHIALCHISPTQHHHYLFPAYLHQQGNDRQDDDTPVKLGIEQLVTLLLEKPTV
FT                   KGELSDDVVARFRQRVLESHDNTQQAINIRLDWPSLRDKPLNFAQAEQGLLAGHAFHPA
FT                   PKSHQPFNEKQAQRYLPILPPASHYAGLQSINATCAAIA"
FT   gene            590048..591271
FT                   /locus_tag="YPDSF_0530"
FT   CDS_pept        590048..591271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0530"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38941"
FT                   /protein_id="ABP38941.1"
FT                   /translation="MRISSESDARSSGLTSSTHWPLAFCVGLLGIGQNGLLVVLPVLVS
FT                   RTHLSLSVWAGLLTLGSMLFLVGSAWWGRQSEIRGCKFVVIMALAGYLLSFVLLALAVW
FT                   GLSAGWLSEMAGLGWLIVARIIYGLTVSGMVPASQTWALQRAGYEQRMAALATISSGLS
FT                   CGRLLGPLCAALALSIHPIAPLWLMAIAPLIALLVVYRQYNDPPLPPVVHQQNRLRLNM
FT                   LPYLLCALLLAATVSLMQLGLAPHLSRLFSHSATTVSHHVAILLSIAAGCTLLAQFLVV
FT                   RPQRFTPPQLLLVAALLMVLGLGLMCVQPLVLFYLGCALASFGAAMATPGYQLMLNDRL
FT                   STGKGSGVIATSHTLGYGMSALMVPVVAKFYGESQLVAAAFMMAILLGGISGWLWCQHR
FT                   TTAHSVGE"
FT   gene            complement(591561..592394)
FT                   /locus_tag="YPDSF_0531"
FT   CDS_pept        complement(591561..592394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38942"
FT                   /protein_id="ABP38942.1"
FT                   /translation="MTNKIMPKVNREGRRSFLQKSIAVVATGVVTHAFSAPNITLEKDT
FT                   KPQPGTCILSVEQMAGPYIKSNMPIRRNIAENENGVPLLLKITVIDSNSCRPLEYYYVD
FT                   IWQCNARGRYSGWSYVDPDKDAPSGEVASINRTDEKSFLRGSQVTDSHGLVRFTSIYPG
FT                   FYAGRAVHIHFAIKPPKASPQEVDKYSFISQLYFPEEFNSEIEQRAEYSLRKIKRLINS
FT                   DDEIFNEANGENAVLAVSKINENDINDGVLAEITIAINKDILSKRIDPKDILKIT"
FT   sig_peptide     complement(592287..592394)
FT                   /locus_tag="YPDSF_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.864 at
FT                   residue 36"
FT   gene            complement(592771..594129)
FT                   /locus_tag="YPDSF_0532"
FT   CDS_pept        complement(592771..594129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38943"
FT                   /protein_id="ABP38943.1"
FT                   /translation="MLTRRKFLMMSAGAGLLLSVPMLARTGVQPAQAATAITQVFGDGI
FT                   RLTAVAVEYPTEVSAEGLNPADFHVEGRTVTGVWTSTSTNPADIAPSGRYMIIALSPDD
FT                   KNATLAEQVQPNSKNNSNKSANGRGGPGNAGDIPAYDTVYRTAQATVLRLPSVHTASGD
FT                   TLPASEKALTTQYVENLIVDDFQQLEFYDEKTGKKLKYNLFIPKDYSPDKNYSPDKAWP
FT                   LVLFMHDAGATSDVTRTTLYQGLGAIAWASPEDQAQRPCFVLAPQYEEIIADDDSKTSD
FT                   MLDTTIDLINVLSEQYNIDKSRIYATGQSGGCMMTIAMNIKYPDFFAASFLVAGQWDPA
FT                   LVKPLAQQKLWILVSQDDNKAWPGQNAIIDVLEKEGVQISRAIWDGTWNEEQFRQAFEQ
FT                   IEAEKSPINYVAFREGTVIPEGQSTEGASGHRNTWRIAYTISPIREWIFRQQR"
FT   sig_peptide     complement(594028..594129)
FT                   /locus_tag="YPDSF_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 34"
FT   gene            594691..595434
FT                   /locus_tag="YPDSF_0533"
FT   CDS_pept        594691..595434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0533"
FT                   /product="quorum-sensing transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38944"
FT                   /protein_id="ABP38944.1"
FT                   /translation="MHSVFNRSNEVIETLRDYIDRKLTIYDSPKYTYMVINKKNPGDIF
FT                   IVTSYPNEWAELYTNNNYQNIDPVVLIAFRRFSPFSWDENITVISELKLSKIFTLSKKY
FT                   NIVNGFTFVLHDTMNNLAMLSLIMDDSALNGVESRVLNDRDRLQMLLIETHEKMLTLSQ
FT                   RNMNIQERQGKGMPGKAILSPRENEVLYWASMGKTYQEIAIITNITPRTVKYHIGNVVK
FT                   KLGVINAKQAIGLGVELEIIKPILA"
FT   gene            complement(595415..596065)
FT                   /locus_tag="YPDSF_0534"
FT   CDS_pept        complement(595415..596065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0534"
FT                   /product="N-acylhomoserine lactone synthase YspI"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38945"
FT                   /protein_id="ABP38945.1"
FT                   /translation="MLEIFDVRYDELTDIRSEDLYKLRKKTFKDRLNWEVNCSNGMEFD
FT                   EYDNSDTRYLLGIYQGQLICSVRFIELHLPNMITHTFNALFDDVALPKRGYIESSRFFV
FT                   DKTRAKLLFGNHYPISYLFFLSIINYSRHNGYTGIYTIVSRAMLTILKRSGWQVEVIKE
FT                   AHITEKERIYLLHLPIDRDNQARLLLQVNQRLQDPCSVLSTWPISLPVMPESA"
FT   gene            597610..597891
FT                   /locus_tag="YPDSF_0535"
FT   CDS_pept        597610..597891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0535"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38946"
FT                   /protein_id="ABP38946.1"
FT                   /translation="MFAPISEEIIFRGFLLNAGIGFGRRGRLLAVVITSLLFALVHTQY
FT                   LYPATFVSLFVFSAILCEVRIRTGSLLMPMVLHSANNIASVAWVLTLS"
FT   gene            598342..598737
FT                   /locus_tag="YPDSF_0536"
FT   CDS_pept        598342..598737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0536"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38947"
FT                   /protein_id="ABP38947.1"
FT                   /translation="MMNKFFKIISINLLAISLGGCGMMLNPLLMKQAEVEPNNLPDGKL
FT                   GQPYYAKLRITGGGGAIASFKGESMPVGSGLVLTSDNPERPPGRDELVIKGIPVISGDI
FT                   TFRVSGALFSSADKGYFGKEYKLKIAE"
FT   sig_peptide     598342..598437
FT                   /locus_tag="YPDSF_0536"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.709 at
FT                   residue 32"
FT   gene            598805..599068
FT                   /locus_tag="YPDSF_0537"
FT   CDS_pept        598805..599068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0537"
FT                   /product="insertion element protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38948"
FT                   /protein_id="ABP38948.1"
FT                   /translation="MACINVHCPRCDSALVYRHGQNPKGQSRFRCRECRSVFQLTYTYQ
FT                   ARKPEVKGQIVDIAFSGTGVWDTARTLKIGINTVIRTLKNSC"
FT   gene            601013..601513
FT                   /locus_tag="YPDSF_0538"
FT   CDS_pept        601013..601513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38949"
FT                   /protein_id="ABP38949.1"
FT                   /translation="MSSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNG
FT                   QEQRPLSEREKLNINKNNFNSVLAEFQPSLKLAVPDTLAGDNTDTAVALTFREMKDFEP
FT                   ESVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRELENILKDDALSDELRAELAALAP
FT                   KEG"
FT   gene            601562..603106
FT                   /locus_tag="YPDSF_0539"
FT   CDS_pept        601562..603106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0539"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38950"
FT                   /protein_id="ABP38950.1"
FT                   /translation="MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIE
FT                   AFQNNDALAEATTDERVTAAVSVFLDLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLD
FT                   AVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELLDISKDHLVQDFEDAPEISQSGLY
FT                   AQTYIQEYDTPGGEPIAAAISNYEFDRSPQDIALLRNISKVAAAAHMPFIGSVGPEFFG
FT                   KENMEDVAAIKDIANYFDRAEYIKWKAFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVRS
FT                   FNYVEQVKGPDHDRYLWTNASFAFAANMVKSFIKNGWCVQIRGPQAGGAVTNLPIHLYD
FT                   LGTGNQVKIPSEVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADA
FT                   TANSRINARLPYIFLLSRIAHYLKLIQRENIGTTKDRRLLELELNNWVRGLVTEMTDPG
FT                   DDLQASHPLRDAKVTVEDIEDNPGFFRVKLYAVPHFQVEGMDVNLSLVSQMPKAKA"
FT   gene            603118..604470
FT                   /locus_tag="YPDSF_0540"
FT   CDS_pept        603118..604470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38951"
FT                   /protein_id="ABP38951.1"
FT                   /translation="MKIERPLWARGILVSPQQFQQQASWEAWTNECIAQMAVMHPWGVL
FT                   QATFELDALAQGRLKAARLHVRFQDGVLVDTECADVLPPTLTLAASLPAEASDATVMLA
FT                   IPQLYANGGNCLQPDERGERPVRYRQAWRDVQNQFGDDKKQVAVMYHQLTLRLDTQENG
FT                   DYQVCPVARLLRDAQGRWTLDPGFIPPMLSLQASAWCGEQLELLMVQLRARLQRLMGMR
FT                   RESNARMADFAVADVSLFWLLNALNSAEPVLGNFQRYPQVHPERLYQELARLAGSLLTF
FT                   SLEHEVTAIPVYQHEQLTRVFPPLFALLNILLEASLPSRVVAIELVHEPRINQWRATLR
FT                   DPRLREGADFYLSVRSSLPAAQLQTQFPQLCKAGAPDEVGNVVNVALSGIPLRPLSHVP
FT                   AAIPLRLENQYFSLDLSHPAATQMMETGACVFYVPGTLGEIQLELFAVLRA"
FT   gene            604467..605153
FT                   /locus_tag="YPDSF_0541"
FT   CDS_pept        604467..605153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0541"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38952"
FT                   /protein_id="ABP38952.1"
FT                   /translation="MNPHLTEHPPVGDIDALLQDTWLQVISLRQGVTCAEGEGQAFWQR
FT                   CVADIERVHQALKDAGHSEQSCQHIRYAQCALLDETVKGRGVQDDAYFVWCHSPLQAHF
FT                   FNTLDAGSQLYERMRAVLREPAPDRAVLTCFHRVLMLGFLGGYASPAASEREQLIDQLS
FT                   VQVPAFSVAPSRGILASAASRNRLGIWLRYWPVRLGLAALMVALLWWGLDHWLSGLLAT
FT                   LLPEPV"
FT   gene            605153..606889
FT                   /locus_tag="YPDSF_0542"
FT   CDS_pept        605153..606889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0542"
FT                   /product="OmpA-family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38953"
FT                   /protein_id="ABP38953.1"
FT                   /translation="MSRWWQRGLWLWAGLLAVILCLAFLPLSPWGRWLMLAWVVLICML
FT                   GGSRAGRQAAGASSDPLFAGLATENGLLPENSRLPVVLVCGDGLASWFGRERSHQSAQG
FT                   CWLRVDDISTLRQFARQLLWQRPEWAAQLAVMMVVNPQQRRDERLLAADLQELRWQLMQ
FT                   LRRDSRHPVPLLLSSTVATSVARDTVWLSQQQTPPLTLWSTVSTPGSLADWQRAESRAV
FT                   QAERLKQAVLFSSQHDWLNAQVLPVLQAPNADVDPLAPQQIIQQQVASLADPVPASLWQ
FT                   HWLAAHTTLTQVAGWHPPPPAAHDALPLPDFVFSALPLGSGVSSRRRVLRHGVTLLTLA
FT                   AMVALCSSAWQNRQLLHRVAFDIRQYHSVAMTDYSPKAQAVAVLHRDAGLLDEGYRNGE
FT                   PLRLGLGLYRGERLRPPLLAAIKSYIPPPPPPPAPPAPKTVRLDSLSLFDVGKFTLNAG
FT                   STKMLVTALIDIKAKPGWLIVVAGHTDITGDAQANHILSLKRAEALRDWMLSTSDVSPT
FT                   CFAVQGYGATRPIADNDTPDGRALNRRVEISLVPQADACQGPDVKTASQDESDVSTQEM
FT                   EK"
FT   sig_peptide     605153..605248
FT                   /locus_tag="YPDSF_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.835 at
FT                   residue 32"
FT   gene            complement(606866..607351)
FT                   /locus_tag="YPDSF_0543"
FT   CDS_pept        complement(606866..607351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0543"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38954"
FT                   /protein_id="ABP38954.1"
FT                   /translation="MNDVAVFKGPGDFFVAQFHQFQVVVLLFRRIFHVVHFRRNFNHFD
FT                   VFQFGVEIFNFLASVINAVPFELGGFQCLTGGHRFVQVRGRRIDFFGEYERGVDTGTGQ
FT                   FAGIVIGWDVQVMVLCHDLNAAFTALHINRTLDVRTAVVFQPQINWNCHGLLLHFLR"
FT   gene            606893..607384
FT                   /locus_tag="YPDSF_0544"
FT   CDS_pept        606893..607384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38955"
FT                   /protein_id="ABP38955.1"
FT                   /translation="MAIPVYLWLKDDGGADIKGSVDVQSREGSIEIVAQDHNLYIPTDN
FT                   NTGKLTGTRIHTPFVFTKEIDASTPYLYKAVTTGQTLKTAEFKWYRIDDAGQEVEYFNT
FT                   KLENVKVVKVAPKMHDVKDPAKEKHNHLELVELRYEKITWTFKDGNIIHSDSWNERATA
FT                   "
FT   gene            607802..610450
FT                   /locus_tag="YPDSF_0545"
FT   CDS_pept        607802..610450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0545"
FT                   /product="Clp ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38956"
FT                   /protein_id="ABP38956.1"
FT                   /translation="MTTHSAHLLRRLNPYCAQALAGAATLCQTRAHAEITVEHWLLKLL
FT                   EQGEGDITVIARRYEWDMDSLWQGLLAYLDTLPRTVQGKPQLSAALQQLIKSAWLDASL
FT                   QENADAVRSVHLMAALINSPSLLAADAAWPLLSLSTTQLHRLLPLLDSQSDERPEIQQA
FT                   AALADSPVNLTDEAATVTSASGQPQLNDALQAALDKFTLDVTAKARANQIDPIFGRDSE
FT                   IRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPDSLKTVSVRTLDLGLL
FT                   QAGAGVKGEFEQRLKNVIEAVQQSPSPVLLFIDEAHTIIGAGNQAGGADAANLLKPALA
FT                   RGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKERYATHHGV
FT                   HILDAAITAAVTLSRRFLTGRQLPDKAVDLLDTAGARVRMSIDTLPTALMAINAELAAL
FT                   AMEQQAIEQDLLLLPNVSSTRLPEIEQRRAALAVGQHTLEQQYKEEKRLTTLIIEARQD
FT                   IANVAHLVALQEELVQIQGNAPLLSLDVDVRTVAAVIADWTGVPLSSLLKDEQTDLLQL
FT                   ENHLATRVVGQDTALGALAQRLRAAKTGLTSENGPLGVFLLVGPSGIGKTETALALADS
FT                   LFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGVLTEAVRKRPYSVVLLDEVE
FT                   KAHRDVLNLFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHLMQLLDEQPEATHSD
FT                   LHELLRPILRDHFQPALLARFQTLIYRPLNAIALRTIVEMKLAQVAKRLNKHYGLHCTI
FT                   EESLYDTLVAACLLPDTGARNIDSLLNQQILPVLSQQLLSRMSEQQRTTSLTLGWDEAD
FT                   GITLEFEGGEK"
FT   sig_peptide     607802..607903
FT                   /locus_tag="YPDSF_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.977 at
FT                   residue 34"
FT   gene            610447..612795
FT                   /locus_tag="YPDSF_0546"
FT   CDS_pept        610447..612795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0546"
FT                   /product="Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38957"
FT                   /protein_id="ABP38957.1"
FT                   /translation="MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDI
FT                   QFTSADKAIDPATMLMHDASLTLAAPMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEEC
FT                   RYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILRERHDMRGQDFVFTLAREYPRREQ
FT                   VMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQGLTLQAVPPSGM
FT                   HDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYADN
FT                   YLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQ
FT                   FGKGVIVTRITSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVN
FT                   DTYGHIDKDGRYRVNLMFDRDSWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAF
FT                   EDGNPDRPYIASVLHDSAHGDHVTISNYKRNVLRTPSNNKLRLEDERGKEHIKLSTEYG
FT                   GKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGIFISADGQAKAQGQVLEMQPAI
FT                   SLLKSAQEQMEAISADAQTATASPADLQAQISLLQQNLTELKQAVLLLSAPKGIALSSG
FT                   EHLQMSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGPITVQAQN
FT                   DLMELLARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYY
FT                   GRLDKAKLPTEFPALAAKTEDPIKRWLFS"
FT   gene            612811..615108
FT                   /locus_tag="YPDSF_0547"
FT   CDS_pept        612811..615108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0547"
FT                   /product="kinase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38958"
FT                   /protein_id="ABP38958.1"
FT                   /translation="MIISPLFLKDKSNSEDDASWVSRMMPVDPERGFPLNSHRSWHGGI
FT                   HIPHTDSGGTPEKIRAIADGTVHSLRQPVGDKKGIPPYNYNGATDCGYVLLKHETEIGS
FT                   GENAKVVYFSLYMHLASIDAAVKTGEKIYRKDPIGTVGQVDGGNAVHFQIFCDDTNLTK
FT                   LVGRTTPELDLTKNGRTDAVYGDMYFYLPTGTKFYSHAPANNATTTTEAETYTSTEPLF
FT                   VSMSFDKGKCTMLTRKKGVFSIGKYSEVGEKLENTDGADYEYNVYAQAKKLYPQSQSAG
FT                   YELLRFGRVINTDYETLVPADAPLWRTISYPGGKGVVNLALPAVKKFSDGDFPHWTGWQ
FT                   LIDDDTDENSQCNSEQVLCRIGDDMQGLICHLPLEWDASTLEKRLSWLKTTVINESLAN
FT                   QKASHQVDDTGNNASGYAFDNINPDMSVLNAQSTPSFEQAAKDTAMAEADWNALIEHAK
FT                   ALCFDVSGLPVGRVWHFNPISFIAHFRKCGWLDPEKIKSILTSALNKKRNVRKITLIEK
FT                   ASDSNYTFLNLAMRKYNILTPNRQSHFLGQGAVESDSLTAMQEVSQEQVIVNGKQTGGG
FT                   IVIKSTLNESELGHWYGSEPSELDIYYSGNKYNKNGGLIAGSYSWSNGNCGDVDAQKFR
FT                   GRGFKMLTGRDKYADYWVYRGWLLKSSFDAYWWDDVKYKSKNLKAMKKRPAIIDDPHKI
FT                   TASPYNCIDSGSFFITCFRRSTVKEIDKDQAESADDSVVTKVTQAINGGDIGLSQRKVM
FT                   TNNAKGKLNDKY"
FT   gene            615095..615862
FT                   /locus_tag="YPDSF_0548"
FT   CDS_pept        615095..615862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38959"
FT                   /protein_id="ABP38959.1"
FT                   /translation="MINIKKLTLKYFYILFFTPHLAHATYYNEVSFDDYIVLLDKNENA
FT                   ILHVKKNHTDIQCVIKNWNIKYNNGAGVISLTTDKKAILLANTQAYLYVDEVINCKEGG
FT                   VSLHKVPVPNSPPFGTVIDLNFDKKIYLSVVLEDIRTLSYTAIVSKFDSNKNIINAKGF
FT                   ENKQTTNKDNSFYLEGSSGGYGGKISINGKYIFPVNLDCSSDSFPGVWDLENKKRVVFS
FT                   SHKNSSITIDEKCHKLFNGVASLEELGGELVSK"
FT   gene            615958..616233
FT                   /locus_tag="YPDSF_0549"
FT   CDS_pept        615958..616233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0549"
FT                   /product="insertion sequence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38960"
FT                   /protein_id="ABP38960.1"
FT                   /translation="MAKVDVKCPFCEQFHPVKKHGPGRTGHQRYRCQACRRSFQLEYEY
FT                   RACHPGMKEQIVDLAMNNAGIRDTARALHISINAVMRTLKNSRRSV"
FT   gene            616287..616655
FT                   /locus_tag="YPDSF_0550"
FT   CDS_pept        616287..616655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0550"
FT                   /product="insertion sequence protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38961"
FT                   /protein_id="ABP38961.1"
FT                   /translation="MWSFVGNKKQQRWLWYAWESRLKRIIAHVFGRRSKKTFRQLLGLL
FT                   SGFNIVFWCTDNFSAYEMLPDEKHIRSKLYTQRIERENLNIRNRLKRLNRKTLGDSKSA
FT                   EMHDRIIGTFIEREHYLV"
FT   gene            617263..617898
FT                   /locus_tag="YPDSF_0551"
FT   CDS_pept        617263..617898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38962"
FT                   /protein_id="ABP38962.1"
FT                   /translation="MQPAISLLKSAQEQMEAISADAQTATASPADLQAQISLLQQNLTE
FT                   LKQAVLLLSAPKGIALSSGEHLQMSASDNLIATAGKNADVSVAKNFFIGVGNTLSIFVR
FT                   KLGMKLIANQGSITVQAQNDLMELLARKAITITSTEDEIKITVKKRITLNAGGSYITLD
FT                   ENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAAKAKPPTQKYPFS"
FT   gene            617982..618230
FT                   /pseudo
FT                   /locus_tag="YPDSF_0552"
FT   gene            complement(618483..618558)
FT                   /locus_tag="YPDSF_R0010"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(618483..618558)
FT                   /locus_tag="YPDSF_R0010"
FT                   /product="tRNA-Phe"
FT   gene            619055..619207
FT                   /locus_tag="YPDSF_0553"
FT   CDS_pept        619055..619207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38963"
FT                   /protein_id="ABP38963.1"
FT                   /translation="MVDAETSSPITQACISAGETCAFNDINLPALHQCSALCDVIDMPK
FT                   WQPHT"
FT   gene            619062..621389
FT                   /locus_tag="YPDSF_0554"
FT   CDS_pept        619062..621389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0554"
FT                   /product="ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38964"
FT                   /protein_id="ABP38964.1"
FT                   /translation="MLRPVHLSLRRVFPPGKRAHLMTSIYRHCISAPHSVMSSICQNGS
FT                   LIPDRLRVSDMTLLKIATSARLASYVETQRGVVYLNQTDFTDVAAVVMSVEDANAGILS
FT                   MLHDLGFAIPAFIAVTAEQTVSADYLPLIKGVITLGEANKAFYNAQVEAAASEYQKNLL
FT                   PPFFSTLKKYVEMNNSTFACPGHQGGEFFRKHPAGRQFFEFYGETIFRSDMCNADVKLG
FT                   DLLIHEGAAKDAQKYAAKVFNADKTYFVLNGTSAANKVVTNALLTRGDLVLFDRNNHKS
FT                   NHHGALIQAGATPVYLETARNPFGFIGGIDAHCFNEDYLRQQLREVAPERAEEARPFRL
FT                   AIIQLGTYDGTVYNARQVVDSIGHLCDYILFDSAWVGYEQFIPMMKDFSPLLLELNEND
FT                   PGIIVTQSVHKQQAGFSQTSQVHKKDNHIKGQKRHCNHKRFNNAFMLHASTSPFYPLFA
FT                   ALDVNAKIHSGDSGRRMWMDCVKLGIETRKSLLARCSMLRPFIPPVVGGKNWQDYATDV
FT                   IANDARFFNFVPDERWHGFEGYNQDQYLVDPCKLLLTTPGIDASTGRYTSFGIPAAILA
FT                   TFLRENGIVPEKCDLNSILFLLTPAENTAKMAHLVDMLVQFERYVEQDAKLCDVLPTIY
FT                   RKNEERYHGYTLRQLCQEMHDLYVSHDVKQLQKDMFRKASFPQVVMNPQDANIQFIRDN
FT                   IELIPIAEAEGRIAAEGALPYPPGVLCVVPGEVWGGAVQRYFLALEEGINLLPGFSPEL
FT                   QGVYIEKGDVSWRRIFGYVITQ"
FT   gene            621945..622904
FT                   /locus_tag="YPDSF_0555"
FT   CDS_pept        621945..622904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0555"
FT                   /product="sugar ABC transporter periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38965"
FT                   /protein_id="ABP38965.1"
FT                   /translation="MKKRLIGLLLAGVTISMSVSAAEPLKIGFANRTLNGAFFNGLTEY
FT                   MKIHAKEKGYTLITTDARGDLNKQIADVEDMLSQGINYLILNPQDPQAGLRITEIAKRA
FT                   GVPTVILDSDIALEAPVITRVQANNAKNNNLIGEYAVGQFGDKPMNCIFLSGNQGNLVG
FT                   QARRDNFLLGVAEAQLRKYNRTNVNFLSQGWGNWDQQGGLKAMEDIIVAQGDKINCVYS
FT                   EMDDMALGAIRALKAANKLDNVKVYAHDGYKKGLEAVKKGELQATASNNPDLLTSTVLE
FT                   VIGQYQAGQTSFPDYVYIPSILITKDNVDKYYKEDSIF"
FT   sig_peptide     621945..622010
FT                   /locus_tag="YPDSF_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 22"
FT   gene            622950..624449
FT                   /locus_tag="YPDSF_0556"
FT   CDS_pept        622950..624449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0556"
FT                   /product="sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38966"
FT                   /protein_id="ABP38966.1"
FT                   /translation="MDQYAIEVIQVTKSFGGIHALKSINLQIRTGSIHAIIGENGAGKS
FT                   TLMKILSGIYTKDSGRIMIHGEEKNFTSPIHSKESRIGIIYQELALSPDLTVAENIFLD
FT                   DLGFGTGMINWKRLNEKASLILNELGFQIDPRARVGDLSVAYQQMVEIAKSLAKDVNIL
FT                   ILDEPSAVLSGKEVAILFTQLRKLKARGVTIIYISHRLEELMVIADVITVIKDGETVKT
FT                   LDPQSCSEDEIITSMVGRKLESLYPEKNVPGNEVVLEVKALSTRALLHGINLTLHKGEI
FT                   VGLAGLVGAGRSEVARCLFGIDKIAGGTVSKAGTPIQINHPSQAMSHGIGLVPESRKEQ
FT                   GAILVRPIRENMTLSNLKAVSGWMGFIRRRQERETSQKLQQKLAIKLGSVEDPIASLSG
FT                   GNQQKVVIAKWLNTDCHILILDEPTRGVDVGAKAEIYNIIHQLAERGYSILVISSEMVE
FT                   VINLCHRIYVMSEGRITKELQHDEISEENIMRYAIPKRETI"
FT   gene            624482..625465
FT                   /locus_tag="YPDSF_0557"
FT   CDS_pept        624482..625465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0557"
FT                   /product="sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38967"
FT                   /protein_id="ABP38967.1"
FT                   /translation="MGSIVKEVDDVRQVSLMKRTALFLLDNSTTVVFIVMLIAAGFFSD
FT                   RFYSGDNITNVLRQSVPLGLAALGMLFVILTGGIDLSIGSIMAFVSVLVGLLIPEFGLW
FT                   PALIAGVGIATLMGAFSGFLVTWFNIAPFIATLAMMTIARGVALIISKGQPVFIDNDAF
FT                   VNFGTGYFLGIPLPVYVFLGFAIICQLVYKNSVFGRLVVSIGSNETATRFAGIRVNNYK
FT                   LAVYAISAFACGAAGIISATRTGVGSPVLSIGFELDVIAAVVVGGASLAGGHGNVVNTI
FT                   IGVFILSIISNLMNLMNISGYNQQVVKGVIIIIAVMVQSLKSRSKA"
FT   gene            complement(625548..627692)
FT                   /locus_tag="YPDSF_0558"
FT   CDS_pept        complement(625548..627692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0558"
FT                   /product="hydroxamate-type ferrisiderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38968"
FT                   /protein_id="ABP38968.1"
FT                   /translation="MNKINMFMLSTFMRSMFMRSTLIPSTFILSTLLLPAVVLAEDTII
FT                   VERNRSQTDSYQATTSVTANRSPANIIDTPQNVTVVTHPVLEDYDVTNLGEALYFVSGI
FT                   TQSNTLGGTQDALIKRGFGNNRDGSILHDGIRSIQARNFTPTSERVEVLKGPSSMLYGM
FT                   NEPGGLINVISKKPQLDPHVHLEANASSFKGGGGQLDVTGPLGESGFAGRLIIDHQETD
FT                   YWRNFGRNRQTVVAPSLDWYGENTTVHLAWERMEYLVPFDRGTVIDPRTGKPVDTPRDR
FT                   RFDESYNATRGDQDTVTFSINHDLNEFWSTQLNYAFSRNSYSDNQARATAFNAETGVLT
FT                   RQSDATANAKSHSQAVQWVVNGDLDWGFTHHQLMFGIDYEARRVFRGDMIRGSKNNGFN
FT                   VYDPIYGTLPPSTAVSAADSDQRENIDSRALFIQDSMRLNEHWLLLGGLRYDSFDVMAG
FT                   KGRPFKKNTDSSDSRLVPRAGVVYNLNDWSSLYVSYTESFKPNVSIATAIDALPPEYGK
FT                   SWEAGYKIDINNRVTGTLAVYDIHKRNIMVSELVDGETVTRTAGKARSRGLELDMAGKV
FT                   TDSLSLIGSYAYTDARLTEDPDNNGNDLPNVARHTAALFLSRDFGSTSLISGDEVKAGI
FT                   GARYVGKRAGDAANSFWLDNYTVADAFIAWKMPLSGYQLKWQLNVKNLFDKTYYPSSAN
FT                   NLRIAIGEPRQVVLQGSIDF"
FT   sig_peptide     complement(627570..627692)
FT                   /locus_tag="YPDSF_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 41"
FT   gene            complement(627685..628785)
FT                   /locus_tag="YPDSF_0559"
FT   CDS_pept        complement(627685..628785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38969"
FT                   /protein_id="ABP38969.1"
FT                   /translation="MRLLLLIFLLCTWAVSAKTITDITGQRIEIPDNPQRIVLGESRML
FT                   YTLALLEPGYPAARVVGWPLDLKKYDPQSWALYTDKFPQMTHIPALGSTGLRDINPEKV
FT                   LELAPDLVILPVLAKTTHEEIALISLLKQAHIPVIRVDLRVDLLNHTIPSLRLLGEALN
FT                   RQDRAEAFISLYQSHMDRIHQRIAAYQGPHPSVLLQLHLGRGDECCTTTLKGNLGQLLE
FT                   FAGGNNIAAAQVKGVFGQLSEEYVLARSPEIYIATGMATAGSQAKTLALGPQVSTAQAQ
FT                   ESFRRVIATQSKLQHLPAIQNGHAWGLWHNFYLSPLHVVAAEFFAKTLYPHLFADVSPQ
FT                   DTLQTIYQQFLPLDFTGTFWSHLDNE"
FT   sig_peptide     complement(628732..628785)
FT                   /locus_tag="YPDSF_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.844 at
FT                   residue 18"
FT   gene            complement(629084..630172)
FT                   /locus_tag="YPDSF_0560"
FT   CDS_pept        complement(629084..630172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0560"
FT                   /product="membrane-bound lytic murein transglycosylase C"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38970"
FT                   /db_xref="GOA:A4TI58"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023664"
FT                   /db_xref="InterPro:IPR024570"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TI58"
FT                   /protein_id="ABP38970.1"
FT                   /translation="MACKMKKILALLVIAPLLVSCSGNKNQVENEVFVKDTNGFEILMG
FT                   QFAHNIENIWGLKEVLIAGPKDYVKYTDQYQTRSHINFDAGTITIETIATTNPAAHLRQ
FT                   AIITTLLMGDDPGSIDLYSDVNDIQISKEPFLYGQVLDNNGEPIRWEWRAAHFADYLLQ
FT                   NKMQTRTSGLHVISFVTIQLVPNHLDKRAHKYLPLVRKSAARYGVEESLILAIMQTESS
FT                   FNPYAVSRSDALGLMQVVQHTAGKDVFKLKGKSGQPSRSYLFDPENNIDAGTAYLSILQ
FT                   NTYLGGIQNATSRRYAVITSYNGGAGSVLRVFHSDKNKAVGIINTMSPGDVFQTLTTKH
FT                   PSGESRRYLVKVNSAQKNYRRY"
FT   sig_peptide     complement(630095..630172)
FT                   /locus_tag="YPDSF_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.522 at
FT                   residue 26"
FT   gene            complement(630343..630615)
FT                   /locus_tag="YPDSF_0561"
FT   CDS_pept        complement(630343..630615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38971"
FT                   /db_xref="GOA:A4TI59"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TI59"
FT                   /protein_id="ABP38971.1"
FT                   /translation="MSRTIFCTFLKKDAEGQDFQLYPGEIGKRIYNEISKEAWSQWITK
FT                   QTMLINEKKLSMMNIEDRKLLEQEMVNFLFEGQDVHIAGYTPPSK"
FT   gene            complement(630793..631911)
FT                   /locus_tag="YPDSF_0562"
FT   CDS_pept        complement(630793..631911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0562"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38972"
FT                   /protein_id="ABP38972.1"
FT                   /translation="MMQAQQFAHVVLDWYQHFGRKTLPWQLDKTPYQVWLSEVMLQQTQ
FT                   VATVIPYFQRFMLRFPDIQALAAAPLDDVLHLWTGLGYYARARNLHKAAQMVVEHHQGE
FT                   FPTTFDQILALPGIGRSTAGAILSLSLGQHFPILDGNVKRVLARCYAVDGWPGKKEVEG
FT                   RLWQISEDVTPANGVGQFNQAMMDLGAMVCTRSKPKCELCPLNIGCMAYANHSWARYPG
FT                   KKPKQTLPEKTAWFLLMQNGSQVWLEQRPPVGLWGGLFCFPQFAEQEELIHWLQKQGIP
FT                   ANETQQLTAFRHTFSHFHLDIVPIWLNTASVRGCMDDGAGLWYNLAQPPSVGLAAPVER
FT                   LLHQLLKDPLAKDELTQQQLTKQSPTQPALFD"
FT   gene            632246..632965
FT                   /locus_tag="YPDSF_0563"
FT   CDS_pept        632246..632965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0563"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38973"
FT                   /db_xref="GOA:A4TI61"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TI61"
FT                   /protein_id="ABP38973.1"
FT                   /translation="MINDVISPEFDENGRALRRIRSFVRRQGRLTKGQQLALDSYWPVM
FT                   GVEYQAAPVDLNTLFGREAPIVLEIGFGMGTSLVTMATNNPQQNFLGIEVHSPGVGACL
FT                   SSAHDAGLSNLRIMCHDAVEVLENMIPEASLDMVQLFFPDPWHKARHNKRRIVQTPFVE
FT                   LVKSKLKVGGVFHMATDWQPYAEHMLEVMSGVSGYLNLSEQNDYVPRPDSRPLTKFELR
FT                   GQRLGHGVWDLMFERKE"
FT   gene            632965..633291
FT                   /locus_tag="YPDSF_0564"
FT   CDS_pept        632965..633291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38974"
FT                   /protein_id="ABP38974.1"
FT                   /translation="MAKNRSRRLRKKMHIDEFQELGFSVQWAFDEGTSVDVIDETVDAF
FT                   IDEVIEANGLAFDGSGYLQWEGLICLQEIGHCTDEHRALVTKWLEARKLKNVETSELFD
FT                   IWWD"
FT   gene            633402..634328
FT                   /locus_tag="YPDSF_0565"
FT   CDS_pept        633402..634328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0565"
FT                   /product="L-glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38975"
FT                   /protein_id="ABP38975.1"
FT                   /translation="MVTTLDNALLNDILQQVRPLIGQGKVADYIPALAEVPANKLGIAV
FT                   CTLDGQIFQAGDADERFSIQSISKVLSLTLALSRYSEQDIWQRVGKEPSGQPFNSLVQL
FT                   ELEKGKPRNPFINLGALVVCDMLQSRLSAPKQRLLEVVRQLVKDDSISYDPRVARSEFE
FT                   HSDRNAAIAYLMKSFGNFDNDVLTVLQTYFHYCAMRMSCVELARCFVYLANQGRSISGS
FT                   ESLITPMQARQINALMITSGMYDGAGEFAFRVGMPGKSGVGGGIIAIVPDEFCIAVWSP
FT                   ELDHAGNSLAGTAALERLAQQMGRSIF"
FT   gene            634440..634970
FT                   /locus_tag="YPDSF_0566"
FT   CDS_pept        634440..634970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38976"
FT                   /protein_id="ABP38976.1"
FT                   /translation="MLHKIKVLRTAGLALLMLTAGQAQAEYQCSVKPQDDVIISPQSVQ
FT                   IVGASGNLQISPDGDVTRNGKTLTLTDAQRQQAFRYQTALRKDLPWIDQGAQQRLEKAR
FT                   VSLDKVIVQQLGSSSNVRNRLTTLSEQLKQQMARIIEKRSDGLAFHHQAIAQVEKEAVS
FT                   WSSRAWVACCRIA"
FT   sig_peptide     634440..634517
FT                   /locus_tag="YPDSF_0566"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 26"
FT   gene            634928..635173
FT                   /locus_tag="YPDSF_0567"
FT   CDS_pept        634928..635173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0567"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38977"
FT                   /protein_id="ABP38977.1"
FT                   /translation="MVQQSMGGVLQDSLNEMGVKQATSSGNNPLQAILGNLGGLQQAIK
FT                   NEWNEQEQDFQQFGREVCGRVTTLEQQRIALLKSLE"
FT   gene            635669..645001
FT                   /locus_tag="YPDSF_0568"
FT   CDS_pept        635669..645001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0568"
FT                   /product="virulence determinant"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38978"
FT                   /protein_id="ABP38978.1"
FT                   /translation="MPNGNEMAGFYIDKLSLSQRLSIVSETYDRVNKNNKKEKLKYSYD
FT                   DIEMIKKRFVKYIDAQLYSLIREGLSVPATLTQEEKIKITDLAIDAALFNDYERFNELI
FT                   IYISSLGISVTPPLPQEEGGSRLYIYFSGDIHAYMDVWRGDLLLGSGTELSDIQSITGL
FT                   RFMIDMAESLKLNIINPADKAMVDLINHLRYEMISYASSFCATYSAERGGTVYLSSPDG
FT                   LRINNYFWNSELPVLRALQKKGLIGDIRILHKPLEFYKDTPLDELGDLLTAKDISMTVE
FT                   YQFLPVWLQEKLLVDIYQQWLDEEFQPSLLAVRKEIINTIDIDRHAPEVELLRYFLRKI
FT                   HEQLDEITEFKVLKEAERIDSIKKKLAVGSEIESWLDNVPAIDVNERKIILESLLQKES
FT                   LLFSNVRDIKKSIIPLDFNSDVININTSLLKNTFIPFNLLRESWDVIISDRSLVEGTLT
FT                   IHFSVGRKIMIKVDANRNQLKQMATLERFLLANFTPRNTPQDLKIIDNVIMSGDVVLAE
FT                   RRDDKGWHNDQQMIEKVKLSEFDYFLKSNDLGVKINDNGFVLYLISDPEDNRDVIIKPN
FT                   DDYNLKSIKDFIENNYLFFDDVPEYLIVKKNVENKECIFAHDEGETYQVAYRDGEAWVL
FT                   LSKMNTSDQIKNLNEITMSVNLNNAESRSVALILSLLNKHARLVSILPDTHPKVMENFL
FT                   DIDSLLKNSTHPFEHPLYRKLLNSISNDINKYMESLNEIKDSYHLLPFDVRPGQYMNTW
FT                   SKIDRDTVIEYSFKQNDKNHHPQFIVLLQDDSLSKRVGEIIASYNNNKSIVLQFDARSS
FT                   EARIAYGTQNNITEMGKFELSFVTHGTTDGVYSFSVANVIEIYKLTINSFALPPPVKIR
FT                   LVICSIADNGQGAQGFNGTHPALGIVNMMHQEGFDIPILAYTTKVGVSVEHPGELVVFN
FT                   SEKPGEVLKNIDDYQVLYHYKNNILLTDGVPVVELLLKDVRNKIKSVDQLIESYSQYLV
FT                   PFFSDDNGVVDRELLELTINDFDTYSKFENFLDIIRQRPELRNSDNWQLVVANNATGFL
FT                   ITTLDEPVVKYPDIVKVNEWDLPAIANIDKTATASQYDMQIVFQCENNPTVNRAATRLA
FT                   GKHAKNSIIIQLDVDNNHRAFIIDDNTHAEWREISHNELVTKLKIQPENGKIRWQVVGH
FT                   GRSEGGNDKHPTLAGQRPEQLTARLNQFSDYLQTEHQINISPQQVSLVGCAMSSSDRYT
FT                   SFAHKFMSHLNENGIRTNVSASTKAIEVDPQGHKHDVDTPDIDSYNNKYLSSIKGTEKL
FT                   YWNRWGEITTERKKDINGRLNNIDSLLDKLITRQLSVNQLNKKQQRKLAEIFPQLTDKK
FT                   LNKGELLLTLHDSWRMQALKYDLLFLQKISDRPDFDTELWRVTDRWRITETDGNTLQDV
FT                   RIKSGSQHKTDLATYPHSITSDPDLKTSAPELKTSNPKARTAIFGRFGYGMQGYGFISA
FT                   LRLSADYQRWMSNGDLTEKQEEEIQLQLAMAWGGIGANLATDGLQYAFGKWGIGYLQKL
FT                   VSKGGRLSPALLSQLTLLKRNPALLLAPGFLKDLRKLALNQFAHGAARFSMPLLSALTS
FT                   GIDIYQAYHAFSQLATETDPHVRRDLIASGVFSTINATIGLGVAFAMAMGGTAATAAGP
FT                   AGIALAFTMIIVGDIYSAVSQIERIRDIVPDMTGSQRFENGLRLFLKFGLTPGLDNQIR
FT                   YNQTMESVYQRQRDYYEALLASKQGVDTLFYSRGEAVLKAIPFIKRDERSQTERDLEKI
FT                   SIFSGDPFTNAKIYTTYAEMGKHEYYELDKINDVDDYVIADFFEDNNRSVVKLQNKNLH
FT                   QAFSELDIDSTYSPFILSADVDRNGLNDFIVINEKYNTTIASRKNSVGMTVIDDYVSRW
FT                   HYELYTWLAQPDGSYLKIDTRLEWEKLFHAIEVDKFNEVVFPVLGDFNGDNVFELVIFH
FT                   DDKMTTYHYDSLDFNQSGKDNHNVINIGDFIEPVRLAFEGEKSKNYPYSLVGDINNDGF
FT                   DDILLLNKSGDMLHLMGNSSGVFRQHKTKLSSELTSLLSSSNLHRSQLQLTDLNKDGGL
FT                   DLVIILNDGIYYQALGDKIDGEYHFDTPSMVNKITIKNEGGDSVRYQQNRLSQIDKHKI
FT                   IAISPSDQGENRLISLSDSGELLAHPLREIKENDVAALFDLGGGDDVAKGYHKKKNIFT
FT                   IGSGFKQYQGGENADTFILTSAVASKSHILSGGEGNDTVALGEVLGNEIDSIIDISNGY
FT                   YSQVNGGVEKQVALLYDFENILGHENVNDTIIGNDVDNYLNGMGGDDKIWGNGGNDLLA
FT                   LQSGLAQGGTGLDSYHILKSTHKKSLQIRIEEVSENNNTDMQISNIFLEHKLNQIKSIE
FT                   LDNIDVLININNDNGFMTQIRLVGVYNINNNQKQQVLNFTIQTVDGFTMVPLWPSYLNE
FT                   ITEFSPNMVAYYSSLVDRNYKELVGKGDPDDIVVRFSLDNGYQQQQVTHLQRVEGEKDI
FT                   VLRQAILPDFIRLSPQEHSMLMGFLPRYELLGDNKDNLLQVLSGEGLLEGRGGQDTYLI
FT                   QEKEGSPTDIIINNFDDSLASDNLVLSSWLLCDVIVERSDDDLLLRYRDQPEKHQSIRL
FT                   VNYMNDERYRHLKITDKSGQSQYRDPVTGTFIDYQINLDKNGHPFIAAQQAPVVSSGND
FT                   EVVITSATFLPGNYIDTGDGNDAIIYIRGHEGTMLKGGGGDDTYYYSAGSGAINIADTS
FT                   GLDHLYLDKHILLHTLSAERRENNLVLNIADNTSGRIIFVDWYLADENKVEFIWVEDSQ
FT                   ITFDELFSLRPYSDEYYQLCQHLKSMGLSLTVRQLADLDSQDGYNTLNQLRTIKAWVTK
FT                   NPIYDVADLDYLVAMSSIAWRGNARNTDPLPLIEQKIDAFFQPLIAERISLTEEHVTWI
FT                   QREEFDTVDIAKWVKNYHLRSQNEINYLLEQLGLLKESPLSDKALDFTFKNRIDLAQAD
FT                   IELCQQECGINRQSLINLAMKYHVTGRGHFELLISNIQVLKEYGVVVSESEQPLVLRKP
FT                   IDLRQYFNQKNLTKDHVGRLAEHDMSFDELTLLLDKNIPIEQAFTQRLQTQLGPLKLFN
FT                   DERVFNKGDVFDQDISQLAEAMGGLESTESYSLPLERQTVMAITTHQFVSDSIAAY"
FT   gene            complement(645191..646333)
FT                   /locus_tag="YPDSF_0569"
FT   CDS_pept        complement(645191..646333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0569"
FT                   /product="coproporphyrinogen III oxidase, anaerobic"
FT                   /EC_number="1.3.99.22"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38979"
FT                   /protein_id="ABP38979.1"
FT                   /translation="MRCAMLKLPPLSLYIHIPWCVQKCPYCDFNSHALKGDVPHQEYVE
FT                   HVLADLDADVPLVSGREISTIFIGGGTPSLLSAEAMQQLLDGVRARLPVASDAEITMEA
FT                   NPGAVEADRFSGYQRAGINRISIGVQSFSAQKLTRLGRIHGPDEARRAAELATSLQLRS
FT                   FNLDLMHGLPDQTLEEALDDLRQAIALNPPHLSWYQLTIEPNTGFSSRPPILPDDDALW
FT                   DIFQQGHQLLSAAGYLQYETSAYAKPGYQCQHNLNYWRFGDYLGIGCGAHGKITFNDGR
FT                   ILRTIKTKHPRGFMQGKYLDKQYEVAAVDRPFEFFMNRFRLLEAAPRADFYHFTGLTES
FT                   TIRPQLDEAIAKEYLIETTEYWQITEKGKLFLNSLLELFL"
FT   gene            complement(646314..646907)
FT                   /locus_tag="YPDSF_0570"
FT   CDS_pept        complement(646314..646907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38980"
FT                   /protein_id="ABP38980.1"
FT                   /translation="MQKIVLATGNPGKVRELANLLADFGLDVVAQTELGVESAEETGLT
FT                   FIENAILKARHAAQTTGLPAIADDSGLAVDALGGAPGIYSARYAGTDASDQENLEKLLV
FT                   ALQNVPDEKRGAQFHCVLVYMRHAEDPTPLVFHGQWPGVIAHQPAGAAGFGYDPIFYVP
FT                   ALGKTAAELTREEKHAVSHRGQALKLMLDALRDA"
FT   gene            complement(647007..647297)
FT                   /locus_tag="YPDSF_0571"
FT   CDS_pept        complement(647007..647297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38981"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TI69"
FT                   /protein_id="ABP38981.1"
FT                   /translation="MSAVLSTENGLILKLYIQPKASRDQIVGLHGDELKVAITAPPVDG
FT                   QANTHLVKFIAKQFRVAKSQVIIEKGELGRHKQIKVINPQQIPPEVTILLE"
FT   gene            complement(647294..647848)
FT                   /locus_tag="YPDSF_0572"
FT   CDS_pept        complement(647294..647848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0572"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38982"
FT                   /protein_id="ABP38982.1"
FT                   /translation="MLTLTFLAKTVIDLYVMVLLLRIWMQWVHSDFYNPLSQFVVKITQ
FT                   PIVGPLRRVVPSMGPIDSASLLLAFLLMTIKYPLLLLIDSGSLSLSIYNLLFGLIALVK
FT                   AVGYLIFWVMIIRALMSWISQGRSPVDYLLLQLTEPLMAPIRRILPAMGGIDFSAMVVI
FT                   LILYLLNFLGMDLFGAMWVML"
FT   gene            complement(648136..648957)
FT                   /locus_tag="YPDSF_0573"
FT   CDS_pept        complement(648136..648957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0573"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38983"
FT                   /protein_id="ABP38983.1"
FT                   /translation="MQHRNITFIGAGNMARAIIAGLVAGGYPAKMISVCAPSAKNRDAL
FT                   ATEFGVISSDDNIRESQKAEVVVLAVKPQLMADVCQQLQKQVDFSDKLVLSIAAGVQVA
FT                   RFYALLGNKLNLVRIMPNTPSLVGKGMSGLYAPEQVSAADRDFTTELMSAIGKVCWVDN
FT                   EDGINSIIAAAGSSPAYFFLFMEAMQQETERLGFDSETARQLVQQAASGACALVEANPH
FT                   VPLSALREQVTSKGGTTAEAIRVFNEQHLPEMVANAMRAAIARAKEMEKLF"
FT   gene            complement(649090..649788)
FT                   /locus_tag="YPDSF_0574"
FT   CDS_pept        complement(649090..649788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38984"
FT                   /protein_id="ABP38984.1"
FT                   /translation="MSTIQQNLQDVRARIATAAHNCGRSPEEVTLLAVSKTKPVAAIEK
FT                   AIAAGQYAFGENYVQEGVDKIHSFVDNKTLEWHFIGPLQSNKSRLVAENFAWCHTVDRL
FT                   KIAQRLSAQRPAAMPALNVLIQINISDEQSKAGISLSELPALADSISTLPNLCLRGLMA
FT                   IPAPEHDYQRQLAVFTQMNQAFLTLKARYPQIDTLSMGMTDDMDAAISAGSTLVRIGTA
FT                   IFGARVYNAD"
FT   gene            649808..650932
FT                   /locus_tag="YPDSF_0575"
FT   CDS_pept        649808..650932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38985"
FT                   /protein_id="ABP38985.1"
FT                   /translation="MDFTSLNNQHSDLNNPVFSRIKAKRIDLENPDLASDGFNKQDFAN
FT                   KVAASVDHNASDLHLCTGFHPVLRIDGELKTFTDWPKVTAGWLNGLRRHMLSDAQESRL
FT                   QQQGQVDCAYTTVGSQRLRANIFQQRQGQSIAFRIIPAICPSLTQLAAPPILNQLIQQD
FT                   NGLILVTGATGSGKSTTLSAMISAINQQQARHIITLEDPIEFIHSSQSCLIQQRELGRH
FT                   THCFSRALNGALRQDPDIILLGELRDLETIRLALTAAETGHLVLATLHTRTATQAIDRL
FT                   IDVFPPEEKAVIRTQLAASLRGVITQKLCRQNGGGRIAVFEILTQTTAVSHLIREGKTY
FT                   QLPTVIQAGGQWGMQTFEQSIAQRQKQGVLAINH"
FT   gene            complement(651041..652156)
FT                   /locus_tag="YPDSF_0576"
FT   CDS_pept        complement(651041..652156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38986"
FT                   /protein_id="ABP38986.1"
FT                   /translation="MSVQDTMLQQQALPGTPRQDGFFMPAEWAPQDAVWMLWPYRQDNW
FT                   RGKAIPAQQTFAKVAEAISRATPVFMGVPAEFMAQAKATMPANVTLVEMASDDAWMRDT
FT                   GPTMVINGAAERRAVDWQFNAWGGLNGGLYADWQQDEKVAVQVSDFLKNAHYSAPLILE
FT                   GGSIHTDGEGTLLTTAECLLNPNRNPHLNQAQIEQLLCDYLGVTHFIWLQDGVYNDETD
FT                   GHIDNMCCFVRPGEVALHWTDDQQDPQYARSVAAFEVLSNTVDAKGRKLKIWKLPAPGP
FT                   LYNTEEETFDVLTSDAVPRTAGERLAGSYVNFLISNQQIIFPLLDSRTDGQANDLLQQM
FT                   FPGYAIVGVPAREILLGGGNIHCITQQIPAA"
FT   gene            complement(652160..653044)
FT                   /locus_tag="YPDSF_0577"
FT   CDS_pept        complement(652160..653044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0577"
FT                   /product="carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38987"
FT                   /protein_id="ABP38987.1"
FT                   /translation="MTKVTVAATQMACSWDLPKNIENAEKLVRQAHAKGAQIILIQELF
FT                   AAPYFCIDQSPEHYALAQELDNSPLIKHFSKLAAELEVVLPLSFFEKANNAYYNSLVMI
FT                   DADGSVLDVYRKTHIPNGPAYQEKQFFIPGDTGFKVWQTRYAKVGVGICWDQWFPETAR
FT                   SLALLGAEVIFYPTAIGSEPAYPEIDSQPHWTRVQQGHAAANLVPVIASNRIGTEKSKY
FT                   IDGLEMTFYGSSFIADQTGALLAQANKTDEAVLVHEFDLQEIAAQRASWGLFRDRRPEM
FT                   YQTLATSDGKTRR"
FT   gene            complement(653224..653646)
FT                   /locus_tag="YPDSF_0578"
FT   CDS_pept        complement(653224..653646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38988"
FT                   /db_xref="GOA:A4TI76"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TI76"
FT                   /protein_id="ABP38988.1"
FT                   /translation="MANRTIIAFDFGTKSIGVAIGQEVTGTARALTAFKAQDGTPDWQQ
FT                   VEKLLKEWQPNLVVVGLPLNMDGTEQPLTARARRFANRLHGRFGVQVALQDERLSTVEA
FT                   RANLFDRGGYRALDKGSVDAASAVIILESWFDEQAG"
FT   gene            complement(653646..654209)
FT                   /locus_tag="YPDSF_0579"
FT   CDS_pept        complement(653646..654209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38989"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TI77"
FT                   /protein_id="ABP38989.1"
FT                   /translation="MNLQHHFLIAMPSLQDPQFKRSVIYICEHGEKGAMGLVINKPLEQ
FT                   LTVETILEKLKIKSPSRDPAIRLDNVVLAGGPLAEDRGFILHSPQEGFASSIHISPETM
FT                   ITTSKDVLETLGTSGQPKNLLVALGYASWRQGQLEQELLDNVWLTTEADTHILFNTPIA
FT                   ERWQAAANKLGINIFNIAPQAGHA"
FT   gene            complement(654325..655284)
FT                   /locus_tag="YPDSF_0580"
FT   CDS_pept        complement(654325..655284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0580"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38990"
FT                   /protein_id="ABP38990.1"
FT                   /translation="MIKLGIVMDPISSINIKKDTSFAMLLEAQRRGWELHYMEMGDLYM
FT                   RGGDGRARTRRLNVKQDKDNWFSFGAEQDLPLYDLDVILMRKDPPFDTEFIYATYILER
FT                   AEDKGTLVVNKPQSLRDCNEKLFTAWFPELTPDTLVSRSKDHIRKFHQEHGDIILKPLD
FT                   GMGGTSIFRVKQDDPNLSVIIETLTELSSRFCMAQNFLPAIKEGDKRVLVVDGEPVPYC
FT                   LARIPAQGETRGNLAAGGRGEARPLSESDWEIARTVAPILKQKGLIFVGLDIIGDRLTE
FT                   INVTSPTCVREIEAAFPEISITGMLMDAIERRLADKKA"
FT   gene            complement(655310..656041)
FT                   /locus_tag="YPDSF_0581"
FT   CDS_pept        complement(655310..656041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38991"
FT                   /protein_id="ABP38991.1"
FT                   /translation="MRIPRIYHPQPLQANTELALTDEAANHVGRVLRMTEGQSLQLFDG
FT                   SNQIFDAEIIRADKKNLIVRLAEGQWEDRESPLNLHLGQVISRGEKMEFTVQKSIELGV
FT                   NVITPLFSARCGVKLDGERLTKKIQQWQKIAIAACEQCGRNTIPEIRDAMQLADWCAES
FT                   DDSLKLNLHPRASNSINTLPSSLNKVRLLIGPEGGLSADEIAMTSRLGFTDILLGPRVL
FT                   RTETTALTAITALQVRFGDLG"
FT   gene            656082..656249
FT                   /locus_tag="YPDSF_0582"
FT   CDS_pept        656082..656249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38992"
FT                   /protein_id="ABP38992.1"
FT                   /translation="MMSTARNKRKINKQLRIAEAGKFQPIENCSPSGNSTTSSENNTTS
FT                   SENNDIRDKV"
FT   gene            complement(656293..657000)
FT                   /locus_tag="YPDSF_0583"
FT   CDS_pept        complement(656293..657000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0583"
FT                   /product="endonuclease I"
FT                   /EC_number="3.1.21.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38993"
FT                   /protein_id="ABP38993.1"
FT                   /translation="MLRNILFLLVLSSPLLPLISHSHGINNFSQAKAVAAKIHQDAPGS
FT                   FYCGCQIDWQGKKGIPDLNSCGYQPRKNAARAARIEWEHVVPAWQFGHQRQCWQQGGRK
FT                   NCAKDPVYRQIETDLHNLQPAIGEVNGDRNNFMYSQWNGGSGQYGQCAMKVDFKNKLAE
FT                   PPVRARGAIARTYFYMRDQYQLRLSSQQSKLFGVWDRQYPVTDWECLRDERIAKTQGNH
FT                   NPYVQRACQRPKS"
FT   sig_peptide     complement(656932..657000)
FT                   /locus_tag="YPDSF_0583"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.937 at
FT                   residue 23"
FT   gene            complement(657098..657655)
FT                   /locus_tag="YPDSF_0584"
FT   CDS_pept        complement(657098..657655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38994"
FT                   /protein_id="ABP38994.1"
FT                   /translation="MSACIWLSTVLFFRIMSTLRIPIALQQAVMQCLRHYLQLANQHLG
FT                   TAYPEPKVNYHQRGTNAGSAYLQSFEIRLNPVLLLENKQPFIDEVVPHELAHLLVYRQF
FT                   GRVAPHGKEWRWMMEQVLKVPASRTHQFEVASVRSKTFNYQCKCQQHALTIRRHNKVLR
FT                   GESEYRCRQCGEKLQFITINPD"
FT   gene            complement(657803..658957)
FT                   /locus_tag="YPDSF_0585"
FT   CDS_pept        complement(657803..658957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0585"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38995"
FT                   /db_xref="GOA:A4TI83"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TI83"
FT                   /protein_id="ABP38995.1"
FT                   /translation="MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETY
FT                   VKTGMVLVGGEVTTNAWVDIEEITRRTIREIGYVHSDMGFDANSCAVLSAIGKQSPDIN
FT                   QGVDRENPLEQGAGDQGLMFGYATNETSVLMPAPITYAHRLVERQAEVRKNGALPWLRP
FT                   DAKSQVTFQYDDGKIVGIDAVVLSTQHSEDINQKDLHEAVMEEIIKPVLPAEWITAHTK
FT                   YFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARY
FT                   VAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVEAFGTEKIPADQLTLLVREFFDLRPYG
FT                   LIKMLDLLHPIYRETAAYGHFGREHFPWEKTDKAALLRDAAGLK"
FT   gene            660164..662143
FT                   /locus_tag="YPDSF_0586"
FT   CDS_pept        660164..662143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0586"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38996"
FT                   /protein_id="ABP38996.1"
FT                   /translation="MSDDNLISRPLTAGAHVSLRSMQEVAMNDRNASKMLSTYNVAYWG
FT                   GNYYDVNELGHISVCPDPDIREARVDLAQLVKKMQLEQGQRLPALFCFPQILQHRLRSI
FT                   NAAFKRARESFGYEGGYFLVYPIKVNQHRRVIESLVNSGEPLGLEAGSKAEMMAVLAHA
FT                   GMTRSVIVCNGYKDREYIRLALIGEKLGHKVYLVIEKMSEIKMVLEEAERLNVVPRLGV
FT                   RARLASQGSGKWQASGGEKSKFGLSATQVLQLVDMLREANSLESLQLLHFHLGSQLSNI
FT                   RDISTGVRESARFYVELHKLGVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNV
FT                   IWGIGDACNEHGLPHPTVITESGRAVTAHHTVLVSNVIGVERNEFCEPQPPEAGAPRAL
FT                   ESLWDTWQEMQEPENRRSLREWLHDSQMDLHDVHTQYAHGMLDLTHRAWAEQLYLSICN
FT                   EIQKQLDPSNRAHRPIIDELQERMADKLYVNFSLFQSMPDAWGIDQLFPVLPLEGLDKP
FT                   PERRAVLLDITCDSDGTIDHYIDGDGVATTMPMPPYDPENPPLLGFFMVGAYQEILGNM
FT                   HNLFGDTAAVDVYVFPDGTVEVEQTDEGDTVADMLEYVQLNPEKLLEHFRGQVKETDLD
FT                   TELQAQFLEEFEAGLYGYTYLEDE"
FT   gene            662303..662623
FT                   /locus_tag="YPDSF_0587"
FT   CDS_pept        662303..662623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0587"
FT                   /product="Rieske protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38997"
FT                   /protein_id="ABP38997.1"
FT                   /translation="MGWFSVCKVNDIKPDFPFSAQAGNNRVGIYLVEGEYFAMEDICPH
FT                   AYALLSQGINDGEIIECPLHGALFNVRTGQCLREPGDRDLNTYAVRINGDQIDVNLDGD
FT                   GE"
FT   gene            complement(662913..663665)
FT                   /locus_tag="YPDSF_0588"
FT   CDS_pept        complement(662913..663665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0588"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38998"
FT                   /protein_id="ABP38998.1"
FT                   /translation="MKIRTSMIALSLAALLSGCQSLNTEGLMQSGAQAFQAATLNDADV
FT                   KALSEKSCVEMDQKAQIASADSQYGKRMAKIAAALGDNINGTPANYKVYVTKDVNAWAM
FT                   ANGCIRVYSGLMDMMTDNEVEGVVGHEMGHVALGHTRKAMQVAYGTTALRTAIASAGGV
FT                   VGTLSQSQLADLGEKLVNAQFSQKQESEADDYSFDLLKKRGIDPNGLVTSFEKLASMEA
FT                   GRNSSMFDDHPSSQARAEHIRQRIAAEK"
FT   sig_peptide     complement(663591..663665)
FT                   /locus_tag="YPDSF_0588"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.730 at
FT                   residue 25"
FT   gene            664156..666150
FT                   /locus_tag="YPDSF_0589"
FT   CDS_pept        664156..666150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0589"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABP38999"
FT                   /protein_id="ABP38999.1"
FT                   /translation="MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDYL
FT                   NHNPTNPHWADRDRFVLSNGHGSMLIYSLLHLTGYDLPMEELKNFRQLHSKTPGHPEYG
FT                   YTAGVETTTGPLGQGIANAVGFAIAERTLGAQFNRPGHDIVDHHTYAFMGDGCMMEGIS
FT                   HEVCSLAGTMKLGKLTAFYDDNGISIDGHVEGWFTDDTAARFEAYGWHVVRGVDGHNAD
FT                   SIKAAIEEAHKVTDKPSLLMCKTIIGFGSPNKAGTHDSHGAPLGEAEVAATREALGWKY
FT                   PAFEIPQDIYAAWDAKEAGKAKEAAWNEKFAAYAKAYPELAAEFKRRVSGELPANWAVE
FT                   SKKFIEQLQANPANIASRKASQNALEAFGKVLPEFLGGSADLAPSNLTIWSGSKSLSDD
FT                   LAGNYIHYGVREFGMSAIMNGIALHGGFIPYGATFLMFVEYARNAVRMAALMKIRSVFV
FT                   YTHDSIGLGEDGPTHQPVEQMASLRVTPNMSTWRPCDQVESAVAWQYALERKDGPSALI
FT                   FSRQNLAQQPRTAEQLANIAKGGYVLKDCAGQPELILIATGSEVELAVAAADQLTATGR
FT                   KVRVVSMPSTDAFDKQDAAYRESVLPSAVSARVAVEAGIADYWYKYVGLNGAVVGMTTF
FT                   GESAPAELLFKEFGFTVENVVAKAQALLK"
FT   gene            666458..666916
FT                   /locus_tag="YPDSF_0590"
FT   CDS_pept        666458..666916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0590"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39000"
FT                   /protein_id="ABP39000.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            667257..668273
FT                   /locus_tag="YPDSF_0591"
FT   CDS_pept        667257..668273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0591"
FT                   /product="D-erythrose 4-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39001"
FT                   /protein_id="ABP39001.1"
FT                   /translation="MAIRIAINGFGRIGRSVLRALYESGRRAEISVVAINELASAEGMA
FT                   HLLKYDSSHGRFAWDVRQECDSLYVGDDIIRLIHQSEIEQLPWSELGIDVVLDCSGVYG
FT                   SREDGEAHVASGAKKVLFAHPGGHDLDATVVYGVNHQDLRAEHRIVSNASCTTNCIIPI
FT                   IQLLDIAYGIESGTVTTIHSSMNDQPVIDAYHQDLRRTRAASQSIIPVDTKLAAGITRI
FT                   FPKFCDRFEAISVRVPTINVTAIDLSVSVTHPVGVAEVNQLLQKAARGAFRGIVDYTEL
FT                   PLVSMDFNHDPHSAIVDGTQTRVSGQHLIKTLVWCDNEWGFANRMLDTTLAMAKSGF"
FT   gene            668376..669539
FT                   /locus_tag="YPDSF_0592"
FT   CDS_pept        668376..669539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0592"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39002"
FT                   /db_xref="GOA:A4TI90"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TI90"
FT                   /protein_id="ABP39002.1"
FT                   /translation="MSVIKMTDLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIE
FT                   AALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKEKLSSPVRLAKDYLDGVEIAAG
FT                   ELVVLENVRFNKGEKKDDEALSKKYAALCDVYVMDAFGTAHRAQASTHGVGKFAPIACA
FT                   GPLLSAELEALGKALGNPARPMVAIVGGSKVSTKLTVLGALSKIADKLIVGGGIANTFV
FT                   AAQGHNVGKSLYEADLIPEAKRLLETCDIPVPTDVRVATEFSETAAATLKPANEIKDDE
FT                   QILDLGDESAERLAEILKNAKTILWNGPVGVFEFPNFRKGTEIVARAIAESEAFSIAGG
FT                   GDTLAAIDLFGIADQISYISTGGGAFLEFVEGKKLPAVVMLEERAKQ"
FT   gene            669659..670738
FT                   /locus_tag="YPDSF_0593"
FT   CDS_pept        669659..670738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0593"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39003"
FT                   /protein_id="ABP39003.1"
FT                   /translation="MSKIFDFVKPGVITGDDVQKVFAVAKENNFALPAVNCVGTDSINA
FT                   VLETAAKVRAPVIVQFSNGGAAFIAGKGVKTDAPQGAAILGAISGAHHVHQMAEHYGVP
FT                   VILHTDHCAKKLLPWLDGLLDAGEKHFAATGKPLFSSHMIDLSEESLEENIEICSKYLT
FT                   RMSKIGMTLEIELGCTGGEEDGVDNSHMDASSLYTQPQDVDYAYEKLNAISPRFTIAAS
FT                   FGNVHGVYKPGNVKLTPTILRDSQDYVSKKHNLPHNSLNFVFHGGSGSTAEEIKEAVSY
FT                   GVVKMNIDTDTQWATWEGILNYYKKNEGYLQGQLGNPEGADKPNKKYYDPRVWLRAAQV
FT                   TMITRLELAFKELNAIDVL"
FT   gene            671176..672045
FT                   /locus_tag="YPDSF_0594"
FT   CDS_pept        671176..672045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0594"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39004"
FT                   /protein_id="ABP39004.1"
FT                   /translation="MEELNVVEGINNASTWLANNQDLLIQYAVNIIAALLILIVGSIIA
FT                   KVLSGMLNRVMRLRGIDVTVADFLSAMVRYSILAFTIVAVLGRLGVQTASVIAVIGAAG
FT                   LAVGLALQGSLSNFAAGVLLVAFRPFKAGEYVDLGGVAGTVVQVQIFSTTLRTVDDKII
FT                   VVPNGKIIANNIINTSREPNRRTDMIVGVAYDADIDVVKKVLGDIIAADSRIIHEKGVT
FT                   VRLNEMAPSSLNFAVRVWTTNGDAQEVFWDLTENFKRALDAHKIGIPYPQMDVHLHQVA
FT                   KAEAEKPE"
FT   gene            672308..672925
FT                   /locus_tag="YPDSF_0595"
FT   CDS_pept        672308..672925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0595"
FT                   /product="LysE type translocator"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39005"
FT                   /db_xref="GOA:A4TI93"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004777"
FT                   /db_xref="InterPro:IPR023445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TI93"
FT                   /protein_id="ABP39005.1"
FT                   /translation="MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCAL
FT                   SDIILICAGIFGGSALLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSV
FT                   TQGRWRILVTLLAVTWLNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFAL
FT                   ALLAAWLSPWLNRPVAQRIINLFVGGVMGFIAFQLARQGFGL"
FT   gene            673094..673894
FT                   /locus_tag="YPDSF_0596"
FT   CDS_pept        673094..673894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39006"
FT                   /protein_id="ABP39006.1"
FT                   /translation="MHILGGTVKLKTLALAAMIGLGTLPLALQAQAAEVPEGPHVVTSG
FT                   TASVEATPDIATIAIEVSVSAKDAADAKKQVDTRVAQYFDFLNKSGIEKKDVKAANIRT
FT                   QPEYDYQKSGEAVLKGYRAVRQVQVTLRQLDKLNDLLDGALKSGLNEIRAVELGVASPE
FT                   TYREQARKKAIENTITQAGALADGFKVKLGPVYSIRYHIANYQPMPVARMYKSAGAASD
FT                   TAVEQTYEQQTINFDDQVDVVFELQTGANPASIAATANKTVAAQ"
FT   sig_peptide     673094..673192
FT                   /locus_tag="YPDSF_0596"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 33"
FT   gene            complement(673905..674813)
FT                   /locus_tag="YPDSF_0597"
FT   CDS_pept        complement(673905..674813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0597"
FT                   /product="chromosome initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39007"
FT                   /db_xref="GOA:A4TI95"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR023490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TI95"
FT                   /protein_id="ABP39007.1"
FT                   /translation="MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENL
FT                   FGQPLLVRTVPPRPTEQGQKLLALLHQVELLEEEWLGNDNGVDTPLLLSLAVNADSLAT
FT                   WLLPALKPVLADLPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQPLPSCLVDQLGALD
FT                   YLFVASKAFAERYFPNGVTRSALLKAPAVAFDHLDDMHQAFLQQNFDLSPGSVPCHIVN
FT                   SSEAFVQLARQGTTCCMIPHLQIEKELASGELIDLTPGLLQRRMLFWHRFAPESRTMRK
FT                   VTDALLSYGRQVLRQDSFIGQ"
FT   gene            675155..675811
FT                   /locus_tag="YPDSF_0598"
FT   CDS_pept        675155..675811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0598"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39008"
FT                   /protein_id="ABP39008.1"
FT                   /translation="MTQDELKKAVGWAALDYVKPGTIVGVGTGSTAAHFIDALGSIKHQ
FT                   IEGAVSSSDASTAKLKSYGIPVFDCNDVDVLDIYVDGADEINGQMQMIKGGGAALTREK
FT                   IIAAIARKFICIADESKQVGVLGKFPLPVEVIPMARSYVARELIKLGGLPEYRQNVLTD
FT                   NGNVILDVHNLSILDAIALENQINGIAGVVTVGLFANRGADVALIGTANGVKVIG"
FT   gene            676118..677359
FT                   /locus_tag="YPDSF_0599"
FT   CDS_pept        676118..677359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0599"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39009"
FT                   /protein_id="ABP39009.1"
FT                   /translation="MAKVSLEKDRIKFLLVEGVHQSAVDNLRAAGYSNIEYHKGALDAE
FT                   SLKASIRDAHFIGIRSRTHLSEDVFAAAEKLVAVGCFCIGTNQVDLKAATKRGVPVFNA
FT                   PFSNTRSVAEMVLGELLLMFRGIPSANAKAHRGEWNKLAVGSFEARGKKLGIIGYGHIG
FT                   TQLGILAESIGMKVFFYDIENKLSLGNAQQVRQLSDLLNMSDVVSLHVPENHTTKNMIG
FT                   AEQLAQMKPGALLINASRGTVVDIPALCDALSSNHLSGAAIDVFPEEPATNKDPFNSPL
FT                   CEFDNVLLTPHIGGSTQEAQENIGDEVAGKLAKYSDNGSTLSAVNFPEVSLPAHGDNTR
FT                   RLLHIHENRPGILTSINTIFAEQNVNIAAQYLQTSADIGYVVIDVETDDADNAEKALQA
FT                   MKAIPGTIRARLLY"
FT   gene            677748..678206
FT                   /locus_tag="YPDSF_0600"
FT   CDS_pept        677748..678206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0600"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39010"
FT                   /protein_id="ABP39010.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(678335..678931)
FT                   /locus_tag="YPDSF_0601"
FT   CDS_pept        complement(678335..678931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0601"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase-family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39011"
FT                   /protein_id="ABP39011.1"
FT                   /translation="MPQNPQHALERQRIRAEIREHRRLLTPVQQQQSAHLAAQHIAEHP
FT                   KIQQAHTVAVFLSFDGELDTQPIIEQLWQQKKQVYLPVLHPFSPGNLLFLRYRPESPLI
FT                   RNRLKILEPQLDVREVLPLHQLDVVITPLVAFDRHGQRLGMGGGFYDRTLQRWQQNGPY
FT                   PIGLAHDCQLVDKLPSEYWDVPLPEIVTPAKVWQW"
FT   gene            complement(679058..679239)
FT                   /locus_tag="YPDSF_R0011"
FT   misc_RNA        complement(679058..679239)
FT                   /locus_tag="YPDSF_R0011"
FT                   /product="6S RNA"
FT   gene            complement(679295..679624)
FT                   /locus_tag="YPDSF_0602"
FT   CDS_pept        complement(679295..679624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0602"
FT                   /product="cell division protein ZapA"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39012"
FT                   /protein_id="ABP39012.1"
FT                   /translation="MSAQPVDIQVFGRSLRVNCPPEQQDALNMAAEDLSQRLQDLKVRT
FT                   RVNNTEQLVFIAALNVCHELAQERLKTRDYASNMEQRIRMLQQTIEQALLEQGRISDRQ
FT                   DTQFE"
FT   gene            679961..680539
FT                   /locus_tag="YPDSF_0603"
FT   CDS_pept        679961..680539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39013"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIA1"
FT                   /protein_id="ABP39013.1"
FT                   /translation="MSIENTLPTYPSLALALSQQAVALTPAEMHGLISGMLCGGSKDNG
FT                   WQTLVHDLTNEGVAFPQALSLPLQQLHEATQEALENEGFMFQLLIPEGEDVTVFDRADA
FT                   LSGWVNHFLLGLGMLQPKLAQVKDEVGEAIDDLRNIAQLGYDEDEDQEELAQSLEEVVE
FT                   YVRVAAILCHIEFTQQKPTAPEMHKPTLH"
FT   sig_peptide     679961..680032
FT                   /locus_tag="YPDSF_0603"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.921 at
FT                   residue 24"
FT   gene            680627..681940
FT                   /locus_tag="YPDSF_0604"
FT   CDS_pept        680627..681940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0604"
FT                   /product="proline-specific aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39014"
FT                   /protein_id="ABP39014.1"
FT                   /translation="MTQQEYQNRRQALLAKMAPGSAAIIFAAPEATRSADSEYPYRQNS
FT                   DFSYLTGFNEPEAVLILVKSDETHNHSVLFNRIRDLTAEIWFGRRLGQEAAPTKLAVDR
FT                   ALPFDEINEQLYLLLNRLDVIYHAQGQYAYADNIVFAALEKLRHGFRKNLRAPATLTDW
FT                   RPWLHEMRLFKSAEEIAVLRRAGEISALAHTRAMEKCRPGMFEYQLEGEILHEFTRHGA
FT                   RYPAYNTIVGGGENGCILHYTENECELRDGDLVLIDAGCEYRGYAGDITRTFPVNGKFT
FT                   PAQRAVYDIVLAAINKSLTLFRPGTSIREVTEEVVRIMVVGLVELGILKGDIEQLIAEQ
FT                   AHRPFFMHGLSHWLGMDVHDVGDYGSSDRGRILEPGMVLTVEPGLYIAPDADVPPQYRG
FT                   IGIRIEDDIVITATGNENLTASVVKDPDDIEALMALNH"
FT   gene            682026..683204
FT                   /locus_tag="YPDSF_0605"
FT   CDS_pept        682026..683204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0605"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase / 2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39015"
FT                   /protein_id="ABP39015.1"
FT                   /translation="MSVIIVGGGMAGVTLALAISSLTHGQVPVALVEAQQPNDRQHPGF
FT                   DARAIALAQGTCQQLARIGAWSALADCATAIDHVHVSDRGHSGFVNLRAEDYGVPALGH
FT                   VLELHDAGERLFALLMKAPGVTLHCPAKVVDVVRTAESARVTLDDGQQLAAKLLVAADG
FT                   SHSALAQSCAIQWQRQDYQQVAIIANITTSELPNGRAFERFTRNGPLALLPMSQGRSSL
FT                   VWCHAKHDQQQIDSWDDARFLAELQQAFGWRLGKMLQAGKRHSYPLQLLIASRHISHRL
FT                   ALVGNAAQTLHPIAGQGFNLGLRDVMSLAETLAEAAAMGNDLGDYTVLSHYQQRRQQDQ
FT                   QATIGVTDGLIRLFANRYGPLVAGRNLALMAMEQMPTIRDTFARRTLGWVER"
FT   sig_peptide     682026..682103
FT                   /locus_tag="YPDSF_0605"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.953 at
FT                   residue 26"
FT   gene            683254..684597
FT                   /locus_tag="YPDSF_0606"
FT   CDS_pept        683254..684597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0606"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39016"
FT                   /protein_id="ABP39016.1"
FT                   /translation="MGWHKCCSNRSRPICFSFAASLHREIYRVNKVHIFMGKCFGMQSF
FT                   DIVIAGGGMVGLALACGLQGSGLRIAIIEHQPAPMPLTAPLTGELALRVSAINAASERL
FT                   LQKIGVWETIQALRASPYHGMEVWDKDSFGKIAFHADEYGFSHLGHIIENQVIQQALWQ
FT                   RASQLPEVTVLAPASFKQVAWGETEAFITLTDDRMLSARLVVGADGAHSWLRQHADIPL
FT                   TFWDYAHHALVATIRTDEPHQATARQVFHGDGILAFLPFSDPHLSSIVWSLPPERAAEL
FT                   AVLPAEQFNRELAMTFDMRLGQCQLESERQTFPLTGRYARSFAAHRLVLVGDAAHTVHP
FT                   LAGQGVNLGFMDVAELVSELRRLQRQGKDIGQHLYLRRYERRRKHSAAMMLASMQGFRD
FT                   LFAGNNPAKKLLRDIGLTLADHLPGVKPQLVRQAMGLNDLPEWLERSQ"
FT   gene            685318..686415
FT                   /locus_tag="YPDSF_0607"
FT   CDS_pept        685318..686415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0607"
FT                   /product="aminomethyltransferase"
FT                   /EC_number="2.1.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39017"
FT                   /db_xref="GOA:A4TIA5"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIA5"
FT                   /protein_id="ABP39017.1"
FT                   /translation="MAKQTPLYDQHVACGARMVDFHGWMMPLHYGSQIDEHHFVRQDAG
FT                   MFDVSHMTIVDLHGNRTREFLRYLLANDVAKLTQPGKALYTGMLNESGGVIDDLIVYFL
FT                   SEDYFRLVVNSATRDKDLAWISQHAEPYQVEVTVRDDLALIAVQGPQAQQKVATLLTTE
FT                   QQQAIAGMKPFFGIQTGDLFIATTGYTGEAGYEIALPKQQVVAFWQQLLAAGVKPAGLG
FT                   ARDTLRLEAGMNLYGQEMDEKTSPLAANMGWTVAWQPEDRQFIGRAALERQRMKGTEQL
FT                   VGLIMTEKGVLRNELPVYFFDAAGNQHVGVITSGSFSPTLGFSIALARVPAGIGEHAVV
FT                   QIRNREMPVRVTKPGFVRAGKAIVL"
FT   gene            686484..686870
FT                   /locus_tag="YPDSF_0608"
FT   CDS_pept        686484..686870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0608"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39018"
FT                   /db_xref="GOA:A4TIA6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIA6"
FT                   /protein_id="ABP39018.1"
FT                   /translation="MSNVPTELKYALSHEWVRADGDGVYSVGITEHAQELLGDMVFVDL
FT                   PEVGSDVSAGSDCAVAESVKAASDIYAPISGEIVAVNTELENSPELVNSAPYTDGWLFS
FT                   IKAADESELDNLLDADAYLAAIEE"
FT   gene            687082..689961
FT                   /locus_tag="YPDSF_0609"
FT   CDS_pept        687082..689961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0609"
FT                   /product="glycine dehydrogenase (decarboxylating) beta
FT                   subunit / glycine dehydrogenase (decarboxylating) alpha
FT                   subunit"
FT                   /EC_number="1.4.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39019"
FT                   /db_xref="GOA:A4TIA7"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIA7"
FT                   /protein_id="ABP39019.1"
FT                   /translation="MTQNLSQLEHNDAFIQRHIGSSVEQQQQMLAAVGASSLSTLIQQI
FT                   VPADIQLPGPPPVGEAATEHQALAELKGIASQNQCYKSYIGMGYSPVLTPPVILRNMLE
FT                   NPGWYTAYTPYQPEVSQGRLEALLNFQQLTQDLTGLDLASASLLDEATAAAESMALAKR
FT                   ASKLKDANRFFVADDVHPQTLDVVLTRAETFGFDVIVDRAEKVLELDGIFGVLLQQVGT
FT                   TGELHDYSALLAELKKRKIITSVAADIMALVLLTAPGAQGADVVFGSAQRFGVPMGYGG
FT                   PHAAFFACRDEFKRSMPGRIIGVSRDAAGNTALRMAMQTREQHIRREKANSNICTSQVL
FT                   LANIASLYAVYHGPQGLQRIAGRIHRMTDILAAGLQHAGLTLRFKHWFDTLTVEVKDKA
FT                   AVLARALSFGINLRTDIHGAVGITLNETTSREDIQTLFALFVGDNHGLDIDQLDAAVSQ
FT                   HSQSIQDSMLRRDPILTHPVFNRYHSETEMMRYMHRLERKDLALNQAMIPLGSCTMKLN
FT                   AAAEMIPITWPEFAELHPFCPPEQAAGYQQMIGQLSQWLVQLTGYDAVCMQPNSGAQGE
FT                   YAGLLAIRRYHESRNQANRHICLIPSSAHGTNPASAQMAGMSVVVVACDKQGNIDLHDL
FT                   RQKAEHAGDELSCIMVTYPSTHGVYEETIREVCQIVHQFGGQVYLDGANMNAQVGITTP
FT                   GYIGADVSHLNLHKTFCIPHGGGGPGMGPIGVKAHLAPFVPGHSVVQIDGMTTQQGAVS
FT                   AAPFGSASILPISWMYIRMMGADGLKQASQVAILNANYIATRLKNAYPVLYTGHDGRVA
FT                   HECILDIRPLKEATGISEMDIAKRLIDFGFHAPTMSFPVAGTLMVEPTESESKVELDRF
FT                   IDAMLAIRAEIEKVAQGEWPLEDNPLVNAPHTQAELVGEWTHPYSRELAVFPVAGVLEN
FT                   KYWPTVKRLDDVYGDRNLFCSCVPISDYE"
FT   gene            690339..690776
FT                   /locus_tag="YPDSF_0610"
FT   CDS_pept        690339..690776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39020"
FT                   /protein_id="ABP39020.1"
FT                   /translation="MINNRFIGSWSLISQHFILPDNSIHYPMGQNMLGRINYEKQGTMA
FT                   AQLYRGDRAKFTTEDWLQGSDSEIKNAFLTALTYFGRYHIDEEQGIVTHTVEGCLFPNW
FT                   VGNQQIRHYQFEEDRLTLRTPPLQMNNSSLVGVLIWQKVKK"
FT   gene            691147..691272
FT                   /locus_tag="YPDSF_0611"
FT   CDS_pept        691147..691272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39021"
FT                   /protein_id="ABP39021.1"
FT                   /translation="MCWCILIYIIIRIHQLIFLWFYFIGIFSGFLSSNDSFIHDK"
FT   gene            691824..691988
FT                   /locus_tag="YPDSF_0612"
FT   CDS_pept        691824..691988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0612"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39022"
FT                   /protein_id="ABP39022.1"
FT                   /translation="MESGMENIIKYDINYFLRFVCFNYFMNIKFYRGLFSISIVMIYLS
FT                   LAPQLLSFM"
FT   gene            692021..693961
FT                   /pseudo
FT                   /locus_tag="YPDSF_0613"
FT   gene            694065..695168
FT                   /locus_tag="YPDSF_0614"
FT   CDS_pept        694065..695168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39023"
FT                   /protein_id="ABP39023.1"
FT                   /translation="MSSFKTLGFFFLSLSLLFSSLLVLLSLLLFAGLLLFPSLLPFSRF
FT                   LPFAGFSPASGFSLATKYDEGFSGNVSYRGDLNDSPKTDPLWIPLPALPLIQQAVTELV
FT                   PTVQGQYQEHVMSQVCALARGERTQEQVAQTLRSYDIDISNIPPQGHPLSLLVSTDQSS
FT                   RVIGCAAYIASSVMAIPKSDEFMVSTDKPADALPGKKNEAASKEKTLSIDPKKLAQYLQ
FT                   TQLAVAKANADIFAIIAVELEKKPGLTVNEYSVQIKKVFSEVASAYLQRVKALYAVGAG
FT                   VNYKLITYSDEGFKFISNDGYLFEYGYDSLSLYFNRIPWYGSGKILGKEYFFSVSYIEP
FT                   NLVKRIREEKREEKSEGVLNQESGVAP"
FT   sig_peptide     694065..694160
FT                   /locus_tag="YPDSF_0614"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 32"
FT   gene            695370..696071
FT                   /locus_tag="YPDSF_0615"
FT   CDS_pept        695370..696071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0615"
FT                   /product="hemolysin III"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39024"
FT                   /protein_id="ABP39024.1"
FT                   /translation="MKNKSGTQPLFATPSVPAAQTATPTPAYPWAEELANSLSHGIGVV
FT                   FGIVGLVLLLVQAVNSGADTKALTSYSLYGSSIILLFLASTLYHAIPHRRAKLWLQKFD
FT                   HCAIYILIAGTYTPFLLVGLDSPLARGLMAVIWGLALIGVIFKLAFAHRFEVLSLVTYL
FT                   TMGWLSLIVIYQLAVKLEIGGLALLAIGGLLYTVGVIFYASKRIRFGHAIWHGFVLGGS
FT                   VCHFMAIYLYV"
FT   sig_peptide     695370..695435
FT                   /locus_tag="YPDSF_0615"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.601 at
FT                   residue 22"
FT   gene            696329..696826
FT                   /locus_tag="YPDSF_0616"
FT   CDS_pept        696329..696826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0616"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39025"
FT                   /protein_id="ABP39025.1"
FT                   /translation="MIMRLSKALMVCAIALFATLVVFGNMTDYNTNFVFVHHVLQMDTI
FT                   FPDATISYRAIHSPWLQQLGYIGIILLETLTAVFCWVGGIGLLINRKAPAKVFNRKKGI
FT                   AIIGLTLGFLTWQVVFMSIGGEWFGMWMSKQWNGVPNAFRFFVTTILVLIYLVQPDGEL
FT                   DE"
FT   sig_peptide     696329..696403
FT                   /locus_tag="YPDSF_0616"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.982 at
FT                   residue 25"
FT   gene            complement(696899..697891)
FT                   /locus_tag="YPDSF_0617"
FT   CDS_pept        complement(696899..697891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39026"
FT                   /db_xref="GOA:A4TIB4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR023758"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIB4"
FT                   /protein_id="ABP39026.1"
FT                   /translation="MAYHTPFAAQPPVASSGLPLTLISLDDWALVTLTGADRVKYLQGQ
FT                   VTADIDALSADQHVLCAHCDAKGKMWSNLRLFYRGEGLAFIERRSLLDNQLSELKKYAV
FT                   FSKVVIEPQPDAVLIGVAGSQAKTALAEIFTELPSAEHPVTQMGNSTLLHFSLPAERFL
FT                   LVTDTEQAQQLVEKLAGRAQFNDSKQWLALDIEAGFPIIDAANSAQFIPQATNIQALNG
FT                   ISFTKGCYTGQEMVARAKYRGANKRALYWLAGNASRVPAAGEDLEWQLGENWRRTGTVL
FT                   SAIQLNDGTVWVQAVLNNDLAADSVLRVRDDALGTLAIQPLPYSLAEDK"
FT   gene            698208..698474
FT                   /locus_tag="YPDSF_0618"
FT   CDS_pept        698208..698474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39027"
FT                   /protein_id="ABP39027.1"
FT                   /translation="MEIDNKARIHWACRRGMRELDISIMPFFEYEYDSLSDNEKQAFIR
FT                   LLECDDPDLFNWLMNHGEPQDSELYQMVKLIQSRNKARGPVAM"
FT   gene            698455..698880
FT                   /locus_tag="YPDSF_0619"
FT   CDS_pept        698455..698880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39028"
FT                   /protein_id="ABP39028.1"
FT                   /translation="MAQWRCNLRVSWHTQLFSLLAHGILVILTLVAPWPLGYTALWLVL
FT                   LTLVVFECIRSQKRIKSCQGEIRLKPGNLVRWKRHEWTVVKPPWITRYGVLLHLQQTGG
FT                   HATRKRLWLSADSMSEDEWRQLCLLLRHSFESDDGTM"
FT   gene            698880..699578
FT                   /locus_tag="YPDSF_0620"
FT   CDS_pept        698880..699578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0620"
FT                   /product="response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39029"
FT                   /protein_id="ABP39029.1"
FT                   /translation="MKPLIWLVEDEPSIADTLIYTLESEGFTLRWFDRGEPALAALSSG
FT                   SPALAIVDVGLPDINGFDLCRRMLAAAPDLPVIFLTARSEELDRIVGLEIGADDYIAKP
FT                   FSPREVSARVRTILRRLQKSHLLAVTSTSYQFGHFSLDEAGARVTYHQQILGLTRYEYL
FT                   LLKTLLLAPERIFSRQQLMDIVWAQAEESQDRTVDTHIKTLRSKLRTVYAEDSPIRTHR
FT                   GLGYSLGYQP"
FT   gene            699603..701021
FT                   /locus_tag="YPDSF_0621"
FT   CDS_pept        699603..701021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0621"
FT                   /product="histidine kinase sensor"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39030"
FT                   /protein_id="ABP39030.1"
FT                   /translation="MKIGVRLLLGYFLIVAIAGYFVIRIFLQEVKPGVRRATEGTLVDT
FT                   ATLLAQFARQDILQNKVADGQLAQAFSSLNLRPIGANIEGIRKDRNEYRVYLTDTDGQV
FT                   IFDSSGRALGQDYSRWNDVWLTLRGEYGARSSRTDPDDAESSVMYVAAPVIVENRIVGV
FT                   LSIGKPNLSMVPVIKRSERKILFAGGLLLGIALLIGLGFVWWINRAIGKLVDYAERVAE
FT                   GQAVALPAMGSSELNDLALALESMRLKLDGKAYIEQYVHTLTHELKSPLAAISGAAELL
FT                   RESPPPETAQRFLINIEQQSARIQQLVDKMLVQARLESRVDLQLSPLEISHILKQSFSA
FT                   KEAQAVSRGVTLRLKSVDNAMLIGDGLLLSQALNNLIDNALDFTPAGGEISVSGERQDD
FT                   TYLITVEDSGSGIPGYAQEKIFDRFYSLPRANSVKSTGLGLNFVREVAAIHQGSICLEN
FT                   RLPQGVSARLTLPL"
FT   gene            701121..702599
FT                   /locus_tag="YPDSF_0622"
FT   CDS_pept        701121..702599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0622"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39031"
FT                   /protein_id="ABP39031.1"
FT                   /translation="MLKGVQVMFKSVLFWKIVTLLGLMLLMMIPKGMLLHVIDERSGYR
FT                   QSVIDKVSDSTSRSQKILGPLIVVPYREWVETEVDGKKQGKWTHFYHYILPNVMTVKGT
FT                   PDVEVRQLGIYKTQVYQGEFDFHGEFEVSSLDDLDREGVIIGKPSLVLALSDARGIQRI
FT                   SPLSVGKTKINFEPGAFSGHSVQGVHAPLTIEQVLQGKFDVDFTMSLAGTTSLSVVPVG
FT                   RNSELTLQSNWPHPNFVGNFLPLQRKVDEKGFRAHWSSNWLANSMNTNFTGGDAAFHFG
FT                   SLPAFTTSLIEPVDHYQLTERAIKYAILFIGLTFFSFFLFESLTSLRLHPMQYLLVGAA
FT                   LVLFYLMLLAFSEHIGFTLAYLLASLSCSLLIAIYLSAVLGGWLRGTLFACGLLLLYGI
FT                   LFGLLQSEDNALLLGAGLLFVVLTVVMLLTRRLDWYQVADTQRLTEWRAPEPSAEESPS
FT                   KTAPEGESMKDDNKKKDDHVKKDANEKDEFRLWK"
FT   gene            complement(702689..703270)
FT                   /locus_tag="YPDSF_0623"
FT   CDS_pept        complement(702689..703270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0623"
FT                   /product="flavodoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39032"
FT                   /protein_id="ABP39032.1"
FT                   /translation="MTGQIWYTRCYSLLAMLRLYIMKIGLFYGSSTCYTEMVAEKIRDI
FT                   LGEDLVDLHNLKEVSPRLMEEYSILILGIPTWDFGELQEDWEAIWPQLTQLNLKGKIVA
FT                   MYGMGDQFGYSEWFLDALGMLHDHIAPLGVKFIGFWPTDGFEFTSPKPLSADGKQFVGL
FT                   ALDEVNQYDLSEERIEQWCEQILLEMEALL"
FT   gene            703314..704213
FT                   /locus_tag="YPDSF_0624"
FT   CDS_pept        703314..704213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0624"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39033"
FT                   /protein_id="ABP39033.1"
FT                   /translation="MKQQDNPLIEQFLDALWLERNLAENTLASYRLDLHALVGWLTHHN
FT                   SDLLRASPQDLQSFLAERIEGGYKATSSARLLSAMRRLFQYLYREKLREDDPTALLSSP
FT                   KLPQRLPKDLSEAQVDALLNSPNVDIPLELRDKAMLEVLYATGLRVSELVGLTISDVSL
FT                   RQGVVRVIGKGNKERLVPLGEEAVYWIENYMEHGRPWLVNGASLDVLFPSNRSQQMTRQ
FT                   TFWHRIKHYAILAGIDSERLSPHVLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYT
FT                   HVATERLRQLHQQHHPRA"
FT   gene            704244..704960
FT                   /locus_tag="YPDSF_0625"
FT   CDS_pept        704244..704960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0625"
FT                   /product="thiol:disulfide interchange protein (DsbC)"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39034"
FT                   /protein_id="ABP39034.1"
FT                   /translation="MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPI
FT                   PGISTVMTESGVLYISADGKHLLQGPLYDVSGDQPINVTNQALLKKLEALSSEMIVYKA
FT                   PEEKHVITVFTDITCGYCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSIWCM
FT                   ADRNKAFDDAMKNNDISPATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKE
FT                   MLQMLNAHQASLKAGG"
FT   sig_peptide     704244..704309
FT                   /locus_tag="YPDSF_0625"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            704967..706700
FT                   /locus_tag="YPDSF_0626"
FT   CDS_pept        704967..706700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0626"
FT                   /product="exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39035"
FT                   /protein_id="ABP39035.1"
FT                   /translation="MTLKTQLRRREAADDSHLPAQLPPLLRRLYASRGVKDAQELERGV
FT                   KGLLAWQKLDGIDAGVTLLQQALADRRRIVIVGDFDADGATSTALAVLALRSMGGSNLD
FT                   YLVPNRFEDGYGLSPEVVEQVAARGAELIVTVDNGISSHAGVDLAHAKGIQVLVTDHHL
FT                   PGETLPAADAIINPNLAGCDFLSKSLAGVGVTFYLMLALRARLRECGWFEQRTLAVPNL
FT                   AELLDLVALGTVADVVPLDANNRILVHQGLSRIRAGKCRPGIRALLEVANRDARQLVAN
FT                   DLGFSLGPRLNAAGRLDDMSIGVALLLSDDIAQARALAIDLDTLNQTRREIEQGMQVEA
FT                   LQLCDQLERTSSELPYGIAMYHPEWHQGVVGILASRIKERFHRPVIAFAPAGEGLLKGS
FT                   GRSVAGLHMRDALERLDTLNPGLILKFGGHAMAAGLSLEEGKFDEFRQRFADLVGEWMD
FT                   ASQLEGVIWSDGELNGAELSLETAELLRDGGPWGQSFPEPTFDGKFRILQQRLVGERHL
FT                   KLMVEPLNGGPLLDGIAFNVDTTLWPDSSVREVKLAYKLDINEYRGNRSVQLLVQHLWP
FT                   Y"
FT   gene            707045..707977
FT                   /locus_tag="YPDSF_0627"
FT   CDS_pept        707045..707977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0627"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39036"
FT                   /protein_id="ABP39036.1"
FT                   /translation="MGKERSTLEEIVTTIDQLEQGLEDVSGLLELAVEADDEETFNETI
FT                   AELEVLDGKLGQLEFRRMFSGEYDRANCYLDLQAGSGGTEAQDWASMLLRMYLRWAESR
FT                   GFKTEIIEESDGDVAGLKSATVKIIGEYAFGWLRTETGVHRLVRKSPFDSGGRRHTSFS
FT                   SAFVYPEVDDDIDIEINPADLRIDVYRASGAGGQHVNKTESAVRITHIPTNIVTQCQND
FT                   RSQHKNKDQAMKQLKAKLYEFEMQKKNADKQVLEDNKSDIGWGSQIRSYVLDDSRIKDL
FT                   RTGVETRNTQAVLDGDLDKFIEASLKAGL"
FT   gene            707987..709504
FT                   /locus_tag="YPDSF_0628"
FT   CDS_pept        707987..709504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0628"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39037"
FT                   /db_xref="GOA:A4TIC5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIC5"
FT                   /protein_id="ABP39037.1"
FT                   /translation="MSEQKPQVAEQAQELNSELQARREKLAVLRGKGIAFPNDFRRENL
FT                   SDQLHAEFDSKENEELEALNIDVTVAGRMMTRRIMGKASFVTLQDVGGRIQLYVSRDDL
FT                   PEGVYNEEFKKWDLGDILGARGKLFKTKTGELSIHCSELRLLTKALRPLPDKFHGLADQ
FT                   ETRYRQRYLDLIANDESRHTFKVRSQVMSGIRSFMVEKGFMEVETPMMQVIPGGASARP
FT                   FVTHHNALDIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELY
FT                   MAYADYKDLIVLTEELFRTLTETILGSSVVQYGEQTFDFGKPFAKLTMKEAICKYRPET
FT                   NVADLDDMDKAVAIAESLGIKVEKSWGLGRIQCEIFEETAESHLIQPTFITEYPAEVSP
FT                   LARRNDDNPFITDRFEFFIGGREIGNGFSELNDAEDQAQRFADQVSAKEAGDDEAMFYD
FT                   EDYITALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK"
FT   gene            709698..709771
FT                   /locus_tag="YPDSF_R0012"
FT                   /note="tRNA-Gly4"
FT   tRNA            709698..709771
FT                   /locus_tag="YPDSF_R0012"
FT                   /product="tRNA-Gly"
FT   gene            709937..711151
FT                   /locus_tag="YPDSF_0629"
FT   CDS_pept        709937..711151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0629"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39038"
FT                   /protein_id="ABP39038.1"
FT                   /translation="MKLNARQVETAKPKDKAYKLADGGGLYLLVNTNGSRYWRLKYRFA
FT                   GKEKLLALGVYPDVSLAVARVKRDEAKKIVAGGGDPSQNKQQEKLARQGEATNTFEAIT
FT                   REWYQRRYDRWSESYRLEMMSTFESDVFPYIGYRPIKEIKPLELMAVLSKLEKRGATEK
FT                   MRKVRQRCGEVWKYAIITGRAEYNPAPDLASAFAPHKREHYPHLTINEIPEFLSSLASY
FT                   SGSMLVKLAMRLLILTGTRPGELRQAEWVEFDFDNALWEIPAVRMKMRRPHMVPLPDQA
FT                   ITILKQIQPISGRYQFVFPGRIQHSKPISEMTLNVLIRRIGYGGRATGHGFRHTMSTIL
FT                   HEQGFNTAWIETQLAHVDKNSIRGTYNHAQYLDGRREMLQWYADYMDSLENGENVIHGR
FT                   FGKRA"
FT   gene            complement(711233..711418)
FT                   /locus_tag="YPDSF_0630"
FT   CDS_pept        complement(711233..711418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39039"
FT                   /protein_id="ABP39039.1"
FT                   /translation="MYDNTPREVEEVIDHCRALIYAIITLESPEVKEILNFVLQQQIDL
FT                   LHQTYHQATSEPLEAE"
FT   gene            complement(711519..711644)
FT                   /locus_tag="YPDSF_0631"
FT   CDS_pept        complement(711519..711644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39040"
FT                   /protein_id="ABP39040.1"
FT                   /translation="MVGWTGASKDAPGSLLTGLLTPFSPPPKGISSSWWWDKAIN"
FT   gene            712339..712701
FT                   /locus_tag="YPDSF_0632"
FT   CDS_pept        712339..712701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0632"
FT                   /product="DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39041"
FT                   /protein_id="ABP39041.1"
FT                   /translation="MAKLQYIHDEAGKPQFVVLPVAEYQQLISNAKYEDIPYVADNDDD
FT                   QTIPNEVVQIMVNDGVSLLAAWRIYRGFSQYEIAELLGTTQSAVSQWEAVDSRPQKKTR
FT                   EKLAAIYKCRAAQMIL"
FT   gene            712865..713161
FT                   /locus_tag="YPDSF_0633"
FT   CDS_pept        712865..713161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39042"
FT                   /protein_id="ABP39042.1"
FT                   /translation="MEKRTPHTRLLKVKELVLKGNIKTTRTARDGAEELGLSFRDMCDA
FT                   VSELISADFYKSMTTHQDHTIWQDVYRPMLSCGRVYLKITVIDDVLNVSFKEI"
FT   gene            713161..713559
FT                   /locus_tag="YPDSF_0634"
FT   CDS_pept        713161..713559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39043"
FT                   /protein_id="ABP39043.1"
FT                   /translation="MMKCPVCGGVELIHEARDVPFTYKGRKFIVEGVIGQHCPACGETV
FT                   MTEAESDVYAAKTMLLRKMVNTESIAPAYIVQIRKKLGLNQREASEIFGGGVNAFSRYE
FT                   KGKALPHPSTIKLLQVLDKHPELLNEIR"
FT   gene            complement(713959..716250)
FT                   /locus_tag="YPDSF_0635"
FT   CDS_pept        complement(713959..716250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0635"
FT                   /product="plasmid and phage DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39044"
FT                   /protein_id="ABP39044.1"
FT                   /translation="MNQFITEVAAQARGKWGFILDALAISHSKQHSPCPACGGKDRFRF
FT                   DDRQGAGTWFCNQCEPQSGDGLDLVKNVRQCSLTEAAQLVADILGVSPKSKAPDLASLM
FT                   AKTTPGESRYLINKGLSSHKLPILPDGSLLLILQNMAGDCTGAQIIRPDGTKKLIAGSR
FT                   KKGTFIPLKPLPEQAETVVLAEGYATAQSLELLLPAAVIIAAIDAGNLLPVAQAFRIYW
FT                   PAAKIIIAADNDINPQDTANVGQLSAEKAANAVNGWVTLPPTPHKADWDDYRQQAGTGQ
FT                   ARNSFYHGLYQPPPVSQLAENKGLHPTLSQMAASQRGQLLAEHYGQIAVHAESETVYHY
FT                   DDERWDKLPDGVLRRELVMIFNANDTPYSPAGIRNAIEAMKLQIPIMGEPPRHLIGFQN
FT                   GVYDLKAKQFRPHRANDWLQHHNDIIFTEPQPDENLAHHAPHFTKWLAHAANDELPKMA
FT                   RIKAALFMILSNRFDWQLFLEVTGEGGSGKSVFTYIATLLAGRQNTASGNMAALDQARG
FT                   RAQFVGKSLITLPDQVKYVGEGAGIKAITGGDLVEIDGKYEKQFSTLLTAVVLATNNEP
FT                   MSFTERQGGIARRRVIFAFNHPVKEADKDPLIGEKIAAELPVVIRCLLAEFADQDKARK
FT                   LLLEQRDSREAMGVKRDADPLYGFCAHIVELGEAVGMYMGTLAISPHAPRIYLYHAYLA
FT                   YMEAYGHQRSLSLTKFGKDFPKVMEEFGAEYKKARTDKGFRYNMDLSDTANDWLPALAL
FT                   PHHPQPEEPH"
FT   gene            716550..716876
FT                   /locus_tag="YPDSF_0636"
FT   CDS_pept        716550..716876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0636"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39045"
FT                   /protein_id="ABP39045.1"
FT                   /translation="MNYTIEYYDDDVITQLLAQPISLQANFISLAKRMKRYGIKMVDAV
FT                   PMHYHEDVFELCFYEPKGWNRVIFMAQIDWQIVILHIVVQKTAYMPWKEKGKAAKRMKE
FT                   LRFG"
FT   gene            complement(717035..717235)
FT                   /locus_tag="YPDSF_0637"
FT   CDS_pept        complement(717035..717235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0637"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39046"
FT                   /protein_id="ABP39046.1"
FT                   /translation="MTYSSLIRLPEVLKRTGFSRPWVYKLLKQKRFPPPIKIGGRAIAF
FT                   VESEVNDWIEQQIAHSRGNKQ"
FT   gene            complement(717417..717749)
FT                   /locus_tag="YPDSF_0638"
FT   CDS_pept        complement(717417..717749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39047"
FT                   /protein_id="ABP39047.1"
FT                   /translation="MEGWVKANGFHWPLPLGAALVPEQRQAEESWGGFAGKETALAFIA
FT                   GMAITLARNNPQYRRGVKMNKTAIARVATQAMFNAGFSGEMVTEKQMSNLISEALLVSL
FT                   PGADNP"
FT   gene            complement(717755..717991)
FT                   /locus_tag="YPDSF_0639"
FT   CDS_pept        complement(717755..717991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39048"
FT                   /protein_id="ABP39048.1"
FT                   /translation="MNCYDYVGFNRTEIEQLLQINLRDSDEEYQNILKDKLPKWLTPFL
FT                   SRINITIKETAALIVGVMPYSIQIDDIGMVIIN"
FT   gene            complement(718004..718369)
FT                   /locus_tag="YPDSF_0640"
FT   CDS_pept        complement(718004..718369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39049"
FT                   /protein_id="ABP39049.1"
FT                   /translation="MINPAEKLKAKQQEFISIRELIQRISRLHPTMSQAQIANWLLIEL
FT                   TDARPVSPPLLIQDALGVTRSPGFDDPQFCYFDLLSAAMANPKMDGAPCDGWIPESYKP
FT                   DEFNHRPDEEDDHELPF"
FT   gene            718638..719780
FT                   /locus_tag="YPDSF_0641"
FT   CDS_pept        718638..719780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39050"
FT                   /protein_id="ABP39050.1"
FT                   /translation="MPKFNHYDLALLNPSFDSPLVDALTELELLRHLRLETDVHPLLFA
FT                   QLKSIFHMLESLGSARIEGNHTTLADYVESKVEGAEDSTDQLKEIGNIEHAMNFIDEHL
FT                   HAGEDITEYFVRELHAMTVNGLEREGDKTPGAYRSHGVSIAQSTHLPPEFIHVPAYMQE
FT                   LVGFMNRADAPKYDLMKVALAHHRFGWIHPFGNGNGRTVRLLTYSLLIKYGFNVKTSGR
FT                   VLNPTAVFCNDRERYYSMLAEADTGAVEGLEQWCLYVLTGISAELKKVDKLSDLHFLNS
FT                   KVLYPALEYSKGRGVINETESKILKRTISQGTVKTSDLKEVLPGLKPAQITYQIGKLVD
FT                   RGLLQPVEVGSRIYTAGFSKSDLMRGVIHALRKEGVIPDF"
FT   gene            720287..721825
FT                   /locus_tag="YPDSF_0642"
FT   CDS_pept        720287..721825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39051"
FT                   /protein_id="ABP39051.1"
FT                   /translation="MAKGYYLVVGDETTCGGVITEGEPTHTIMGRAVAREQDRITCGKH
FT                   PGTYIIVGHIPGDTILGRKFAGSLHSTSNCPCKARFIPSMMNDAYELIGSPTSGQSSIA
FT                   PSFTETSESPPDVTPVFAKSCLREKGCTDAGTEGEPHRNFGKMGFYQTIPPSPTSPTDN
FT                   NEVDQRAQTARRKPVETEPDVKTPWYKRVLGRTSAAPAAVVVPVSTGAGLAALEQAGIQ
FT                   GMRFVGGNLMTAGRWMVGSSPVGAAIMGMMPGTLNEGETDLLDKLKLENIAKNGGSAPT
FT                   RVRFRWVDSGNGRLKAEGYHMSAEGGLDRVPVRKMTLNVFTGNYEFWEDGAAGPTILWT
FT                   PNDPGFKAPSNTGNNDGPIIRTTITVLPMPEADETGEHSTTLPMPEEKDFRDYILIHPL
FT                   LDLPPLYIYLSKNPDTPIWTKTKRLEPVSNAYEHWVKHGHEFSDQPFNNAKEYVESTHD
FT                   FVNNPPEGTLTKTRPNGDELFYHPQLNTFAVKTKDGVPKTMFKPSDKMGYWNKQ"
FT   gene            721822..722016
FT                   /locus_tag="YPDSF_0643"
FT   CDS_pept        721822..722016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0643"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39052"
FT                   /protein_id="ABP39052.1"
FT                   /translation="MSDEYSCQCCGSKTIDNLGDYEICPICKWEDDPIQSKEPDYVGGA
FT                   NKMSLNEAKEAYKQGRKVI"
FT   gene            723297..725492
FT                   /locus_tag="YPDSF_0644"
FT   CDS_pept        723297..725492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39053"
FT                   /protein_id="ABP39053.1"
FT                   /translation="MKINSKLWMGLLMGMLGMAVPPSQASSDNTGCVWGKYCPLSGVPF
FT                   LDVYNDTRVNMMLLVGEPKNFILPRLTMPADITRSRNYHFGEFYYDEMSFPKREKSLTD
FT                   ENNDSPSEETPFDKMAKTLGINSASFKGTNARYREARHISNNPASVEQFFTALLADSSL
FT                   TADDRHNLALWRSNIFHNVDAPVDGGITPPPFNIVPGSHVDAFSDYLHGANAFYRGDYP
FT                   EATALFSALQKSSQAWVAETATYMLFRVALNESSTNASDKYGMFETKNINQDAARQALD
FT                   YSRAYLVAYPQGIYAESIQGLERRIYWYLSDWQQLARLYEETLLAAPNAEALWDTVSEV
FT                   DAKFISKDAFGGEPFISDMQAPLLTFTQTLRWLRLGGRQSGSELEVTQEKLASYKPMFV
FT                   DADRLPLWQYLQTAWLYYHEQDYAGVVATVSAVDSLPATDIVTFSQQILYGDALVAQQQ
FT                   WSQAEAHWRKLLGLVQSPQQQQYLQLKLAAVLVNSDQIEAIFTADSPIKNLRYRSLILK
FT                   TKAQKALLQQQVISGANDEEKTIALHTLLLRDLMLGDYQGYEQDKQLSPHIQQSVDQKS
FT                   FADVDLAAFDWQGDNVEQGYACAALDGTVKALVKNKTDGHALNCLGEFFRVTDININTY
FT                   QEGEGNEVLNVAVHAHETVITQPNRFDYYQHVINDPKAEPEDKSYALYRAVMCYAPSGY
FT                   NQCGGEDVDIATRKRWFSSLKTQYKGSRWAERLNYYW"
FT   sig_peptide     723297..723374
FT                   /locus_tag="YPDSF_0644"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.865 at
FT                   residue 26"
FT   gene            725462..726229
FT                   /locus_tag="YPDSF_0645"
FT   CDS_pept        725462..726229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39054"
FT                   /protein_id="ABP39054.1"
FT                   /translation="MGRTAQLLLVSCLLALFMPPAMAEVSDKLQLSHKVYAHDYQAFWL
FT                   WSGVNPQPALQQANQVYLHQGEVVIRQRAAWFQKMGLPSSRLTLPAMWVTVRITTLDVP
FT                   DDILAILIDLPRRWAAAGNQVIGLQIDFDAGTYRLDDYAGFLRRVRTKLDPNFALGVTG
FT                   LLDWAKTGSIQQLNALPIDELVIQTYQGRSTVNQYSRYLPALLQLRLPFKIGLVQHGEW
FT                   DPQWEQYLAASPFYRGEVVFLLNHLRSEPANGK"
FT   sig_peptide     725462..725533
FT                   /locus_tag="YPDSF_0645"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            726834..727613
FT                   /locus_tag="YPDSF_0646"
FT   CDS_pept        726834..727613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0646"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39055"
FT                   /protein_id="ABP39055.1"
FT                   /translation="MKKVNLLVWIGLSLNLVLVLASWFFTVDYQELYGELGYRDRMLLD
FT                   AIAVLRYYFAVSLVLQILSVIFLDKANKLSFGLAIISCLGMLPLSIVFLIGYLFTYNDY
FT                   VYRGLKTFSLNETGKLDTYLNFATVRYFMLGAFATVAGVFMFFTDMPMSMLIIVVGVLN
FT                   MINGIRLGPRPVIALMGDNLVFTPALMSNTYIISIEHVDLVESKKGKFKIKLNLEGLEK
FT                   KITFQKNIMENDKDSSALEKILAKIEKNNGEKQHIFL"
FT   sig_peptide     726834..726899
FT                   /locus_tag="YPDSF_0646"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.834) with cleavage site probability 0.816 at
FT                   residue 22"
FT   gene            727830..728135
FT                   /locus_tag="YPDSF_0647"
FT   CDS_pept        727830..728135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39056"
FT                   /protein_id="ABP39056.1"
FT                   /translation="MPISEINRKIEVYMKGVICIGDKTTHGGQVLSGSGKMKFAGIGVA
FT                   RLNDPVSCPQHGNTFIIEAHPSFKDNGIPVAFHGHRCGCGCTLISSQKGATVIAMR"
FT   gene            complement(728234..728554)
FT                   /locus_tag="YPDSF_0648"
FT   CDS_pept        complement(728234..728554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39057"
FT                   /protein_id="ABP39057.1"
FT                   /translation="MPGYRYRITIEPLTDRKGEAIDKAPVTFEAENHDEILSIIERLQA
FT                   REDLGFGQEKTAAFALGLKLFSETMMENRKHPLFEPLRGAFKDFMILLKKGSPRDRSDH
FT                   AE"
FT   gene            complement(728554..729234)
FT                   /locus_tag="YPDSF_0649"
FT   CDS_pept        complement(728554..729234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0649"
FT                   /product="transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39058"
FT                   /protein_id="ABP39058.1"
FT                   /translation="MFGHSKHDHRHGGHRHEGQGHCGEKMRRGGRHNVMAEDAESARGG
FT                   KHGRGRGGKMHRLFEHGDLRVVLLALLNKTPSHGYELIKAIEEASSGLYVPSPGVIYPT
FT                   LTLLEEQDFVTPVATGNGRKSYQITDAGKFELQKNQAMVDVIFARLAQVNRHKEGNLAE
FT                   GIADAMHRLRHILRSNMMRADLTPEQVARINTALLAAVDTIEEELQPVGVQPAAVDTTV
FT                   QEKN"
FT   gene            complement(729658..730515)
FT                   /locus_tag="YPDSF_0650"
FT   CDS_pept        complement(729658..730515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0650"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39059"
FT                   /protein_id="ABP39059.1"
FT                   /translation="MRSIGWRFFTLGWLILLAGCATDVSLSGKNKSTEANRIQFQRMGS
FT                   APESGAADVTSLDLQPGDILLSSSTGINSLGIRIFSLAPVSHAAIYLGEEQVAEATSTG
FT                   VNIVSLNEAIDHNTAVIAFRYPGLTPEHAAKLREFALDKEGSDYNFGGIVLIAPYMITK
FT                   RICELPLFNATVRNHCLSLLATVQLGDGGSLTEDQRFFCSQFVLEAYNYAGHPISDSNP
FT                   VWITPADLLHMREGDSSSFRSNQPLSYIGHLKQRSSLFTGNKGLAMNNADTLLEDKSPR
FT                   MLSQ"
FT   gene            complement(730891..731409)
FT                   /locus_tag="YPDSF_0651"
FT   CDS_pept        complement(730891..731409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39060"
FT                   /protein_id="ABP39060.1"
FT                   /translation="MKNKIFTAIVLLFSFSLSIQAIANKKNDKKIIINNLTLSSTWVRT
FT                   AISESIDSPSNTINKDDIKRMAAGKHIYIMDNKITIEGVCTFKYVIKKSSPLNYWHSDK
FT                   TVNLYKEEFLKNGFKLSENLAFISAEDPSNDCDSPYSQIAITDNVIFTVYNGHIVFYTN
FT                   SNNVNELAL"
FT   sig_peptide     complement(731344..731409)
FT                   /locus_tag="YPDSF_0651"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.537 at
FT                   residue 22"
FT   gene            complement(732188..733189)
FT                   /locus_tag="YPDSF_0652"
FT   CDS_pept        complement(732188..733189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0652"
FT                   /product="sugar-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39061"
FT                   /protein_id="ABP39061.1"
FT                   /translation="MKKTMLQTLLAATLILSFAASVQAAPVKIAILMYGMKAEFVQLME
FT                   KSAKEHPAVTQGLTTLTLFDGRYDPLVQNNQAETAIRTRYDAIIIVPIDFEANVDVVTM
FT                   ANKANIPVIVANARLNTDKATSGIFSDDVQGGYLEAKAVLDKMQCQGNVVVIEGPIGQS
FT                   AQIQRGQGNDKAIAECGPGKINVLERKTANWSRAEAMPLMENWLQKHRGKINGVIGQND
FT                   EMALGAIEAIKSAGLNVQDFAIAGIDGVSDAIRAVKQGEMMSILQDGQAQIQGAIDIAM
FT                   RSVQGERYQPMSTIWQQYQGKMDWQQGTAKMYEVPWTEVTPQNADELLKMRQ"
FT   sig_peptide     complement(733115..733189)
FT                   /locus_tag="YPDSF_0652"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(733624..734628)
FT                   /locus_tag="YPDSF_0653"
FT   CDS_pept        complement(733624..734628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0653"
FT                   /product="sugar transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39062"
FT                   /protein_id="ABP39062.1"
FT                   /translation="MSLTRTSKFRKAIHQYGIILAFVGLCAVIALAGEFAVNSGTWSEN
FT                   YFLSRDNTLIILRQVSINGILAIGMTFVIITAGVDLSVGAVLGLAGIVAARFATNNSAI
FT                   ALGGTDWPLLVPIVIAIGIGLVCGAINGFILGKYRLQPFIVTMGMLSVARGLTLLTTGG
FT                   NPVSQLTDEFRWLGNGYILGIPVPVLIFIILFAIAWFVLNKMTFGRYVYAVGGNEKSAR
FT                   TSGINVLRIKVAVYTLCGILAAIAGLILTARTGSAQTGAGVSYELDAIAAVVIGGTSMA
FT                   GGIGTLRGTLFGVLIIGVMNNGLDLLGVQSYYQQIIKGVLIVFAVMLDPSRKQ"
FT   sig_peptide     complement(734530..734628)
FT                   /locus_tag="YPDSF_0653"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 33"
FT   gene            complement(734700..736208)
FT                   /locus_tag="YPDSF_0654"
FT   CDS_pept        complement(734700..736208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0654"
FT                   /product="sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39063"
FT                   /protein_id="ABP39063.1"
FT                   /translation="MIRNEILAKKPDYLLEATGLKKSFGDVIALNNAEFCLKRGSIHAL
FT                   CGGNGAGKSTFLGLLMGFIQPDDGAFFINGQYCEFDSPGQALAAGITIVQQELSGVQDL
FT                   SVAENIYLGSEPRRFGIVDFRALNRQADVLLHELGFAISPKAKMRSLSVAEQQRVEIAK
FT                   ALSHTHADIIIMDEPTSALGEEDAQKLFQTIKKLASLGKGVIYVSHRLSEIFQIADSYT
FT                   VFRDGCYICEGETSHITREQLIEHIIGGEIDGEFSKYNTPTNVPLFKASGICWKSKVND
FT                   VSLTLHCGEILGIYGLVGSGRSEFLNLLFGLERADHGSIHIGDEILLKHTPEKAINAGI
FT                   AYVTEDRQETGLVLNHSVSENINISSLNVISRMSIINENDIQRRADHTIRIFNIKTPSR
FT                   QQRVANLSGGNQQKVVLGRWALLDPKVLLLDEPTRGIDIGAKKEIYRFMSDFALKGKGI
FT                   VMVSSELSEIIGMSDRILVFKKGKIVGEITGTEATQAKLMSMAV"
FT   gene            complement(736747..737847)
FT                   /locus_tag="YPDSF_0655"
FT   CDS_pept        complement(736747..737847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0655"
FT                   /product="sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39064"
FT                   /protein_id="ABP39064.1"
FT                   /translation="MSSIRLRNVTKRFGKTETLHNINLDIEDGEFAVFVGPSGCGKSTL
FT                   LRMIAGLEEISDGEVLIDDEVINDVAPSHRGVAMVFQSYALYPHMTVAENMGYGLKVNK
FT                   VPKEQIRHQIEMVAKTLQLSHLLDRKPKQLSGGQRQRVAIGRAIVRNPKVFMFDEPLSN
FT                   LDAELRVEMRLHIAKLHQEMKTTMVYVTHDQVEAMTLADKIVVMNYGKIEQMGSPMSLY
FT                   YNPVNKFVAGFIGSPKMNFLPATVESWQPDSVTVAEGHSLTLALHTSPLQAGDPVTIGI
FT                   RPEHLSVADSTVQTLDFHCEVVERLGNNTYLFGQCHGHDGFKMLLAGDVHFRPYQKLNL
FT                   SFDAGYCMVFNADGLRINAEIPVPHE"
FT   gene            738204..739439
FT                   /locus_tag="YPDSF_0656"
FT   CDS_pept        738204..739439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0656"
FT                   /product="sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39065"
FT                   /protein_id="ABP39065.1"
FT                   /translation="MKINKITALVLTALAVTQFAGFAAHAATQQLTVWEDIKKSAGIKE
FT                   AIADFEKQHQVKVNVLEMPYAQQIEKLRLDGPAGIGPDVLVIPNDQLGGAVVQGLLTPL
FT                   SVDPTIVTTFTKPSIAAFTMDNALYGLPKAVETLVMIYNKDMLPTPLATLDEYAAFSKK
FT                   QRAENKYGLLAKFDQIYYSWGAIEPMGGYIFGKDANGSLKANDIGLNTPGAVEAVTYLK
FT                   TFYANGLFPIGTIGDNGLNAIDSLFTEKKAAAVINGPWAFQPYEAAGINFGVSPLPALP
FT                   NGKDMSSFLGVKGYVVSTWSKDKALAQQFIEFINQPQYVKTRYQVTKEIPALTAMIDDP
FT                   LIKNDEKASAVAIQASRASAMPGIPEMGEVWGPANSALELSVTGKQEPKVALDNAVKQI
FT                   NMQIEAMQASNQ"
FT   sig_peptide     738204..738284
FT                   /locus_tag="YPDSF_0656"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            739599..739739
FT                   /locus_tag="YPDSF_0657"
FT   CDS_pept        739599..739739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0657"
FT                   /product="ABC maltodextrin transporter, permease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39066"
FT                   /protein_id="ABP39066.1"
FT                   /translation="MIISSGDNGAAAKQSSRHAIAAVLCAVVPGFGQFYHRQCGQRDSY
FT                   F"
FT   gene            739712..740908
FT                   /locus_tag="YPDSF_0658"
FT   CDS_pept        739712..740908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0658"
FT                   /product="maltodextrin transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39067"
FT                   /protein_id="ABP39067.1"
FT                   /translation="MWAKGLVFLVLISSFVGVFFDFLQEGLWGLYTLGEEVPRDNSIFL
FT                   LAEGIISVLIIGFGVALYYFSLRDAWVNGKKRDAGIPLNSVRKQYQLLLSEGFPYLMIT
FT                   PGFILLVFAVIFPILFGFSIAFTNYNLYHTPPAKLVDWVGFKNFVNIFTLSIWRSTFFD
FT                   VLQWTVVWTLLATTLQCTVGVLLAILVNQKDLRFKPLIRTIFILPWAVPGFVTILVFAG
FT                   MFNDSFGVINNSILAFFGIAPKAWMTDPFWTKTALIMMQTWLGFPFVFAMTTGVLQAIP
FT                   DDLYEAATMDGASTSTKLRTITLPLVLYSIAPIIITQYTFNFNNFNIIYLFNNGGPAVA
FT                   GSNAGGTDILVSWIYKLTMSSSQYAIAATITILLSIFVVGLALWQFRATKSFKNDDMA"
FT   gene            740920..741771
FT                   /locus_tag="YPDSF_0659"
FT   CDS_pept        740920..741771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0659"
FT                   /product="maltodextrin permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39068"
FT                   /protein_id="ABP39068.1"
FT                   /translation="MAKSQSIKQEKWIRLSLSWLVIILVSVIIIYPLIWTVGASLNAGN
FT                   SLLSTSIIPENLSFQHYADLFNGEVNYMTWYWNSMKISFLTMVLTLISVSFTAYAFSRF
FT                   RFKGRQNGLMLFLLLQMIPQFSALIAIFVLSQLLGLINSHMALVLIYVAGMIPMNTYLM
FT                   KGYLDAIPKDLDESARMDGASNFRIFIEIIMPLSKPIVAVVALFSFTGPLGDFILSSTI
FT                   LRTPDKYTLPIGLYNLVAQKMGASYTTYAAGAVLIAVPVAILYLALQKYFVSGLTSGST
FT                   KG"
FT   gene            741776..742978
FT                   /locus_tag="YPDSF_0660"
FT   CDS_pept        741776..742978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0660"
FT                   /product="galactosidase"
FT                   /EC_number="3.2.1.89"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39069"
FT                   /protein_id="ABP39069.1"
FT                   /translation="MKFFKPALLTVCLSLSLMVGANAAEPFTIAPLKNVPADFIKGADI
FT                   STLAEVERQGGKFFNEQNVQQDAMAILKANGVNYVRLRLWVDPKDSDGQSYGGGSNDLA
FT                   TTLALAKRAKAQGLKVLLDFHYSDFWTDPGKQFKPKAWQKMNYDQLKVAIHDYTRDTIA
FT                   TFKKEGVLPDMVQIGNESNGGLLWPEGKSWGEGGGEFDRLAGLLNAAIGGLRENLSSPS
FT                   DVKIMLHLAEGTKNDTFHWWFDEITKRNVPFDIIGLSMYTYWDGPISALQTNMDDISQR
FT                   YQKDVIVVEAAYGYTLENCDNAENSFTAKEEKDGGYPGTVQGQANFIHDLMQSVINVPD
FT                   GRGKGIFYWEPTWISVPGNTWATPAGMKYINDNWKEGNARENQALFDCQGKVLPSMKVF
FT                   N"
FT   sig_peptide     741776..741847
FT                   /locus_tag="YPDSF_0660"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 24"
FT   gene            743029..744024
FT                   /pseudo
FT                   /locus_tag="YPDSF_0661"
FT   gene            744036..745100
FT                   /pseudo
FT                   /locus_tag="YPDSF_0662"
FT   gene            745212..745523
FT                   /pseudo
FT                   /locus_tag="YPDSF_0663"
FT   gene            complement(745896..747155)
FT                   /locus_tag="YPDSF_0664"
FT   CDS_pept        complement(745896..747155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0664"
FT                   /product="maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39070"
FT                   /db_xref="GOA:A4TIF8"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIF8"
FT                   /protein_id="ABP39070.1"
FT                   /translation="MKTSLRTLSVALAAALVSPSVLAIEKIDFHGYMRAGVGVSSDGGL
FT                   AEWQKTMVGRLGNESDTYGEIGLGAEVYKKEDVSFYLDSMVSMLSDGSNDSETTIGDDA
FT                   QFGLRQLNLQIKGLIPGDKEAVIWGGKRYYQRHDLHIIDTKYWNISGSGAGIENYTVGP
FT                   GAVSVAWVRGDANDVDTRITGDSDVNINYIDVRYAGFKPWAGSWTEVGIDYAMPNPTKQ
FT                   QKEYGGLYDADNAVMLTGEISQDMFGGYNKLVLQYANKGLAQNMISQGGGWYDMWHKTD
FT                   EAKGYRVINTGLIPITDKFSFNHVLTWGSANDITEYTDKTNLISLVGRAQYQFTQYVRA
FT                   IGEVGGFYQKDTYHNGSNYKQGGEKYTIALGLAEGPDFLSRPELRVFASYLNDSENGKP
FT                   FEDGTSNDTWNFGVQVEAWW"
FT   sig_peptide     complement(747084..747155)
FT                   /locus_tag="YPDSF_0664"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.799 at
FT                   residue 24"
FT   gene            747427..748500
FT                   /locus_tag="YPDSF_0665"
FT   CDS_pept        747427..748500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0665"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39071"
FT                   /protein_id="ABP39071.1"
FT                   /translation="MKSKSTTLEDVARHAGVSYQTVSRVLNKSAKVSEATRRKVEQSIE
FT                   LLRYVPNRLAQQLVGKQSMTMGLVTTSLALHAPSQVAAAIKRYAHIEGYQVLISMIDES
FT                   VNQSIQHSINDLKSQWVGKVIINVPLETAVAEKIAADNDDVTCLFLDVDPYSSVFNVSF
FT                   NPADGTRASVKYLYELGHREIALLAGPKQSVSANLRLKSWLETLADYGLSPVSVIHGNW
FT                   DAQSGYSGALQMLRETPQFSAVLVANDQMALGVLSAFHQNQLAVPGEKSVIGYDDTYES
FT                   SFFYPALTTVSLDLDLQGKEAVRRMLSASDNESMRSSSILPAKLVVRNSTGPQAKEHRD
FT                   LQKIAEELRLIAQRLAS"
FT   gene            complement(748813..751188)
FT                   /locus_tag="YPDSF_0666"
FT   CDS_pept        complement(748813..751188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0666"
FT                   /product="glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39072"
FT                   /protein_id="ABP39072.1"
FT                   /translation="MKTLKNWLLINEYPDHLELRVDDRHIFCLYVLEPNLCRVLIKREG
FT                   ELALSRTWSIAPQGDVPWSGRDRLSLEGFSLPGYQLEKHEQQLVVTTECLRVTIHQPLH
FT                   LTWEYKNPHGEWLPLAADRPTSAYLLSPQGEAIAHYQRRYPNEQYYGLGEKAGDLNRAG
FT                   RRFEMRNLDAMGYNAASTDPLYKHIPFTITRRDDVSFGLFYDNLSSCWLDLGNEIDNYH
FT                   LAYRRYQAEAGDLDYYLFLGPKVLDVTKAFVRLTGKTQFGPKWSLGYSGSTMHYTDAPD
FT                   AQVQLQKFIALCQQHDIPCDSFQLSSGYTSIKNKRYVFNWNYDKVPQPKVMSQTFLQAG
FT                   IKLAANIKPCLLQDHPQYQQAAERGLFIRDSETDLPERSTFWDDEGSHLDFTNPDTVNW
FT                   WQENVTKQLLEMGIGSTWNDNNEYEVWDGEARCNGFGKSIAIKHIRPVMPLLMMRASME
FT                   AQKAFAPEMRPYLISRSGCAGMQRYAQTWSGDNRTCWQTLRYNIRMGLGMSLSGLYNLG
FT                   HDVGGFSGDKPEPELFVRWVQNGVMHPRFTIHSWNDDNTVNEPWMYPAATPMIRDAMAL
FT                   RYRLLPYFYTLQWQASHDDEPMLRPTFLDHEHDSLTFKENDDFMLGRDLLVASVVDAGQ
FT                   RQRQIYLPDNQVGWYCFHSGQWYSGGQTITLDAPLERLPLLVRAGAALPLSRRIAFVNP
FT                   EADCQRELALYPTQGGGQSSGMLFEDDGESHRWQQGHALWLNWQVTTDNHRIDITFSRT
FT                   GNYQPAWRELTINLPTNESRTLSINGVAGNTLDLTKLA"
FT   gene            complement(751339..752646)
FT                   /locus_tag="YPDSF_0667"
FT   CDS_pept        complement(751339..752646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0667"
FT                   /product="sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39073"
FT                   /protein_id="ABP39073.1"
FT                   /translation="MSIDINQSAKIVGRRKIKSLRWWMLALFLLGVTVNYITRNSLGIL
FT                   APELKTSLNMTTEQYSWIVASFQLAYTVFQPLCGWLIDVIGLKMGFLVCASVWAVVCMM
FT                   HAGAGTWFQLAVLRFFMGSAEAAATPANAKAISDWFPKKERPIAAGWAGVGFSIGAMLA
FT                   PPIIVLAHVALGWQGAFLFSGALAMIWVLLWWRFYHSPDTHPNLSQEEFELIHQDNEPV
FT                   LPRLPFLKSLAILSKNKKFYGIAIPAFLAEPAWAVFSFWVPLYLATERGMDLKQIAMFA
FT                   WLPFLAADIGSVASSYLTKLYQKWFGCSRVNSVVASSVTGAFMMVSLAFVAVTKDPYLA
FT                   IALISIGGFGHQVISCMLSALVVDSFDKNQVATVNGLRGSSAWIASFLFTLLIGAVSDT
FT                   IGFNPLFIAMGFFDLIGAVFLIALFAERRNKPQPTV"
FT   gene            753040..754122
FT                   /locus_tag="YPDSF_0668"
FT   CDS_pept        753040..754122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0668"
FT                   /product="LacI-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39074"
FT                   /protein_id="ABP39074.1"
FT                   /translation="MNGKLKIQEIANQTGLSISTVSRVLAGKGNTSAKAKQQVMAYAKS
FT                   QGILQNLSSGRLMLNNIMVFAPHRAFDVRTDIFYYKVIQGITQAVSQHEVMIRYCGLSE
FT                   THSDISLFLDKMTHPQSEAAIIIGIDDPRIHALAASLHKPAVLINCRDKEMSLDSVSPD
FT                   HQSIGEFSAHYLIQQGHRRILTLQCLRRNTMELRLLGIKDAFASNNMRFDDHQHLITTH
FT                   GFGAEEAEQAITTFFTACEDESRLPTAILVGGDYMAVGAVNALNKLNVNVPNRVSVMSM
FT                   DGFNLAEIHDVPLTAVHVPRDELGAEAIQLLQRRVLRPDAPFSNLLLQGKLVVRSSVKQ
FT                   VNQNRAMPAANKPTDQIYDL"
FT   gene            complement(754363..754941)
FT                   /locus_tag="YPDSF_0669"
FT   CDS_pept        complement(754363..754941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0669"
FT                   /product="ThiJ/PfpI-family thiamine biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39075"
FT                   /protein_id="ABP39075.1"
FT                   /translation="MTKHVAVLLAHGFEEAEAVIFIDIMRRLDIRVDILSCEATTALST
FT                   YFETPISADALLSDRLDHHYDAVMMPGGPKGTDSLTANPQVIAFLRRHIAQDKYICALC
FT                   SSGAKVLAAHHLLAGRTYSTGDKLADKFADGAYLDQDVVVDGKFITAKGLGVSFEFAFT
FT                   VARHLLSDNLPKVEHQASHIYFKHGSAQT"
FT   gene            complement(754965..755819)
FT                   /locus_tag="YPDSF_0670"
FT   CDS_pept        complement(754965..755819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0670"
FT                   /product="tagatose-bisphosphate aldolase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39076"
FT                   /protein_id="ABP39076.1"
FT                   /translation="MFLVSSREMLRQAQIGGYAIPAFNIHNLETIQAVVETAAEMASPV
FT                   ILAGTPSTFSYAGTEYLVQICQQAARHYRMPFALHLDHHESYDDITQKVAAGIKSIMID
FT                   GSHFNFEQNIALTRQVVEYCHRWDGTVEAELGRLGGQEDDLTVDEKDALYTDPGSAAHF
FT                   IQATGIDSLAIAIGTAHGMYKEAPSLDFDRLALIRRNTDIPLVLHGGSGIPDEDVRRCI
FT                   ELGISKVNVGTELKIAFSGALKAYFLENKGANDPRHYMVPAKAAMKKVIQDKINVCGSA
FT                   GKR"
FT   gene            complement(755930..757417)
FT                   /locus_tag="YPDSF_0671"
FT   CDS_pept        complement(755930..757417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39077"
FT                   /protein_id="ABP39077.1"
FT                   /translation="MSVDISAKPRPIIPYEHPDAAMYYQLFKQHMIRQWHKKRPYARHD
FT                   ARLQALFQNQKVSLQSQCDYLVRYVAEAFDHYAVWDYTHAYYPGRPSQQNARTDALEGV
FT                   SRVLPTLAAWLHSQPTRLDNTRLADLKGGELDIVAILRRAFLAGTDPTHRGYWGTLHDY
FT                   DQRICESADLALALWLSHESVWQAFTPPEQQQVTRWFSQVNTLQTVDNNWHLFPLTVQF
FT                   VMRSLNGTGDISDDKYQRIKEFHVGEGWFRDGAQGNYDYYNAWGFHYSLYWLDQINPDY
FT                   DRQFIRSCMAEFVAAYRYLITPQGIPFFGRSACYRLAVSAPLLAVASHSTDPVHTGEAK
FT                   RALEATLRYFIGHGAMRFGAPTQGLFADDERLVDNYSGPASSFWSLRALNIALYCANDC
FT                   GLWQCESSQLPIETEDFSFTINAIDLFVMGTFETKEVVVTFRYDYTKEQTPLTRRLVSQ
FT                   PWLERVKENVTGRAERPKNNLLRKGVTSYSSKMTSLF"
FT   gene            complement(757540..759147)
FT                   /locus_tag="YPDSF_0672"
FT   CDS_pept        complement(757540..759147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0672"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39078"
FT                   /protein_id="ABP39078.1"
FT                   /translation="MKLPAGKRSLLAGMIAAAGMSMTPVTLAAPAEKPNVLLVIMDDLG
FT                   TGQLDFTLNNLDKKALSQRPVPVRYQGDLDKMIDAAQRAMPNVSLLAKNGVKMTNAFVA
FT                   HPVCGPSRAGIYTGRHPTSFGTYSNDDAMQGIPLDIKLLPALFQEHGYATANIGKWHNA
FT                   RIEKKAFVADEVKSRDYHDNMISVSAPGYAPEKRGFDYSYSYYASGAALWHSPAIWQNS
FT                   KNIAAPGYLTHNLTDETLKFIDDSGKKPFFISLAYSVPHIPLEQASPAKYMDRFNTGNV
FT                   EADKYFAAINAADEGIGRIVQHLQEKGELDNTLIFFISDNGAVHESPMPMNGMDRGHKG
FT                   QMYNGGVHIPFVAYWPKQIPAGTQSDALVSALDILPTALKAAGIAIPAEMRVDGKDILP
FT                   VLAGKEQTSPHQYMYWAGPGAKHYSDENQSFWHDYWKWITYEHQQAPKNDHVETLSKAS
FT                   WAIRDQEWALYFYDDGTNTPKLFNDKHDPMESKDLADQYPERVSAMKAAFYDWIKDKPK
FT                   PVAWGQDRYQILASSAKS"
FT   sig_peptide     complement(759061..759147)
FT                   /locus_tag="YPDSF_0672"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 29"
FT   gene            complement(759168..760394)
FT                   /locus_tag="YPDSF_0673"
FT   CDS_pept        complement(759168..760394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0673"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39079"
FT                   /protein_id="ABP39079.1"
FT                   /translation="MAQPHTQQAYFHMMAKPTSYRCNLDCEYCFYLEKETVLPPQKNPS
FT                   PTMSDSMLRRYVRDYLRSHAGDTVDFAWQGGEPTLAGLDFYRKAVEYQQHYANGKTVTN
FT                   SFQTNGIAINRQWAAFFAEHRFLIGLSVDGLEAVHDKYRIAVNGQPTFARVKKALDLLR
FT                   EYQVDFNTLTVVNDQNWDKGRETYQALKALGSTFMQFIPIVEVDTRCLSRTTGHYSPPA
FT                   NPPMAPFTVPAAGYGRFMNDVFDAWVTEDVGTVYVREFDSLLGTWMGYPAASCIQSVTC
FT                   GQALIIEANGDIYSCDHYVYPAHRLGNIADTSLVKLATSRQQQRFGDAKQEKLTQACIR
FT                   CEVKALCQGGCPKHRIMALPDEKHKHNYLCASYKHFFNHTAPLMQAMCQIIQRGGIAAD
FT                   IMPQLTQPK"
FT   gene            complement(760638..761696)
FT                   /locus_tag="YPDSF_0674"
FT   CDS_pept        complement(760638..761696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39080"
FT                   /protein_id="ABP39080.1"
FT                   /translation="MSNMTQQTRTQQARETMKRVYRYQAANQTRSVIRRSGKTRFIKDT
FT                   DWERGVFWSCVAAAWLATDDAEYLEGVMNYTLHTGFRPGPNLRFADDLICCQAYLDVWP
FT                   QIAVPEALDPTIKAVSAMVDEPKPGREDWWWCDSLFMAPATFAALSQRTGDARYLAYMD
FT                   TAFWDAVDYLRDPDSGLFYRDHRYIPDGTGTELREENGEKVFWSRGIGWVLAAIPRLLA
FT                   RMPEDYTGRQRYLDLFTDLADNVIRYQQADGLWRTSLLDPQRFPAPESSATALFCYGLS
FT                   WGINQGILAPETYLPVVEKAWDALQGCIHDNGMMGWVQLPAFNPRDVKFEHNMDYGAGA
FT                   YLLAASEMLRLA"
FT   gene            complement(761712..762467)
FT                   /locus_tag="YPDSF_0675"
FT   CDS_pept        complement(761712..762467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0675"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39081"
FT                   /protein_id="ABP39081.1"
FT                   /translation="MQLFDLNGKVAIITGCNTGLGQGMAIGLAKAGADIVGVGVAEAPE
FT                   TQAQVEALGRKFHFITADLIQQKDIDSIVSQAVEVMGHIDILINNAGIIRRQDLLEFGN
FT                   KDWDDVININQKTVFFLSQAVAKQFVKQGNGGKIINIASMLSFQGGIRVPSYTASKSAV
FT                   MGLTRALATELSQYNINVNAIAPGYMATDNTAALRADTARNEAILERIPASRWGTPDDL
FT                   AGPAIFLSSSASDYVTGYTLAVDGGWLAR"
FT   gene            complement(762663..763829)
FT                   /locus_tag="YPDSF_0676"
FT   CDS_pept        complement(762663..763829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0676"
FT                   /product="N-acetylglucosamine 6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39082"
FT                   /protein_id="ABP39082.1"
FT                   /translation="MRTAYLADRTFTPQGIETGVAVIVEQGEIVAVTRELPADAEIVHL
FT                   TGKTLIPGLIDIHIHGRQGADVMDASAEALRTIARALPQTGVVAWVGTTVSAPIQDIFA
FT                   ALAQVRDFIADPDNARDTRTATLLGSFLEGPYFTAPFRGSHPEKYLTTPTPQELEQLRH
FT                   SAGNTLLRAAIAPESPEALAAIRWLVNHGIKTSVAHTAANFEQVTAAYQQGADCGVHLY
FT                   NGMSGLHHREPGCCGAVLYHDMLAELIADGIHVHPVMMNLAYRMKGYRRIALITDCMRA
FT                   GGLGEGRYLLGAQHITVRQGEARTDDGSLAGSTCSLDQALRNMIQHAQVPEWEAVQMAS
FT                   AVPAAYLGLASTLGSIQMGAQASMVVMESDFTVAATLIKGEWAYRHSA"
FT   gene            complement(763832..764272)
FT                   /locus_tag="YPDSF_0677"
FT   CDS_pept        complement(763832..764272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0677"
FT                   /product="PTS permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39083"
FT                   /protein_id="ABP39083.1"
FT                   /translation="MIGIVVSGHINFASGMASAVRAITGEQSQMLFIDFVESMSTDMLE
FT                   SELRRAAHEVDSGEGVLFLTDIPGGSPCNRALNILMSGSNVELLAGVNLPMIANAAFER
FT                   EGASLSELVEILMDIGASSVQNLRAELDTALVTDSGENEDGL"
FT   gene            complement(764358..765248)
FT                   /locus_tag="YPDSF_0678"
FT   CDS_pept        complement(764358..765248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0678"
FT                   /product="PTS permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39084"
FT                   /protein_id="ABP39084.1"
FT                   /translation="MASDITVDKDHTAKAKTDSLVDKIDSYQDLEVRKVVTRKDLWKCA
FT                   IRGLFMEGNFNFERMQAGGFAYSMIPALKKIHGNNRADLAKSLKNHLQFFNASPKLFTF
FT                   LLGTAVAMEENKEKPSMINVMKVAGMGPTGGIGDAIDHMTLMPLTLALGASIAIEGSIA
FT                   GPFVFFILYQTVHFLVYFGLMFMGYRAGTAAMVNMGDATEKLAKAANIMGIFVIGALCA
FT                   TFIRLQTTAAIDLGGKTVELQTALFDKIMPNLLPLALVFFMFKMVKGTGFWAKPPVLIF
FT                   STLAAGVVGHLLGIV"
FT   gene            complement(765238..766026)
FT                   /locus_tag="YPDSF_0679"
FT   CDS_pept        complement(765238..766026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0679"
FT                   /product="PTS permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39085"
FT                   /protein_id="ABP39085.1"
FT                   /translation="MLFEATLVGIWAFLCGIDKYDVALNIHRPLITGPVVGLIMGNMEV
FT                   GLIAGATLELAWLGLVPNAGAQPPDVTMGTIAAVAFAVMTGQSPEVAMGVGMPIAVLMQ
FT                   MIIIGFFAMTAFTMGRADKYAEQADTAGISRLLIGTLLTRSMLYFVIAFVTVYFGEHAA
FT                   TWIDENTPTALLEGLGIGAKMVPAIGFAMLLKIMWSKEVAGVFFIGFVMTTYLKLPIMA
FT                   IAILGAAVAVLYYFFSGNNNGSNNNGNNTNKQPEDFEDGI"
FT   gene            complement(766073..766570)
FT                   /locus_tag="YPDSF_0680"
FT   CDS_pept        complement(766073..766570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0680"
FT                   /product="PTS transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39086"
FT                   /protein_id="ABP39086.1"
FT                   /translation="MTRPNIVWTRIDERLLHGQIRITWGKHTEANLILVANDDAADGPN
FT                   SAFMQAGMKASAGGEYAVRFFSIQKTIDVIHKASPQQKVFILCNSPTDVARLVEGGVPI
FT                   TQCNVGNMHYHDGKRQIAKTVSVDEKDLDAFQRMAALGVACTVQNTPDQTPINVIELAA
FT                   RA"
FT   gene            complement(766588..767754)
FT                   /locus_tag="YPDSF_0681"
FT   CDS_pept        complement(766588..767754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0681"
FT                   /product="phosphosugar isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39087"
FT                   /protein_id="ABP39087.1"
FT                   /translation="MTQYLGYSREELTRLHASWTAQEIEQQPACWGKTQRIVEESQAAI
FT                   NDFLHQALAASNTRIIFTGAGTSAFAGRALAPLLAPYLSHRIEAIATTDLVATPEQYFS
FT                   EDIPTLLVSFARSGNSPESVAALQVASACLSRCFHLVLTCNQGGQLYQYCQTAPGALAV
FT                   LMPAETNDQSLAMTSSFSSMMMAAMAIFAGIDKYSKEIERFCKGSADWFKEINHKIIDN
FT                   TKSSQYQRVIYLGSGGLQGLAQESALKLLELTAGKVVATFDTPLGFRHGPKSIVNPDTL
FT                   VVVYISNDPYTRQYDLDLLAEVRANNVAGKVIAIAAQSDAYVTAGDHVLVPGMAESSDL
FT                   GLLFAYLMFAQSFAFHSSVALNNTPDSPSPTGEINRVVQGVTIYPFKK"
FT   gene            complement(767751..769049)
FT                   /locus_tag="YPDSF_0682"
FT   CDS_pept        complement(767751..769049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0682"
FT                   /product="tagatose-bisphosphate aldolase noncatalytic
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39088"
FT                   /protein_id="ABP39088.1"
FT                   /translation="MHPLEKLVQRHKAGEQIGIYSVCSAHPLVIEAALEQALENDSELL
FT                   IEATSNQVDQFGGYTGMTPVDFRDYVFAKADALHFPLEKLILGGDHLGPNRWQHLPANE
FT                   AMAHADDLIAAYVAAGFKKIHLDCSMSCADDPVPLSDEIVAERAARLAAIAEATEYQHF
FT                   NTHTAVYVIGTEVPIPGGATEELDEIEVTSPEAARKTIECHQKAFEKSGVAECWPRVIG
FT                   LVVQPGVEFDHTGVIDFCPEKAHELSKVMDEYDYQVFEAHSTDYQTDDAYRALVKGHFA
FT                   ILKVGPALTFALREALFSLCHIEEELFPAEQCSRLRQVMEDVMLKSPEYWKRYYLGDTE
FT                   QVRLARVYSFSDRMRYYWPMEAVQAAQEKLFANLNSAPIPLPLLSQYMPRQFTAVREGT
FT                   LSFEATALVKQQIKNTLIGYVNACHLFNGNTSK"
FT   gene            complement(769099..769875)
FT                   /locus_tag="YPDSF_0683"
FT   CDS_pept        complement(769099..769875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0683"
FT                   /product="DeoR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39089"
FT                   /protein_id="ABP39089.1"
FT                   /translation="MKAAIERRMEIFNIVTQQGKARVEDLAERFNVSSVTIRSDLSFLE
FT                   KNGYIVRSHGSAIPNTGVIAELTVHEKRRRNSGVKSLIGQAAAKLINSGDTVILDSGTT
FT                   TREIAANLRSVENVVVMTNGLDVAMELASAPGVEVLISGGVLRKSAMSFSGSQAEASLK
FT                   NFRFDKVFLGVDGFDLRVGITTYNEQEASLNRLMCDISEQIIAVADSTKFGKRSCHMIR
FT                   EFGDIDILVTDSDIPEEYVQRLRDMRIEVIIAEKEK"
FT   gene            770715..772268
FT                   /locus_tag="YPDSF_0684"
FT   CDS_pept        770715..772268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0684"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39090"
FT                   /protein_id="ABP39090.1"
FT                   /translation="MSLTRRNLLKGIAVSGALGATAAATGVLSTAQAVVPAKKTGKQPN
FT                   LLIIFPDEMRTQSLGFMGQDPSITPFINQFASQSVVLKQAVSNYPLCTPFRGMLMTGQY
FT                   PYRNGLQGNCHTGADGNFGGKDFGIELKKESVTWSDILKKQGYSMGYIGKWHLDAPEAP
FT                   FVPSYNNPMEGRYWNDWTPPEKRHGFDFWYSYGTYDLHLNPMYWTNDTPRDKPLKINQW
FT                   SPEHEADIAIKYLRNEGGKYRDNDQPFALVVSMNPPHSPYDQVPQKYLDRFKDHTSESL
FT                   NTRPNVVWDKAYQDGYGPKYFKEYMAMVNGVDEQFGRIVAELDRLNLDKDTLVVFFSDH
FT                   GCCMGSNGQPTKNVHYEESMRIPMMFRWPGKLPVREDELLFSAPDIYPTLLGLMGMSEH
FT                   IPDQIEGTDFSNTVAGRPGDKRPTSQLYTFMPYGGQSYGQRGVRTDRYTLVIDRKVGKP
FT                   LTYTLHDNKNDPYQMKNIAAENMALVNQLIADELIPWLEHSGDVWRPTEVAANAAKAYL
FT                   "
FT   sig_peptide     770715..770816
FT                   /locus_tag="YPDSF_0684"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.814 at
FT                   residue 34"
FT   gene            complement(772720..773154)
FT                   /locus_tag="YPDSF_0685"
FT   CDS_pept        complement(772720..773154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0685"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39091"
FT                   /protein_id="ABP39091.1"
FT                   /translation="MWITIAPFVTVFAPKYRRQVFYREKRRAIGSILRKLCEWKNVNIL
FT                   EAECCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNREFWCRGYYV
FT                   DTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            773211..774233
FT                   /locus_tag="YPDSF_0686"
FT   CDS_pept        773211..774233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0686"
FT                   /product="transposase for insertion sequence IS100"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39092"
FT                   /protein_id="ABP39092.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVERMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            774233..775012
FT                   /locus_tag="YPDSF_0687"
FT   CDS_pept        774233..775012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0687"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39093"
FT                   /protein_id="ABP39093.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(775357..778470)
FT                   /locus_tag="YPDSF_0688"
FT   CDS_pept        complement(775357..778470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39094"
FT                   /protein_id="ABP39094.1"
FT                   /translation="MYAPSRLKLIALTMTTLLGTAAYTPHLSANNTKSAKTEVSQKALM
FT                   QSSIIDFDGNQLPDFVTASSGSTLSLSSTRYIMGQQSLKWEWQAGSTMTIEHPITLVTD
FT                   KVASKTWGRKATQVLSFWIYNETPVDDYMIVDLGRGLGPSGAPDAGIKVKMNFSGWRTV
FT                   GVSLQNDLEGREIEGIGFDDNAEGESGGRSTIAGGAKSDMDSIRFRAPLKAPAGIFYID
FT                   RVMLSIDDARYQWSDDHVKTRYQIPEINFRLPAKLPAPTAGEIAAADDIRGALIRVFTE
FT                   GQGGENGLVVVDNREKLRAHFAALKIQRDADGQLSGRHIITDKQKVLYQPEFMDDIDQQ
FT                   RFSDYVLLGDYTTLMFNISRAYQRSTSEEVRQELADMYILMTQHLLDQGYMDGSGLVTT
FT                   HHWGYSSRWWYISAMLMANELDKHQLRQPVSDALLWYSREFKANFDMVPGPESSDLDYF
FT                   NTLSRQHLALLMLESDPAKRVALLKRFGEYINVALSQTPPGGYDGLRPDGTAWRHEGNY
FT                   PGYSFPAFKNAGQLVYMLHGTPFAVSDEGRAALKKAMLSAWVYSNPATSLGLAGRHPFN
FT                   SSSVTLFQDAFRWLALTGDPKTGDKVDKALAAAYLQITETPESESEAIFGVRIAPAELP
FT                   QGNWTFNGGAFGIHRFSDKMVTLKAYNSNVWSSEIYYRDNRYGRYQSHGAIQVLPYGNQ
FT                   KEIGFVQDGWDWNRNPGTTTIHLPLAELDSPNTHTLMLRGNHPFSGHSSLSGKYGMFAF
FT                   KFDAPSMPKFDSSFTARKSALETENRLVLLGSNISNNTEKYATETTLFQHGITDKASDL
FT                   WVNGERITALPYQRALEEGDWLIDGHGNGYLLTKGAKGEVRRQHQVSANDKSRDPTEGN
FT                   FSLAWLDHGAKPQNAQYEYLMVLEATPEGMQQLATDYRAGKKVYEVLRQDASAHIVRDN
FT                   VTQTTGYAAFSSVTPDEGVVKNIAQPAIVMTQMQSHGQLKISGVTPDLNMTRTTKATPL
FT                   AIAVTLNGQWQATENNPQVSVKLAGETTQLVFTSYFGMPQEVTLKPMN"
FT   sig_peptide     complement(778381..778470)
FT                   /locus_tag="YPDSF_0688"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.775 at
FT                   residue 30"
FT   gene            complement(778540..780672)
FT                   /locus_tag="YPDSF_0689"
FT   CDS_pept        complement(778540..780672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39095"
FT                   /protein_id="ABP39095.1"
FT                   /translation="MSVSFNTLAVVCPPEAPAGSSCDAFIANDGKAVSLANDLYITNGN
FT                   ALTYSGNTPFVAQYLRKNIIATGTDAHAIYADANTVFNNNINLERGISIISENGTAIKI
FT                   DGSFSHTAAAPNFGIAVKDGSIVRGNGAAIDFRDAQTAIRMDINGSIYGDILGNGVTGN
FT                   KINFAYQGAAANALFDGYTISGVEKLENWGNLSIIAKDRTITWSGDFTNKNNASLDFKI
FT                   GDEVDLASPILLVEGKTVFNTGSKALFSYVGSNINDIVNKDIILIQSNGGMSGPIDVAQ
FT                   NEITVVSNLSPLLAQTDSWVTTTDPIVNGGISGNQLVVRYGVNYEGTDNFLDLALQGGA
FT                   NQYQLNAANYIVSYALSQYNKTQSEASGELLALLTSAGNSSAGIASIADQITPNAEGGE
FT                   VRAALRMVDKMRDQIDNRSLYLRNQSAATPWNFWAQTLYAHSRQSSGTYTPGYQTNGYG
FT                   INVGVDRRFNDESLFGVSLGYQNANINIHSYGNEKDVDSYELMAYTGWFDDRYFFNGNV
FT                   NMGYNSNSSTRNIGENTGYQGNTKATADYNSLQMGYQVKAGMTFDLDVVKLQPSVAYNY
FT                   QWLRVDDYAEFGSPASLEVDRQSYSVKHLGAGLTAFNTYELGMGLLTPSLTLMGYRDLN
FT                   DTEIIVKKAGLTTDQGKGKGRFIVEGDSVGNNIFEAKMNSNLQLKNNLSLDGNINYYKR
FT                   GDYNEGYIGLSVSKHF"
FT   gene            complement(780840..781790)
FT                   /locus_tag="YPDSF_0690"
FT   CDS_pept        complement(780840..781790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39096"
FT                   /protein_id="ABP39096.1"
FT                   /translation="MKAKLLITSGKLLVTSGTAACLGIMAALMPADVQAAQVNATLSWV
FT                   TGDYGTTYDYSGPRLDMTINPDGSNWYYDLGFRKQLHDTDQRYQRMEVSAGYRFRFAEG
FT                   WVQPSFRLREDLSTYASGNRTTINFYDAKVAGQYQLSERFAFVGNMIVGMEREEANTAS
FT                   NLVERNSDRLSWEIEPGIRFKSSANTQMTLNYFNAGKRSDKGETWGLSDDSKNQQVRFY
FT                   FNWNTPIGLVLTPYARYSLDYGETSGWYESAAFSETKTMSKVDRLALQLAYPLSDTFRL
FT                   QAEYYIENVKYQEGYTMGKDDSRVKYMRVGVRATF"
FT   sig_peptide     complement(781683..781790)
FT                   /locus_tag="YPDSF_0690"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 36"
FT   gene            complement(782393..782701)
FT                   /locus_tag="YPDSF_0691"
FT   CDS_pept        complement(782393..782701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39097"
FT                   /protein_id="ABP39097.1"
FT                   /translation="MLIFLQNLRFFSTYCHHDSYYFEMIFQRVLSVTDRESKQDMYKTI
FT                   TVGCFVGLMVAWLPPAAVQQYVMQFELLAQRWKTSHTGVPDQTFDDNQLKEIARYPE"
FT   gene            783077..783832
FT                   /locus_tag="YPDSF_0692"
FT   CDS_pept        783077..783832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0692"
FT                   /product="carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39098"
FT                   /protein_id="ABP39098.1"
FT                   /translation="MSKITDCCSEENHPNSRRSVLKAALGMTAAGVIGGIGLGLPQISY
FT                   AAALTQEERDKLTPDQIVESLKQGNKRFTSGKALQHDYLAQKRASAEGQFPAAVILSCI
FT                   DSRAPAEIILDTGIGETFNARVAGNIANDDLIGSLEFASAAAGAKVILVMGHTACGAIK
FT                   GAIDNVELGNLTGLLNRIKPAIEVTQFDGEKSSKNEKYVDAVAKTNVKNTMDEIRKNSE
FT                   IIRKLEQEGKVKIVGSMYNLNNGEVEFFM"
FT   gene            785029..785562
FT                   /locus_tag="YPDSF_0693"
FT   CDS_pept        785029..785562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0693"
FT                   /product="general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39099"
FT                   /protein_id="ABP39099.1"
FT                   /translation="MLSLFIMRFFLLKIRLKNPFRTLNCNQFIFIELSIVFLVAFHTVM
FT                   VFWSIIYNDSNDMFILYDGQSYDSQNSTEKAKVIDSSNLSKMFDRKINKPDKKIEMNDV
FT                   LFYSPEYIGEIKLVGVIEHSAPSESIAILEVKGKQTTHLTRENINYEDIVIVKIFTDRV
FT                   IIKRNGKYYSLIIN"
FT   gene            785643..787565
FT                   /locus_tag="YPDSF_0694"
FT   CDS_pept        785643..787565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0694"
FT                   /product="general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39100"
FT                   /protein_id="ABP39100.1"
FT                   /translation="MYISGKGIKSIHGMIFLFTLIMPLDIISANFSVSFKDVDIKEFIN
FT                   SVSKNINKTIIIDPTVQGLISIRSYENLDKDTYYQLFLNVLDVYGYAAIEMPHNVLKVI
FT                   SSKRAKGVVAPLPKEGVTFDGDELINRVIPLRYISAKKITPLLRQLNDNTESGSIINYD
FT                   PSNILLITGRAAVVNRLHSIVTDLDQAGDNEIELYKLNYAIAADVVKIVNEAINPINNL
FT                   KQEVSIVGKVIADERTNSILISGDTYIRKKSILMIKKLDKRQSSDGNTKVVYMKYAQAS
FT                   KLLDVLNGISEGFHNEKKTKQSNQWNQRPVAIKAYDQTNALVITADPDMMLALGEVIEK
FT                   LDIRRAQVLVEAIIVETQNGEGINLGVKWENKRSDDINFIKNSDGLLNNNGWGIATTIT
FT                   GLTAGFYKGNWDVLLSALSTNTNNNILATPSIVTLDNMEAEFNVGQEVPVLISTQTTTT
FT                   DKVYNSISRQSIGVMLKVKPQINKGDSVLLEIRQEVSSIADSSTVNTHNLGSVFNKRVV
FT                   NNAVLVKSGETVVVGGLLDKKSSTIVNKVPFLGDLPLIGWLFRQTKEKVEKSNLILFIK
FT                   PTILRESDDYSVVTSKEYNKYKKDNMNGYTLADDIVLSDKKYLSVIPSIRKDINNFYTL
FT                   LDSEL"
FT   gene            787712..789073
FT                   /locus_tag="YPDSF_0695"
FT   CDS_pept        787712..789073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0695"
FT                   /product="general secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39101"
FT                   /protein_id="ABP39101.1"
FT                   /translation="MAHSPILFNLVTDEEFENNLTERYQNNSADPYQTMSVISNEIDIY
FT                   SFANELSDDDDLLDINDEAPVIKLINSILVEAIKELASDIHIESFDKKLTVRFRIDGVL
FT                   RKILELQRHVALLLVSRIKVMAKLDIAEKRIPQDGRIALNLAGRALDVRVSVLPSSHGE
FT                   RVVMRLLDKNSIKLDLPSLGMSKDNCISMNTQVHKPHGIILVVGPTGSGKSTTLYAALM
FT                   GIDANEKNIMTVEDPIEFDIPGISQTQVNPKIEMTFARSLRAILRQDPDVILIGEIRDI
FT                   ETAQIAVQASLTGHLVLSTLHANSAIGAVTRLKDMNVEAFMLSSSLLAIISQRLVRRLC
FT                   IACRQESSVTEKVLQRLNIDDKCSLVGSVYRAKGCNKCNLTGYRGRIALHEFLVVDNLL
FT                   RGAIYKGLGEFELAKLASGAINSLLSDGISKVIAGLTTIEELVRICQEDDNGCI"
FT   gene            789245..790261
FT                   /locus_tag="YPDSF_0696"
FT   CDS_pept        789245..790261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0696"
FT                   /product="general protein secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39102"
FT                   /protein_id="ABP39102.1"
FT                   /translation="MVLITRQIATLVNASMPLDEVLDIVGKQNSKSKMIEIIQRIRVNI
FT                   QEGHSFADALSPFPAVFSPLYKTMVTAGEVSGHLGLVLVRLADHIEQTQKIQRKIIQAL
FT                   IYPCVLVLISLSVIIILLTAVVPNIVEQFSFSETALPLSTKVLMILSYSIKENVIFIMA
FT                   IGVSAVIFLNRLLKINKINVFFHRHYLSLPMLGNMFVRINTSRYLRTLTTLHSNGVTIV
FT                   QAMSISNAVLTNVYIKNKLNISVKLVSEGCSLSSSLVDSGVFPPIILHMIISGERSGKL
FT                   DHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPILEINSLVM"
FT   gene            790281..790718
FT                   /locus_tag="YPDSF_0697"
FT   CDS_pept        790281..790718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0697"
FT                   /product="general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39103"
FT                   /protein_id="ABP39103.1"
FT                   /translation="MANKKTKGFTLLEIMVVIVILGLLASLTIPSLMSNKNRADQQKAV
FT                   SDISALENALDMYRLDNGDYPTEQQGIAALVTKPNVPPLPQRYPSDGYIRRLPTDPWGN
FT                   SYQMNNPGKHGQIDIFSIGPDRLPETEDDIGNWITLSISET"
FT   sig_peptide     790281..790400
FT                   /locus_tag="YPDSF_0697"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.875) with cleavage site probability 0.414 at
FT                   residue 40"
FT   gene            790675..791265
FT                   /locus_tag="YPDSF_0698"
FT   CDS_pept        790675..791265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0698"
FT                   /product="general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39104"
FT                   /protein_id="ABP39104.1"
FT                   /translation="MILVIGLLYLSVRHRSMFHSQRAFTLLELLLAMIIISGLYYSVII
FT                   TLPKGSGVVKSEAENLVQGLRYINQKIRHEGGVFGLKLSETHWRFYKFCCDDCHGIKDN
FT                   FKINTKINCIWQDSGNDKILSREYPDKLTSKLNVYGEDSIIDNVIGDNIKPQLVFSPEE
FT                   EYSDFSLVLRNEENSECVEIKNNITGVSLFIHK"
FT   gene            791348..791647
FT                   /locus_tag="YPDSF_0699"
FT   CDS_pept        791348..791647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0699"
FT                   /product="general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39105"
FT                   /protein_id="ABP39105.1"
FT                   /translation="MSIMKIISERLRWINILEQRMISSWVAENVLTEIKILKIEQTNEW
FT                   LMGQESMAGQLWYWQSRSIKLQDDRMEIIAVEVRNNKESEHPDFSLEGYKTTND"
FT   gene            792245..793201
FT                   /locus_tag="YPDSF_0700"
FT   CDS_pept        792245..793201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0700"
FT                   /product="general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39106"
FT                   /protein_id="ABP39106.1"
FT                   /translation="MNQNGIALLMVLCALFLMSTMVMASYNYWFDIYYLAKNSQQRQKE
FT                   KWILLGAEEKFVSKLIKNTSEDRFNDNEFRRLLSGGRVTVGTWNVNFKSIDNTNCFNIN
FT                   ALKTKISNPEEIIETYSWQVFKYLLLISGVGVKETQDTLERVVELYRSNLVIEQSINGL
FT                   STLKEIPYEADEINISSKMNRADFLKIAPVLCIRGDRKLLVNINMLDAGNSQYLQAALL
FT                   NKVSARDIYDVISAKPNNGWDNIFIFYDLLSSHSPMSARNVNKNILDKLTVDEYFINYI
FT                   FRIDHEDSYYQLITFIHAVGKSIAILNRRYSFSEQHH"
FT   sig_peptide     792245..792319
FT                   /locus_tag="YPDSF_0700"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            793185..794375
FT                   /locus_tag="YPDSF_0701"
FT   CDS_pept        793185..794375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0701"
FT                   /product="general secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39107"
FT                   /protein_id="ABP39107.1"
FT                   /translation="MSNIIDDVKLTFTLLIRLGETEFEPIYWYVESQGKKLVRHGKING
FT                   VAELKNITLYANNVVKILVPANKIIFRSLSIKKNEVMNNIKSIAFSIEQSISSDIDNFH
FT                   IVILDQDKDFCHVAAIEHELMNRWLFWLNINGISACCIMPDAFALPFFNSEWSVIKIES
FT                   NWLVRNNEMSGFLVNSSVLENILMLAEPTIKVNTFSPTDIKWGNWQSLDYSDPVLIMAK
FT                   TVSGNHVNLLSGKYKYAERIIVNNSVFLRVASWFFLLFLVMSLNGWYQGYKIVRDTGAL
FT                   SKVAQDFYADFLPPAYHGGDVNTSFNKYISDLDLKKNNVSFIKLLNAVSYYTADENVDV
FT                   RSFNFNYSDGEISFDIEGDDDLINEMLNDKTNLFNARVEVIRSGEDKYNIKLSSQP"
FT   gene            794372..794833
FT                   /locus_tag="YPDSF_0702"
FT   CDS_pept        794372..794833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0702"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39108"
FT                   /protein_id="ABP39108.1"
FT                   /translation="MSYVMFLQHLFSAKRRVLLLYLLVISIPIVYYITSRVIEVRNNKL
FT                   LIKYSELSYHLQQHSIMAKKSNIKSHKKSDPIDIEINKSFKNKNIIFTVSLLDGGKCFV
FT                   EINSAKFSNLLDAIIDVSNKYDINVSSADIYLHQDDDDGYVAGKIIFFK"
FT   gene            794859..795701
FT                   /locus_tag="YPDSF_0703"
FT   CDS_pept        794859..795701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0703"
FT                   /product="prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39109"
FT                   /protein_id="ABP39109.1"
FT                   /translation="MMDIQVFFVSYLIFGAMVGSFLNVLIYRLPIMLANLSSRSESHGE
FT                   EIKMRSHLRNINLFQPGSFCHHCNESIPIKYNIPILGWIFLRGASRCCNKKISTRYLFI
FT                   EVLAVIQTLLVLMIFKEDLLICTSLVLIWSLTALAFIDFDTYLLPDCMTIPLLWLGLLI
FT                   NIDTVFAPLTSAVLGAVSGYLFLWLSYWLFKIVRGVDGMGYGDFKLMAALGAWFGVSAV
FT                   PFLILFSSFFGLVAYAIFYFFDKKDNGKEINYIAFGPYISLAGVLYLFLGSHVTNLFS"
FT   gene            complement(795685..796050)
FT                   /locus_tag="YPDSF_0704"
FT   CDS_pept        complement(795685..796050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0704"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39110"
FT                   /protein_id="ABP39110.1"
FT                   /translation="MPNSNIKLMVFFAPILFGCQINSEEKKPNEEIINQLTALTAGLRF
FT                   LKEDCNLKKIPNEQEIINSAIKIANLKGEIMTSKHNNKIIKKSESLYQDIKSDLTAKNT
FT                   KCLELEELLTPFIKKIN"
FT   gene            796804..798012
FT                   /locus_tag="YPDSF_0705"
FT   CDS_pept        796804..798012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0705"
FT                   /product="transposase for the IS285 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39111"
FT                   /protein_id="ABP39111.1"
FT                   /translation="MDEKKLKALAAELAKGLKTEADLNAFSRMLTKLTVETALNAELTE
FT                   HLGHEKNTPKSGSNTRNGYSSKTLLCDDGEIELNTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFKEMYDADVSPTLISKVTDAVKEQVAEWQNRQLDALYPIV
FT                   YMDCIVVKVRQNGSVINKAVFLALGINTEGQKELLGMWLAENEGAKFWLSVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKAVTSGLKMVY
FT                   QAPTEEAALMALDKFAEAWDDKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   VNSVIRAAIKKRKVFPTDDSVRKVVYLAIKDASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   DHL"
FT   gene            complement(798247..798912)
FT                   /locus_tag="YPDSF_0706"
FT   CDS_pept        complement(798247..798912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39112"
FT                   /protein_id="ABP39112.1"
FT                   /translation="MATAHPIKAAIFDMDGLLIDSEPLWLQAELDIFTALGLDTSSRDS
FT                   LPDTLGLRIDLVVKLWYQTMPWQGPSQEEVCNRIIARAIDLVEDTRPVLPGVEYALALC
FT                   RQQGLKIGLASASPLHMQERVLAMLGVEKYFDCLVSAEYLPYSKPHPEVYLNAAAQLDV
FT                   DPLQCVTLEDSVNGMIATKAARMRSIVIPSVEYRADPRWALADIQLESLDQLRKDDIS"
FT   gene            799323..799877
FT                   /locus_tag="YPDSF_0707"
FT   CDS_pept        799323..799877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0707"
FT                   /product="yfeABCD locus regulator"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39113"
FT                   /protein_id="ABP39113.1"
FT                   /translation="MTYQQAGRVAVIKRIAGWLVFIPALLSTLISIINFVYLYSQKGTG
FT                   VNAVMLDFIHVMTDMARFNTPFLNIFWYNSPVPNLEQGLSAGNIMFFIIYMLIFVGLSL
FT                   QASGARMSRQVRHIREGIEDQMILERAKGNEGHSREQLEEKIVLPHHTIFLQFFTLYIL
FT                   PSVIGVLGYFVIKLLGIMIQG"
FT   gene            complement(800006..800881)
FT                   /locus_tag="YPDSF_0708"
FT   CDS_pept        complement(800006..800881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39114"
FT                   /protein_id="ABP39114.1"
FT                   /translation="MWQAVNRLLSECLGPAEIRERTELPGGDIHEAWRLSYGEKEVFVK
FT                   CNTREMLPIFTAESDQLSLLARSKTVQVPEVYGVGSDRDYSFLLLEYIPLKPLDAHNAY
FT                   CLGQQLAHLHQWSEQLQFGLDFDNDLATTPQPNSWQRRWAQFFAEKRIGWQLQLAAEKG
FT                   MSFGDIDDITNAVQERLQSHQPQPSLLHGDLWPANCAASSNGPVIFDPACYWGDRECDL
FT                   SMLPLYPTLPAQIYDGYQSVWPLPIGFIERQSIYQLYYLLNRSNLFGGKHLINAQKAVD
FT                   NLLHPEQFSL"
FT   gene            complement(800906..801118)
FT                   /locus_tag="YPDSF_0709"
FT   CDS_pept        complement(800906..801118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0709"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39115"
FT                   /protein_id="ABP39115.1"
FT                   /translation="MAVSINACVFSTVIFCRDTDITYQQRYSPLFYLMPFHAYVGFILV
FT                   QFYLARLSLCASSYFSHHKDVNLTM"
FT   gene            complement(801186..802079)
FT                   /locus_tag="YPDSF_0710"
FT   CDS_pept        complement(801186..802079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0710"
FT                   /product="chelated iron transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39116"
FT                   /protein_id="ABP39116.1"
FT                   /translation="MNMLFSLISEPFAYPFMQRAIVAAIVTGVVCAILSCYLVLKGWSL
FT                   MGDAISHAVLPGIVLAFWLGIPLVIGAFVSGIFCAVATGYLKENSRVKEDTVMGIVFSG
FT                   MFAFGLVLFSRIDTDQHLSHILFGNMLGISLTELKQTLWIAGFTLLVVLLKRKDFMLYC
FT                   FDPNHARVIGLPVKFLHYGLLCLLALTIVASLQAVGVILVIAMLIAPGIIAFMICRSFD
FT                   QMLVVATLVSVVACVLGTLISFHIDGATGPCIVIIQALFFVVALIYNHIKPIKDRKMAP
FT                   LTKAVNPENTAPSNLP"
FT   gene            complement(802076..802960)
FT                   /locus_tag="YPDSF_0711"
FT   CDS_pept        complement(802076..802960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0711"
FT                   /product="chelated iron transport system membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39117"
FT                   /protein_id="ABP39117.1"
FT                   /translation="MLELLLQPFNYNYMVKAIWVSAIVGAVCAFLSAYLMLKGWSLMGD
FT                   ALSHSVVPGVAGAYALGFPYAAGAFFTGMLAALAMTLVRHITRLREDAIIGFIFSTFFA
FT                   VGLLIVSLNPTSVNVQSIIFGNILGIADEDVLQVEIIILVSFVILCLIWKDLLAVFFDE
FT                   SHAMSIGLSPLRLKILFFTLLSACTVAALQTVGAILVIAMVVTPGATAYLLTDRFGRLL
FT                   IIAIAIGAITSAFGAYLSFYLDGATGGVIVTLQTLVFLPAFFFAPKHGLLATRYRTRLK
FT                   RRHPPVHLPEDNL"
FT   gene            complement(802960..803850)
FT                   /locus_tag="YPDSF_0712"
FT   CDS_pept        complement(802960..803850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0712"
FT                   /product="ATP-binding transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39118"
FT                   /protein_id="ABP39118.1"
FT                   /translation="MSHPVFVRPELVVDNVTVTYNNGHTAIYDASFSLTGGTICALVGV
FT                   NGSGKSTLFKSIMGLVKPSVGKVELSHKPISHALKQNTIAYVPQTEDVDWNFPVLVEDV
FT                   VMMGRYGKMNFLRIPSREDKAIVNKSIERVGLTALRSRQIGELSGGQKKRVFLARALAQ
FT                   QGTLLLLDEPFTGVDVKTENAIIELLQSLRDEGHLILVSTHNLGSVPEFCDHVILINQT
FT                   VLAAGPIETTFTQKNLEMTFGGVLRHINLSGTALHDDNDPRTVTVITDDERPAVFYGHT
FT                   KNDPPAQSQSKEQNS"
FT   gene            complement(803847..804815)
FT                   /locus_tag="YPDSF_0713"
FT   CDS_pept        complement(803847..804815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0713"
FT                   /product="periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39119"
FT                   /protein_id="ABP39119.1"
FT                   /translation="MLIKKKSPYLKMIERLNSPFLRAAALFTIVAFSSLISTAALAENN
FT                   PSDTAKKFKVVTTFTIIQDIAQNIAGDVAVVESITKPGAEIHDYQPTPRDIVKAQSADL
FT                   ILWNGMNLERWFEKFFESIKDVPSAVVTAGITPLPIREGPYSGIANPHAWMSPSNALIY
FT                   IENIRKALVEHDPAHAETYNRNAQAYAEKIKALDAPLRERLSRIPAEQRWLVTSEGAFS
FT                   YLAKDYGFKEVYLWPINAEQQGIPQQVRHVIDIIRENKIPVVFSESTISDKPAKQVSKE
FT                   TGAQYGGVLYVDSLSGEKGPVPTYISLINMTVDTIAKGFGQ"
FT   sig_peptide     complement(804687..804815)
FT                   /locus_tag="YPDSF_0713"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 43"
FT   gene            805027..805689
FT                   /locus_tag="YPDSF_0714"
FT   CDS_pept        805027..805689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0714"
FT                   /product="membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39120"
FT                   /protein_id="ABP39120.1"
FT                   /translation="MNSKVGCLMAILLLAGCAKQTPPPQANNGWLKKTPQGNSLNVAKS
FT                   SAGSTTVAYSDVIKQAASHYGVDETLIKAIIQVESGYNPDVVSRSNAVGLMQIKASTAG
FT                   RDAYRMKGRNGQPSSRELKDPVKNIDIGAAYINILQNQQLAGINDPQTLRYATIVSYAN
FT                   GAGAMLRTFSSDKRLAVNKINSLSPNEFYQHIQKKHPAAQAPRYLWKVDTAYRAMSE"
FT   sig_peptide     805027..805089
FT                   /locus_tag="YPDSF_0714"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.562 at
FT                   residue 21"
FT   gene            complement(805811..806494)
FT                   /locus_tag="YPDSF_0715"
FT   CDS_pept        complement(805811..806494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0715"
FT                   /product="multiple antibiotic resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39121"
FT                   /protein_id="ABP39121.1"
FT                   /translation="MLSIFELFKAVGLGLVLLLPLANPLTTVALLLGLSGNMTREERNN
FT                   QSLMAAIYVFFIMTIAFYAGQIVMSTFGISIPGLRIAGGLIVAFIGFRMLFPQQSAEDT
FT                   QLEAKSQDLKKRKSINIAFVPLAMPSTAGPGTIAMIISSAATMKDQTMFAPWVLAIAPV
FT                   ITFLCVSLILWGSLLSSGAIMRWVGKSGIEAISRLMGFLLVCMGVQFIINGVLELISTY
FT                   QPVMA"
FT   sig_peptide     complement(806411..806494)
FT                   /locus_tag="YPDSF_0715"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.234 at
FT                   residue 28"
FT   gene            complement(807823..808035)
FT                   /locus_tag="YPDSF_0716"
FT   CDS_pept        complement(807823..808035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0716"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39122"
FT                   /protein_id="ABP39122.1"
FT                   /translation="MQRQPVSSSRILSIGYDPDNRMLEIQFREQGTYQYLGVPERAHQN
FT                   FMSAVSKGRFFDGVIKGKFLCRKIG"
FT   gene            808426..810354
FT                   /locus_tag="YPDSF_0717"
FT   CDS_pept        808426..810354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0717"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39123"
FT                   /db_xref="GOA:A4TIL1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIL1"
FT                   /protein_id="ABP39123.1"
FT                   /translation="MPVITLPDGSQRHYDHAVSVLDVALDIGPGLAKACIAGRVNGELV
FT                   DASDLIESDAQLAIITAKDAEGLEILRHSCAHLLGHAIKQLWPDTKMAIGPVIDNGFYY
FT                   DVDIEHTLTQEDLALLEKRMHELADKDYDVIKKKVSWQEARDTFAARGEDYKVAILDEN
FT                   ISRDDRPGLYHHEEYVDMCRGPHVPNMRFCHHFKLQKTSGAYWRGDSKNKMLQRIYGTA
FT                   WGDKKQLNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEAPGMVFWHNDGWTIFRELETFV
FT                   RMKLKEYQYQEVKGPFMMDRVLWEKTGHWENYAEHMFTTSSENREYCIKPMNCPGHVQI
FT                   FNQGLKSYRDLPLRMAEFGSCHRNEPSGALHGLMRVRGFTQDDAHVFCTEEQVRDEVNS
FT                   CIKMVYDMYSTFGFEKIVVKLSTRPEKRIGSDELWTRAEDDLAAALTENGIPFDYQPGE
FT                   GAFYGPKIEFTLHDCLDRAWQCGTVQLDFSLPGRLSASYIGENNDRQVPVMIHRAILGS
FT                   MERFIGILTEEYAGFFPTWLAPVQVVVMNITDSQSDYVQQVTKKLQDAGIRAKADLRNE
FT                   KIGFKIREHTLRRVPYMLVCGDKEVESGKIAVRTRRGKDLGSLDVNVVVDQLLAEIRSR
FT                   SLHQLEE"
FT   gene            810559..810909
FT                   /locus_tag="YPDSF_0718"
FT   CDS_pept        810559..810909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0718"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39124"
FT                   /protein_id="ABP39124.1"
FT                   /translation="MDYGKFLYEKSKSTKEQKKKQKVIQVKEIKFRPGTDDGDYQVKLR
FT                   NLIRFLEDGDKAKITLRFRGREMAHQQIGMEVLNRVRKDLCEDSDLAVVESFPTRIEGR
FT                   QMIMVLAPKKRQ"
FT   gene            811006..811203
FT                   /locus_tag="YPDSF_0719"
FT   CDS_pept        811006..811203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0719"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39125"
FT                   /db_xref="GOA:A4TIL3"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIL3"
FT                   /protein_id="ABP39125.1"
FT                   /translation="MPKIKTVRGAAKRFKKTANGGFKRKHANLRHILTKKATKRKRHLR
FT                   PKGLVSKNDLGLVVACLPYA"
FT   gene            811241..811597
FT                   /locus_tag="YPDSF_0720"
FT   CDS_pept        811241..811597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0720"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39126"
FT                   /db_xref="GOA:A4TIL4"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIL4"
FT                   /protein_id="ABP39126.1"
FT                   /translation="MARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQY
FT                   AYRDRRQRKRQFRQLWIARINAAARQNGLSYSRFINGLKKASVEIDRKILADIAVFDKV
FT                   AFSALVEKAKAALA"
FT   gene            812096..813079
FT                   /locus_tag="YPDSF_0721"
FT   CDS_pept        812096..813079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0721"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39127"
FT                   /db_xref="GOA:A4TIL5"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIL5"
FT                   /protein_id="ABP39127.1"
FT                   /translation="MPHLAELVAKAKAAVEGAQDIAALDLVRVEYLGKKGHLTLQMTSL
FT                   RELPAEERPAAGAVINQAKQEVQEALNARKEKLESAVLNARLAAETIDVSLPGRRMENG
FT                   GLHPVTRTIERIETFFGELGFSVESGPEIEDDYHNFDALNIPAHHPARADHDTFWFDAT
FT                   RLLRTQTSGVQIRTMQEQQPPIRIIVPGRVYRNDYDQTHTPMFHQMEGLIVDRDISFTN
FT                   LKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLR
FT                   NVGIDPEIYSGFAFGMGMERLTMLRYGVTDLRAFFENDLRFLKQFK"
FT   gene            813093..815480
FT                   /locus_tag="YPDSF_0722"
FT   CDS_pept        813093..815480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0722"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39128"
FT                   /protein_id="ABP39128.1"
FT                   /translation="MKFSELWLREWVNPAISSDDLAHQITMAGLEVDGVDAVAGEFNGV
FT                   VVGHVVECGQHPNADKLRVTKIDVGGDRLLDIVCGAPNCRQGLKVAVATVGAVLPGDFK
FT                   IKAAKLRGESSEGMLCSFSELAISDDHDGIIELPADAPIGVDVREYLHLDDKTIEISVT
FT                   PNRADCLGIIGVARDVAVVNQLPLTEPDMAEVVASINDTLPIRVDAPQACPRYLGRVVK
FT                   GINVKAATPLWMREKLRRCGIRSIDPVVDVTNFVLLELGQPMHAFDLDRISGGVIVRLA
FT                   TDGEELTLLDGTKAKLNADTLVIADHQKPLAMAGIFGGEHSGVNEETRNVLLESAFFNP
FT                   LSITGRARRHGLHTDASHRYERGVDPALQHKAIERATRLLIDICGGEAGPVVDVTTASE
FT                   LPKQATITLRREKLDRLIGHHIPSEQVSDILRRLGCKVTECGSDWQAVAPSWRFDMAIE
FT                   EDLVEEVARIYGYNNIPDVPVRADLVMTKHREASLSLKRVKTALVDRGYQEAITYSFVD
FT                   PKVQALLHPQQEALILPNPISVDMSAMRLSLLTGLLSAVVYNQNRQQSRLRLFESGLRF
FT                   VPDNTADLGIRQDVMLAGVIAGHRYDEHWDLARQPIDFYDLKGDLEAILELTGKLSDVQ
FT                   FRAEAHSALHPGQSAAIYLAGEHIGFIGVVHPELERKLDLNGRTVVFEVQWNKLADRAV
FT                   PQAREISRFPANRRDIAVVVAENVPAEDILAECKKVGANQVVGVNLFDVYRGKGVAEGY
FT                   KSLAISLVLQDTARTLEEEEIAATVAKCVEALKQRFQASLRD"
FT   gene            815485..815781
FT                   /locus_tag="YPDSF_0723"
FT   CDS_pept        815485..815781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0723"
FT                   /product="integration host factor alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39129"
FT                   /db_xref="GOA:A4TIL7"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIL7"
FT                   /protein_id="ABP39129.1"
FT                   /translation="MALTKAEMSEHLFEKLGLSKRDAKDLVELFFEEVRRALENGEQVK
FT                   LSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVESATPKE"
FT   gene            816154..816573
FT                   /locus_tag="YPDSF_0724"
FT   CDS_pept        816154..816573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39130"
FT                   /protein_id="ABP39130.1"
FT                   /translation="MPLIAQSDVSLDINMPGINLHLGDQDKRGYYWDGYDWQPPQWWKD
FT                   HRGAHIGERNERGYSWDGGRWQKPQIQQGRNPFREQDRGNGMNNNPQPPRGEGPQKHSD
FT                   NNNKGGNGQGQRTISNNAGPGTQQVYPQQDNHGHR"
FT   gene            816785..817807
FT                   /locus_tag="YPDSF_0725"
FT   CDS_pept        816785..817807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0725"
FT                   /product="putative vitamin B12 transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39131"
FT                   /protein_id="ABP39131.1"
FT                   /translation="MAEGVMQTSQLFTALQQRQRQRDYRYLTGLVVMLLFALLISLCAG
FT                   DVWIWPEHWFSESGKLFVWQLRLPRSMAVIMVGASLAVSGAVMQALFENPLAEPGLLGV
FT                   ANGAGVALVTAVLLGHGLLPIWVLSTCAIIGALLMTSILLSFTRRRLLTNAQLLLVGVA
FT                   LGIICSAMMTWAVYFSTSLDLRQLMYWMMGGFSGVDWRQQSLVLALLPTVIWLCCQGRV
FT                   LNFMSLGEQQARQLGVSLHLWRNLLVLAIGLLVGISVALAGVISFIGLVIPHILRLTGL
FT                   TDQRRLLAGCAFAGGGVLLLADVVARTVLSSAELPIGVVTATLGSPLFIWLLIRVKGVK
FT                   "
FT   gene            817877..818431
FT                   /locus_tag="YPDSF_0726"
FT   CDS_pept        817877..818431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0726"
FT                   /product="vitamin B12 transport protein"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39132"
FT                   /protein_id="ABP39132.1"
FT                   /translation="MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEG
FT                   LESLYKTYQKQGFEVLGFPSNEFAGQEPGSDEEIHAFCRGTFGVDFPMFSKIEVNGPHR
FT                   HPLYQHLVTAKPVAVKPEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLARFA
FT                   PDMAPEAPILINAINQALASH"
FT   gene            818456..819214
FT                   /locus_tag="YPDSF_0727"
FT   CDS_pept        818456..819214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0727"
FT                   /product="vitamin B12 transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39133"
FT                   /protein_id="ABP39133.1"
FT                   /translation="MLLQLNNVSVGTRLASFSSQVTTGLQIHLIGPNGAGKSTLLASLA
FT                   GLLPASGEIVLAGKSLQHYEGHELARQRAYLSQQQSALSLMPVFQYLSLYQPAGANSQA
FT                   VATAISYICNKLRLTDKLPRMLSHLSGGEWQRVRLAAVFLQVWPDINPDSKLLLLDEPY
FT                   SGLDVAQKVALDALLVEFCRSGRSVIISGHDLNHTLQQADEVWLLAQGQVLVQGETQQV
FT                   MRADVLSQVFEVDFQIHNFNKQQWITTRSV"
FT   gene            819564..820718
FT                   /locus_tag="YPDSF_0728"
FT   CDS_pept        819564..820718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0728"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39134"
FT                   /db_xref="GOA:A4TIM2"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIM2"
FT                   /protein_id="ABP39134.1"
FT                   /translation="MQSFLPFSRPAIGSEEINAVANVLGSGWITTGPQNHQLETDFCQI
FT                   FGCKHAIAVCSATAGMHITLLALGIGPGDEVITPSQTWVSTINMIVLLGAEPVMVDVDR
FT                   DTLMVNAAAIEAAITPNTKAIIPVHYAGAPCDLDALRQISQRHGIPLIEDAAHAVGTRY
FT                   RDQWIGEQGTAIFSFHAIKNITCAEGGLVATDDDELAARVRRLKFHGLGVDAFDRQIQG
FT                   RSPQAEVVEPGYKYNLSDIHAAIAVVQLRRLPEINARRQALVASYHKALAHLPLQPLAL
FT                   PHYSHQHAWHLFMVRVDEERCGISRDQLMACLKDMGIGSGLHFRAVHSQKYYRERYPHL
FT                   CLPNTEWNSARLCTLPLFPDMLDSDIERVANALTTIIGSHRVTK"
FT   gene            820705..821688
FT                   /locus_tag="YPDSF_0729"
FT   CDS_pept        820705..821688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0729"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39135"
FT                   /db_xref="GOA:A4TIM3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR022857"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIM3"
FT                   /protein_id="ABP39135.1"
FT                   /translation="MSLNEPIKKVSIVIPVYNEQESLPALIDRTTAACKLLTQAYEIIL
FT                   VDDGSSDNSTELLTAAANDPDSHIIAILLNRNYGQHSAIMAGFNQVSGDLIITLDADLQ
FT                   NPPEEIPRLVHVAEEGYDVVGTVRANRQDSLFRKTASRMINMMIQRATGKSMGDYGCML
FT                   RAYRRHIVEAMLHCHERSTFIPILANTFARRTTEITVHHAEREFGNSKYSLMRLINLMY
FT                   DLITCLTTTPLRLLSLVGSAIALLGFTFSVLLVALRLIFGPEWAGGGVFTLFAVLFMFI
FT                   GAQFVGMGLLGEYIGRIYNDVRARPRYFVQKVVGAEQTENNQDVEK"
FT   gene            821685..823688
FT                   /locus_tag="YPDSF_0730"
FT   CDS_pept        821685..823688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0730"
FT                   /product="formyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39136"
FT                   /db_xref="GOA:A4TIM4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR021168"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIM4"
FT                   /protein_id="ABP39136.1"
FT                   /translation="MKAIVFAYHDIGCVGLNALAEAGYDIQAVFTHTDNPGENRFFSSV
FT                   ARVAADLALPVFAPEDVNHPLWVERIRELQPDIIFSFYYRNMLSDEILSLAPQGGFNLH
FT                   GSLLPQYRGRAPINWVLVNGETETGVTLHQMVKKADAGPIAGQYKVAISDVDTALTLHA
FT                   KMRDAAQELLRNLLPRMKEGPLPLTPQKEADASYFGRRTAADGEIHWQKSAFTINNLVR
FT                   AVTEPYPGAFSYLGQRKLTIWRSRPLDLVHNKLPGTVLSTAPLTVACGEGALEIITGQG
FT                   EAGLYVQGDRLAQEMGIVTDVRLGNKPSNTLKRRTRVLILGVNGFIGNHLTERLLQDDR
FT                   YEVYGLDIGSDAISRFLGNPAFHFVEGDISIHSEWIEYHIKKCDVILPLVAIATPIEYT
FT                   RNPLRVFELDFEENLKIVRDCVKYNKRIVFPSTSEVYGMCDDKEFDEDTSRLIVGPINK
FT                   QRWIYSVSKQLLDRVIWAYGVKEGLKFTLFRPFNWMGPRLDNLDAARIGSSRAITQLIL
FT                   NLVEGSPIKLVDGGAQKRCFTDIHDGIEALFRIIENRDGCCDGRIINIGNPTNEASIRE
FT                   LAEMLLTSFENHELRDHFPPFAGFKDIESSAYYGKGYQDVEYRTPSIKNARRILHWQPE
FT                   IAMQQTVTETLDFFLRAAVIEKTAAPKDELNA"
FT   gene            823685..824590
FT                   /locus_tag="YPDSF_0731"
FT   CDS_pept        823685..824590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0731"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39137"
FT                   /db_xref="GOA:A4TIM5"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR023557"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIM5"
FT                   /protein_id="ABP39137.1"
FT                   /translation="MKQVGLRIDVDTYRGTQYGVPSLLTVLEKHDIRASFFFSVGPDNM
FT                   GRHLWRLFRPRFLWKMLRSNAASLYGWDILLAGTAWPGKKIAKDFGPLMKAAAMAGHEV
FT                   GLHAWDHQGWQANVASWSQQQLTEQVQRGVDTLQQSIGQPISCSAAAGWRADERVLAVK
FT                   QQFDFSYNSDCRGTHPFRPLLPNGSLGSVQIPVTLPTYDEVVGGEVQAENFNDFIIDAI
FT                   LRDSGVSVYTIHAEVEGMSQAAMFEQLLMRAKQQDIEFCPLSKLLPSDLQLLPVGKVIR
FT                   AAFPGREGWLGCQSDIKDAE"
FT   gene            824587..826251
FT                   /locus_tag="YPDSF_0732"
FT   CDS_pept        824587..826251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0732"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39138"
FT                   /db_xref="GOA:A4TIM6"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR022839"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIM6"
FT                   /protein_id="ABP39138.1"
FT                   /translation="MKLLKDSGAALLALFFVLVYLLPVNSRLLWQPDETRYAEISREML
FT                   QRGDWVVPYFMDIRYFEKPVAGYWFNNISQWIFGDSNFAVRFGSIFSTALSAVLVYWLA
FT                   TLLWRNRSTSVLATLIYLSFLLVFGIGTYAVLDPMISLWLTAAMVSFYLTLKAENWQQK
FT                   VGAYALLGVACGMGFMTKGFLALAVPVIAVLPIVIQQKRIKDLVVFGPIAIVCAVLLSL
FT                   PWALAIAQREPDFWNYFFWVEHIQRFAEASAQHKSPIWYYLPILCIGVLPWLGLLPGAL
FT                   FKGWRERATKPELFFLLSWVVMPLLFFSVAKGKLPTYILPCMAPLSLLMAAYATDCANN
FT                   IRMRALKINGVINLLFGVACALVIVVIGLGLVKDIVAYGPQENQKVWLGVLAFAGWGVT
FT                   GFITLRNNARNWRWAAACPLLFILLVGYLIPQQVVDSKQPQNFIKNNFSELSSSRYVLT
FT                   DSVGVAAGLAWELKRSDILMFSEKGELTYGLAYPDSQDNYISNDDFPTWLAQARKEGDV
FT                   SLVVQLAKNEALPAHLPPADKVNLMNRLALLWYQKTP"
FT   sig_peptide     824587..824667
FT                   /locus_tag="YPDSF_0732"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.787 at
FT                   residue 27"
FT   gene            826248..826592
FT                   /locus_tag="YPDSF_0733"
FT   CDS_pept        826248..826592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0733"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39139"
FT                   /db_xref="GOA:A4TIM7"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR022883"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIM7"
FT                   /protein_id="ABP39139.1"
FT                   /translation="MNSYLLLLMVSLLTCIGQLCQKQAAQCWEQPQARRLNLTLRWLAI
FT                   AVVSLGLGMLLWLRLLQQLPLSVAYPMLSFNFVLVTLAAQLFYGEKATLRHWLGVAAIM
FT                   FGILLMSWHL"
FT   sig_peptide     826248..826316
FT                   /locus_tag="YPDSF_0733"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.681 at
FT                   residue 23"
FT   gene            826589..826975
FT                   /locus_tag="YPDSF_0734"
FT   CDS_pept        826589..826975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0734"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39140"
FT                   /db_xref="GOA:A4TIM8"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR022832"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIM8"
FT                   /protein_id="ABP39140.1"
FT                   /translation="MKGYLWGGASVVLVTVAQLVLKWGMMNIPLLSLADINVQFLTMYF
FT                   VQLASVMCGLMGYALSMLCWFFALRYLPLNRAYPLLSLSYALVYLGAVLLPWFNEPATL
FT                   LKTLGAGFILLGIWLINIKPIKAS"
FT   gene            827255..827719
FT                   /locus_tag="YPDSF_0735"
FT   CDS_pept        827255..827719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0735"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39141"
FT                   /protein_id="ABP39141.1"
FT                   /translation="MRTRFWIFLISMVLAGCSSHTPTPSGYLSDSIVVVAKLNEQLRQW
FT                   EGTPYRNGGLDQRGVDCSGFVYRTFRDRFDMQLPRTTLAQTTLGTKVSRDELMPGDLVF
FT                   FKTGSGQNGLHVGIYDTNDEFIHASTSKGVIRSSLENVYWKRVYWQARRI"
FT   sig_peptide     827255..827314
FT                   /locus_tag="YPDSF_0735"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.303 at
FT                   residue 20"
FT   gene            827844..828860
FT                   /locus_tag="YPDSF_0736"
FT   CDS_pept        827844..828860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0736"
FT                   /product="lipoate-protein ligase"
FT                   /EC_number="6.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39142"
FT                   /db_xref="GOA:A4TIN0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="InterPro:IPR023741"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIN0"
FT                   /protein_id="ABP39142.1"
FT                   /translation="MSSLRLLISDSYDPWFNLAVEECIFRQMSPNQRVLFLWRNADTVV
FT                   IGRAQNPWKECNTRRMEQDGVKLARRSSGGGAVFHDLGNTCFTFMAGKPGYDKTISTQI
FT                   ILNALASLGIQATASGRNDLVVINGEDERKVSGSAYKETKDRGFHHGTLLLNADLSRLA
FT                   DYLNPDPKKLQAKGITSVRSRVTNLVELLPGIDHGKIRTAIEQAFFAYYDEQVSAEVIS
FT                   PQSLPNLPGFTEQFAKQSSWEWNFGQAPAFSHVVDTRFIWGGIELHFDVLHGAIDRCQI
FT                   FTDSLNPTPLEALAQRLQGAAYRPDAIDKICQHWIDDFPELQTELQQACHWLVEVLR"
FT   gene            828912..830375
FT                   /locus_tag="YPDSF_0737"
FT   CDS_pept        828912..830375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39143"
FT                   /db_xref="GOA:A4TIN1"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIN1"
FT                   /protein_id="ABP39143.1"
FT                   /translation="MKPRMEYAPEFDNSYARQLSGFYTRLQPTPLKGARLLYHSKPLAQ
FT                   ELGLDAHWFTEPKTAVWAGEALLPGMEPLAQVYSGHQFGMWAGQLGDGRGILLGEQRLN
FT                   DGRYMDWHLKGAGLTPYSRMGDGRAVLRSVIREFLASEALHHLGIPTSRALTIVTSDHP
FT                   IYREQTERGAMLLRVAESHIRFGHFEHFYYRQQPKQVQQLADYVIARHWPQWVGHQECY
FT                   RLWFTDVVERTARLMAHWQTVGFAHGVMNTDNMSILGITMDYGPFGFLDDYVPGYICNH
FT                   SDHQGRYAYDNQPAVALWNLHRLGHALSGLMSADQLQLALEAYEPALMVAYGEQMRAKL
FT                   GFLERDSQDNDLLTGLLSLMIKEGRDYTRTFRLLSEVEVHSAQSPLRDDFIDRAAFDDW
FT                   YRRYRSRLQQESIDDDQRQQSMKAANPKYILRNYLAQQAITQAEKDDIQPLQRLHQALQ
FT                   QPFTDQPEFDDLAALPPDWGKHLEISCSS"
FT   gene            complement(830544..831590)
FT                   /locus_tag="YPDSF_0738"
FT   CDS_pept        complement(830544..831590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0738"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39144"
FT                   /protein_id="ABP39144.1"
FT                   /translation="MYKIDELRTARIDSLITPQQLAEKLPISEVIADNVTASRKRIEKI
FT                   LIGEDPRLLVVIGPCSIHDLDAAVDYATRLKVLRERYQDRLEIVMRTYFEKPRTVVGWK
FT                   GLISDPALDGSCQVNLGIELARKLLLAVNELGLPTATEFLNMVTGQYIADLISWGAIGA
FT                   RTTESQIHREMASALSCPVGFKNGTDGNVRIAIDAIRAAQASHMFLSPDKTGQMTIYQT
FT                   SGNPYGHIIMRGGKQPNYDASDIAAACDSLREFDLPEHLVVDFSHGNCQKMHRRQLDVA
FT                   ENIGLQIRAGSTAIVGVMAESFLIEGTQKIVAGQPLTYGQSITDPCLNWDDTEQLLSLL
FT                   ADAVDSRF"
FT   gene            complement(831747..832568)
FT                   /locus_tag="YPDSF_0739"
FT   CDS_pept        complement(831747..832568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0739"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39145"
FT                   /db_xref="GOA:A4TIN3"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR008917"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIN3"
FT                   /protein_id="ABP39145.1"
FT                   /translation="MERCVFYISDGTAITAEVLGHAVLSQFPINVTTFTLPFVENAARA
FT                   QSVCKQINEIYQDTGVRPLVFYSIISLEVREIIQRSEGFCQDIVQALVAPLQGELGVPP
FT                   QPVLNRTHGLTESNLDKYDARIAAIDYALAHDDGISLRNLDQAQVILLGVSRCGKTPTS
FT                   LYLAMQFGIRAANYPFIADDMDNLQLPAALKPFQHKLFGLTINPERLAAIREERRENSR
FT                   YASLRQCRMEVGEVEALFRKNQIRYLNSTNYSVEEISTKILDILGMSRRMF"
FT   gene            832867..835251
FT                   /locus_tag="YPDSF_0740"
FT   CDS_pept        832867..835251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0740"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39146"
FT                   /protein_id="ABP39146.1"
FT                   /translation="MSNNGHTRCNVLWYNQLGMHDVDRVGGKNASLGEMITHLSELGVS
FT                   VPNGFATTAQAFNDFLEQSGVNQRIYQLLDNTNIDDIAELSKAGAQIRQWVIETPFHPE
FT                   FEQSIYDAYKQLADGEPEASFAVRSSATAEDMPDASFAGQQETFLNVQGIDAIMVAIKH
FT                   VFASLFNDRAISYRVHQGYDHRGVALSAGVQRMVRSDLASSGVMFTIDTESGFDQVVFI
FT                   TAAHGLGEMVVQGAVNPDEFYVHKPTLRNGKPAIVRRNMGSKKIRMIYAENQEHGKQVC
FT                   IEDVPEIQRNRFALSDDEVEALAHQALLIEEHYGRPMDIEWAKDGHTGQLFIVQARPET
FT                   VRSNEQVMERYQLNNQSNVLVEGRAIGHRIGAGPVKVIHDISEMDRIQAGDVLVTDMTD
FT                   PDWEPIMKKASAIVTNRGGRTCHAAIIARELGIPAVVGCGNATELLKEGQNVTVSCAEG
FT                   DTGYVYHELLDFSVQSSQVTELPDLPLKIMMNVGNPDRAFDFARLPNEGVGLARLEFII
FT                   NRMIGVHPKALLEFDQQEPALQAEIKALMHGYDDPVEFYIGRLTEGIATLGAAFWPKPV
FT                   IVRLSDFKSNEYANLVGGAGYEPHEENPMLGFRGAGRYVSDHFRDCFALECEAMKRVRN
FT                   VMGLTNVEVMVPFVRTVAQAEAVVAELARQGLKRGENGLKIIMMCEIPSNALLAEQFLE
FT                   HFDGFSIGSNDMTQLTLGLDRDSGVVSALFDERNEAVKALLSMAIQAAKRHGKYVGICG
FT                   QGPSDHEDFALWLMEQGIDSLSLNPDTVVKTWLSLAQHTKH"
FT   gene            complement(835851..836891)
FT                   /locus_tag="YPDSF_0741"
FT   CDS_pept        complement(835851..836891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0741"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39147"
FT                   /protein_id="ABP39147.1"
FT                   /translation="MGMIIASFWVIQPFVMGFAWAGMVVIATWPLLIRLEKLLWGRRSL
FT                   AVVVMTILLILLFVIPIALLVSSLVENSAPLIQWASSPSNLRMPNVDWMKSIPLIGDKL
FT                   YSSWNTLISGGANALMAKVQPYIGATATWFVAQAAHVGYFLIHLALMVLFSVLLYIHGE
FT                   QVALGIRHFAMRAADKRGDAVVVMAAKAIRAVALGVVVTALVQAILGGIGLAIAGIQYA
FT                   TLLTVLMFICCVAQLGPLLVLVPAVIWVYWTGDTTWGTILLVWSCIVGTLDNFLRPYLI
FT                   RMEADMPMILILSGVIGGLLSFGMIGLFIGPVVLAISYRLISAWVHETPEPEESVTDAA
FT                   KHLEEL"
FT   gene            837575..840631
FT                   /locus_tag="YPDSF_0742"
FT   CDS_pept        837575..840631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39148"
FT                   /protein_id="ABP39148.1"
FT                   /translation="MIPQISQAPGVIQSVLDFLDALKQNGFTGDTATNYADRLTMATDN
FT                   SIYQLLPDAVVFPRSTADVALVGRLAGLESFKSLVFTPRGGGTGTNGQALNRGIVVDMS
FT                   RHMNRILEINPEQGWVRVEAGVIKDQLNQYLQPFGFFFSPELSTSNRATLGGMINTDAS
FT                   GQGSLVYGKTSDHVLGLRAIVLGGEMLDTQAMPTSLAETIAQEDSVVGRIYHTVLNRCR
FT                   EQRALILEKFPKLNRFLTGYDLRHVFSDDLQTFDLTRILTGSEGTLAFITEATLDITPL
FT                   PKVRRLVNVKYDSFDSALRNAPFMVEAKALSVETVDSKVLNLAKEDIVWHSVKELITDV
FT                   PDKEMLGLNIVEFAGDDAALIDTQMAALCQRLDELMSTRQGGVIGYQICSELAGIERIY
FT                   GMRKKAVGLLGNSKGRAKPIPFAEDTCVPPHHLADYIVEFRQLLDSHNLSYGMFGHVDA
FT                   GVLHVRPALDMCDPQQERLMKQLSDQIVALTARYGGLLWGEHGKGFRAEYSPDFFGDVL
FT                   YRELRRIKSAFDPDNRLNPGKICSPLGSDAPMMKIDSADKRGTLDRRIPLEVRTSFRGA
FT                   MECNGNGLCFNFDAHSPMCPSMKITGDRIHSPKGRATLVREWLRLLSEQGVDPVALEKG
FT                   LASKRPSLRGLIEKTRNSWQASQGVYDFSHEVKESMSGCLACKACSTQCPIKIDVPGFR
FT                   SRFLQLYHTRYHRPLRDYVVAGVESYAPLMAKAPKVFNFFLKQLWVRSLSQKSIGMVDL
FT                   PMLSSPTLKQALSGHYASTMTLEQLEKLSEQERRQHVLIVQDPFTSYYDAQVVADFVRL
FT                   VEKLGFNPVLLPFSPNGKAQHIKGFLQRFAKTARKTADFLNRIALLAMPMVGVDPALVL
FT                   CYRDEYKEILGDARGDFTVQLVHEWLQTALADQPEQQISGEPWYLFGHCTETTALPGSS
FT                   QHWATIFSRYGARLENVSVGCCGMAGTYGHEAKNVENSLGIYALSWQQALQTLPGKRCL
FT                   ATGYSCRSQVKRIEGNGLRHPLQALLELV"
FT   gene            840753..841169
FT                   /locus_tag="YPDSF_0743"
FT   CDS_pept        840753..841169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39149"
FT                   /protein_id="ABP39149.1"
FT                   /translation="MLWKRAATLEQLNQQSQGCMVGHLGIEFTRLSDDELEATMPVDSR
FT                   TTQPFGLLHGGASVVLAESLGSMAGYLCTVEGQQVVGLEINANHLKSVRSGNVRGCCRA
FT                   IHVGRSHQVWQIEIFDEQGHLCCTSRLTIAVLTR"
FT   gene            841785..842156
FT                   /locus_tag="YPDSF_0744"
FT   CDS_pept        841785..842156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0744"
FT                   /product="FeS assembly scaffold SufA"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39150"
FT                   /protein_id="ABP39150.1"
FT                   /translation="MQQESVGTFSLDDNDWQGVTITDSAAAQITRLMQQDPQIKGLQLG
FT                   VKQSGCAGFAYVMDMAKEPASDDLVFEQGSARLYVPLKAMPFIDGTEVDYVREGLNQIF
FT                   KFNNPKAQHSCGCGESFGV"
FT   gene            842171..843682
FT                   /locus_tag="YPDSF_0745"
FT   CDS_pept        842171..843682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0745"
FT                   /product="Iron-regulated ABC transporter membrane component
FT                   SufB"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39151"
FT                   /protein_id="ABP39151.1"
FT                   /translation="MTRSNVEIPDDVQAWVSDGRYKEGFFTHLATDELAKGINEEVVRA
FT                   ISAKRNEPEWMLEFRLGAYRSWLEMEEPHWLKAHYQGLDYQDYSYYSAPSCGSCDDNCD
FT                   SQPGAVQQSSADGSAPSNANEYLTAEVESAFAQLGIPVREGAEVAVDAIFDSVSVATTY
FT                   REKLAGQGILFCSFGEAIQEYPDLVQKYLGSVVPAKDNFFAALNAAVASDGTFVYVPKG
FT                   VRCPMELSTYFRINAAKTGQFERTILIADEGSYVSYIEGCSAPVRDSYQLHAAVVEVIL
FT                   HKNAEVKYSTVQNWFAGSDSTGGILNFVTKRALCEGEGSKMSWTQSETGSAITWKYPSV
FT                   ILQGDNSVGEFFSVALTNGYQQADTGTKMIHIGKNTKSTIIAKGISAGHSQNTYRGLVK
FT                   ILPGADNARNFTQCDSMLIGPDSGAHTFPYVEVRNNTAQLEHEATTSKIGDDQLFYCLQ
FT                   RGISEDDAISMIVNGFCKDVFSELPLEFAVEAQKLLAISLEHSVG"
FT   gene            843868..844614
FT                   /locus_tag="YPDSF_0746"
FT   CDS_pept        843868..844614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0746"
FT                   /product="Iron-regulated ABC transporter ATPase subunit
FT                   SufC"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39152"
FT                   /protein_id="ABP39152.1"
FT                   /translation="MLSIKNLKVSVEGNEILKGLDLEIKPGEVHAIMGPNGSGKSTLSA
FT                   ALAGREEYEVTEGEVTFKGKDLLELAPEDRAGEGVFLAFQYPVEIPGVSNHFLLQTSVN
FT                   AVRKYRQQAPLDRFDFSDFIEEKIALLKMPADLLTRSVNVGFSGGEKKRNDILQMAALE
FT                   PSLCILDETDSGLDIDALKIVANGVNSLRNENRSFIIVTHYQRILDYVKPDFVHVLYQG
FT                   RIIKSGDFTLVKQLEEQGYGWLTDQQ"
FT   gene            844589..845914
FT                   /locus_tag="YPDSF_0747"
FT   CDS_pept        844589..845914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0747"
FT                   /product="Iron-regulated ABC transporter permease protein
FT                   SufD"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39153"
FT                   /protein_id="ABP39153.1"
FT                   /translation="MAGLPTNSNVLERQRLEQQRQEQQRIDALKHFGQLFKQRQIEPSA
FT                   DARAHWQQVLQLGFPGSKHEDWKYTPLERLFAHEFSFPHAPDVTTAQCDALSLVPNAHR
FT                   LVFINGQFSPTLSDRECGPYQLTHAAENVPFPTAIQSEVFLHLTESLAQERLHIRLPVG
FT                   QHSDKSLYLLHISSGNDSDMVNTSHSRHHLVVEANAQAEVIEHFVSLNEQPHFTGARLT
FT                   IAVGDNAELNHYKLAFETPKSYHFAHNDLVLGRDARARSHSFLLGAGLTRHNTSSQLNG
FT                   EGSSLSMNSLLLPVGREICDTRTYLEHNKGHCESRQLHKVMVRERGKAIFNGMIKVAKH
FT                   ALKTDGQMTNNNLLLSHLAEVDTKPQLEIYADDVKCSHGATVGRIDAEQLFYLQSRGIN
FT                   QADAQQMIIFAFAAEVTEAIHNEAIRKQVLARIAERLAWESV"
FT   gene            845911..847131
FT                   /locus_tag="YPDSF_0748"
FT   CDS_pept        845911..847131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0748"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39154"
FT                   /db_xref="GOA:A4TIP2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIP2"
FT                   /protein_id="ABP39154.1"
FT                   /translation="MNFPIERVRADFPLLSRQVNGQPLVYLDSAASAQKPQAVIDKELH
FT                   FYRDGYAAVHRGIHSLSAEATQQMEAVRTQVADFIHAASAEEIIFVRGTTEAINLVANS
FT                   YGRHFLAAGDSIIITEMEHHANIVPWQMLAQDLGVEIRVWPLTATGELEITALAALIDD
FT                   TTRLLAVTQVSNVLGTVNPIKDIVAQAKAAGLVVLVDGAQAVMHQPVDVQALGCDFYVF
FT                   SGHKLYGPSGIGILYGKSALLQQMPPWEGGGAMIKTVSLTQGTTFADAPWRFEAGSPNT
FT                   AGIMGLGAAIDYVTELGLLPIQQYEQSLMHYALAQLSQIKSLTLYGPTERAGVIAFNLG
FT                   QHHAYDVGSFLDQYGIAIRTGHHCAMPLMAFYQVPSMCRASLALYNTREDVDRLVAGLQ
FT                   RIEKLLG"
FT   gene            847220..847642
FT                   /locus_tag="YPDSF_0749"
FT   CDS_pept        847220..847642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0749"
FT                   /product="Cysteine desulfuration protein SufE"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39155"
FT                   /db_xref="GOA:A4TIP3"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="InterPro:IPR023939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIP3"
FT                   /protein_id="ABP39155.1"
FT                   /translation="MAGLPDRDKLIRNFSRCLNWEEKYLYIIELGGQLAPLTEQQRHPE
FT                   NLISGCQSQVWIAMTLSAEGHVIFAGDSDAAIVKGLVAVVFILYHDLTPQQIISLDVRP
FT                   FFADLALSQHLTPSRSQGLEAMIRAIRTKVANLSAH"
FT   gene            847913..848932
FT                   /locus_tag="YPDSF_0750"
FT   CDS_pept        847913..848932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39156"
FT                   /protein_id="ABP39156.1"
FT                   /translation="MKRALTLIGMLFATCLAGSLTAANANEYPLPPANSRLIGENTTFT
FT                   VPNDGRPLEAIAADYKIGLLGMLEANPGTDPYLPLPGSVLTIPNQMLLPDTPREGIVIN
FT                   LAELRLYYYPKGQNKVIVYPIGIGQLGRDTPTMVTSISQKIPNPTWTPTANIRKNYLAE
FT                   GITLPSVVPAGPDNPMGQFALRLSAGRGEYLIHGTNADFGIGLRVSSGCIRLRPDDIEA
FT                   LFNSVPKGTRVQIINEPVKYAVEPDGKRYVEVHQPLSRVDSDDPQTMPIAIGSGLQKFI
FT                   NDSQTDAKAVQDAIVRRSGMPTIVTVGEASTQQAPTPVASQDEQQAQAEALLSTTDEK"
FT   sig_peptide     847913..847990
FT                   /locus_tag="YPDSF_0750"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.641 at
FT                   residue 26"
FT   gene            complement(848976..849755)
FT                   /locus_tag="YPDSF_0751"
FT   CDS_pept        complement(848976..849755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0751"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39157"
FT                   /protein_id="ABP39157.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
FT   gene            complement(849755..850777)
FT                   /locus_tag="YPDSF_0752"
FT   CDS_pept        complement(849755..850777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0752"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39158"
FT                   /protein_id="ABP39158.1"
FT                   /translation="MVTFETVMEIKILHKQGMSSRAIARELGISRNTVKRYLQAKSEPP
FT                   KYTPRPAVASLLDEYRDYIRQRIADAHPYKIPATVIAREIRDQGYRGGMTILRAFIRSL
FT                   SVPQEQEPAVRFETEPGRQMQVDWGTMRNGRSPLHVFVAVLGYSRMLYIEFTDNMRYDT
FT                   LETCHRNAFRFFGGVPREVLYDNMKTVVLQRDAYQTGQHRFHPSLWQFGKEMGFSPRLC
FT                   RPFRAQTKGKVVRMVQYTRNSFYIPLMTRLRPMGITVDVETANRHGLRWLHDVANQRKH
FT                   ETIQARPCDRWLEEQQSMLALPPEKKEYDVHLDENLVNFDKHPLHHPLSIYDSFCRGVA
FT                   "
FT   gene            complement(851359..851817)
FT                   /locus_tag="YPDSF_0753"
FT   CDS_pept        complement(851359..851817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0753"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39159"
FT                   /protein_id="ABP39159.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(852565..853977)
FT                   /locus_tag="YPDSF_0754"
FT   CDS_pept        complement(852565..853977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0754"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39160"
FT                   /protein_id="ABP39160.1"
FT                   /translation="MKKTKIVCTIGPKTESEEMLTNLLNAGMNVMRLNFSHGDYAEHGQ
FT                   RIKNLRAVMAKTGKKAAILLDTKGPEIRTMKLEGGKDAALVAGQTFTFTTDQSVVGNDK
FT                   IVAVTYPGFAADLKIGNTVLVDDGLIGMEVIEVTEHTVVCKVLNSGDLGENKGVNLPGV
FT                   SIQLPALAEKDKGDLIFGCEQGVDFVAASFIRKRSDVLEIREHLKAHGGEHIQIISKIE
FT                   NQEGLNNFDEILEASDGIMVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQML
FT                   DSMIKNPRPTRAEAGDVANAILDGTDAVMLSGESAKGKYPLESVTIMATICERTDRVMP
FT                   SRIESLNDNRKMRITEAVCRGAVETAEKLEAKVIVVATGGGKSAKSVRKYFPTATILAL
FT                   TTNEMTAHQLILTKGVITQLVDEIASTDDFYRLGKEAALASGLAQKGDVVIMVSGALVP
FT                   SGTTNTSSVHVL"
FT   gene            complement(854553..854629)
FT                   /locus_tag="YPDSF_R0013"
FT                   /note="tRNA-Val5"
FT   tRNA            complement(854553..854629)
FT                   /locus_tag="YPDSF_R0013"
FT                   /product="tRNA-Val"
FT   gene            complement(854689..854765)
FT                   /locus_tag="YPDSF_R0014"
FT                   /note="tRNA-Val4"
FT   tRNA            complement(854689..854765)
FT                   /locus_tag="YPDSF_R0014"
FT                   /product="tRNA-Val"
FT   gene            complement(855008..856381)
FT                   /locus_tag="YPDSF_0755"
FT   CDS_pept        complement(855008..856381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0755"
FT                   /product="transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39161"
FT                   /db_xref="GOA:A4TIP9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="InterPro:IPR022913"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIP9"
FT                   /protein_id="ABP39161.1"
FT                   /translation="MQKYIVEARSLLALAIPVVIAQLSQTAMGVVDTIMAGSVSATDMA
FT                   AVAVGTSIWLPAILFGHGLLLALTPTVAQLNGSGRRSQIAHQVRQGFWLALCVSVLIML
FT                   VLYNSDHVIKQMDNIDPVLAQKAVGFLHAIMWGVPGYLFFQVLRNQCEGLSKTKPGMVI
FT                   GFVGLLVNIPINYIFIYGKFGAPALGGVGCGVATASVYWVMFLMMRWYVTRARSQQDIK
FT                   LEKGFAAPDWQVMKRLSGLGLPVALALFFEVTLFAVVALLVSPLGIVAVAGHQIALNFS
FT                   SLMFMLPMSLSVAATIRVGFRLGQGAVEQAQVAAYTSMAVGLLLASVTAVFTIVFREHI
FT                   ALLYNKTPEVVTMASHLMLLAALYQLSDAVQVIGSGVLRGYKDTRSIFFITFTAYWLLG
FT                   LPSGYLLGLTDYILPAMGPAGFWIGFIIGLTAAAILMVLRIRWLQKQPTAFILQRAAH"
FT   sig_peptide     complement(856292..856381)
FT                   /locus_tag="YPDSF_0755"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.769) with cleavage site probability 0.545 at
FT                   residue 30"
FT   gene            856630..857286
FT                   /locus_tag="YPDSF_0756"
FT   CDS_pept        856630..857286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0756"
FT                   /product="riboflavin synthase alpha chain"
FT                   /EC_number="2.5.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39162"
FT                   /protein_id="ABP39162.1"
FT                   /translation="MFTGIVQGTGLVVAIEEKSNFRTHVVELPIDMLPELALGASVAHN
FT                   GCCLTVTHIEGNRVSFDLMKETLRLTNLGDINVGDKVNLERAAKFSDEIGGHLMSGHII
FT                   CTAEIAKIYTSENNRQIWFRMPSEDLMKYVLHKGFIGIDGISLTIGEVVGNRFCVHLIP
FT                   ETLSRTTLGKKRLGHRVNIEIDPQTQAVVDTVERVLAQRNIANAALVDEKVVRVS"
FT   gene            complement(857337..858488)
FT                   /locus_tag="YPDSF_0757"
FT   CDS_pept        complement(857337..858488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0757"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39163"
FT                   /protein_id="ABP39163.1"
FT                   /translation="MSSSCIEDQSVQESPWFRIVQDMLNQADIEINGSRPFDIRVNNPD
FT                   FFKRVLQGGSLALGESYMDGWWECDRLDIFFQRVLQAGLEHKLPRHFKDTLRIAAARVI
FT                   NLQSKRRAWIVGKEHYDLGNDLFTQILDPNMQYSCAYWKEATSLEQAQEHKLQMICEKL
FT                   QLAPGMKLLDIGCGWGGLAAYAARHFGVSVSGVTISVEQQKLAQQRCEGLDVSILLQDY
FT                   RDLNEQFDRIVSVGMFEHVGPKNYSTYFKVVNRNLKPDGLFLLHTIGANRTNMNVDPWI
FT                   NKYIFPNGCLPSVQHIAQASEPYFVMEDWHNFGADYDRTLMAWYERFQAAWPNLSANYS
FT                   QRFERMFSYYLNACAGAFRARDIQLWQVLFSPNGVNGGIRVPR"
FT   gene            complement(858968..860170)
FT                   /locus_tag="YPDSF_0758"
FT   CDS_pept        complement(858968..860170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0758"
FT                   /product="drug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39164"
FT                   /protein_id="ABP39164.1"
FT                   /translation="MKTSSSFMFYLAGLSMLGYLATDMYLPAFGAMQRELQTTAGAISA
FT                   SLSIFLAGFAIAQLIWGPLSDKLGRKPVLLAGLGLFAIGCLGMLWVENATQLLVLRFIQ
FT                   AVGVCSAAVSWQALVVDRYRDGKANRVFATIMPLVALSPALAPLLGAWLLNHFSWRSIF
FT                   VVLLAITLLLLIPTMVLQERKKARADNSDQPKNTVSFWQLLQSPTFSGNVMIFAACSAG
FT                   FFAWLTGSPFILENMGYSPNVIGLSYVPQTLAFLLGGFGCRSALAHIKGNTLLPWLLVG
FT                   YAGSMIALYLIATLTTPSLLTLLIPFCLMALVNGACYPIIVANALMPFPDNTGKAAALQ
FT                   NTLQLGLCFVASMLVSAYISQPLLATVTVMLLTVVLAALGYGIHCYALRKDKTRLMTRT
FT                   P"
FT   sig_peptide     complement(860105..860170)
FT                   /locus_tag="YPDSF_0758"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.646 at
FT                   residue 22"
FT   gene            860460..861392
FT                   /locus_tag="YPDSF_0759"
FT   CDS_pept        860460..861392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0759"
FT                   /product="LysR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39165"
FT                   /protein_id="ABP39165.1"
FT                   /translation="MWSEYSLDVVDAVARTGSFSAAAQELHRVPSAVSYTVRQLEDWLA
FT                   VPLFERRHRDVELTEAGVVFLKEARDVIKKMNDTRRQCQQVANGWRGQLNIVVDKIVKP
FT                   QRSRRLVLDFYRHFPDVELRVRYEVFNGVWDALSDGRADIAIGATRAIPVGGRFVFRDM
FT                   GFLSWLCVVSVDHPLALLSGPLSDEQLRPYPSLCLEDTALNLPKRDTWTLDNQQRLVAP
FT                   DWSTGIDCLCAGLCMGMVPAHMVSPLIAQGKLAAITLAEPLPDSPCCLTWEQNNHSPAL
FT                   AWLLDYLGDSVTLNTEWLRDDSQQLIANN"
FT   gene            complement(861481..862506)
FT                   /locus_tag="YPDSF_0760"
FT   CDS_pept        complement(861481..862506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0760"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39166"
FT                   /db_xref="GOA:A4TIQ4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR023588"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIQ4"
FT                   /protein_id="ABP39166.1"
FT                   /translation="MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHY
FT                   SPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQ
FT                   KAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAF
FT                   EGGYLAGRYLIERGHRDIGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDFE
FT                   PESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNAR
FT                   YFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYR
FT                   R"
FT   gene            complement(863033..863611)
FT                   /locus_tag="YPDSF_0761"
FT   CDS_pept        complement(863033..863611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0761"
FT                   /product="superoxide dismutase (Fe)"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39167"
FT                   /protein_id="ABP39167.1"
FT                   /translation="MSFELPALPYAQNALEPHISAETLEYHYGKHHNTYVINLNNLIKD
FT                   TEFAGKSLEEIVKTANGGVFNNAAQVWNHTFYWHCLSPNGGGEPTGKIAEAINKSFGSF
FT                   AEFKAQFTDAAVKNFGAGWTWLVKKADGTLAIVSTSNAGTPLTTTDKPLLTVDVWEHAY
FT                   YIDYRNARPKYLENFWAVVNWSFAEKNLD"
FT   gene            complement(863989..864840)
FT                   /locus_tag="YPDSF_0762"
FT   CDS_pept        complement(863989..864840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39168"
FT                   /protein_id="ABP39168.1"
FT                   /translation="MRLMLTLFVLLFTQLFLNLAHASPQAHSSVEQKKGHVSQASPDDR
FT                   KKRKADKSTKRSKIATTKGPVSKKTTEPRKTGNNKTSTNKVVRNKINSSRTTESKTAAN
FT                   KKRTSSIRTAKTPYERQRNKAQGKASTELAANNKLKLSPAHKKRYQKAKQTAMSKLMKQ
FT                   VGKPYRWGGSSPNTGFDCSGLIYYAYKDVVKIKMPRTANEMYHLRDAAPVKRTELESGD
FT                   LVFFKIANRGVADHVGVYLGNGKFIQSPRTGEEIRISMLNNDYWQEHYVGARRVVTPKT
FT                   IR"
FT   sig_peptide     complement(864772..864840)
FT                   /locus_tag="YPDSF_0762"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.975 at
FT                   residue 23"
FT   gene            865280..865630
FT                   /locus_tag="YPDSF_0763"
FT   CDS_pept        865280..865630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39169"
FT                   /protein_id="ABP39169.1"
FT                   /translation="MTTIDKIQRQITENPILLYMKGSPKLPNCGFSAQAVQALSACGER
FT                   FAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDILMEMYQRGELQTLLKETAD
FT                   KYRSQEDQPAAE"
FT   gene            complement(865939..866619)
FT                   /locus_tag="YPDSF_0764"
FT   CDS_pept        complement(865939..866619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0764"
FT                   /product="RNAse T"
FT                   /EC_number="3.1.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39170"
FT                   /protein_id="ABP39170.1"
FT                   /translation="MHAEFDKDKKLMADKSDLNALSGRFRGYYPVVIDVETAGFNAQSD
FT                   ALLEIAAVTLQMNKEGWLLPDETLHFHVEPFEGANLQPEALAFNGIDPTNPLRGAVSEH
FT                   DALHAIFKAVRKGIKDKGCNRAIIVAHNANFDHSFVMAAAERASLKRNPFHPFATFDTA
FT                   ALSGLVLGQTVLAKACLAAGIPFDSSQAHSALYDTLQTAKLFCELVNRWKKLGGWPLPA
FT                   AESE"
FT   gene            complement(866698..867105)
FT                   /locus_tag="YPDSF_0765"
FT   CDS_pept        complement(866698..867105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0765"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39171"
FT                   /protein_id="ABP39171.1"
FT                   /translation="MRLLHTMLRVGDLQRSIDFYTKVLGMRLLRTSENTEYKYSLAFVG
FT                   YSDESKGSVIELTYNWGVDQYDMGTAFGHLALGVDDVAATCDQIRQAGGKVTREAGPVK
FT                   GGNTIIAFVEDPDGYKIELIENKSAGDCLGN"
FT   gene            867378..870332
FT                   /locus_tag="YPDSF_0766"
FT   CDS_pept        867378..870332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0766"
FT                   /product="insecticial toxin"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39172"
FT                   /protein_id="ABP39172.1"
FT                   /translation="MNTSLFSKTPAVTVLDNRGLSVRSIAYHRHPDSPDDTGERITHHQ
FT                   YDARGFLTQSADPRLHDTGRANVKYLSDLVGNALCTVSADVGTTVALNDAAGRLFMTVS
FT                   NIDTADDDLEDRSQVVNRTWQYEGASLPGRLLSITEQVTGEAARVTERFTYAANTDEKK
FT                   ALNLVGQCVSHYDTAGLRQMDSIALTGVPLSVTRRLLKDADNPDTVANWQGEDSSAWND
FT                   QLAADRLTTLTTADAIGAVLTTTDTKGNVQRVVYNVAGLLSGSWLRVKGGAEQVIVQSL
FT                   TYSAAGQKLREEHGNGVVTTYTYEPETQRLTGIRTERSAGHASGTKVLQDLRYEYDPVG
FT                   NVQSIRNDAEETRFWRNQKVVPENTYVYDSLYQLVSATGRVMVNAGQQGRSLPSATLPI
FT                   ESSAYTNYTHTYTYDTAGNLTQIRHTPATGSGHTTDITVSDRSNQGVLSTLTTNPAEVD
FT                   ALFTAGGQQKQLQPGQHLIWTARNELLKVTPVVRDGDSDDRESYRYDGNSQRILKVSVQ
FT                   KTGGSTQTQRVMYLPRLELRSTASGVTETESLQIITVGEAGRAQVQVQVLHWEKGKPDA
FT                   IDNDQLRYSYDNLIGSSTLEVDGDGNVISMEEYYPYGGTAVWTAHSQTEADYKTIRYSG
FT                   KERDATGLYYYGWRYYQPWVGRWLSADPVGTVDGLNLYLMVGNNPTSFHDSNGLIREGQ
FT                   SARKLVGEAFVHPLHMSVFERISIEENMAMSVREAGIYTILALGEGAAAKGHNILEKTI
FT                   KPGSLKAVYENKAGAALELAKNSGFIGRVGRWNASGVQGVYAYNRPSGEDLVYPASLQD
FT                   TSDNELVNAWIKHKIITPYTGDYDMHDIIKFNRGKGYVPTAESAEETGVKDLINKGVAE
FT                   VDPARPFEYTAMNVIRHGPQVNFVPYMWEYEHDKVVSDNGYLGVVARPGPFPIAMVHQG
FT                   QWTVFDDSKELFNFYKSSNTPLPEHWQQNFIARGPGIVATPRHADVLDKRRIMH"
FT   gene            complement(870553..871650)
FT                   /locus_tag="YPDSF_0767"
FT   CDS_pept        complement(870553..871650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0767"
FT                   /product="NADH:flavin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39173"
FT                   /protein_id="ABP39173.1"
FT                   /translation="MKTAKLFSPLKVGALTLPNRVFMAPLTRLRSIEPGDIPTPLMAEY
FT                   YRQRASAGLIITEATQISFQAKGYAGAPGLHTQEQLNAWKKVTQGVHNEGGHIAVQLWH
FT                   VGRISHNSLQPGQQAPVAPSAIAADTRTTVRDETGAWVRVPCSTPRALETEEIPGIIND
FT                   FRQATANAREAGFDYIELHAAHGYLLHQFMSPASNQRTDQYGGSIENRTRLTLEVVDAT
FT                   AAEWGADRIGIRISPLGPFNGLDNGEDQEEAALYLIDQLNKRNIAYLHISEPDWAGGKP
FT                   YSDTFRAAVRAHFNGVIVGAGAYSAEKAECLIQKGFIDAVAFGRSYISNPDLVTRLQQH
FT                   APLNEPDSNTFYGGGAKGYTDYPTL"
FT   gene            complement(871738..872337)
FT                   /locus_tag="YPDSF_0768"
FT   CDS_pept        complement(871738..872337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0768"
FT                   /product="TetR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39174"
FT                   /protein_id="ABP39174.1"
FT                   /translation="MNKIQHTHVDTREHLLATGERLSLRLGFNGMGLSLLLTTAGIPKG
FT                   SFYHYFRSKEVFGEAMLQRYFDRYDAEMESLLAGSQGDKRHHLLHYFAQSIANYCGSEC
FT                   HNACLAVKLSAEVSDLSEPMRHALDIGTARVIGRLQDAIEAGIDEGSLRTVLSPAATAE
FT                   TLYALWLGASLRAKVKHSVAPLTCALGSIELILQPA"
FT   gene            complement(872560..874197)
FT                   /locus_tag="YPDSF_0769"
FT   CDS_pept        complement(872560..874197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0769"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39175"
FT                   /protein_id="ABP39175.1"
FT                   /translation="MNARYKLQCNGLTFILACALFFTFFQNALFIYKAWSLIRFDNSDS
FT                   YFFAATIPVVIFCALNIIFSLLTLPLLRKPIIILFLLGSAVANYFMFSYGAVIDANMMQ
FT                   NAFETNSQEATALFTPRMALWLITLGILPAMIVCFVRIRATRPWWYMLGLRVANILMSM
FT                   VIIFLIAVLFYKDYASLIRNNKNIVKMLTPSNFVSGSFQFAKHKYFISNMPLVKIGEDA
FT                   HKGPVINAQQNKTLVILVVGETARSENFSLGGYARETNPRLQQQDIIYFKHASSCGTET
FT                   AVSVPCMFSNMPRKSYDASLASHQEGLMDIIARAGLSVLWRENDGGCKGACDRIPHQDV
FT                   TQLQLNADCQDGVCLDNALLYKLDNYINGLQNDGVIVLHQMGSHGPAYYRRTSPELTKF
FT                   TPTCNSNQIQDCTAQELVNTYDNSILYTDAMLDDTIALLKQHSDRFNTALVYLSDHGES
FT                   LGENGLYLHGTPYVFAPSQQTHIPFLMWLSPEYTKSYGIDRQCLSHSAQQDEVSQDNLF
FT                   HTLLGMVNIQTNEYLSGMDLLQKCRSLQ"
FT   sig_peptide     complement(874111..874197)
FT                   /locus_tag="YPDSF_0769"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.713) with cleavage site probability 0.587 at
FT                   residue 29"
FT   gene            874245..874610
FT                   /locus_tag="YPDSF_0770"
FT   CDS_pept        874245..874610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39176"
FT                   /protein_id="ABP39176.1"
FT                   /translation="MKLKITLAVAGRDCACINISENSDLPAAMNQSSIKVLVVGGSVAQ
FT                   QLEFFDIPSPCRGICQTDDRGFCRGCFRSRDERFNWIKMDDGQKREVLRLCHQRLLRLK
FT                   RANKQPDEPLPEQPSLF"
FT   gene            874742..875638
FT                   /locus_tag="YPDSF_0771"
FT   CDS_pept        874742..875638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0771"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39177"
FT                   /protein_id="ABP39177.1"
FT                   /translation="MDTRSQLASLGPEFSRMICGYWRLMEWGMTPEQLLVFMEQHIELG
FT                   ITTVDHADIYGGYQCEQAFGQALRLKPSLRDQMELVSKCGIATTAKPEHALGHYITDCS
FT                   HIVHSAEQSLTHLHTDYLDLLLIHRPDPLMDADEVAEAFIQLHKSGKVKYFGVSNFTPT
FT                   QFSLLQSRLPFSLVTNQVEISPLHQPAIMDGTLDACQQLRIKPMAWSCLGGGRLFSDPT
FT                   FQVLRDELQTVADEMGAESIEQVVYAWVLRLPSAPLPIIGSGKIERVKAAWASLSLTMT
FT                   RQQWFRIRRAALGYDVP"
FT   gene            876436..876867
FT                   /locus_tag="YPDSF_0772"
FT   CDS_pept        876436..876867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0772"
FT                   /product="MarR-family transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39178"
FT                   /db_xref="GOA:A4TIR6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023071"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIR6"
FT                   /protein_id="ABP39178.1"
FT                   /translation="MESTLGSDLARLVRVWRALIDHRLKPLELTQTHWVTLYNINRLPP
FT                   EQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHTCANDRRAKRIKLTEQSSPIIEQVD
FT                   GVICSTRKEILGGISSDEIAVLSGLIDKLEKNIIQLQTK"
FT   gene            complement(877011..877478)
FT                   /locus_tag="YPDSF_0773"
FT   CDS_pept        complement(877011..877478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0773"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39179"
FT                   /protein_id="ABP39179.1"
FT                   /translation="MIKPFVAVAIAVVTLTGCANNNTLSGDVFTASQAKQVQTVSYGTL
FT                   ISVRPVTIQGGDDNNVVGAIGGAVLGGFLGNAVGGGTGRSLATAAGAVAGGIAGQGVQG
FT                   ALNRTDGVQLEIRKDDGQTILVVQKQGPTQFSVGQRVMLANSGSTITVSPR"
FT   sig_peptide     complement(877413..877478)
FT                   /locus_tag="YPDSF_0773"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.538 at
FT                   residue 22"
FT   gene            878034..879146
FT                   /locus_tag="YPDSF_0774"
FT   CDS_pept        878034..879146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0774"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39180"
FT                   /db_xref="GOA:A4TIR8"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIR8"
FT                   /protein_id="ABP39180.1"
FT                   /translation="MKSGRFIGVMSGTSLDGVDVVLAAIDERMVAQQASYTHPIPLQLK
FT                   KDILGMCQGQSTTLSAVGKLDAQLGILFAEAVLALLAKEGLSAQDITAIGCHGQTVWHE
FT                   PLGEPAFTMQLGDNNRIAAMTQIATVGDFRRRDMAYGGQGAPLVPAFHHALLAHATEKR
FT                   MVLNIGGIANLSVLLPDSPIRGFDTGPGNMLMDAWIWRNCSLPYDKDACWALSGHVNQP
FT                   LLEQMFNDPYFRLPAPKSTGREYFNAAWLDKQLARIPGVTAEDIQATLAELTAVSITEQ
FT                   VRLAGGCDRLLVCGGGARNPLVMARISALLSGTEVCTTDDAGIRGDDMEALAFAWLAFR
FT                   TLSGKPGNLPSVTGASRETILGAVHPVSSW"
FT   gene            879201..879518
FT                   /locus_tag="YPDSF_0775"
FT   CDS_pept        879201..879518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0775"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39181"
FT                   /protein_id="ABP39181.1"
FT                   /translation="MMKYLFAATVPLLLAGCSLLQSMNGTSVNETLHYQCGTTKLTVTQ
FT                   NNKQDNVSFIMDGKQLTLPQVRAASGAKYSDGHYTFWSKGDSAFIEREEKVIINDCVLI
FT                   K"
FT   sig_peptide     879201..879269
FT                   /locus_tag="YPDSF_0775"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.691 at
FT                   residue 23"
FT   gene            879540..880262
FT                   /locus_tag="YPDSF_0776"
FT   CDS_pept        879540..880262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0776"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39182"
FT                   /protein_id="ABP39182.1"
FT                   /translation="MIVILWRRGQNDNHSFPARYRVYMTENNEFDVADLRREYIRGGLR
FT                   RSDLTENPLELFERWLKQACEARLPDPTAMCVATVDTNGQPYQRIVLLKHYDDQGLVFY
FT                   TNLGSRKAQQLAENPHISLLFPWHMLDRQVIFLGKAERLSTLEVLKYFHSRPKDSQIGA
FT                   WVSQQSSRISARGVLESKFLELKQKFQQGDVPLPSFWGGFRVKFDSVEFWQGGEHRLHD
FT                   RFIYQREADAWKIDRLAP"
FT   gene            880444..881718
FT                   /locus_tag="YPDSF_0777"
FT   CDS_pept        880444..881718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0777"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39183"
FT                   /db_xref="GOA:A4TIS1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4TIS1"
FT                   /protein_id="ABP39183.1"
FT                   /translation="MTSSNLIKQLQERGLVAQVTDEDALAERLAQGPISLYCGFDPTAD
FT                   SLHLGHLVPLLCLKRFQLAGHRPVALVGGATGMIGDPSFKASERKLNTEDTVNEWVEKI
FT                   RHQVSPFLDFDCGENSAIAANNYDWFGGMNVLTFLRDIGKHFSVNQMINKEAVKQRLNR
FT                   DDSGISFTEFSYNLLQAYDFACLNKNHGVALQIGGSDQWGNITSGIDLTRRLHQQQVYG
FT                   LTVPLITKADGTKFGKTEGGAVWLDPKKTSPYKFYQFWINTADADVYRFLKFFTFMSLE
FT                   EINALEEEDKNSGKAPRAQYVLAENVTGMVHGPEGLAAAKRITDSLFSGDLHDMTEADF
FT                   AQLAQDGMPTVELNRDADLQQALVNAELVPSRGQARTMIGSNAVAINGEKQADPEYVFT
FT                   DADRLFGRYTLLRRGKKHYCLISWL"
FT   gene            881873..882733
FT                   /locus_tag="YPDSF_0778"
FT   CDS_pept        881873..882733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0778"
FT                   /product="Pyridoxal kinase"
FT                   /EC_number="2.7.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39184"
FT                   /protein_id="ABP39184.1"
FT                   /translation="MKNILSIQSHVVFGHAGNSAAEFPMRRMGVNVWPLNTVQFSNHTQ
FT                   YGHWTGCVMPASHLTDIVQGIADIDRLKDCDAVLSGYIGSPEQGSHILAAVAQVKQANP
FT                   DAWYFCDPVMGHPEKGCIVAPGVAEFFCNEALPASDMIAPNLLELEQLSGERVENVEQA
FT                   VQVARSLCARGPKVVLVKHLSRAGYHADCFEMLLVTADDAWHICRPLVDFGKRQPVGVG
FT                   DLTSGLLLVNLLKGEPLDKALEHVTAAVYEVMLKTQEMGEYELQVVAAQETIVTPICQF
FT                   TAVRL"
FT   gene            complement(882793..883398)
FT                   /locus_tag="YPDSF_0779"
FT   CDS_pept        complement(882793..883398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0779"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39185"
FT                   /protein_id="ABP39185.1"
FT                   /translation="MKLFYKPGACSLSPHIVLREAGLDFSIERVDLVTKKTETGADYLS
FT                   INPKGQVPALVLDDGSLLTEGVAIVQYLADKVPDRHLIAPSGTLSRYHAIEWLNFIATE
FT                   LHKGFSPLFNPNTPDEYKTIVRERLDKQFSYVDSVLAEHDYLLGKKFSVADAYLFTVSR
FT                   WANALNLQIKERSHLDQYMARVAERPAVKAALAAEDIK"
FT   gene            complement(883643..883906)
FT                   /locus_tag="YPDSF_0780"
FT   CDS_pept        complement(883643..883906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39186"
FT                   /protein_id="ABP39186.1"
FT                   /translation="MKKLTLKEMTESEQRDVKTQLDRARINLGRALTNSEQNKVKDEAI
FT                   EKIMHAREQIAKLTRVERKTKKTAPSTTTFSWSASISTRPPR"
FT   gene            complement(884152..884742)
FT                   /locus_tag="YPDSF_0781"
FT   CDS_pept        complement(884152..884742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0781"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39187"
FT                   /protein_id="ABP39187.1"
FT                   /translation="MVNHVWGLLTHPRQELQQIKREGESIPHLYTHHVLLLAAIPVICA
FT                   FIGTTQVGWRFGNGQAIKLDTLTALYSAVIFYTLILAAVALMGQVIYRLARRYASRPSW
FT                   QRCTLFAGYAATPMFLSGIVALYPLVWLCLFAGIIALCYSAYLMYLGIPTFLDIDRQEG
FT                   FIFSSSTLAIGVLVLELLLGLTVLLWGYGSRLI"
FT   gene            complement(884997..886496)
FT                   /locus_tag="YPDSF_0782"
FT   CDS_pept        complement(884997..886496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0782"
FT                   /product="proton dependent peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39188"
FT                   /protein_id="ABP39188.1"
FT                   /translation="MSTANNNQPESISMNAFKQPKAFYLIFSIELWERFGYYGLQGIMA
FT                   VYLVKMLGMSEADSITLFSSFSALVYGFVAIGGWLGDKVLGAKRVIVLGALTLAVGYSM
FT                   IAYSGHEIFWVYLGMATIAVGNGLFKANPSSLLSTCYSKDDPRLDGAFTMYYMSINIGS
FT                   FFSMLATPWLAAKYGWSVAFSLSVVGMLITLVNFWFCRKWVKNQGSKPDFLPLQFKKLL
FT                   MVLVGIIALITLSNWLLHNQIIARWALVSLGIIFIFTKETLFLQGIARRRMIVAFLLML
FT                   EAVIFFVLYSQMPTSLNFFAIHNVEHSIFGIGFEPEQFQALNPFWIMLASPILAAIYNK
FT                   MGDRLPMPHKFAFGMMLCSAAFLVLPWGASFANEHGIVSVNWLILSYALQSIGELMISG
FT                   LGLAMVAQLVPQRLMGFIMGSWFLTTAAAALIAGKVAALTAVPSDAITDAHASLAIYSH
FT                   VFMQIGIVTAIIAVLMMLTAPKLYRMTLAPSDHNDVKIMTQ"
FT   gene            complement(887139..888419)
FT                   /locus_tag="YPDSF_0783"
FT   CDS_pept        complement(887139..888419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0783"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39189"
FT                   /protein_id="ABP39189.1"
FT                   /translation="MVQFRRRNNAHWYHETQCSGSLEHCSGSPVNISTTVNVPTTVNNE
FT                   NPPVDIRPRDPSESDNMSTGSNITEQSIITEQGIFLLGVTENIAPTLQDTLYHEQPILT
FT                   ASDAMYQALFPTIIEINHTNTFSLYDRLSTALTVAQVTGIQRLCSHYALRLAPLPSPDA
FT                   SRESNIRLTQITQYARQLASQPTLIDRHALAQLHDVGLTDSDIIILSQIIGYVGYQARV
FT                   VAGISALAGYPTVMLPGFPRMEDAAPSPLPDVMPNWQGWLPSHAANDDQPDKEPDETAS
FT                   TLTELLGHHQQSLLAYHAITTHQPNSPQLQRDWLELVALVSARINGSLYCQARHRQHLQ
FT                   QLTEPPLLVTELLKGIDHALFLLPEQQIPHQLISVTAELTRAPERFNHQHVKRLQTLGV
FT                   SDTQVMRIIFSIAITGWTNRLRHTLGK"
FT   gene            complement(888809..889624)
FT                   /locus_tag="YPDSF_0784"
FT   CDS_pept        complement(888809..889624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0784"
FT                   /product="peptide transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39190"
FT                   /protein_id="ABP39190.1"
FT                   /translation="MAETLLEVRNLSKTFRYRTGLFRRQHVEAVKSVSFTLREGQTLAV
FT                   IGENGSGKSTLAKMLSGMIEPTAGELLIDDHHLAYGDYAYRSQRIRMIFQDPSTSLNPR
FT                   QRIGQLLDAPLKLNTELDAPAREQRIYQTLRQVGLLPDHANYYPHMLASGQKQRVALAR
FT                   ALILQPKVIIADEALAALDMSMRSQIINLMLELQEKHGISYIYVTQHLGMMKHISDQVI
FT                   VMHEGEVVERGSTAEVLAAPLHDLTKRLISSHFGEALTADAWRRDTSNF"
FT   gene            complement(889624..890616)
FT                   /locus_tag="YPDSF_0785"
FT   CDS_pept        complement(889624..890616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0785"
FT                   /product="peptide transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39191"
FT                   /protein_id="ABP39191.1"
FT                   /translation="MPLLDIRNLTIEFMTSEGPVKAVDRISMTLTEGEVRGLVGESGSG
FT                   KSLIAKAICGVSKDNWRITADRFRFNDIDLLQLTPRQRRKVIGHNISMIFQEPQSCLDP
FT                   SESIGLQLIQAIPGWTYKGRWWQRFHWRKRRAIELLHRVGIKDHKDIMHSYPYELTEGE
FT                   CQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNNNTTILLISHDLQMM
FT                   SKWATRVNVLYCGQTVESAVCEDLLSTPHHPYTQALIRAMPDFGRSLPHKSRLNTLPGA
FT                   IPSLEHLPVGCRLGPRCPYAQKTCIETPRLRLVKNHAFACHFPLNLEEQ"
FT   gene            complement(890616..891506)
FT                   /locus_tag="YPDSF_0786"
FT   CDS_pept        complement(890616..891506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0786"
FT                   /product="peptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39192"
FT                   /protein_id="ABP39192.1"
FT                   /translation="MPFDNVYREKKMPSPLLYTWRLFSSDGLAMVGFYGVLGLLLLCLL
FT                   GSTLAPYTLDQQFLGYQLLPPSWSRYGNVSFFLGTDDLGRDVLSRLLTGTASTYGSALL
FT                   VTVAAALCAIVLGVFAGITRGLRSAILNHVLDTLLSIPSLLLAIIVVAFVGPSLEHAMF
FT                   AVWLALLPRMVRTIYSAVHDELDKEYVIAARLDGASTPHILAYAILPNIASVLVTEFTR
FT                   ALSMAILDIAALGFLDLGAQLPSPEWGAMLGDSLDLVYVAPWTVMLPGGAILVSVLLVN
FT                   LLGDGMRRAINAGVE"
FT   gene            complement(891493..892458)
FT                   /locus_tag="YPDSF_0787"
FT   CDS_pept        complement(891493..892458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0787"
FT                   /product="peptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39193"
FT                   /protein_id="ABP39193.1"
FT                   /translation="MIIFTLRRLLLLVITLFMLSLVSFSLSYFTPYAPLHGAGLLDAYR
FT                   FYFSSLLQWDFGISSINGQPISEQLREAFPATMELCVLAFGLALFIGIPLGIIAGVMRG
FT                   KWADIAISTVALIGFSIPVFWLALLLMLFFSLHLGWLPVSGRFDLLYQVKPVTGLALVD
FT                   AWLSPSPYRNEMMLSALQHMILPITALAVAPTTEVIRLMRTSTDDVIGQNYIKAAATRG
FT                   LSRFTIIRRHVLHNALPPIIPKLGLQFSTMLTLAMITEVVFNWPGLGRWLINAIRQQDY
FT                   AAISAGVMVVGSLVIVINVLSDILGAMMTPLKHKEWYALR"
FT   sig_peptide     complement(892345..892458)
FT                   /locus_tag="YPDSF_0787"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.402 at
FT                   residue 38"
FT   gene            complement(892455..894101)
FT                   /locus_tag="YPDSF_0788"
FT   CDS_pept        complement(892455..894101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0788"
FT                   /product="peptide transport periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39194"
FT                   /protein_id="ABP39194.1"
FT                   /translation="MRGLLILLLSLICLATPVLAQPVAAEQPLPDIRQRGFVYCVSGIL
FT                   NTFNPQMASSGLTVDTLAAQLYDRLLDVDPYTYRLIPELAESWQVLDNGATYRFHLRKD
FT                   VPFQTTDWFTPTRMMNADDVVFSFQRVFDSKHPYHKVNGGEYPYFDSLQFASAVKSVKK
FT                   LDDYTVEFKLKAPDASFLWHLATHYAPVLSSEYADVLTQKGKEEQIDREPVGTGPFLLD
FT                   EYRSGQYIRLFRNSHYWKGVPRMPQVVIDLGVGGTGRLSKLLTGECDVLAYPAASQLSI
FT                   LRDDPPRLRLTLRPGMNVAYLAFNTRKPPLSDQRVRQAIALSINNQRLMQSIYYGTAET
FT                   AASILPRASWAYDNQAQVTEYNPEKAKEILKDLGITQLQLNLWVPTASQSYNPSPLKTA
FT                   ELIQADLAQVGISVTIVPVEGRFQEARLMEMNHDLTLSGWSTDSNDPDSFFRPLLSCAA
FT                   IRSQTNYAHWCDPAFDELLQKALRSQQLSERIEYYQQAQRILEQQLPLLPLASSLRLQA
FT                   YRYDIKGLVLSPFGNSSFAGVYRESDEGKTP"
FT   sig_peptide     complement(894039..894101)
FT                   /locus_tag="YPDSF_0788"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 21"
FT   gene            894808..895266
FT                   /locus_tag="YPDSF_0789"
FT   CDS_pept        894808..895266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0789"
FT                   /product="transposase for the IS1541 insertion element"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39195"
FT                   /protein_id="ABP39195.1"
FT                   /translation="MRDEKSLAHTRWNCKYHIVFAPKYRRQVFYREKRRAIGSILRKLC
FT                   EWKNVNILEAEYCVDHIHMLLEIPPKMSVSGFMGYLKGKSSLMLYEQFGDLKFKYRNRE
FT                   FWCRGYYVDTVGKNTARIQEYIKHQLEEDKMGEQLSIPYPGSPFTGRK"
FT   gene            complement(895431..896459)
FT                   /locus_tag="YPDSF_0790"
FT   CDS_pept        complement(895431..896459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0790"
FT                   /product="psp operon transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39196"
FT                   /protein_id="ABP39196.1"
FT                   /translation="MNEQLDNLLGEANAFVDVLEQVSGLAKLNKPVLVIGERGTGKELI
FT                   AHRLHYLSERWQGPFISLNCAALNENLLDSELFGHEAGAFTGAQKRHLGRFERADGGTL
FT                   FLDELATAPMLVQEKLLRVIEYGHLERVGGSQPLQVDVRLVCATNDNLPALAAAGKFRA
FT                   DLLDRLAFDVVQLPPLRERQQDIMLLAEHFAILMCRELGLPLFSGFTATAKEQLLEYRW
FT                   PGNVRELKNVVERSVYRHSDSSLPLNNIIINPFASNQKGEIEGVDTPNEGGAVLPALPV
FT                   DLKHWLHTSEHQMLTRALKQARFNQRKAAHLLGLTYHQLRGLLKKHTILSGELPQVSDS
FT                   GE"
FT   gene            896704..897369
FT                   /locus_tag="YPDSF_0791"
FT   CDS_pept        896704..897369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0791"
FT                   /product="phage shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0791"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39197"
FT                   /protein_id="ABP39197.1"
FT                   /translation="MGIFSRFADIVNANINTLLDKAEDPQKLVRLMIQEMEDTLVEIRS
FT                   TSARALAEKKQLLRRIDHSESQQQEWQEKAELALRKDKEDLARAALIEKQKVMTLVETL
FT                   KREVATVDETLSRMKHEITELENKLTETRARQQALTLRHQAASSSRDVRRQLDSGKLDE
FT                   AMARFEQFERRIDHMEAEAETVGVGKQKSLDQQFAELRADDEISSQLAALKAKMKSVE"
FT   gene            897531..897758
FT                   /locus_tag="YPDSF_0792"
FT   CDS_pept        897531..897758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPDSF_0792"
FT                   /product="phage shock protein B"
FT                   /db_xref="EnsemblGenomes-Gn:YPDSF_0792"
FT                   /db_xref="EnsemblGenomes-Tr:ABP39198"
FT                   /protein_id="ABP39198.1"
FT                   /translation="MSILFLAIPLTIFVLFVAPIWLWLHYNGRQQNGVQLSHQDMQRLS
FT                   LLTEDARRMRERIQALEEILDTEHPNWRQS"
FT   gene            897758..898117
FT                   /locus_tag="YPDSF_0793"
FT