(data stored in ACNUC7421 zone)

EMBL: CP000675

ID   CP000675; SV 2; circular; genomic DNA; STD; PRO; 3576470 BP.
XX
AC   CP000675;
XX
PR   Project:PRJNA17491;
XX
DT   25-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Legionella pneumophila str. Corby, complete genome.
XX
KW   .
XX
OS   Legionella pneumophila str. Corby
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Legionellales;
OC   Legionellaceae; Legionella.
XX
RN   [1]
RP   1-3576470
RX   DOI; 10.1016/j.ijmm.2007.07.012.
RX   PUBMED; 17888731.
RA   Glockner G., Albert-Weissenberger C., Weinmann E., Jacobi S., Schunder E.,
RA   Steinert M., Hacker J., Heuner K.;
RT   "Identification and characterization of a new conjugation/type IVA
RT   secretion system (trb/tra) of Legionella pneumophila Corby localized on two
RT   mobile genomic islands";
RL   Int. J. Med. Microbiol. 298(5-6):411-428(2008).
XX
RN   [2]
RP   1-3576470
RA   Gloeckner G., Albert-Weissenberger C., Weinmann E., Jacobi S., Schunder E.,
RA   Steinert M., Buchrieser C., Hacker J., Heuner K.;
RT   ;
RL   Submitted (15-NOV-2006) to the INSDC.
RL   Genome Analysis, Leibniz Institute for Age Research - Fritz Lipmann
RL   Institute, Beutenbergstr. 11, Jena D-07745, Germany
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3576470
RA   Gloeckner G., Albert-Weissenberger C., Weinmann E., Jacobi S., Schunder E.,
RA   Steinert M., Buchrieser C., Hacker J., Heuner K.;
RT   ;
RL   Submitted (30-MAR-2009) to the INSDC.
RL   Genome Analysis, Leibniz Institute for Age Research - Fritz Lipmann
RL   Institute, Beutenbergstr. 11, Jena D-07745, Germany
XX
DR   MD5; 7caab0b7761266af7713bb4f3cd10b6c.
DR   BioSample; SAMN02603241.
DR   EnsemblGenomes-Gn; EBG00001188186.
DR   EnsemblGenomes-Gn; EBG00001188187.
DR   EnsemblGenomes-Gn; EBG00001188188.
DR   EnsemblGenomes-Gn; EBG00001188189.
DR   EnsemblGenomes-Gn; EBG00001188190.
DR   EnsemblGenomes-Gn; EBG00001188191.
DR   EnsemblGenomes-Gn; EBG00001188192.
DR   EnsemblGenomes-Gn; EBG00001188193.
DR   EnsemblGenomes-Gn; EBG00001188194.
DR   EnsemblGenomes-Gn; EBG00001188195.
DR   EnsemblGenomes-Gn; EBG00001188196.
DR   EnsemblGenomes-Gn; EBG00001188197.
DR   EnsemblGenomes-Gn; EBG00001188198.
DR   EnsemblGenomes-Gn; EBG00001188199.
DR   EnsemblGenomes-Gn; EBG00001188200.
DR   EnsemblGenomes-Gn; EBG00001188201.
DR   EnsemblGenomes-Gn; EBG00001188202.
DR   EnsemblGenomes-Gn; EBG00001188203.
DR   EnsemblGenomes-Gn; EBG00001188204.
DR   EnsemblGenomes-Gn; EBG00001188205.
DR   EnsemblGenomes-Gn; EBG00001188206.
DR   EnsemblGenomes-Gn; EBG00001188207.
DR   EnsemblGenomes-Gn; EBG00001188208.
DR   EnsemblGenomes-Gn; EBG00001188209.
DR   EnsemblGenomes-Gn; EBG00001188210.
DR   EnsemblGenomes-Gn; EBG00001188211.
DR   EnsemblGenomes-Gn; EBG00001188212.
DR   EnsemblGenomes-Gn; EBG00001188213.
DR   EnsemblGenomes-Gn; EBG00001188214.
DR   EnsemblGenomes-Gn; EBG00001188215.
DR   EnsemblGenomes-Gn; EBG00001188216.
DR   EnsemblGenomes-Gn; EBG00001188217.
DR   EnsemblGenomes-Gn; EBG00001188218.
DR   EnsemblGenomes-Gn; EBG00001188219.
DR   EnsemblGenomes-Gn; EBG00001188220.
DR   EnsemblGenomes-Gn; EBG00001188221.
DR   EnsemblGenomes-Gn; EBG00001188222.
DR   EnsemblGenomes-Gn; EBG00001188223.
DR   EnsemblGenomes-Gn; EBG00001188224.
DR   EnsemblGenomes-Gn; EBG00001188225.
DR   EnsemblGenomes-Gn; EBG00001188226.
DR   EnsemblGenomes-Gn; EBG00001188227.
DR   EnsemblGenomes-Gn; EBG00001188228.
DR   EnsemblGenomes-Gn; EBG00001188229.
DR   EnsemblGenomes-Gn; EBG00001188230.
DR   EnsemblGenomes-Gn; EBG00001188231.
DR   EnsemblGenomes-Gn; EBG00001188232.
DR   EnsemblGenomes-Gn; EBG00001188233.
DR   EnsemblGenomes-Gn; EBG00001188234.
DR   EnsemblGenomes-Gn; EBG00001188235.
DR   EnsemblGenomes-Gn; EBG00001188236.
DR   EnsemblGenomes-Gn; EBG00001188237.
DR   EnsemblGenomes-Gn; EBG00001188238.
DR   EnsemblGenomes-Gn; EBG00001188239.
DR   EnsemblGenomes-Gn; EBG00001188240.
DR   EnsemblGenomes-Gn; EBG00001188241.
DR   EnsemblGenomes-Gn; EBG00001188242.
DR   EnsemblGenomes-Gn; EBG00001188243.
DR   EnsemblGenomes-Gn; EBG00001188244.
DR   EnsemblGenomes-Gn; EBG00001188245.
DR   EnsemblGenomes-Gn; EBG00001188246.
DR   EnsemblGenomes-Gn; EBG00001188247.
DR   EnsemblGenomes-Gn; EBG00001188248.
DR   EnsemblGenomes-Gn; LPC_0092.
DR   EnsemblGenomes-Gn; LPC_0381.
DR   EnsemblGenomes-Gn; LPC_0382.
DR   EnsemblGenomes-Gn; LPC_0383.
DR   EnsemblGenomes-Gn; LPC_0384.
DR   EnsemblGenomes-Gn; LPC_0419.
DR   EnsemblGenomes-Gn; LPC_0572.
DR   EnsemblGenomes-Gn; LPC_0652.
DR   EnsemblGenomes-Gn; LPC_0697.
DR   EnsemblGenomes-Gn; LPC_0746.
DR   EnsemblGenomes-Gn; LPC_1026.
DR   EnsemblGenomes-Gn; LPC_1027.
DR   EnsemblGenomes-Gn; LPC_1301.
DR   EnsemblGenomes-Gn; LPC_1302.
DR   EnsemblGenomes-Gn; LPC_1308.
DR   EnsemblGenomes-Gn; LPC_1309.
DR   EnsemblGenomes-Gn; LPC_1310.
DR   EnsemblGenomes-Gn; LPC_1311.
DR   EnsemblGenomes-Gn; LPC_1324.
DR   EnsemblGenomes-Gn; LPC_1325.
DR   EnsemblGenomes-Gn; LPC_1326.
DR   EnsemblGenomes-Gn; LPC_1383.
DR   EnsemblGenomes-Gn; LPC_1396.
DR   EnsemblGenomes-Gn; LPC_1540.
DR   EnsemblGenomes-Gn; LPC_1541.
DR   EnsemblGenomes-Gn; LPC_1542.
DR   EnsemblGenomes-Gn; LPC_1633.
DR   EnsemblGenomes-Gn; LPC_1756.
DR   EnsemblGenomes-Gn; LPC_1757.
DR   EnsemblGenomes-Gn; LPC_1758.
DR   EnsemblGenomes-Gn; LPC_1832.
DR   EnsemblGenomes-Gn; LPC_2315.
DR   EnsemblGenomes-Gn; LPC_2411.
DR   EnsemblGenomes-Gn; LPC_2498.
DR   EnsemblGenomes-Gn; LPC_2727.
DR   EnsemblGenomes-Gn; LPC_2728.
DR   EnsemblGenomes-Gn; LPC_2729.
DR   EnsemblGenomes-Gn; LPC_2730.
DR   EnsemblGenomes-Gn; LPC_2745.
DR   EnsemblGenomes-Gn; LPC_2755.
DR   EnsemblGenomes-Gn; LPC_2778.
DR   EnsemblGenomes-Gn; LPC_3027.
DR   EnsemblGenomes-Gn; LPC_3029.
DR   EnsemblGenomes-Gn; LPC_3030.
DR   EnsemblGenomes-Gn; LPC_3031.
DR   EnsemblGenomes-Gn; LPC_3032.
DR   EnsemblGenomes-Gn; LPC_3033.
DR   EnsemblGenomes-Gn; LPC_3034.
DR   EnsemblGenomes-Gn; LPC_3035.
DR   EnsemblGenomes-Gn; LPC_3036.
DR   EnsemblGenomes-Gn; LPC_3060.
DR   EnsemblGenomes-Gn; LPC_3076.
DR   EnsemblGenomes-Gn; LPC_3288.
DR   EnsemblGenomes-Tr; EBT00001766639.
DR   EnsemblGenomes-Tr; EBT00001766640.
DR   EnsemblGenomes-Tr; EBT00001766641.
DR   EnsemblGenomes-Tr; EBT00001766642.
DR   EnsemblGenomes-Tr; EBT00001766643.
DR   EnsemblGenomes-Tr; EBT00001766644.
DR   EnsemblGenomes-Tr; EBT00001766645.
DR   EnsemblGenomes-Tr; EBT00001766646.
DR   EnsemblGenomes-Tr; EBT00001766647.
DR   EnsemblGenomes-Tr; EBT00001766648.
DR   EnsemblGenomes-Tr; EBT00001766649.
DR   EnsemblGenomes-Tr; EBT00001766650.
DR   EnsemblGenomes-Tr; EBT00001766651.
DR   EnsemblGenomes-Tr; EBT00001766652.
DR   EnsemblGenomes-Tr; EBT00001766653.
DR   EnsemblGenomes-Tr; EBT00001766654.
DR   EnsemblGenomes-Tr; EBT00001766655.
DR   EnsemblGenomes-Tr; EBT00001766656.
DR   EnsemblGenomes-Tr; EBT00001766657.
DR   EnsemblGenomes-Tr; EBT00001766658.
DR   EnsemblGenomes-Tr; EBT00001766659.
DR   EnsemblGenomes-Tr; EBT00001766660.
DR   EnsemblGenomes-Tr; EBT00001766661.
DR   EnsemblGenomes-Tr; EBT00001766662.
DR   EnsemblGenomes-Tr; EBT00001766663.
DR   EnsemblGenomes-Tr; EBT00001766664.
DR   EnsemblGenomes-Tr; EBT00001766665.
DR   EnsemblGenomes-Tr; EBT00001766666.
DR   EnsemblGenomes-Tr; EBT00001766667.
DR   EnsemblGenomes-Tr; EBT00001766668.
DR   EnsemblGenomes-Tr; EBT00001766669.
DR   EnsemblGenomes-Tr; EBT00001766670.
DR   EnsemblGenomes-Tr; EBT00001766671.
DR   EnsemblGenomes-Tr; EBT00001766672.
DR   EnsemblGenomes-Tr; EBT00001766673.
DR   EnsemblGenomes-Tr; EBT00001766674.
DR   EnsemblGenomes-Tr; EBT00001766675.
DR   EnsemblGenomes-Tr; EBT00001766676.
DR   EnsemblGenomes-Tr; EBT00001766677.
DR   EnsemblGenomes-Tr; EBT00001766678.
DR   EnsemblGenomes-Tr; EBT00001766679.
DR   EnsemblGenomes-Tr; EBT00001766680.
DR   EnsemblGenomes-Tr; EBT00001766681.
DR   EnsemblGenomes-Tr; EBT00001766682.
DR   EnsemblGenomes-Tr; EBT00001766683.
DR   EnsemblGenomes-Tr; EBT00001766684.
DR   EnsemblGenomes-Tr; EBT00001766685.
DR   EnsemblGenomes-Tr; EBT00001766686.
DR   EnsemblGenomes-Tr; EBT00001766687.
DR   EnsemblGenomes-Tr; EBT00001766688.
DR   EnsemblGenomes-Tr; EBT00001766689.
DR   EnsemblGenomes-Tr; EBT00001766690.
DR   EnsemblGenomes-Tr; EBT00001766691.
DR   EnsemblGenomes-Tr; EBT00001766692.
DR   EnsemblGenomes-Tr; EBT00001766693.
DR   EnsemblGenomes-Tr; EBT00001766694.
DR   EnsemblGenomes-Tr; EBT00001766695.
DR   EnsemblGenomes-Tr; EBT00001766696.
DR   EnsemblGenomes-Tr; EBT00001766697.
DR   EnsemblGenomes-Tr; EBT00001766698.
DR   EnsemblGenomes-Tr; EBT00001766699.
DR   EnsemblGenomes-Tr; EBT00001766700.
DR   EnsemblGenomes-Tr; EBT00001766701.
DR   EnsemblGenomes-Tr; LPC_0092-1.
DR   EnsemblGenomes-Tr; LPC_0381-1.
DR   EnsemblGenomes-Tr; LPC_0382-1.
DR   EnsemblGenomes-Tr; LPC_0383-1.
DR   EnsemblGenomes-Tr; LPC_0384-1.
DR   EnsemblGenomes-Tr; LPC_0419-1.
DR   EnsemblGenomes-Tr; LPC_0572-1.
DR   EnsemblGenomes-Tr; LPC_0652-1.
DR   EnsemblGenomes-Tr; LPC_0697-1.
DR   EnsemblGenomes-Tr; LPC_0746-1.
DR   EnsemblGenomes-Tr; LPC_1026-1.
DR   EnsemblGenomes-Tr; LPC_1027-1.
DR   EnsemblGenomes-Tr; LPC_1301-1.
DR   EnsemblGenomes-Tr; LPC_1302-1.
DR   EnsemblGenomes-Tr; LPC_1308-1.
DR   EnsemblGenomes-Tr; LPC_1309-1.
DR   EnsemblGenomes-Tr; LPC_1310-1.
DR   EnsemblGenomes-Tr; LPC_1311-1.
DR   EnsemblGenomes-Tr; LPC_1324-1.
DR   EnsemblGenomes-Tr; LPC_1325-1.
DR   EnsemblGenomes-Tr; LPC_1326-1.
DR   EnsemblGenomes-Tr; LPC_1383-1.
DR   EnsemblGenomes-Tr; LPC_1396-1.
DR   EnsemblGenomes-Tr; LPC_1540-1.
DR   EnsemblGenomes-Tr; LPC_1541-1.
DR   EnsemblGenomes-Tr; LPC_1542-1.
DR   EnsemblGenomes-Tr; LPC_1633-1.
DR   EnsemblGenomes-Tr; LPC_1756-1.
DR   EnsemblGenomes-Tr; LPC_1757-1.
DR   EnsemblGenomes-Tr; LPC_1758-1.
DR   EnsemblGenomes-Tr; LPC_1832-1.
DR   EnsemblGenomes-Tr; LPC_2315-1.
DR   EnsemblGenomes-Tr; LPC_2411-1.
DR   EnsemblGenomes-Tr; LPC_2498-1.
DR   EnsemblGenomes-Tr; LPC_2727-1.
DR   EnsemblGenomes-Tr; LPC_2728-1.
DR   EnsemblGenomes-Tr; LPC_2729-1.
DR   EnsemblGenomes-Tr; LPC_2730-1.
DR   EnsemblGenomes-Tr; LPC_2745-1.
DR   EnsemblGenomes-Tr; LPC_2755-1.
DR   EnsemblGenomes-Tr; LPC_2778-1.
DR   EnsemblGenomes-Tr; LPC_3027-1.
DR   EnsemblGenomes-Tr; LPC_3029-1.
DR   EnsemblGenomes-Tr; LPC_3030-1.
DR   EnsemblGenomes-Tr; LPC_3031-1.
DR   EnsemblGenomes-Tr; LPC_3032-1.
DR   EnsemblGenomes-Tr; LPC_3033-1.
DR   EnsemblGenomes-Tr; LPC_3034-1.
DR   EnsemblGenomes-Tr; LPC_3035-1.
DR   EnsemblGenomes-Tr; LPC_3036-1.
DR   EnsemblGenomes-Tr; LPC_3060-1.
DR   EnsemblGenomes-Tr; LPC_3076-1.
DR   EnsemblGenomes-Tr; LPC_3288-1.
DR   EuropePMC; PMC2257941; 18194518.
DR   EuropePMC; PMC2621349; 19165328.
DR   EuropePMC; PMC2805308; 19915024.
DR   EuropePMC; PMC2903611; 20644718.
DR   EuropePMC; PMC2976443; 20833813.
DR   EuropePMC; PMC3811488; 23974134.
DR   EuropePMC; PMC4126679; 25105285.
DR   EuropePMC; PMC4473214; 25926494.
DR   EuropePMC; PMC5406027; 28445535.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02057; STnc40.
DR   SILVA-LSU; CP000675.
DR   SILVA-SSU; CP000675.
XX
CC   On Mar 30, 2009 this sequence version replaced gi:148279912.
CC   Source DNA is availabe from Michael Steinert (m.steinert@tu-bs.de)
CC   or Klaus Heuner (heunerk@rki.de).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3576470
FT                   /organism="Legionella pneumophila str. Corby"
FT                   /strain="Corby"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:400673"
FT   gene            655..2013
FT                   /gene="dnaA"
FT                   /locus_tag="LPC_0001"
FT   CDS_pept        655..2013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="LPC_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54001"
FT                   /db_xref="GOA:A5I9F1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9F1"
FT                   /protein_id="ABQ54001.1"
FT                   /translation="MSTTAWQKCLGLLQDEFSAQQFNTWLRPLQAYMDEQRLILLAPNR
FT                   FVVDWVRKHFFSRIEELIKQFSGDDIKAISIEVGSKPVEAVDTPAETIVTSSSTAPLKS
FT                   APKKAVDYKSSHLNKKFVFDSFVEGNSNQLARAASMQVAERPGDAYNPLFIYGGVGLGK
FT                   THLMHAIGNSILKNNPEAKVLYLHSERFVADMVKALQTNSINEFKRFYRSLNALLIDDI
FT                   QFFAGKDRSQEEFFHTFNALLEGQQQIILTSDRYPKEIEGMEERLKSRFGWGLTVAVEP
FT                   PELETRVAILISKAEQSNIELPYEVAFFIAKRIRSNVRELEGALRRVIANAHFTGKPIT
FT                   IEFVHEALRDLLALQDKLVTIENIQKTVAEYYKVKVADLLSKRRSRSIARPRQMAMALS
FT                   KELTNHSLPEIGDHFGGKDHTTVIHACRKVKELIQDDSDFAEDYKNLMRILSS"
FT   gene            2027..3130
FT                   /gene="dnaN"
FT                   /locus_tag="LPC_0002"
FT   CDS_pept        2027..3130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="LPC_0002"
FT                   /product="DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54002"
FT                   /protein_id="ABQ54002.1"
FT                   /translation="MFELTIKKEDLLTPLLTVSGAVDKKQSLAILSHFLLKLSDGLLYI
FT                   TATDLEIEMSAQVACDSNNTSGSITVPAKKFIDIIRSLDENPSPSIVFDKALVTIKQNR
FT                   STFKLATLPAENYPSSEDECNDVELTIPRLVLLQLLQSTHFAMSQQDVRIFLNGLLLEF
FT                   DSNIISAVATDGHRMAISRYSCNNITQTKLLIPKKGVQELLRLLNCINDEQVLLAAGKS
FT                   HIKLITNQFVFLSKLIEARFPPYTKAIPREQDKYIVIDCATLKRALSRIVILAHEKSKA
FT                   VLLHLQPGQLTLIANNNEQEEAIETLSAETQGDELKIGLNATYLLDVLAHFSDGQIRLS
FT                   MSNTESSILIESLVNDNYQYIIMPMKI"
FT   gene            3127..4188
FT                   /gene="recF"
FT                   /locus_tag="LPC_0003"
FT   CDS_pept        3127..4188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="LPC_0003"
FT                   /product="DNA recombination and repair protein ATPase RecF"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54003"
FT                   /protein_id="ABQ54003.1"
FT                   /translation="MILSEVRIHNFRNIASTSLILNPNFNCITGPNGSGKTSLLEALYM
FT                   LSCAHSFRSREVAPIISYGQNQLNVFAHTYDESTISVQKSITDGTQIKLNNQFCCTTSQ
FT                   LAYALPCQVIYSDIFQIIDAGPSVRRSLLDWGLFHVKHDYLKIWKDYKRILSQRNALLK
FT                   SRATYEHFIPWDQQLSQLANQLDKARNDYFLQWQPKFYQVLSDLTNISCTIEYYKGWDR
FT                   KNAGQNMEELLQKSFDSDKNKLYTQYGPHQADLIINIEQYRVKHTLSRGQQKIILIALK
FT                   LAQGQLLDKDCLYLIDDLAAELDDYHQRNLIKYLTQQKGQFVITNLINNNNYDILPIDS
FT                   GLFEVNCGAIKVL"
FT   gene            4485..6902
FT                   /gene="gyrB"
FT                   /locus_tag="LPC_0004"
FT   CDS_pept        4485..6902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="LPC_0004"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54004"
FT                   /protein_id="ABQ54004.1"
FT                   /translation="MSVDASYDSNNIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDESLAGYCKEIFVTIHSDESITVKDDGRGIPVDIHKEEGKSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSEELHLLVRRHGKVYEQHYRHGVPESPIAETGESN
FT                   STGTQIWFKPSAETFSNIEFHYDILAKRLRELSYLNSGVCIHLFDERTQKKDTFHYEGG
FT                   IKAFVEHLNKNKTPVHPVVFSMTSEKDGIVIELAMQWNDGYQETIFCFTNNIPQRDGGT
FT                   HMAGFRAALTRTLNNYIENEGYAKKAKVSPTGDDAREGLTAVLSVKVPDPKFSSQTKDK
FT                   LVSSEVKPAVESCVAEKFNDFLLENPTAAKSIVAKIIDAARAREAARRAREMTRRKGAL
FT                   DIAGLPGKLADCQEKDPSLSELYLVEGDSAGGSAKQARDRKFQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGPEEYDPDKVRYHRIIIMTDADVDGSHIRTLLLTFFYR
FT                   QTRELLERGYIYIAQPPLYKVKRGKQEQYVKDDEALFDYLTQCALDGATFYPAKEAPPI
FT                   SAKSLEELVQHFRRVEKIIKRYKRRYPSDILKRVAYMPMLHQEDFNNLSKIESWCRQLH
FT                   LSLQQVDSKTEQYKVDIQKLTEGNQYTPKITVYQHGLENDIPMQVEFFLSKDYKEMVDL
FT                   GHKLSNLIEEGAYIQRGDKSLPVENFEQVLNWLMDEAKKGQTIQRYKGLGEMNPEQLWE
FT                   TTMDPEVRRMLQVSIEDAVAADEIFTTLMGDNVEPRRDFIETNALDAENIDI"
FT   gene            complement(7266..8312)
FT                   /locus_tag="LPC_0005"
FT   CDS_pept        complement(7266..8312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0005"
FT                   /product="peptidylarginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54005"
FT                   /protein_id="ABQ54005.1"
FT                   /translation="MNMNTAPKQYGFYMPAEWYPHERCWMAWPCHHDTWSKIGLDKAKM
FT                   AYARVAKAIAQFEPVTLLVNPGDEDSAENLCKGHNIEIISLPINDSWTRDTGATFLINN
FT                   ERQLAGVDWIHNAWGGNYADCSLDNLLASHLIKYTEAQYFHAPLVMEGGSFHVDGEGTI
FT                   LTSKECLLNSNRNPHLSQQEIEQYLINYLGAERIIWLNMGLIGDETDGHVDEIATFIAP
FT                   GKVLCLITKDKEDPNYHRLQENFEILKSSKDARGRTFEVYTVEQPPATYLNGERLTLSY
FT                   INFYMANQGIVMPAFGYESFDRLAYQLFVQIFPGYQITQIDALDVFSGGGGIHCITQQQ
FT                   PKSYKLVG"
FT   gene            complement(8309..10201)
FT                   /gene="speA"
FT                   /locus_tag="LPC_0006"
FT   CDS_pept        complement(8309..10201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="LPC_0006"
FT                   /product="biosynthetic arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54006"
FT                   /protein_id="ABQ54006.1"
FT                   /translation="MNNNTLSDDNLYNIENWGEGYFRINSKGNIEISKKPGKPGVELQT
FT                   IVDAADRAGLHLPLLIRCSDILHDRVHRIYQAFTQAREDTYYAGNYQLVYPIKVNQEQS
FT                   VVRELLKSPDNQIGLEAGSKPELMAVIGMLGDHQSTIVCNGYKDTSYIRTALIAQQMGH
FT                   KVFIVIEKKSELDIILKESARLQIKPTLGVRIRLVSKSAGKWENTGGVKSKFGLNAKQV
FT                   LELILQLKANDMLDCLQLMHCHLGSQIANIHDIRHCMQEVARYYIELRQLNAPIGTIDV
FT                   GGGLSVDYEGTRSNKGCSMNYSLVEYATHIMLALKHLCQEAEIPEPDLISESGRALTAH
FT                   HAVLISNITDVEIINKAPVLPEISEDDSHVIRDIYDTYQAITDSSPTEIYNYAAHSLNE
FT                   AHSLFKHGVISLQEKAKVEAFYTNICMEIKDKLDEENPSEKALLMRINECMAAKIFCNI
FT                   SFFQSIPDAWAIGQIFPVAPISQLNRTLSMHSILQDLTCDSDGTIKQYPGSSCVTTTLM
FT                   LPSYDINNPYNIGFFLVGAYQEILGNLHNLFGDTNSLDVKLSDDGQFELDDLVSGDTVT
FT                   NVLNLAHFDTKKLIQSYEKQLIKSELPKEKALSYLNELRSIFSQLTYLDGNIAQ"
FT   gene            complement(10221..11066)
FT                   /locus_tag="LPC_0007"
FT   CDS_pept        complement(10221..11066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0007"
FT                   /product="amidohydrolase"
FT                   /note="COG0388"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54007"
FT                   /protein_id="ABQ54007.1"
FT                   /translation="MKENKLTVALVQEQWYENPKEHQDKLASGIFSATQQGAKLVCLQE
FT                   LTLSPYFCTRSDVDPAPYMEDIATGPTAQFVSQMAKSNQIHITASLFEKAGYNTAVAFN
FT                   PQGELIAVTRKQHIPSGEKYHENFYFKPGDSNYPVHTIAGHYLGLPTCYDQWFPELSRI
FT                   YGLKGAEILVYPTAIGGEPTAPGFDSQPMWQKVMVAQGIMSNTFIIAVNRIGCEDGLSF
FT                   YGSSFISTPMGEILVQAPRNEPAVLVAELDFSQRELWGRLFPFPQQREPETYHELVKSR
FT                   "
FT   gene            11535..11621
FT                   /locus_tag="LPC_0008"
FT   CDS_pept        11535..11621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54008"
FT                   /protein_id="ABQ54008.1"
FT                   /translation="MMCKEWVKKCKVALNQVRAKDMAALLAE"
FT   gene            complement(11607..12866)
FT                   /locus_tag="LPC_0009"
FT   CDS_pept        complement(11607..12866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54009"
FT                   /protein_id="ABQ54009.1"
FT                   /translation="MTFTCDELKGLEHPYKVLGNGDALAENREELNKLTNDEKLVLASR
FT                   LVLECPVNELKDFAHAIEAARMPQDDSDTFHSFLFQAYQVKKRIISLLDPRNKNPHSMI
FT                   LEKEFDGELFNNFNKLAIDVLTNNEVAIALRLAETTPAQDRSRVSQNINNIFPQSLFAA
FT                   KVGHAFAVRRDIERLLLGDRPDQFFSSREFKIDSCIEFASLFNVINDKESSIAGKLALR
FT                   TPAENRSDVVMKIKGFCAEDSELAIKVQSAFALRRDIERNLLGDNPEQFFNSRDFSVDL
FT                   CLEFAILFPELLKGHEQAIGEKLAKLDAKVRSDISRKLEMINGAAHEQSSPFRIIASAM
FT                   VPKEEPCLTKPTPVVLPSTEEIIPKQESPTSLRNRNVLFKEQTEEHKKKNSQMEPIASD
FT                   SEEEEEKQNCWTSFCGLFGK"
FT   gene            13054..13311
FT                   /gene="hfq"
FT                   /locus_tag="LPC_0010"
FT   CDS_pept        13054..13311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="LPC_0010"
FT                   /product="host factor-I protein for bacteriophage Q beta
FT                   replication"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54010"
FT                   /db_xref="GOA:A5I9G0"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9G0"
FT                   /protein_id="ABQ54010.1"
FT                   /translation="MSKNHLLQDPFLNELRKEKVPVSVFLVNGIKLHGIIDSFDQYVVM
FT                   LKNSITQMVYKHAISTVVPSRMVKIPAEESSGEEEGTVAD"
FT   gene            13339..14583
FT                   /gene="hflX"
FT                   /locus_tag="LPC_0011"
FT   CDS_pept        13339..14583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="LPC_0011"
FT                   /product="GTP binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54011"
FT                   /protein_id="ABQ54011.1"
FT                   /translation="MFERPQGGERAVLVQLALPGVDADKALAEFEELALSAKAEVLDCV
FT                   LGARATPDAKYYVGKGKAEEIAHLVNMLDADLVLVNHELSPSQERNLERLFGCRVVDRS
FT                   GLILDIFAQRARTFEGKLQVELAQLQHLSTRLIRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRERIRYINKRLEKVRCSRDQNRQARRKASMPTVSLVGYTNAGKSTLFNVLTGEHT
FT                   YVADQLFATLDPTMRKLELPGSSAAILADTVGFIRDLPHHLVEAFRATLEETQQADLLL
FT                   HVIDISDPNWRETVFEVQKVLDELKVSNIPVIQVFNKIDLQEGWQPKIDYTEDACKVWL
FT                   SATTGAGLDLLKEAIATQLHGMILIEDIVIKPDQAKLRAQLYQLGAVLKESVDENGDWL
FT                   MKIRITADQKRRLLS"
FT   gene            complement(14688..15158)
FT                   /gene="resA"
FT                   /locus_tag="LPC_0012"
FT   CDS_pept        complement(14688..15158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resA"
FT                   /locus_tag="LPC_0012"
FT                   /product="thiol-disulfide oxidoreductase ResA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54012"
FT                   /protein_id="ABQ54012.1"
FT                   /translation="MKRLIPTFIYLLALAITPFSTHAEALLKDTFGHNIPFSSLKGKWV
FT                   FINYWASWCETCVDEIPEFNRFYKNHKNEAVALYAVNYDALPLPEQKLLIKKFNINYPN
FT                   LLKDPAQDLQLGDITGVPVTFVFNPKGQLIKKLYGGQTAKTLEKVIAENRTS"
FT   gene            complement(15327..16904)
FT                   /locus_tag="LPC_0013"
FT   CDS_pept        complement(15327..16904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0013"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54013"
FT                   /protein_id="ABQ54013.1"
FT                   /translation="MNTTEHTELGNGLLMDKIEGNPYLRIDEFGVLHLRLQRFGENNLP
FT                   EPMELEMSAGEIIAMAGDYFTQANWTMDLDLPKCELFNSPAELGKHLIRKPIDPKEESA
FT                   LITAYNNLAAPDVTRKEIDRIYSINNANYVPFSPTLNFYAQQLMYYFRVKDYGEMLVRN
FT                   QTHFTPWSIRVYILGHAIALRYAHLSYELKQLATDRNYQSDNPDLSTLKISLQNKNETL
FT                   SSNTLLDLANRYHAQAYSIELFTFHYYSDHFATGHMSMIGDLRVVLKERFGVWGNILAN
FT                   NLHDEVNRVGVYTVRPYDPTPNATEAPSRARGDGKFDTCLNQFNRLACLNGMTASLKDI
FT                   NQVLSGSVIPEQKDFGGLVHMPDVDFNSRQHQPLLVLSKGKVYYRNNLSQIHIISPSEY
FT                   EALRESPEKHGYKELTSKWTAFKLVTKLRLFPYLYDGSVMPVSDEKLAEIIADEKRRNP
FT                   QRAPIPTPSCLPESEPTVFDWRTKASWRNNKDSLDILDGLKKHSILGAKQTHSAIQEEE
FT                   EVRLNLGV"
FT   gene            17050..17889
FT                   /locus_tag="LPC_0014"
FT   CDS_pept        17050..17889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0014"
FT                   /product="pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54014"
FT                   /protein_id="ABQ54014.1"
FT                   /translation="MKAIEVERLIQGTLIREGGGVKLRRYIGADKTNHFEPILLFDYFD
FT                   SSDPLDYLAGFPPHPHRGFETITYLMEGSITHEDNKGNKGVINAGGVQWMTAGKGIIHS
FT                   EMPSSSTGRLHGLQLWLNLPAAEKWREPRYQEKSSDQLPIEVMESGATIKVIAGRIDQG
FT                   LSSPIVEIATRPLFLDINLPANATIQQTIPDDYQAVLFVIEGAVNTGGQQITAGTLASL
FT                   TNGERIQIEGKDKENRNHCLLIAAAKLHEPIVRYGPFVMNTQEEITQAIHDFRTGHF"
FT   gene            18326..19537
FT                   /locus_tag="LPC_0015"
FT   CDS_pept        18326..19537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0015"
FT                   /product="esterase of the alpha-beta hydrolase superfamily"
FT                   /note="COG1752"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54015"
FT                   /protein_id="ABQ54015.1"
FT                   /translation="MSLEVEPKPHGNNPYANRFDNLPSKAQGRFPRVAYVLQGGGSLGA
FT                   YQFGVVKGLLEAGYEPDWIAATSIGAIQAAIIVGNPPEKRIEKLERFWDEIAPGNFFDF
FT                   LGESDITLDFYNKLSAACALLFGQPEFFFPKWCTGTIPLWGDPTTLSYYDTTPLRKTLL
FT                   DLIDFELLNSCPIRLSLGAVQISNGHLIYFNNINYRIEVEHIMASAALPPGFPAVNIDG
FT                   ELYWDGGVHSNTPLEVILEAIPAENTLCFLIDCFGGRSFIPKSMSEIEERRKDISYGTH
FT                   AQRTIYNYLQRQKMRNSMMELSRILTDEQKKESAHLLDIGSPHHCTLVHLAYSSRIVKA
FT                   ASKDYNFGRVVIKKRMESGYSDAKAVLAEESQWGYLPEDGKSRLYESPNNLSRLFRKRK
FT                   KEVF"
FT   gene            19639..20712
FT                   /locus_tag="LPC_0016"
FT   CDS_pept        19639..20712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0016"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54016"
FT                   /protein_id="ABQ54016.1"
FT                   /translation="MKEKFATWYKIATKHIRFFFSYSIPMFFKKAKNYINLPIIVVGLA
FT                   LIIGLFHLFSYLIPFTDNAFVVTNVTPVAADVSGFITEIYVKNGQKVKKNDPIFSVYRV
FT                   PYELAYQQAMADYKEGLKKIDVFQKQIERTVALIKATDSELEKAQFALGLKKNKNVAEA
FT                   VSVLELKNLGYDVSTLSNKRNALQQEVAVLQAKIEQQRHTVASLKAKMDNAKVNLDLTI
FT                   VRAPGDGVIDNMYVSPNTPIEIHKPVFSFIDTANYYIQANFNETDLRNVRQGDKAYIIL
FT                   RMYYFDKIFHGVVVNSLWAAERQSTAPKSQIQVVTNQNEWLLLPQRFPLQIKILDPDPD
FT                   YPLNPGASAYVYISTKR"
FT   gene            20687..21619
FT                   /locus_tag="LPC_0017"
FT   CDS_pept        20687..21619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54017"
FT                   /protein_id="ABQ54017.1"
FT                   /translation="MFISQLKDKLASYDRYKEHRINGLKAVFVLELMILFYFFSSIDNP
FT                   YFYYFYAPITCFTVEAAGTTLKEKYMLLLYTLLGSILSIFLFGIISVYNVLFIFFVFFY
FT                   TLALYFLVLHHFKKMLVIVPLILSLASYSLIYGVEADSNFYIAINNALYTLAAMAVIFA
FT                   GLFIFPKKYYFDIWERAFLEVITGLESLSAKICKGEVKTIAIFSGIIVMERYSKMLPRN
FT                   IKCYSILKITILSFELILTMSYLLSFQKQLRKEYIIVLHHYLERLCQSCKARQPLILSD
FT                   QELPAFKETHELEILYQLILSWNYLCADG"
FT   gene            21604..22509
FT                   /locus_tag="LPC_0018"
FT   CDS_pept        21604..22509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54018"
FT                   /protein_id="ABQ54018.1"
FT                   /translation="MRRWLGVQAFSYVELRSIQISTVFAFTIFVQEWLRYPRAGWTGFA
FT                   VMMIYAGFDNGTTIFRTYHRFLGVLLGLFTGYLLWFVGHLDYRTLILIMPLMVFFAFFL
FT                   VGRAYSVPTVFTVNVSVLGSGYFSTEDTLPVTYFIIDYTLCTLIAFTIILGFEYFWFRH
FT                   YGLMQRFIKSTQAEVIDDLYRLVRLLNQGKIKKTEWFQACIKLTDSLFEVNKLITNSQF
FT                   LISSEHAVGDEFNQFVELANRIFIGLKALYMAYYTKHYHTFDYYQLFQQVQKDLVHLKD
FT                   FVAGEQTIDLSEGVKHATSG"
FT   gene            22493..23899
FT                   /locus_tag="LPC_0019"
FT   CDS_pept        22493..23899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0019"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54019"
FT                   /protein_id="ABQ54019.1"
FT                   /translation="MLRPVKIILLSVFLVGCYSEPYHRPHVEVINKWSVKDKNVKNIDS
FT                   KNIPYIAWWRDFKDPTLNQLIERGLISNTSLGMSRGSIEAAEGELKKIRYQWVPTLDLM
FT                   TGYSRNPATGFPGVLIVFIPNYTINIINQIREQKRAKYTLAQVKAEDDALKLTIISQIA
FT                   ASYFTYLAEIERKEFLQTLANDLTQLAKVANKVYQGGLSSEIEQEELYSQVNLIQGELE
FT                   VTERNIVISRNALRYLLNQNPGEIKTVKKLLQLKNRKLIPGSLPLTVLENRPDMQVAEN
FT                   RLRASHEGIGVAESNLLPTIQLDYIGGLAAGDSRYALPKKTVKFNDQLLKAPIIDMPVL
FT                   GAVAKAKGVNKVSYYNYIDTLQKALRDTTNALSENERLTNKLKQTASAQKHLAKAYNLN
FT                   DRLYQTGIQSYIETLNSKISLDKINISLNQDKLQELLSIVRLYQELAGGYRANLESEIK
FT                   SSGRATRTRL"
FT   gene            24125..25801
FT                   /locus_tag="LPC_0020"
FT   CDS_pept        24125..25801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0020"
FT                   /product="hemagglutinin/protease, zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54020"
FT                   /protein_id="ABQ54020.1"
FT                   /translation="MSKKTMFFILSISTSSIFAADNVDLYQAPLNSINKYPILQTPKNA
FT                   IILKSSSAVIDNSLQKLNQTKEDNQMIVRYQQLYKGIPVIGAQVMITKGTDSGVQSNDN
FT                   AEVNGHLLDNIELNTKPAISAQQAKEYAKKSYFQFSPQSNIQQETAELQIRPDHNNQLK
FT                   LVYLVSFKSVQQSGKPDWPFFVIDAQTGALIKQWNNIKNYLDTGPGGNEKVQEYWYGKD
FT                   GLPALDVTQNGSQCVMENSKVKLVNLHSQWDWENTINTPFEYVCNNNIEEKINGGFSPG
FT                   NDAYYFGHVIVGMYKDWYGLNALQHSNGAPMQLVMRVHFGQNYDNAFWDGQAMSFGDGL
FT                   DFYPLVSLDVAGHEVTHGFTEQHSGLEYHDQSGALNESLSDMAGQASRAYLLEKNPQLY
FT                   NKAYLQPNEVTWGIGETIVRDSYGKALRFMDYPSSDGSSADCLDKGIAQNNGSYCAISY
FT                   DEVVAYANTHIALPQERQSFIVHTASGVFNKAFYLMSKDMGIKNAYHIMVVANTKYWTP
FT                   TTDFKNGACGVIYAARDLNTDINKVKSAFGQVGIDTAGCVI"
FT   gene            26021..26932
FT                   /locus_tag="LPC_0021"
FT   CDS_pept        26021..26932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0021"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54021"
FT                   /protein_id="ABQ54021.1"
FT                   /translation="MAFFLITLCILILSFFCLAVMVLKFMQQPSSPLSFSQYVKLMCSG
FT                   VIAFIADTVGVGSFAVNVALAKLLGTFRDDELPAVNNGAQVLPGAIESLFFIHMVDVDL
FT                   TTLLTLVTGTCIGGLVGGFVVSQLSKQAIRLAMICSFALIIVLLIAHQLRLLPVGGDLT
FT                   ELHSWKLVIGFFAMVVCGSLTSVGVGLFVMVQGVLFLMNVSPVVAFPIMTTAGAMQQPL
FT                   TTLVFLQKNKIPLKKTLILSFSGCLGVMITIPIFTKLTITWLHFLLLFILIYNFLAIGH
FT                   TYLRSRPVKQYVQSSVKLAAAD"
FT   gene            27124..27603
FT                   /locus_tag="LPC_0022"
FT   CDS_pept        27124..27603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0022"
FT                   /product="conserved hypothetical protein; DUF615"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54022"
FT                   /protein_id="ABQ54022.1"
FT                   /translation="MDEQISKSQKKRDAHYLQDIGIKFIDLSASKLDSLPLPDNLRQAI
FT                   IDARSIKSHGAKRRQAQLIGKLMRAADFEAILAAYEKILEEESSITASFHEIELWRDRL
FT                   LQDGKDALTEFIDAYQPEDVQQLRQLIKKALDDQMKEKNTGAAKALFRYLRSLIK"
FT   gene            27600..29723
FT                   /locus_tag="LPC_0023"
FT   CDS_pept        27600..29723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0023"
FT                   /product="N6-adenine-specific DNA methylase and
FT                   SAM-dependent methyltransferases"
FT                   /note="COG0116; COG1092"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54023"
FT                   /db_xref="GOA:A5I9H3"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR017244"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9H3"
FT                   /protein_id="ABQ54023.1"
FT                   /translation="MNYSLFISCSKGLEYLLEDELKGLGLHVTQVSPQGVYGEASLPVI
FT                   YNLCLWSRLANRIQLILFSGHAAKEQAVHQLCTDFHWQTVFTHDKTIAIEFHGASEQIR
FT                   NTMFGAQIVKDGIVDHFRRLNGSRPSVDKEKPQILIHAHLKNDILTVSFDLVGYSLHQR
FT                   GYRKKAGKAPLKENVAAAMLLRAKWPELAAQGYGLHDPFCGSGTLVIEAAMMAAHIAPG
FT                   LLRQDQSLQYWARHQSSLWEKLRTQALQQVKPLAVKLVGTDADGKIITLARSNAERAGV
FT                   LPLVEFNTLPLNACRPGTKKGLVVCNPPYGERLGEVTQLVPLYQQLGTTLHTCYQGWQA
FT                   AILTSSPVLAKALGLRADKQYTLYNGPLECKLYCLTLSAANKLKNTPNAPLSDNAQMLF
FT                   NRLEKNRNHLQKWARKNQITCYRIYDADLPEYAYAIDIYNDYAVLQEYAPPASIPVHKA
FT                   EKRSLEMLQVVPRALGIHPEKLIVKQRKQQKGSEQYQKIGKTSQRLIVTEGKAKLIVNL
FT                   YDYLDTGLFLDHRLMRLKFAQLEPGTRFLNCFCYTASASVHAALAGALTTNVDLSKTYL
FT                   LWAEDNFRLNDIDLSKHQFLQYDCKEWMKITRDKFDVIFLDPPSFSNSKRMSDILDIQR
FT                   DHVSLINMAMRLLNPNGVLYFSTNLRQFKLEPMLKEKYAVQDITPQTIDQDFKRNSKIH
FT                   HCFKIVMPHFADN"
FT   gene            complement(29793..30335)
FT                   /locus_tag="LPC_0024"
FT   CDS_pept        complement(29793..30335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54024"
FT                   /protein_id="ABQ54024.1"
FT                   /translation="MKSFIEQAQFYATYHQNPATRYTHMAGVPLIMLSIMIFLGFVKIV
FT                   IPGVYATDLACLATLAALIYYFLLNWQLALALTPILIFLLWLASWFNYDGPTKFGLWVF
FT                   IITFVVGWGLQFYGHFIEGKKPAFMVNFTQALIAPLYLTAELFFMAGLMNSLREQIYGN
FT                   EEVNTEEISKTKTKSKS"
FT   gene            complement(30482..30907)
FT                   /locus_tag="LPC_0025"
FT   CDS_pept        complement(30482..30907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54025"
FT                   /protein_id="ABQ54025.1"
FT                   /translation="MMLKTQLTAFIGAVILAGSSLANPIKPEVCPSVPSIQSEGMSMSS
FT                   EILEGMYITYNLSHYNTSSSWVFIVGPIAAENDDMALAESNKLLSTMSGSPHPEDDGEG
FT                   NWICQYTTKSKDIIAFAIEADDMLSPLKMMRYLRTIR"
FT   gene            complement(31047..31619)
FT                   /locus_tag="LPC_0026"
FT   CDS_pept        complement(31047..31619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54026"
FT                   /db_xref="GOA:A5I9H6"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9H6"
FT                   /protein_id="ABQ54026.1"
FT                   /translation="MKRLISCLTIICALNASAAAETTSNPCSRWISFLKPVCQRIHQTW
FT                   AEGHDDMYFSGYAWHNRYVYSNEKIKSYNETAWGGGLGKSLFDEKGNWHGLYAIAFLDS
FT                   HRHFEPAVGYAYLKTASVNKDLKAGLGYSVLVTSRVDYDNVPIPGALPWAALFYKRITI
FT                   AATYIPGSSREGHENGNVLYMLGKISL"
FT   gene            31779..33170
FT                   /locus_tag="LPC_0027"
FT   CDS_pept        31779..33170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0027"
FT                   /product="Amino acid transporters; PotE"
FT                   /note="COG0531"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54027"
FT                   /protein_id="ABQ54027.1"
FT                   /translation="MDLFRKKDIKGSLDNESHLAKCLSVFDLTFLGVGAIIGAGIFVLT
FT                   GIVAATISGPAVIFSYVVAGFACAFAALSYAELAASIGGCGSAYGYAYAGFGELIAWIV
FT                   GWDLLLEYSIAVSAVSIGWSGYANDFLMALKIFIPANLLHGPADGGDLNILAILIIAVL
FT                   TTLLIVGVKSSSRFNNIMVLVKLLVIFIFIAVAFGEVKVENWSSFMPYGWAGVMKGASI
FT                   IFFAYVGFDAVSTAAEEAINPQRDLPIGIIASLAICTVIYILVSGLLTGIAHYTTLNVS
FT                   SPISHVLLVLGYKTAAGLVGVGAIAGLTTVMLVLFYGLTRVFLAMSRDGLLPRFLSKTN
FT                   EHTKTPIRIILLCGILMASLASVTPIGTLAELVNIGTLFAFIVVCGGVLYLRRTHPDME
FT                   RPFKTPFMPYVPILGIISCFYLILNLPWVTILRFIIWMLVGIAVYFAFSRTNSALSVEG
FT                   DCAAE"
FT   gene            complement(33180..34175)
FT                   /gene="pit"
FT                   /locus_tag="LPC_0028"
FT   CDS_pept        complement(33180..34175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pit"
FT                   /locus_tag="LPC_0028"
FT                   /product="low affinity inorganic phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54028"
FT                   /protein_id="ABQ54028.1"
FT                   /translation="MDYNTIFILFVIFIAFVFDFINGFHDAANSIATIVTTGVLTPRQA
FT                   VLWAAFFNFIAFLIFNLTVAQTIGYGLIDTDLVDTYFILAALMGAIFWNLVTWYYGLPS
FT                   SSSHALIGGLAGAAIAKGGLSSLKIAGFAKVAAGIFISPVLGLLIGLLFTHIFSLFLRH
FT                   KNEEELNTLFKSFQLISSALLSITHGGNDAQKTMGIIAVLLFSASWLDGVFYVPFWVVI
FT                   SCHGVISLGTLAGGWRIVHTMGTKITKLNTLKGCAAETGAAITIFAATEFGVPVSTTHT
FT                   VTGSIAGVGLISGIGGAHWKVLRRIFYSWLLTIPAAALVAAAIMTISPTA"
FT   gene            complement(34192..34833)
FT                   /locus_tag="LPC_0029"
FT   CDS_pept        complement(34192..34833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0029"
FT                   /product="ubiquinone biosynthesis protein COQ7"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54029"
FT                   /db_xref="GOA:A5I9H9"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9H9"
FT                   /protein_id="ABQ54029.1"
FT                   /translation="MRTSSFLDRLIGEVDSALRTLVLPQKRITTRQSPAENLADTVLSA
FT                   QEKKHISGLMRVNHAGEVCAQALYQGQALTARLTHIKEQMASAAAEEVDHLAWCEERLY
FT                   ELGSKPSLLNPIWYCGSVLLGALAGLAGDKISLGFVAETERQVTAHLQRHLHYLPEKDK
FT                   KTIAILKRMQEDEEHHAHTAMEAGAVELPYIIKQLMNAVSKLMTQSSYYI"
FT   gene            35068..37986
FT                   /gene="rre41"
FT                   /locus_tag="LPC_0030"
FT   CDS_pept        35068..37986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rre41"
FT                   /locus_tag="LPC_0030"
FT                   /product="sensory box (GGDEF/EAL domain) regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54030"
FT                   /protein_id="ABQ54030.1"
FT                   /translation="MRKSKKPHPLNHIASGDNFSHLNLLERSLISQLIELSYEENTLHT
FT                   LSLSGLELLGKHPLLKDTITAVWHHDGSHINILASNGLKFDAPKELEKFLAVVSDWHFL
FT                   KIYKTKLKKHSEEKLKQRIDICLDKCQGNLFCISFWFDSIDCNFEILMPFFKDILGILN
FT                   LSLAKLMNKKREKLLTTILEKAGDSVEITNEEAVIQYVNPAFENITLYNAREAINKTVA
FT                   SLLRSPVEDAQLFEEINQTLKSGNTWKGQIRSRKKDGSYWVAQTIIVPVMDDELGRITQ
FT                   HIAIKQDITEQVHRFNQLKISEERYRNLMNAVADGIFIHNLQGAFLEVNEAACLSLNYS
FT                   REELINSYVWDIEVGFSQESLNQLWENVQKGPINTEGMHRRKDGTIFPVDVRLAVFNAT
FT                   GEKLVLAIVRDITLQKRSEATIRKLTRALEQSPVLVIITDKTGTIEYVNAKVIEQTGYR
FT                   KEELVGGNTRILRSGQTPHEIYKTMWEHLANGEEWHGELLNKNKSGEHFWVSAIISPIR
FT                   NENEEITHYLAVMEDVTQKKSYEEMLKHQATFDNLTNLPNRLYAVNKLERAISKSHINN
FT                   QKLAVLFLDLDEFKQINDSLGHAIGDLLLKALSERFLSMIRQTDTIARLGGDEFMMILE
FT                   NIMQDKDAESIAKKCREICSQPFVIESQELLVSTSIGIAIYPDHGKDAKTLMRNADTAM
FT                   YQSKIRGKNNWTVFQKTMIDGANNHIRIKTELHQAFTRNELYICYQPIIDLKENKVVAA
FT                   EALLRWQNTTLGQINPDQIISLAEETGMIIPLGYWILDKVCTQAKEWEFITGSKIKVAV
FT                   NISTLQLKQKDFIHKVQLILKRTKLSADSLIFEVTESAFIDDSKFILSQLNKLSDIGIH
FT                   FSLDDFGVGYSFLQYIKSYPFKNLKIDRVFIQGVNTNHNQLSLINSIITMARNLKLSVI
FT                   AEGIETAEQLELMRSMNCDMVQGWYFSKPLSGDKFLFFLMNK"
FT   gene            complement(38086..38976)
FT                   /locus_tag="LPC_0031"
FT   CDS_pept        complement(38086..38976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54031"
FT                   /protein_id="ABQ54031.1"
FT                   /translation="MKTEALLSWLNVESNESYDSIRIKYQLRLEALEKEERIKKMGGIN
FT                   PFAPKIPLNNTRIITSKEIQEAWAAIDSLSKYQQFKGLVAQEENLSTIPNKKMDSKREE
FT                   TKLIHFVRERAQGPQGRRLPAHLQAKIKRAPLDKPHSKLITEGVEQQINAILDKTTLSA
FT                   SDLQSAVYTAVQNYTNYHMKSENKNNPKYNRGQGDGFFSFFRHGSFGITTANNLYTSIS
FT                   AKNATLDETIEKLKDFLGDSSRAYHHHSFTSYLADALAEKGLLTSHPASRYKQEDVVNQ
FT                   LDQWIAQNSTVNLLK"
FT   gene            complement(39035..40228)
FT                   /locus_tag="LPC_0032"
FT   CDS_pept        complement(39035..40228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0032"
FT                   /product="leucine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54032"
FT                   /protein_id="ABQ54032.1"
FT                   /translation="MVFKSRLVGVILLCFSSITGWCLSQSPEEDRIIVSNCLYEQLKDK
FT                   ARLIAQSDHFSFIAIPIDENITNTLQKMRPVCGNYLNAEPYIQQTSNRFLDSQKLLDKL
FT                   TSYHSISTANPYPINHEAQVHGLLEQIDPAKIWQTNQHLTSYINRSAKSRTGVEAAQWF
FT                   KQQFDTLAQDYGRKDVESYFVKTGNKFIQPSVVTVIGKDKPGEAIVIGAHIDTLDGNMP
FT                   GADDDSSGISVELEMARVLFSSNFELNRPVYFIAYAAEERGLIGSGYVVQDFLQKKIPV
FT                   KAVMQLDQAGYRANAKDQTIWLLKDYVDKGLTEFTAELLTRYVKIPVGYTKCGYACSDH
FT                   VNWTNEGFKTTYPSATTLDDDNPYVHTSNDTLDILNLEHMVNFTKLGLAFIVELGLN"
FT   gene            complement(40290..41315)
FT                   /locus_tag="LPC_0033"
FT   CDS_pept        complement(40290..41315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54033"
FT                   /protein_id="ABQ54033.1"
FT                   /translation="MGWTDRFWNAYRVVTNTVIEGAANSLNAAGSLACLLGGAGVSLSY
FT                   SMSETIKAGYFGSVGVAGTVNLDVTAVEFNYGFNQTIPFRRDLLEKSGGGSYALNDFAN
FT                   PGTIFMISSLAILSGTTLRTFGANLKKWQQNREDKYHFIAKYSTDLEPPSYKEYLYVNA
FT                   ESFFNSLAIASFSSLLAKNVLDFSIKDLSKYHFTYPFNGTNITGSVKTPDYTGPVTSEF
FT                   FPLDFFVSQNTTIHTDYFNLIVNEKVKANAMTNVTYGGGVHLEPSHQSSAPLLAASATI
FT                   GIGTYLAGTFFGKKILRERDERLQRSRSSSYSIVSGTFWDNKHDIEAKGDTKFEHTHSL
FT                   Q"
FT   gene            41681..42340
FT                   /locus_tag="LPC_0034"
FT   CDS_pept        41681..42340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54034"
FT                   /protein_id="ABQ54034.1"
FT                   /translation="MLILMMEYTLVCKNKQYHLAKECVLHSKIYNLYHSSTELGDLKAA
FT                   VVKSSRSSKGNTLYYVDLLTSQGPVNLTGSSSSGRDDKEIAANSINNYISNSLETTFKV
FT                   SYPASWWMYGLSVFFLLVGALLLTVRGAITDFDRILKTIVIKRKGLFKTEETKLSFSDV
FT                   DKIIVEESLGSRGTKTYRLAIALKDKPPIPLVTTYDSSFAKKEKIANQLNQFIHES"
FT   gene            complement(42324..42428)
FT                   /locus_tag="LPC_0035"
FT   CDS_pept        complement(42324..42428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54035"
FT                   /protein_id="ABQ54035.1"
FT                   /translation="MTELKIFFNKEIGVFRKSCKPVYNFFGTAISSHG"
FT   gene            42586..42942
FT                   /locus_tag="LPC_0036"
FT   CDS_pept        42586..42942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54036"
FT                   /protein_id="ABQ54036.1"
FT                   /translation="MSKFFTLLICISIGLLSFPTYAQKTIRLSPNETKTLKNSTLWTLN
FT                   ATCNVQSSTQVNGKIKIIVLKNNGKVNGKSLSTGQGTSITIKNNSSISVSAESGTQINL
FT                   INLGNQELQAVCST"
FT   gene            complement(43005..43727)
FT                   /locus_tag="LPC_0037"
FT   CDS_pept        complement(43005..43727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54037"
FT                   /protein_id="ABQ54037.1"
FT                   /translation="MNYQYSPSLKKKLLLAFTTLFIVQMFYFAPVRASTRDTQLWTLMN
FT                   AIGPINKQHRKIRYWLEIQDRIGENISQLSQLILRPGIGYELLPTTTIWLGYDRIYTAQ
FT                   PFANPPVNENRVWQQLLWSKEYTRLRLTARSRLEERFIQRAIHTAWRYRQLFKTSIFIP
FT                   KHPKYAAVISDEAFFHLNDFNLQRNQGFDQNRLFVGLGYRTSKNSTIEIGYLNQMIKRV
FT                   NNPDYRGDYLSMALLLTE"
FT   gene            complement(43941..44684)
FT                   /gene="artJ"
FT                   /locus_tag="LPC_0038"
FT   CDS_pept        complement(43941..44684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="artJ"
FT                   /locus_tag="LPC_0038"
FT                   /product="arginine 3rd transport system periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54038"
FT                   /protein_id="ABQ54038.1"
FT                   /translation="MVRLRIYLCSLLLVIPFYSGYALNLVIGTLSYNPPFEIQVNNPSK
FT                   ENEFYGFEIELMNEICKRINAKCQYKPLLFEQILAEINSGAINLGIGSINITPERSERF
FT                   LFSLPYKSSYHQFLIPSNSNIKKIDDLKGKTIGIHLGSPTIDYLKVYFNNNIQFKYYET
FT                   FMDLLNGLTDPQVSAIVTNSDQAQYWASSTPDCKLLGDGFPFGIGFGVVARLDQAELIE
FT                   KINQALIEIENDGTYLKIYNLFFQP"
FT   gene            complement(44846..46363)
FT                   /locus_tag="LPC_0039"
FT   CDS_pept        complement(44846..46363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54039"
FT                   /protein_id="ABQ54039.1"
FT                   /translation="MAATIPHIEAITFTDWFLAIIDTPGIPIDEIETRAAEGFKRKLTE
FT                   RQFQQLTELIHLISFIKHRRFSNPTLALRIYVDENTNSLSRTALVEAVRMLPPEDNKTY
FT                   ELVACLAQKNKLERYTSITKVPPLQIYQGDGVFEQYDEWILLFELFELTQATPSDVIPA
FT                   IAHLLIIKNFGIPDLRALSKFMNTTHKLGILSQNFMNNMIPHLCNGQIIEKYESFLLKL
FT                   QINDLLSEEILDVIYPLLNQPDALDTFFSLYHEELSHDSALSFLREILPPFCAMSLPCK
FT                   ESYDDQVPTNTPLHLAVIESNKANLERTLTFANRNLLKKCSYENTALLLACKLADKEAA
FT                   RLILAKMQELGCDVNQRDHHGMTALHWANFYHFDELIRELEIAGADPQLKAANGKTCEY
FT                   FYQHQFTLKDLKLNGKEIIDGEFKLSDCALTDIAFHMDKVALNLKLTTPSEIAELYARD
FT                   EVAQIRSSNRFYLFFKLFRPKLINWLEQQNDLEPQVTYRFSGQSSSA"
FT   gene            46626..47108
FT                   /locus_tag="LPC_0040"
FT   CDS_pept        46626..47108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54040"
FT                   /protein_id="ABQ54040.1"
FT                   /translation="MKFRFRFYLGIILLILAIVCPLLIPLIVQSNFSVLMKGFLSSILV
FT                   FGLPEVLIVLAIALLGKEVYGLIEQKIKNILFKEKVSRARYRLGLVFFAFPLVIGLLEV
FT                   FVKEITLAYGSYYYWVEIIWTTMFALSFFICGKQFWDKFKSLFIYDSYVVFEKNKK"
FT   gene            complement(47130..48125)
FT                   /locus_tag="LPC_0041"
FT   CDS_pept        complement(47130..48125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0041"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54041"
FT                   /protein_id="ABQ54041.1"
FT                   /translation="MDPITHGVLGAACAQAAFGKFDKRIPWQAGALAGMAPDLDVFIRF
FT                   SQEPLSLEQWHRYLTHSLMFIPIGGLVVALFLLCFSQYRQYWKVTIGASLVGYATHCLL
FT                   DSLTSYGTVLFWPWSDSRISWDIISIIDPVFTLPLLLGTAWSVIYQNQKAVTASLFFCI
FT                   LFLIFNTILHNRAVDGIHQYATSNNFKINHPRALPKLASSTDWRIIAKQQDCLIIAEAK
FT                   TSLFYPTTIRLIRKALSFNESMIPFALSSGQKSDLATFHWFTDGFLIVANKNPLILADA
FT                   RYTIDDSPIFSLWGIEILPGQEHINKLSLPKINEYCKSPDSESYNENGLN"
FT   gene            48359..50545
FT                   /locus_tag="LPC_0042"
FT   CDS_pept        48359..50545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54042"
FT                   /protein_id="ABQ54042.1"
FT                   /translation="MLFCSFALAQEKVVTHFFKEVNSSIAISEGKANIQASQYRVVDID
FT                   INQLYAELENAPHRDGISTGISLQFELPQPDGTVKRYQVMENSTLAPELSTKFPEIKTY
FT                   DAYGIDNPGELVKFDLTPQGFHAMILSPGRDTVFIDPLIKGNTQYYMIYYKKDFITSKK
FT                   MKCGVKSQNQPLINAASKRGFTDFNPCVLKKYRLALAATAQYTQFHGGTVPQALAAETT
FT                   TVNRVNGIYEIDMAITMQIIANNNLIIYTDPNNQPYTSGDPDKMINENQANIDQMIGSA
FT                   NYDIGHVVDAAGSGLAQTPSVCINGEKAMGVTGQSNPVGDPFDVGYVAHEIGHQFGANH
FT                   VQNNNCQRNNPTAVEPGSGSTIMSYAGICDPNVQDDSDPYFNGISLQEMGNFVSDAAHT
FT                   CPVKTSIPSAPVIQGTNGGVKIPAQTPFALTATATKSGGNEVLTFAWEQQNNEASQQPP
FT                   VSTSRVGPNFRSFSPQVSGTRFFPNLNALANNGPFTWEVLPSVSRTLKFRVTVRRNTPG
FT                   GSCNAYTDTTLSVESKAGPFVVTNPTESGITWTGISPRTVTWDVANTNIPPINARFVNI
FT                   LLSIDGGQTFPFTLLSNVDNTGSEVICVPNLNSSTARIMVQASNGTFFNVSKNNLTIIP
FT                   VPPRPPELTRADRNPMNTSEAFVLYANCIPTGNDVYTVNGLPPGATVRFDANNRRFVIE
FT                   NINTPKRVRNVTITATDENGVNRTSNAITIPSIL"
FT   gene            50558..51259
FT                   /locus_tag="LPC_0043"
FT   CDS_pept        50558..51259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54043"
FT                   /protein_id="ABQ54043.1"
FT                   /translation="MNRYSIFFLVFCAFSLESHAGLYSGINLGINAVKINKDLVYPLED
FT                   PVPTTSSFNSAYTDFHGQLIAGYDFSLTSKISAAVEANIDLFTGKARHRITEWYFDEDV
FT                   YAEEQLKVGYSLFLLPTYHLNDMVQLFVGPGVSSSRFNIAFSNTAGNVGVSDSLNEWLT
FT                   GVSIKAGSITKLTRNIDLLLTYQFTQYNSVTGVQMEPLSEDTLRGSYKPNVNTVLIGFK
FT                   VHPSDEITKDT"
FT   gene            complement(51328..51519)
FT                   /locus_tag="LPC_0044"
FT   CDS_pept        complement(51328..51519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54044"
FT                   /protein_id="ABQ54044.1"
FT                   /translation="MECKCNQCGMGVKNLTCSKCDALLVSGTIVKNDGNKVQVAKCPNG
FT                   CGQIKSPVCCGHDMACSV"
FT   gene            complement(51574..52434)
FT                   /locus_tag="LPC_0045"
FT   CDS_pept        complement(51574..52434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0045"
FT                   /product="Protein of unknown function UPF0187"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54045"
FT                   /protein_id="ABQ54045.1"
FT                   /translation="MISYLFSEVHFTHALKKVLGISVLVGVYSAIIYFWFEQDNLHSSN
FT                   WLSYSQSVFGIILGLLLVFRSNRAYERWWEARTLWGQLVNASRNLAIKIRVLLSPNTDE
FT                   AKKFSELINTFCEVLAIHLRQKSTRDDFKKFLKMVSLPSHVPSYVAQELYCELSEKTKA
FT                   SKRLNLWLLDNEFSKFMDICGGCERIKNTFISLSFRVFVKHVFIIFILFLPCSLIDTLG
FT                   VWAIPATIIITYLIIAIEGIARNLEEPFGLTEDHLNLGAITESIRESVNEVLLGQKSNE
FT                   ESNSI"
FT   gene            complement(52611..52847)
FT                   /locus_tag="LPC_0046"
FT   CDS_pept        complement(52611..52847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54046"
FT                   /protein_id="ABQ54046.1"
FT                   /translation="MKRVHHHPATHSHPSNATVQVSNGQQTVVVNPNPPYFPGQPPMYH
FT                   PNSFFTTHHHSPYYASQNQHYHQQPAPNTHQHP"
FT   gene            complement(53050..53262)
FT                   /locus_tag="LPC_0047"
FT   CDS_pept        complement(53050..53262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54047"
FT                   /protein_id="ABQ54047.1"
FT                   /translation="MKSTNNIQKKETDKPTSEQAQKKEVRTNNAPDFIPGASPYYNLYC
FT                   FFYKLCHGEDTSRQHQPATSFQHGK"
FT   gene            53472..53870
FT                   /locus_tag="LPC_0048"
FT   CDS_pept        53472..53870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54048"
FT                   /protein_id="ABQ54048.1"
FT                   /translation="MNCFPFFAKKNKKNNEEKAEKTLSVFPAGTSINKTTVKEICFTDI
FT                   FCDTHPFVWYYYPEHNLAIWTSRLAGTTQEYPVDYLLNQLAKIPGITIDQGDAAIKDVS
FT                   TFLQDHQMIPIRNSESWRYIKSSSFSMS"
FT   gene            53905..54039
FT                   /locus_tag="LPC_0049"
FT   CDS_pept        53905..54039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54049"
FT                   /protein_id="ABQ54049.1"
FT                   /translation="MEDFAGSVSQVMRKGYSNDFSHLIDCIEPTHNETLESYDHNNIQ"
FT   gene            54069..54731
FT                   /locus_tag="LPC_0050"
FT   CDS_pept        54069..54731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0050"
FT                   /product="chloramphenicol acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54050"
FT                   /protein_id="ABQ54050.1"
FT                   /translation="MKPTDKKHWSKIEYLHQSIKNPNIHIKGKHSYYSDAWTGSFEETV
FT                   VRYLYGDEYSLKTWQPQWQIDQLYIGDYVCIAAEVIILLGGNHNHRADWFCLYPFADKY
FT                   VEAYQGKGDTIIKDGVWLGMRAVIMPGVTIGEGAIVAASSIVTKDVEPYSIVAGNPAKP
FT                   VKKRFAENVIERILALDIYSWSEAKFNLLKDYICSNNIDKLEQASRSYDQNHTIESK"
FT   gene            54728..55606
FT                   /locus_tag="LPC_0051"
FT   CDS_pept        54728..55606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0051"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54051"
FT                   /protein_id="ABQ54051.1"
FT                   /translation="MINIRKLRLSDESTLETFLKSHADESMFLRSNLYHSGLSYHDKPF
FT                   HGDYFAAFDNTKKISGVLAHYWNGNVIVQCPDFNVLTALVGAFQKTATREIAGILGEDQ
FT                   QADVVMKQLQLEHVDYAVNYPDGLYALNLQNLAMPDNQDRYQLKVAKDCDKCLLYEWLR
FT                   AYQIEALGAEEGSSILKEQVESEVKNTLEGNDRWVLEENGIPVSLCGFNARLPDIVQIG
FT                   PVWTPVTLRGRGYARTVVALSLSAAQKSGVSRAVLFTNNQAAVRAYQAIGFNKVGNYRL
FT                   AILKKPILLTR"
FT   gene            55659..56954
FT                   /locus_tag="LPC_0052"
FT   CDS_pept        55659..56954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0052"
FT                   /product="amino acid transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54052"
FT                   /protein_id="ABQ54052.1"
FT                   /translation="MDMDIKHKPLKRELSLFGATMMGLGSIVGTGVFVSIGIAAGVTGP
FT                   SVILAIALAALVATCNAFSSAQLAANHAVSGGTYEYGYRYLHPAFGFTAGWMFLCAKSA
FT                   SAATAALGFAGYFIHLSGLETVPVIPIALAVSITLILLVLSGLRRTNTVNIIIVMITLI
FT                   TLTVFIISGLPDFMQRGTANLRPFFPVSKQEGLSHFFYATALMFVAYTGYGRIATLAEE
FT                   VKNPGKFIPAAIIITLMVSAVLYILVGLVAIGAVGVEKLAQVTETNATPLESAAQAIGI
FT                   PGLSILVSIGACTAMLGVLLNLILGLSRVALAMGRKGDLPKMFCYVSETRHVPVSAVIG
FT                   VGVVIIALVLTGSVETTWTFSAFTVLIYYAITNLAALRLPKEEQLYPPLFAIGGLLSCL
FT                   FLAFWVPIGVWITGISLLVLGLLWKVVAHRFL"
FT   gene            57022..57132
FT                   /locus_tag="LPC_0053"
FT   CDS_pept        57022..57132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54053"
FT                   /protein_id="ABQ54053.1"
FT                   /translation="MRLGLILQLLSLAFIDNCFDGGFFVPLKGKLRGYQT"
FT   gene            complement(57171..57323)
FT                   /locus_tag="LPC_0054"
FT   CDS_pept        complement(57171..57323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54054"
FT                   /protein_id="ABQ54054.1"
FT                   /translation="MFNLKRNLIKLGTLSISIALLAACHTVKGTVTGAKQDIKATGKAI
FT                   SRTMQ"
FT   gene            complement(57598..58080)
FT                   /locus_tag="LPC_0055"
FT   CDS_pept        complement(57598..58080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54055"
FT                   /protein_id="ABQ54055.1"
FT                   /translation="MWLDYLHKINSDPNLLYLFIRTFIIYVFAIFIIRVGNTRYNFETA
FT                   FDYIFVFVIGAVLSRAINGNSTLISAMAGSSLLIFLHWVFAICSFYSHGFGKLVKGKSV
FT                   LLIQDGQLIWSALKRHQVTEEDLRQVFREKLNASDLTTVKEARLERTGRISFITYK"
FT   gene            complement(58111..58215)
FT                   /locus_tag="LPC_0056"
FT   CDS_pept        complement(58111..58215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54056"
FT                   /protein_id="ABQ54056.1"
FT                   /translation="MFINNRLTLYPDRHSKAIYLKFDKVIAKEKQFYL"
FT   gene            complement(58293..59186)
FT                   /locus_tag="LPC_0057"
FT   CDS_pept        complement(58293..59186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0057"
FT                   /product="carboxyphosphoenolpyruvate phosphonomutase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54057"
FT                   /protein_id="ABQ54057.1"
FT                   /translation="MSNFRYSQGKKLREALMKEKPLQVVGTINAYAALQAKRAGFHAIY
FT                   LSGAGVANASYGLPDLGITTLNDVLEDVRRIMSAVDLPLLVDIDTGWGGAFSIARTIKE
FT                   MIKAGAAAVHIEDQVQAKRCGHRPGKALVEKEEMIDRIKAAVDAKTDPDFVIMARTDAL
FT                   ANEGLNKALERISAYIEAGADMIFFEGVRKLEEYQALTEQCNVPVLANITEFGVTPLFT
FT                   LEELKEAGVSLALYPLSAFRAMSAAAEKVYDTIRKNGSQKDILAEMQTREELYQVLNYH
FT                   FYEDKLNELFMKEKTT"
FT   gene            complement(59300..59494)
FT                   /locus_tag="LPC_0058"
FT   CDS_pept        complement(59300..59494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54058"
FT                   /protein_id="ABQ54058.1"
FT                   /translation="MIFAISRYDIRQTSLSLVHDLYAFQALDVVLLCISRSLKKYPKER
FT                   KNQINQTYEKPQDQSKKCF"
FT   gene            complement(59495..60229)
FT                   /locus_tag="LPC_0059"
FT   CDS_pept        complement(59495..60229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0059"
FT                   /product="transferase enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54059"
FT                   /protein_id="ABQ54059.1"
FT                   /translation="MLNKLMWLTGKAQEDWIEKILHLRQKIWPDYQRIKNDTLFKLYSH
FT                   YPLYQWLSHYNGEVVAVINSLPVALAQSLDNLPQEGLNWVLSHLASTIPLTPSNYLAAV
FT                   SVTVNPAYQRLGLSKLLLNRLKASAQEAQYKALIVPARPSQKENYPLISLEDYLKWKRV
FT                   DNTIFDPWLRVHAQLGGKIAYPCQQSRVITANIAQWEQWFGHPLLQTGQYLVKGGLNPV
FT                   TINKEKDIGIYIEPNVWVIHDL"
FT   gene            complement(60219..60923)
FT                   /locus_tag="LPC_0060"
FT   CDS_pept        complement(60219..60923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54060"
FT                   /protein_id="ABQ54060.1"
FT                   /translation="MIREYMDKRNNQFTTEILNYFSDLKKFSTSYLGWLTMEHYQFSLN
FT                   NTRFLMNSHIQTKSLSDPGVSEELLANYNEEKNHAQMYRHALKKIGLDVTNRIPYVATR
FT                   QFFMRLEALIEVNASKTLGVMYATETAAIFEHILFKEISAELCQRKRLDFENSRIKQFH
FT                   DLHLDGVEQAHKDELGKFMDHTLAQEHVDPNIFLQEKEIIDGAYAAIDIMEDWWSGLIN
FT                   AKAHLLEQAHAQ"
FT   gene            61029..61937
FT                   /locus_tag="LPC_0061"
FT   CDS_pept        61029..61937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0061"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54061"
FT                   /protein_id="ABQ54061.1"
FT                   /translation="MINFSQIQVFIAIVESGGFIAAGEKMHRSQPAITNAIKKLESSLG
FT                   FELFDRKVYRPQLTAKGKAFYQKAREVAAQFMQLENSAETLRSGVETQFSIDLDIALPL
FT                   PGYAPLIQSFIRQYPETCFSLSNNTFVRCLERLERRECHLCIAASHIRSPQIEYLRMPS
FT                   IRMIPVASRDYYDQHKERINNPKLGIYCMQIMIAGTQQELYQLKIEPLSNSMPKWFVGD
FT                   MYIRKQLILSGMGIGRLPDHLVEKELAEGSLVQLNTRDYVAVTMDIYAMRLNNQEHGIV
FT                   SNYAWQSLKSYADDTVSPELK"
FT   gene            62082..62819
FT                   /locus_tag="LPC_0062"
FT   CDS_pept        62082..62819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54062"
FT                   /protein_id="ABQ54062.1"
FT                   /translation="MIDFKINSQPNDESCGPTCLHAIYQHYGLDISYEEVASQVESFLS
FT                   GGTIAPMLGKHALQLGFKVTLYVNNLHLYDPTWFNSDGSSNTDVLREMLMQQMRYKRNQ
FT                   YLARGTHAILDFLTLGGAIYFRCLTAEILKEYFARKIPILTGLSSTYLYNCSREIFNKE
FT                   GKSRSDPIRGLPCGHFVVLCGYNQKHRLVVVADPYKKNPVSGDNYYTVSIHRLINAIML
FT                   GVVTRDGNLLIIEPKYAQASSKF"
FT   gene            62956..63954
FT                   /locus_tag="LPC_0063"
FT   CDS_pept        62956..63954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54063"
FT                   /protein_id="ABQ54063.1"
FT                   /translation="MSVIIDSLKNSDVPHLYLLKVGLTKKEYNNTSRMSRDEKRQLVNN
FT                   IIAKAYHEEILKIINDLMDIELSIESTDPIRTGNRLIGQLLLGYITKIDQQNFMSFYDQ
FT                   TIKNGNKTLGDYLIPEQVKQIWATIKQTAAKYFSLNQRGADYQAFLNKGFRILPIFYYQ
FT                   QQFPEITPEQYRQGIRPVELTREPEEIKNAFHNNLSANVTIPAFPEANYLKTRLAEIKT
FT                   HIMASEWKLANYSFYSDGVMHGDKRLPHRVKDILDVIEKFESSKLNAKAAYEQIVVKAK
FT                   EALDYPRSGRFSETTDFYQDIYSHHILRDDYQFNHSRELTNSHGPSFNLNR"
FT   gene            64230..64505
FT                   /locus_tag="LPC_0064"
FT   CDS_pept        64230..64505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54064"
FT                   /protein_id="ABQ54064.1"
FT                   /translation="MGMLTQLKNGFIPVFIVMSSLGYWMGIGEMGSELVVKVTPGHGFR
FT                   PPPRLLKSCSTIFKIFNQIIITAMLSFEPALSNQYQVQCMRSYINR"
FT   gene            64639..65886
FT                   /locus_tag="LPC_0065"
FT   CDS_pept        64639..65886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0065"
FT                   /product="SdbB protein (putative substrate of the Dot/Icm
FT                   system)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54065"
FT                   /protein_id="ABQ54065.1"
FT                   /translation="MTRSKESKTENSSFFQNHLKLSVAKLLFSEGVGDWYKKKGYGAQD
FT                   TDKDFLAPFADFLKQQKTNPEATYYNAFQNLKLTLNRVPSQLVSRDSCELEVLTCEPEA
FT                   DSPQKTGTGKHIVYFPGANTYYQACFRDISAAAKETGATVHALNYPGIGMSTGEVVEAN
FT                   DLTNAGIAVVLSLLNQGVKPDDIVLQGDCFGASVALEVKNEIEKQADIKVRLIMNNAFK
FT                   SFKAAVSDLIDRSPLIPSVSKSIVKNLLEFTGWNVAPGQKYIHSDPYQCYIQHEGDQTL
FT                   TTATLSSKVAKYKEEIRTGRTTSRSRDPVIDKCPEEYKPFRDFLDENCFVRVRDSAKER
FT                   LAAKFGVDSCGEVNAHFADLCELEMLGGQSVYEGFVNNYLVMSDKYIKAHPQKDYDPDK
FT                   INFLSSNPMGYTPKSS"
FT   gene            complement(66192..66596)
FT                   /locus_tag="LPC_0066"
FT   CDS_pept        complement(66192..66596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0066"
FT                   /product="putative regulator, MerR family transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54066"
FT                   /protein_id="ABQ54066.1"
FT                   /translation="MNNKKIGEFAKLCGVGIETVRYYQRQGLLHVPLLNKELGAEKIRR
FT                   YGDDDINRLRFILLAKKAGFTLKEIKELLEFDANNDRERVRDMAERRIEKLNLKINELT
FT                   EARNRLSLLVTKCIETSSSPCPILMTFEKS"
FT   gene            66666..67409
FT                   /locus_tag="LPC_0067"
FT   CDS_pept        66666..67409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54067"
FT                   /protein_id="ABQ54067.1"
FT                   /translation="MNHTSIKKAVLYRMVIEHHVCPYGLKARDLLRRQGYEVEDNWLTT
FT                   REQVDAFKDKHNVKTTPQIFINDERIGGYDDLRHYLGKKVRDPKEKSYRPVIVLFAITA
FT                   LMAMAVSYASFANPFTPHVLSWFIAFSMAVLALLKLQNIESFSTMFLNYDLLAKRWVPY
FT                   SYIYPFAEGLAGILMIAGALNWLSIPIALFIGTVGALSVFKAVYIDKRELKCACVGGDS
FT                   NVPLGFISLTENLMMIGMALFMLLM"
FT   gene            67713..68699
FT                   /locus_tag="LPC_0068"
FT   CDS_pept        67713..68699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54068"
FT                   /protein_id="ABQ54068.1"
FT                   /translation="MTRIIVLTESAGIALGILGVLFSVIGFVSSTIARIFDPTASKLSR
FT                   VMSAGILIAAAAGAIPLIYLGTLFPAMWVYLGIGIMGFGVLNSSYYLYSDVRKENALIN
FT                   QYKDNPEQYVESIKEKRQAKYEKLLNTRLDDKQARVLLVFKLYQLDKKLAVAKQEGLAR
FT                   LYDIVCHRKHTRSLERFIDLGTSLTSLIVGVSVLFWGIAAWPIGPILLGISLAVFSVSL
FT                   SKSAIQFYRKVNKNNALLKEVLSNDRYISLLDANLDNPYDIEEMGTMEKTQEKVCTHEL
FT                   SQEPALSKDQEHKEHYTKLFQPVNKTALRPNDEETDELSCKSVLLQR"
FT   gene            complement(68705..69013)
FT                   /locus_tag="LPC_0069"
FT   CDS_pept        complement(68705..69013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54069"
FT                   /protein_id="ABQ54069.1"
FT                   /translation="MGEVRMDLYLKTQRWLYHRGNREVKKRILDEFCKTHGYHRKAAAR
FT                   LLRQLPIPDKKTKKQVKRKLMTRTYYWSCLKRFGLPGIRFVAHCGVNSKGSGTLIGL"
FT   gene            69153..69647
FT                   /locus_tag="LPC_0070"
FT   CDS_pept        69153..69647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54070"
FT                   /protein_id="ABQ54070.1"
FT                   /translation="MKAFNVPKSMETLFSKAQAYVQDYFQNLKIDPSKGTIDINGERYI
FT                   LVRAASMSIEFFETVKKLYENDASKSEEVVFQLLFDISHSIGKQDAKKFHKQLSLKDPI
FT                   EKLSAGPPHFAFSGWAFVDILPESKPTPDENFYLVYNHSYSFESSAWLKANKKINFLFA
FT                   S"
FT   gene            69739..69900
FT                   /locus_tag="LPC_0071"
FT   CDS_pept        69739..69900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54071"
FT                   /protein_id="ABQ54071.1"
FT                   /translation="MSADPHHFKYMHNMHEWCSKSVEPYFNFLQNIPINQFPWLISKLK
FT                   KKESSECK"
FT   gene            69902..71443
FT                   /locus_tag="LPC_0072"
FT   CDS_pept        69902..71443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0072"
FT                   /product="hypothetical signaling protein"
FT                   /note="similar to sll1895"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54072"
FT                   /protein_id="ABQ54072.1"
FT                   /translation="MNKLPKWALAEKKEFKREKIQSLLIVPMEKENSLVGFMGFDIVTH
FT                   KKQWLAEDIFMLSTVADIVIQSILKSYTIIEHESIVRYFDPLTRLPNKELFVNYLQAVL
FT                   SNIEQQENCFSFLILLNIDEFHIINDAYGTPFGDQLLFIIAEKLLHILPYKAKLCRLEA
FT                   DRFLILLQGNKAEILKIADEILSMFNHVFKLNNHQVYLQARIGVTKIDNHSDNPEKLIQ
FT                   RASLAMRKARLDNIKIAIFESNTEKSVNLKLNIQAELYQAITENQLVLHYQPQFCAKTK
FT                   QIVALEALLRWMHPKKGLLYPSEFLDVLLCSDLLLPAGEWVLKTVCAQNVAWIKQGLRP
FT                   VSIAVNISEPQFRQPNFVPMLKKILTKTHMDPCLLKLEVTEQVMIDHLDETARKLHEIE
FT                   AHNIQIILDDFGTGYASLSYLHQLPISKLKIDKSFIKNMLTNKNAAMITKTIILLAKGL
FT                   GIKSLAEGVETKEQFDILKQLGCDEIQGYYFSEPLPVEKIALFLQDGSTPNKGAF"
FT   gene            71496..71957
FT                   /locus_tag="LPC_0073"
FT   CDS_pept        71496..71957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54073"
FT                   /protein_id="ABQ54073.1"
FT                   /translation="MPQKDCILNLPGYSIKKVGGENPVKRLSQTRAWYRVERRQSFIKA
FT                   HERSVENALIIHVRDFLIELGQGFAFVGSQVLLTFDDQLRKPGNNQTIGILLCKSKNKV
FT                   MAEYALRNISAPIGVSEYTLSKSIPTDLKGSLLTIEEIEAELNESVKED"
FT   gene            72300..72482
FT                   /locus_tag="LPC_0074"
FT   CDS_pept        72300..72482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54074"
FT                   /protein_id="ABQ54074.1"
FT                   /translation="MSILIKFESLAKQAIFSSNKDIILQSIGLLDTIKAKNNQKIRMTL
FT                   SNSSEQFADMSRVVR"
FT   gene            72590..73261
FT                   /locus_tag="LPC_0075"
FT   CDS_pept        72590..73261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0075"
FT                   /product="methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54075"
FT                   /protein_id="ABQ54075.1"
FT                   /translation="MYLVNEPITKQWIERYSKLSESLDPIYFAENDRQISYDKIRDKIL
FT                   TELETHNFITVVLYGHPTVFADPGLQSIIIAQKKSIETIVLPGISVENCLYADLKIDPG
FT                   QFGCFHVEATELLLYDKIIDPTVHLCIWQPGMIGNRSVPKPNQKSNHLELLRIKLKKYY
FT                   PDDHISILYEASMYPGVEPIIHKFPLYDIEDQNIGTLSTLYIPPLPQRKPNLDILKQIT
FT                   S"
FT   gene            73291..74469
FT                   /locus_tag="LPC_0076"
FT   CDS_pept        73291..74469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0076"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54076"
FT                   /protein_id="ABQ54076.1"
FT                   /translation="MLSVLSYRLSLLPKLSKTCYLLLLFSFLECVAGGIAYYLSLYLGT
FT                   STPLTKLQIGQVGSIVGFGALAGALCSTYITDKLNNKNIIIASFLFLGLGFFCLPQSMS
FT                   VLLISGCVFIIGFATSIFLTTNNTLLLQNAPQDQNSLRFIQSMKIVSENLGNSFSILLI
FT                   MFFAAQYYGQIFETIGLFFFLFALNTMKYLNVKQNSLEDSSYEEKETNQQGNNKRLYVT
FT                   ISAVFIVGIIYSQQRIAYPLFLHETFSSFTITAILFWLDPIIVSLFQIKITKIVSPLKI
FT                   SYQLAMGGLLLGTGLFALLIVDSIGGAIMACLTFILGEMLFMPTSFVRCYESAGNKRKG
FT                   MVAGAWRSAYSSGLIVGPFLSGFLMEYYSYNACWILAGILGFFLFILFSVKK"
FT   gene            complement(74470..75741)
FT                   /locus_tag="LPC_0077"
FT   CDS_pept        complement(74470..75741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54077"
FT                   /protein_id="ABQ54077.1"
FT                   /translation="MKTINPVFFELVDKLSPDNKFAMYLVDYGYGDLVGDDDGIFLPTK
FT                   TGQYVRLDSEYTPPSMLNDLAYGLSNSPLGMFFNKSFEWFLNTSDEQINRTFPIYIDPP
FT                   GTFFSIGHIINYGYTATHLPNGVLFVTAGSKSNFMIPKIGCGIMHSRIQKNHNITKSAP
FT                   RSYHEHADIFQDIVKGNRDNNGWSASVLYFSENWIEKISKDSAWQEVRDYFYRISNHRS
FT                   EYAVNSDYYNHVYRVTNKRNNLKSNLLIYETARHLFEILLGAKLGFAPAMDDELLPLSI
FT                   IQEVYSECYKLEYLPIIAIPAYYNYRDPKPVYYSLQYPSLCSYSPKARNASTTLSDLIA
FT                   LIDVVHKYQKDFTLPIRECKNTILEEVSKITSFNFYHPATEENSIIKSPEIIPYQDERF
FT                   RGEKRFPINASFFKGCVSIFSNSI"
FT   gene            75983..77173
FT                   /gene="aroH"
FT                   /locus_tag="LPC_0078"
FT   CDS_pept        75983..77173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /locus_tag="LPC_0078"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54078"
FT                   /protein_id="ABQ54078.1"
FT                   /translation="MFKSVQQRTIQNGQVIPFYHSTNELAHIQNILQSQTPLVSLKEIN
FT                   KFRQLIARASAGEYFLIQSGDCADNFYECDKDTTHAKLDFIRHLATFFHQKTGCSVIQV
FT                   GRIAGQYAKPRSNQYEICQNKRIYSYFGDMINQSQETQRRPDPWRILLSYNCSASIYRK
FT                   INQWNRGINPEQKIYTSQEAFLFNYEQSLIRWDERTGLYYNLSTHFPWLGKRIVSSLQH
FT                   INHLKKIANPIAVKIGPDTPIKSLVKTINELDPSYIPGRITLIPELGAQNVYHILPQLI
FT                   DAVKRTDRTVLWSCDPMHGNTETLSSGIKIRKLSNIVDEIKNSFFIHRKMGSQLNAIHL
FT                   EATHQNVTECMDYNSSRCESISDLKKNYKSLLDPRLNYAQTMHVIQCVAKHYVNSY"
FT   gene            77278..78204
FT                   /locus_tag="LPC_0079"
FT   CDS_pept        77278..78204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54079"
FT                   /protein_id="ABQ54079.1"
FT                   /translation="MNSLKNEYYIRAPKEKDFQNYNGKELKKIHLFMNKIYHQILFGDK
FT                   PIDNKVFHEFKKYESSWMANEKNYFLTKYDCNVIVKDESLVRDVLQKHEVFNHPIFDYL
FT                   MHDASIEDLKKFAYSESIMNLEFFDYLALAVIGVSDQAKVEIMANLWDEAGQGCAEKFH
FT                   TVLFQNFLNDLGITYDRKQILEGLSWEGVAGINLFNYFSIYPFNKTKYFGMLAATEMLD
FT                   PPHYNKLIKGIMRIFSSHNIDYSYYTEHELVDAHHASGWLNHVVIPELARKPYKTQDFW
FT                   LGFYMRLDSTKKYYDQLLNSLIMKKAA"
FT   gene            78222..79031
FT                   /locus_tag="LPC_0080"
FT   CDS_pept        78222..79031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54080"
FT                   /protein_id="ABQ54080.1"
FT                   /translation="MLVSNEKVIAEEWEKYAGYTVRPLPSTCAYYKDLIQSNSNKDSFL
FT                   IYGGTPEIRSLFQESNLKVTLTDQSELIVRAMGYLTMGAAPIAANEELVVTNWLNLEGI
FT                   ANDSCDFLIGDDAINMVEWTQFDLFLSNANRVLKSNGLFICHLLVKPQECFITNTIDDV
FT                   RREYKEGVIRTKYDLASRLNFICYDTNSYAMGWQNTIEQLGINQLDQFKPSFDFVGTFG
FT                   RCNSKFYCPPQDAFERLLTNYFHIEEVFYPHEYEYCQFEPVYVLRKK"
FT   gene            79048..80352
FT                   /locus_tag="LPC_0081"
FT   CDS_pept        79048..80352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0081"
FT                   /product="phosphoribosylglycinamide synthetase ATP-grasp
FT                   (A) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54081"
FT                   /protein_id="ABQ54081.1"
FT                   /translation="MSIHLINYTTQPEFIKLIVQEYKNFDLTKKTILFIEPYGAVLSLL
FT                   KRGLEKKYNIIVLTANSDFRVVPEEFLNQAALNINIDTANNNSVLELAGTLQQHMSIDA
FT                   AIPGFEYFVPIASRVSALLKVPGIDCKHVLNLRRKDLMRTALNKAGLNSPRYYLVTSLD
FT                   DINEAVDYIGFPAICKPIDAAGSVHVKKVKNKKELLEAANRILNGNDVLWGHKLSSSLL
FT                   LEEYIDGKEYSLEGTVQDGVIAHFSTTEKFVSDQSEFIEIGHIVNAPIEQQLHTKIQNY
FT                   IDQVIKILGADNCPFHAEVRLRRDGEPVLMEIAARLAGDKIGDLLCLSRGINYFDYVYA
FT                   AYLGIKMPLVEMKNNYAGIRFFYRPHTDMFAIVTGMDAAKMQAIEDIAIYYNAHVAIPE
FT                   FPKPLRRLGHVIAKSDDYNKLSKMLHDIDSDIHFN"
FT   gene            80373..80963
FT                   /locus_tag="LPC_0082"
FT   CDS_pept        80373..80963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0082"
FT                   /product="YdeN-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54082"
FT                   /protein_id="ABQ54082.1"
FT                   /translation="MSQSNVIIVHGAYGHPFENWFNWMKTELESLGIECFVPQLPTPDG
FT                   QELKNWLHVFNSTVSPMITHDTILIGHSLGSAFLLRWLEQANQSVFSTILAGPFIGAVG
FT                   IQKFDKINESFFENGFDWHSIINKSKQFFCYHGSNDPYISRSNFNFIANNLQARKIIIS
FT                   QGGHLNEAAGFSSFPQLLIQLKLLLGINYGKFI"
FT   gene            80947..81894
FT                   /locus_tag="LPC_0083"
FT   CDS_pept        80947..81894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0083"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54083"
FT                   /protein_id="ABQ54083.1"
FT                   /translation="MANLFSFLFLGTLGWGISLYLMKILLVSLTPTEIVLYRMAIGAAS
FT                   LFILAKLFKLKTDNIRGLILDGIIVGTFNMTLPFYLTTYAVKTVSSSLASVINGLTPLC
FT                   TLILGMVFFSSKQKLSVLNLLSIVLGFIGIIIINSDVSIYQGSAVEFIALLATTISYGV
FT                   TANYFKYHARTKDPILVSAVSAFVSAITMLIFKCATESSINYWGIPQDMHQIIALLWLG
FT                   VIGSGFCLYLYCSLIQNAGAVFASMITYLMTITGVIMGMIFLHETISHQVMIGCIFIFF
FT                   SLILVNHAPLLEKILVSISRQISLKSARRYELNQ"
FT   gene            81994..82371
FT                   /locus_tag="LPC_0084"
FT   CDS_pept        81994..82371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0084"
FT                   /product="transposase (IS652)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54084"
FT                   /protein_id="ABQ54084.1"
FT                   /translation="MPRKDIILNLPGYSIVKVTGNNPAYIQVSYNRVVRCIYCNEKRLR
FT                   KKDSFERKIRHESIGLRYSYLIIKSHKFQCYGCKRYFNQRFPGIGKYQRATEVLRKEVF
FT                   HHHTEGVSQKNLRVYLNFAKT"
FT   gene            82602..83825
FT                   /locus_tag="LPC_0085"
FT   CDS_pept        82602..83825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0085"
FT                   /product="integrase, phage related"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54085"
FT                   /protein_id="ABQ54085.1"
FT                   /translation="MKNFTDTYIRNLKAKEKRYEEFEGGGFGIRITPNNVKTWIYRYKI
FT                   NGVTTKFTLGHYPAMSLSNAKRRFLELSQMRREGVDPKTVIQAQEEQDNNTVDKLALNW
FT                   YTNYIEKHVKRPLVIKRQIDNDIIPLLGKKKLDDVQTKDISDALDTIVKRGARILANRT
FT                   LSSIKQMFNYAVSRGYTQFNPASNIRSRDIGGIEKPKERVLTLEEIKALWLFLDSDLTQ
FT                   MSTQTRIAIKLLLLTGVRTVELRLASWHEIDFEASLWTIPALHSKASIIHKVHLSKLAK
FT                   SLFLQLKPLSHSDYVLTGVDGFHPITENALPRAIKRIQEKLGIPDWTAHDLRRTFATQL
FT                   GETLQIDPVVIEKCLGHKMPRIMATYNRNEMLPQRREALERWAVCIENMMQDNVVYINK
FT                   LLQNERSL"
FT   gene            83909..84232
FT                   /locus_tag="LPC_0086"
FT   CDS_pept        83909..84232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54086"
FT                   /protein_id="ABQ54086.1"
FT                   /translation="MSWIVEFYNESVEEAILTMPPKIQARMIKLLELIETHGANLGPPH
FT                   TEAMGDGLFEIRAKAQEGIGRSLYCYMKGKHIVVLHAFVKKSAKTPKPDLQLALKRKRE
FT                   VEK"
FT   gene            84229..84513
FT                   /locus_tag="LPC_0087"
FT   CDS_pept        84229..84513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54087"
FT                   /protein_id="ABQ54087.1"
FT                   /translation="MMKLKTLKAKALKNPEVKEAYDALESEFALIDALLTMRQKAGLTQ
FT                   EELAERMGTKKGNISRLEKGNTNPSWNTLEKYAHACGFDISMAVKRIAS"
FT   gene            84695..85510
FT                   /locus_tag="LPC_0088"
FT   CDS_pept        84695..85510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0088"
FT                   /product="LvrA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54088"
FT                   /protein_id="ABQ54088.1"
FT                   /translation="MILRMISLSFLFANAHELAALLELPYIQRVLYLMGIRPYMDRQSC
FT                   IVGIKRRISYQSLRETLYVGPIAGVKTGSPSLQQMKRAVKSLERAGLIEIQSTERHLIV
FT                   KCIYAELDNPAQKKAVLKPNLYPDTNPTQEDTLESGESCNFRQKPNIANSTEADPPQKS
FT                   EDYNYIYMCSKFEKFWKSYPHPLDREAAFYQFRELNPDDKLFEKIMARLHGQIESYNFQ
FT                   VMMGVWVPTWKYPANWLARKCWQTNPYVFEHSSPIVQDCDNQQVGIQED"
FT   gene            complement(85642..85812)
FT                   /locus_tag="LPC_0089"
FT   CDS_pept        complement(85642..85812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54089"
FT                   /protein_id="ABQ54089.1"
FT                   /translation="MKWLSIRHQLMFRQGFTSASVMLDSKLAKRCLLSKGFWKEFCPIP
FT                   IGGIGQNAEKC"
FT   gene            complement(86285..87697)
FT                   /locus_tag="LPC_0090"
FT   CDS_pept        complement(86285..87697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54090"
FT                   /protein_id="ABQ54090.1"
FT                   /translation="MKSKKILILGLSITLTAITSASYAKKIFPSDIIGRDLNYPGMGWL
FT                   GHVGIATRPMMDSSGMSTPANQVIEILNEPVIGQINTIDNFKRRSPYWGSKYGVIGNPE
FT                   QGYRVLVEANHQRWWVREYTSNTDYRIAQGNPRTGEIFVTGRWRCDTYAWWAFYSQGVD
FT                   TMPGRIWLPRNLFNFFPYYNDERLVAESSEPSAEILTNKSLDDVSAEDLNEMSLEEFQT
FT                   VIDAPLKAPTNYVAPMSAYMRFAYSDSLNDIKRGAMIDKITSKVSDVDLVPKLLRLYDE
FT                   TDREEVKNKIVSGLMFHVQGELREHPNSRDKELLRSFFHRLIGEKLNQRCADWATMGFI
FT                   DTHTADETLQNLDKIDAQLATATHPASITLKYKLVHKSKKLQSIYIKSIVDELREANNS
FT                   DLDSYFFGPLAIGYQGTGKNLLEPESKQIVINYLDEVRYKYTSKGIKANPSDFHRGTTA
FT                   PYYFELLKHMDN"
FT   gene            complement(87728..88336)
FT                   /locus_tag="LPC_0091"
FT   CDS_pept        complement(87728..88336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54091"
FT                   /protein_id="ABQ54091.1"
FT                   /translation="MDASKGNNHLKSLNKYSWFILVMFIFAVFAMSYQTTNTFFDGFIQ
FT                   TLPLIIVFVFWSEKSARLIKQAESNLKRAELFNRDTFILSFSFLLGCLISLLFAYDNSD
FT                   VKGWWVLIIYFITLYGLIFSLIFSGIALQIKNHKTYTLVFSLLIIVFVSMGKFFPRYTF
FT                   IPLLGYIDTFYAVTCVLLIIHCLFAFNCKIIRTIKRNTP"
FT   gene            complement(88446..88521)
FT                   /locus_tag="LPC_0092"
FT   tRNA            complement(88446..88521)
FT                   /locus_tag="LPC_0092"
FT                   /product="tRNA-Asn"
FT   gene            complement(88581..89759)
FT                   /gene="aatA"
FT                   /locus_tag="LPC_0093"
FT   CDS_pept        complement(88581..89759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="LPC_0093"
FT                   /product="aspartate aminotransferase A"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54092"
FT                   /protein_id="ABQ54092.1"
FT                   /translation="MDIALAKRVQKVKPSPTLAVAAKAAQMKAQGLDIIGLGTGEPDFD
FT                   TPQHIKLAAISAIEAGDTKYTAVDGIVELKEAVKNKFKRDNELDYQLNQILVSVGGKQS
FT                   CYNLCQAYLNPGDEVIIPAPYWVSYPDMVLLADGVPVIIETTPAQRYKINAQQLEQAIT
FT                   PKTRMIFLNSPSNPSGIAYTQNELKELGDVLKKHPQILIATDDMYEHIIWSQPFTNILN
FT                   ACPELYDRTIVLNGVSKAYAMTGWRIGYAAGPAPLINAMKNIQSQSTSNPCSIAQRAAV
FT                   AALNGSNESIEEMVNAFHQRHDYVADRLQSIDGIEVIPADGTFYIFPSVQAIIEKRGYA
FT                   NDIEFSEKLLNEVGVALVPGSAFGTEGCIRISFATGIDTLKDALNRLQRFCS"
FT   gene            89806..91797
FT                   /gene="uvrB"
FT                   /locus_tag="LPC_0094"
FT   CDS_pept        89806..91797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="LPC_0094"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54093"
FT                   /db_xref="GOA:A5I9P3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9P3"
FT                   /protein_id="ABQ54093.1"
FT                   /translation="MKDLFKIYSNYQPAGDQPTAIASLIDGLESGLAKQTLLGVTGSGK
FT                   TFTIAHVIQAMKRPTLIMAPNKTLAAQLYGEFKAFFPDNAVEYFVSYYDYYQPEAYVPA
FT                   SDTFIEKDASINEHIEQMRLSATKALIERKDAIIVATVSAIYGLGDPDSYLRMLLHLSR
FT                   GEQSDQRKILKRLAEMQYTRTNLSLERGQFRVHGDVIDIFPADSEKEAIRIELFDDEVD
FT                   NIARFDPLTGEILQRLPRVTIFPKTHYVTPRERILETVEKVKAELQERLAELNAQNKLV
FT                   EAQRLEQRTCFDIEMMLELGYCSGIENYSRYLSNREAGEAPPTLFDYLPPDALLIIDES
FT                   HVTVPQIGGMYRGDRARKETLVNYGFRLPSALDNRPLRFEEFEERSPQTIYISATPGPY
FT                   EQEHSDNVAEQVVRPTGLIDPEVEIRPVKTQVDDLMSEIRQVIAQGSRILVTTLTKRMA
FT                   EDLTEYLSEHGIKVRYLHSDVDTVERMEIIRDLRLGEFDVLVGINLLREGLDMPEVALV
FT                   AILDADKEGFLRSERSLIQTIGRAARNVKGRAILYADTMTGSMQRALMETERRREKQKA
FT                   FNLKHGITPKGINKSVEDILEGAYIGKRKTMVAEQAPRYTHWSPQELAKQINALEKQMY
FT                   AHAQNMEFELAAKIRDEYLLLKEQLMKI"
FT   gene            92152..93765
FT                   /locus_tag="LPC_0095"
FT   CDS_pept        92152..93765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0095"
FT                   /product="diguanylate cyclase/phosphodiesterase domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54094"
FT                   /protein_id="ABQ54094.1"
FT                   /translation="MNIKSNLAYSSVILKGHVNRYAFLGLLISVGSILIASCIVSYQLT
FT                   GSVSLGGFIQAQRTNPAIWILDLTPFMFVYWGQAFCYGLVNKAESLLVDKTKELLNISG
FT                   NLELKLKYESNHDSLTNLPNNRLLNEKIRLAIEQLGLQGELAVIVIKINDLNYNFSSFN
FT                   ANNIVKQFAEKLKSILIDPYMLKASLGINMVARLQSDEFAILMPRLKKDLDINELLIHL
FT                   LTLLNNNLMVDGISINVTSTVGAAIYPAHGEEDDVLVNHAIIAVYQARKENKSYAIYSP
FT                   EMEEDLIQNRIVMNELQRSIENKDLKIYYQPIVELANGQIVGAESSARFEHPELGLLSA
FT                   EKFMPLIEGTSLIHNLTTLMLKEVIKQLAAWHDAGHKIFVSVNLSVHHELPELIEKLLN
FT                   DYEIAPEFLKLEFTERACLTEQMVTKEVFDRLSTMGIKLCIDDFCSENSSFIHLTNFPI
FT                   ENIKIEKSFVLKIAKDAKKAKIVEAIVKLAQTLGWEPLADGIADQNALEKLRDLGCLYG
FT                   QGLYFSRAVNVAEFTSLLKK"
FT   gene            complement(93856..95427)
FT                   /locus_tag="LPC_0096"
FT   CDS_pept        complement(93856..95427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0096"
FT                   /product="glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54095"
FT                   /protein_id="ABQ54095.1"
FT                   /translation="MRRQWYIGFGVILLCLFALFAMLQDIVWFFAFLIPIVILWIYDVL
FT                   QTKHTILRNFPVLGHVRYFLEFLRPEIQQYFIATDESELPFNRETRSMIYQRAKNVRDT
FT                   IPFGTERDILSVGYTWALHSLSPKHSSEVEPRIDVGGPDCKKPYNASRLNISAMSFGSL
FT                   SSNAIMALNKGAKLGGFYHNTGEGGLSPYHLQGGDIVFQIGTAYFGCRDDKGNFDENEF
FT                   IKEASRDEVKMIEIKLSQGAKPSHGGILPAAKLTEEIAKVRKVPMGKDVLSPIAHTAFD
FT                   NPVGLLHFVKRLRDLSGGKPVGFKLCLGRRHEFMAICKAMLKTNILPDFITIDGAEGGT
FT                   GAAPVEYTNFIGTPLEAGLVFVHNALVGTGVRDKIRVICSGKVTNGFDLLTNIALGADI
FT                   CNSARAMMMAIGCIQSKQCNANTCPTGVATQKKRLQYGLVVDEKKFLVANFHNNTIKSF
FT                   LEMVGALGLNNPSDLKPSHIMRRIGVDEVKSFDQIYTYVKLGQFLQGDIPDDYRIHWEY
FT                   ADPDKF"
FT   gene            complement(95505..95819)
FT                   /locus_tag="LPC_0097"
FT   CDS_pept        complement(95505..95819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0097"
FT                   /product="conserved hypothetical protein; DUF710"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54096"
FT                   /protein_id="ABQ54096.1"
FT                   /translation="MTNIKLCKIKLLNKIYEIKCPDGEEVSLILAAEKLNEKMQNNKNK
FT                   FKHLDNFHILLLAALDIGHELIVCKNEQEQQRLQVTQFISSLENKINKAVVGSETDSNQ
FT                   "
FT   gene            95975..96556
FT                   /locus_tag="LPC_0098"
FT   CDS_pept        95975..96556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0098"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54097"
FT                   /protein_id="ABQ54097.1"
FT                   /translation="MSLDNDSLHLPKYDDFVQSISVLALTMSGSELHGIMCGYLCAGAD
FT                   SQGEAYIRALLNNKKDEQSRNALLSMFSVFSISQQQMNNFDFEFEMLLPDDDESLVTRA
FT                   QAFSEWCEGFTQGLTIAGVGMEQFYEEESQDALQHLIEFAELDCESLEVGEEDERALME
FT                   VSEYTRMAVLRLHSDLVLHERELGDSGTTH"
FT   gene            96661..97971
FT                   /locus_tag="LPC_0099"
FT   CDS_pept        96661..97971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54098"
FT                   /protein_id="ABQ54098.1"
FT                   /translation="MISQQEYKARRKKLAAQLPDDSVAVIPAAHEVLRSGDTHYRFRQD
FT                   SDFYYLTGFNEPDALLVIIAGKDSQSILFNRPRNPAEEQWTGKRLGQDGALQELGVQAA
FT                   YPLSSIAEELPKLFSGKSAIYYDLGRNLSLEKKIRHVLSSLKAQVRRGIKAPESLCDLE
FT                   PILSEMRLLKSDAELELMRQAARISVAAHKRAMQVCQKMEYEYQLEAELIYEFSRHGCR
FT                   SVAYDPIVGGGANACILHYTENNKPLRRGDLVLIDAGGEYGSYAADITRTFPVSGTFSP
FT                   EQKIIYELVLKAQKAGIAAIEPGLPWNHIQQTIIRILTEGLCDIGILKGDLEELIKNEA
FT                   YKPFYMHNSGHWLGLDVHDVGRYKINNEWRPLEAGMVLTVEPGLYISAGMEGVDKRWWD
FT                   IGVRIEDDILVTRAGYEVLTGDLPVNVDDIEALMRGE"
FT   gene            97961..99163
FT                   /gene="ubiH"
FT                   /locus_tag="LPC_0100"
FT   CDS_pept        97961..99163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="LPC_0100"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54099"
FT                   /protein_id="ABQ54099.1"
FT                   /translation="MANKETDILIIGGGLTGASLSLALQGLGFSVTLVESRPYSDKVNP
FT                   DFDARSLALSPASQRILAMLGVWEILKEYTTPIHMIHVSDQHRFGVSRLHGEKNSPLGY
FT                   VVEMQYINRALSILLNKEHLLAPAALKSIDFNNSTATVAHGDDMISIQAQLIVAADGTE
FT                   SMTRHLCNLPVKIKDYAQDAIVANVGLIKPHGNRAFERFTPNGPLALLPMMNDKMSLVW
FT                   ASKPEEAKRLVMLNDGDFLRELQTAFGYRLGRFGKVGKRYSYPLKQVLMPQQTKWPVVF
FT                   VGNAAHTLHPVAGQGFNLGLRDIAALAQCVSQKGLNPQMLEHYLKLRAHDQQMITWLTD
FT                   GLIHLFTSRLPGMGVARNLGLLALDNIPALKNLLARYARGFGGITPDLVCEIALSTGEF
FT                   Q"
FT   gene            99160..100326
FT                   /locus_tag="LPC_0101"
FT   CDS_pept        99160..100326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0101"
FT                   /product="2-polyprenyl-6-methoxyphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54100"
FT                   /protein_id="ABQ54100.1"
FT                   /translation="MSQHFDVLVIGGGIVGLTAALAMAQRHYTVAVIDAGTLMVNTDKS
FT                   DLRVYAINKASKMLLSELGVWQHLDDARVAPYNKMHVWDGVSGAYIDFDSRSIAEPNLG
FT                   AIIEESILKQALLRRISSESKINLFPQSVIDEVCHLERSIKISGQNTAWEGQLLMIADG
FT                   ANSPMRHKLKVDVTTWSYEQQALVATVNSEKSHQNTAFQVFHPDGPLAFLPLSNLNQCS
FT                   IVWSTHADNAMRLKLLDDNEFSRELTKAFGGQLGQIKVASNRHQFPLQMRHVKQYAGHR
FT                   WLLLGDAAHTIHPLAGLGLNVGLADVKSWLTCLEMGKGELISKKVLGTYQRERKHSVGK
FT                   LFCLWRDLKDYLEPPHLLLPHYAVSDCGHAMNLSQLNDYLCARLVVYK"
FT   gene            complement(100651..101598)
FT                   /locus_tag="LPC_0102"
FT   CDS_pept        complement(100651..101598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0102"
FT                   /product="glutathione synthase/ribosomal protein S6
FT                   modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54101"
FT                   /protein_id="ABQ54101.1"
FT                   /translation="MINLFRRLKNHGVLSINQRNTDFVLRYNPRKLFPLVDDKLKTKKL
FT                   ALKAGIAVPALYDIIETEQQIKSIETRFASYNDFVVKPARGSGGDGILVFKDKVYGRYR
FT                   QINGKLTTVQELSYHLSCLLSGAYSLGGSSDYAIIEKRVVVDPVFAEVSYEGIPDIRII
FT                   TLLGYPAMAMVRLPTRLSGGKANLHQGAIGVGVDLATGKTLGGVFQNDTIDYHPDTLNP
FT                   IVGIEVPYWNQILEIASSCYELTGLGYLGVDIVLDKEHGPLMLELNARPGLNIQIANRE
FT                   GGLKRYRTIEARFKENGKESTLDKVNFCRKEFAR"
FT   gene            complement(101595..103118)
FT                   /locus_tag="LPC_0103"
FT   CDS_pept        complement(101595..103118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54102"
FT                   /protein_id="ABQ54102.1"
FT                   /translation="MKNNKRHVYGLILTLLLLGSGIFLYRHIILDVPLTDTETINSWMV
FT                   ESNLRFTADRNTPIKASFNIPYLPPNFAILDEYFVSRNYGVTTNLNGSNRETVWSIRRG
FT                   NGPQSLYYRAIFRQTDSDESSLPKPSVTKSQPLNDSQKSAVETITNQVRSTSADIQTFA
FT                   QSTIKELNKRDGNAKLLVGNEFNDDNIINATILILNQSKIPAITVQGIYLNQQKKADLK
FT                   SLLAVFNGKNWIYINPKTGSAGLPKEFLIWQYGNGPLFNVVGGNRAQFSLTVSPTPINA
FT                   LSVAKSRGLEDSQLLRFSLLQLPVNVQGIYKILLTVPIGAFIILILRNFIGIKTFGTFM
FT                   PVLIALAFRETHVAWGITLFVIIISFGLLARFYLDQLRLLLVPRLAAILTVVILLMIFI
FT                   SVLCQNLSLDTGMSVALFPMVILTMTIERMCITWDERGASEAIKSGIGSLAAAVISYGA
FT                   MSYEPLQYLIFAFPELLLVLLSLILWFGQYRGYRLVELKRFKSLASAMK"
FT   gene            complement(103108..103581)
FT                   /locus_tag="LPC_0104"
FT   CDS_pept        complement(103108..103581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0104"
FT                   /product="conserved hypothetical protein; DUF785"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54103"
FT                   /protein_id="ABQ54103.1"
FT                   /translation="MANSEAQIYGYVEEATLIDQNLTLSAKLDTGAKSASLHAVNITEI
FT                   EKKGIPYLRFTVPTKTGDYSFEGEYVGKVKIKVRSSETNPGLLRTTPIKRPVVLLNIKL
FT                   GDKVRTIKVNLTNRKRFLYPLLLGRDAIIDFNGAVDPALTFTTKSKSPVNNEK"
FT   gene            103885..105816
FT                   /locus_tag="LPC_0105"
FT   CDS_pept        103885..105816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0105"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54104"
FT                   /protein_id="ABQ54104.1"
FT                   /translation="MPHASDENQASKPTDLVFILAIAGRIDAQSRILAQKLDKSRSIYY
FT                   AYAVMDSLSSSYSMFKYFFDLFASPNDNDAMHEFLNSPTGLITIAVESVFLVTFSVLAC
FT                   QFENEKEDYYKKFIANAWPYFRDVMKGLKNAYKGWRSAVVAFSLIGGVDAKFLILPMGV
FT                   ILGVFAAANRFWIRSMLEDRKTMMSENIALLMEIKKLISLSHEESFSYFKRIRSQTMQT
FT                   RNFAFWAVAAGGLLDGLYLYVGVLSLAVLSPQLLMAMALICAFYTVACVITRIYEEYDF
FT                   QLRLLVTQTKCQLALITKELETNYAKLLLLQDKMDLDKADQEELKRLKRLVHNLITRFD
FT                   DSRKLLSQQSNRTYLSSALLGMKNGLYAYGALASVLFLVGSILVMAGVSFPPALLTACI
FT                   ILGLVLVLSFTIHSLVSNYWHQKKQETQKQRPYERLIEWNNCLNDEFNKTELLAPEEFN
FT                   KLLNDGLSLDPSPQFFFQEWFEVLRSLFSGFGKGQKFIDFAGNSLQELGEDGHYRDTPV
FT                   MYVLSVFSALLFGVTLALRALAKGLGRTPLAQQAKLTEDSKEASVSPEITKGVMQKTEE
FT                   QRESIQSEKTRTDSPGHTDSLSLFGIFETKTKTKRNQPDSPSIPHSKSESALNQLIPSQ
FT                   NSTILGLA"
FT   gene            complement(105782..106372)
FT                   /locus_tag="LPC_0106"
FT   CDS_pept        complement(105782..106372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0106"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54105"
FT                   /protein_id="ABQ54105.1"
FT                   /translation="MQESFDPSTITTLHKTSIIRWKANGIEYQHKQFLQLVEENHAFNF
FT                   QLWHAEDKARRNDMGFEFVYQAKREIDAFNQQRNNRMEAMDEWLYKALQPENHNHCPVN
FT                   SESPGMIIDRLSILSLKSYHMDLQTKRQDVGVEHRIACTQKLEIIQQQLNQLALCLDEL
FT                   LNEVRAKTRTFRVYHQFKMYNDPKLNPELYCSD"
FT   gene            complement(106599..107327)
FT                   /locus_tag="LPC_0107"
FT   CDS_pept        complement(106599..107327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0107"
FT                   /product="glutamine ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54106"
FT                   /protein_id="ABQ54106.1"
FT                   /translation="MKRFMFILLIFINFHAFGKPLIIGVPDFAPPFVSRSGGGEFYFGF
FT                   NIDLMNSICKIIEEECQYKGMNIQQLYTNLNAGKVDIMLAPTPIVSTAGTNYIFSLPYL
FT                   PSNAQIVTLKANDHINALTDLKGKKVGTLKYTLYGGLLQEHFQDYVDLMQFSKLPDMAI
FT                   ALSNREIEAVVLNANAAKYAMSNSATELKFVGDPIPIGNGYGILALKNNAPLIMKINKA
FT                   LLQIEKNGTYLEIYNTYFGD"
FT   gene            complement(107419..107865)
FT                   /locus_tag="LPC_0108"
FT   CDS_pept        complement(107419..107865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0108"
FT                   /product="conserved hypothetical protein; DUF188"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54107"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9Q7"
FT                   /protein_id="ABQ54107.1"
FT                   /translation="MTIWVDADACPKMIKDILFRAAIRTNTNLILVANSYLTYPNSPFI
FT                   RSVLVEKGYDRADHYITSHMKAKDLVITADIPLAAEVIVKQGLAMSPRGELFTANNIKQ
FT                   RLTLRDINEQLRSAGERTGGPSALSAKEKTNFANALDRWLVKSK"
FT   gene            107976..111950
FT                   /locus_tag="LPC_0109"
FT   CDS_pept        107976..111950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54108"
FT                   /protein_id="ABQ54108.1"
FT                   /translation="MKQLISIIKGQIQQLPIPDLKHLLLSHLKEDAHDLTELFCQQTPA
FT                   QKNQFSHNQSVPFGLPASLSVLAIVLTYAPNLLHRELSEQLLTMLDSIRETETSVDNQL
FT                   AERCTEQLNYYSDAKPVLIALKERGAKDLIQILEQADERSLLAFSHLAKDTDLNVLIET
FT                   FLVKNNKDLDLVNRNHLVQFLRQPDLAGWLTRFLDSLIDGSINALSIRLLLSLISSVKA
FT                   IEKLKAARACLAQYPFSIDLHAMRAVFDFYQYELKRDLFSPESHLVMQLLHDLLKNTKL
FT                   DKQQEFFQGLSQETVLLIIEYCIAEYNKTTGEEKQNCKNLLTRLCSAFSDSSQDFLGKI
FT                   RTKINQLDPYLFDTPQLYQLASDLITKSCNSGKESLSSSPIALLLSMPQFVGVCTPKVL
FT                   KQLVERYSLYTLTLNQKDYKQDLCFKEYAPYFDEINEHMAQIERNLLIHPEAQSFWLDK
FT                   KYSLLQFRVEISKSALLHQMECLLEANKGGEELNNKGLEVLYHYYALSYPNLRSDLFLK
FT                   VVNHIYSRFFIKGNNETEARDGLFHWLKQNFPLIDKLPKDLDRKKEIFLYNSAGKKIGF
FT                   LGESNAAMTFVNEEIVLLAQTGSMDINEPLYDQEGLVLGYLTEESCLRSESAIHKNAAA
FT                   WVLAGLSKSDLESSSFGLESLLHNVLFENSIGVLYQCESICLDANKRIWLNNKLLKEIQ
FT                   EAPGEIPASVLYPLLDHFEDETVFELLGVIRNKNNALELFHYILNRDSRCSILLNGLYE
FT                   SDFQRFLEHQGADVCLADYLVNYYDKPWFSEVLLRFAYHGKKYKKPDLLSSALTFITKE
FT                   ISRDKKQETICDAVLDRLISSEACAALVLKEFLGDRTHNSIQRVNNPEIGKVSQFFDRR
FT                   HIVSLIAQLNKTSYWEQNAQYKLALHILANQHGRLFSETDLNPDSPQVWQGKELKELAC
FT                   FTSRHLSKKRPFDNKHDIGYRVLGELLFRCANSGITSLFYKQKTLNRAITRLSITEPFL
FT                   VRMVDKLWMPKGIRELYGKSLFFKGSWFDDQVFLQKELKDHHPLLDWSHFIKQTWNKRD
FT                   KQKKSPIICTYLLSYTGRKSVLSRLLQDYFNSFQGMPDYIRPVSQLLRFFPQRDVSAVI
FT                   YDALEAEMIKKPQLLDRQILSDMAFYYGKQLARKDTSFPQADINLLTYWGQNKHYSLVK
FT                   RGCELLVRDCEDKGVKKRLVSAAKEAEVEQDLSSSVQTFYFGLIKFFKRLWHYGFNAEN
FT                   SSSKIIKFCDDPTPGPTRKKAGDLINAPVAESRTNSLYLGFSERRKQLISLLATIKSSP
FT                   AHFTRVVNYSDNTQTFFGEQPKQSIDYNTPAIPSSFESIM"
FT   gene            112168..112632
FT                   /locus_tag="LPC_0110"
FT   CDS_pept        112168..112632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0110"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54109"
FT                   /protein_id="ABQ54109.1"
FT                   /translation="MRILLSFFLLLLSTGLFAESTFPDGCRAVPVQGQSVTLKAKKNKL
FT                   VFIHNVTNLDLWITHPVTDPGASAGWTSRLQAGKWSALVVDKPAFILNCIESRPGHEQQ
FT                   IPCENAIAVCQWKGVKIPASNQGTFWVAEDLSLAALNAAVGGRGFVLPEK"
FT   gene            113109..115208
FT                   /gene="vacB"
FT                   /locus_tag="LPC_0111"
FT   CDS_pept        113109..115208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vacB"
FT                   /locus_tag="LPC_0111"
FT                   /product="(exo)ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54110"
FT                   /protein_id="ABQ54110.1"
FT                   /translation="MEILDEYGRPMSRSKLFDKLDLSSESQQESLGFRLKAMLRDGQIM
FT                   QDRRGRFCLLQKINLLRGTVQGHPDGFGFFIPDDGSEDMVLSAKEMRAVMHGDMVLAYQ
FT                   SGLDRRGRPEAKIHEVLEHANTTVVGRFFTDHGVNFVIPDSKRLTQDISIPQEFIGEAK
FT                   NGQIVLVELIAYPNKRSQAIGRVIHILGEHMAPGMEIQVAIHAHGIPFEWPDDVLAEVG
FT                   KIPQQISEEQLKGRTDLRNLPFVTIDGEDAKDFDDAVYCYKKPKGGFQLYVAIADVSHY
FT                   VAKDSALDQEAARRGNSVYFPGKVVPMLPEALSNGVCSLNPHVDRLCMVAELSITQEGK
FT                   ISRSRFYRAVIHSHARLTYTSVGAWLEQGKADEKHQALWPMLESLYDLYHVLLDTRRLR
FT                   GAMDFETTETRIEFDENKKIKCIVPVIRNDAHKLIEECMLAANVATARFLEKAEIPTLY
FT                   RVHAAPEEDKITALRQFLGELGLSLGGGRKPGPKDFQRTMNMIGDRPEKHLIETVMLRS
FT                   LKQAQYVESNEGHFGLAYSAYTHFTSPIRRFPDLLIHRAIGHLLDNHPVYEFEYSHEDM
FT                   NRLGKHSSMTERRADEATREVITWLKCEYMQDKLGQVFKGRISAVTSFGIFVELDEIYV
FT                   EGLVHVTSLKNDYYTFDSAKHRLIGARGGQVYRLGDKMTVLVARVDLNERKIDFEPVED
FT                   EVCNE"
FT   gene            115201..115950
FT                   /locus_tag="LPC_0112"
FT   CDS_pept        115201..115950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0112"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54111"
FT                   /protein_id="ABQ54111.1"
FT                   /translation="MNEQYVYGLHAVSALLANPHRMIKKLFVNQDRIDKRLHEFLVKAE
FT                   NAHVPIEKLSAQKMNQQFSEFTHQGVVALASALPEYGESDLVTLLERSKKPVLILILDG
FT                   ITDPHNLGACLRSADATGVDFVVIPKDKSANITPVVSKVACGAAESIPLVRVTNLARAM
FT                   DILKQQGVWIFGAAGEAEHLLYAMDCSGNIALVMGAEGTGLRRLTREHCDGLFSLPMMG
FT                   SVESLNVSVATGVSLYEVIRQRGQFRE"
FT   gene            115943..116593
FT                   /gene="rpiA"
FT                   /locus_tag="LPC_0113"
FT   CDS_pept        115943..116593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="LPC_0113"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54112"
FT                   /db_xref="GOA:A5I9R2"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9R2"
FT                   /protein_id="ABQ54112.1"
FT                   /translation="MSELKIKAAKAAIAYIEDDMVIGVGTGSTVNFFIKELAAIKHKIE
FT                   ACVASSKATEALLRAEGIPVIDLNSVQDLPIYVDGADEVNERGEMIKGGGGALTREKIV
FT                   ANVATQFICIVDESKVVKRLGEFPVAVEVIPMARSFVARQIVKLGGDPEYREGFVTDNG
FT                   NIILDVFNLNFSTPMALEDSLNVIPGVVENGVFAKRLADKVLVASASGVNNLK"
FT   gene            116657..118036
FT                   /locus_tag="LPC_0114"
FT   CDS_pept        116657..118036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0114"
FT                   /product="cytosolic IMP-GMP specific 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54113"
FT                   /protein_id="ABQ54113.1"
FT                   /translation="MDTHKVFVNRIINMRKIKLIGLDMDHTLIRYNSKNFESLVYDLVK
FT                   ERLAESFHYPEEIKKFKFNFDDAIRGLVIDSKNGNILKLSRYGAIRLSYHGTKQISFSD
FT                   QKKIYRSIYVDLGDPNYMAIDTSFSIAFCILYGQLVDLKDTNPDKMPSYQAIAQDVQYC
FT                   VDKVHSDGTLKNIIIKNLKKYVIREKEVVEGLKHFIHYGKKIFILTNSEYSYSKLLLDY
FT                   ALSPFLDKGEHWQDLFEFVITLANKPRFFYDNLRFLSVNPENGTMTNVHGPIVPGVYQG
FT                   GNAKKFTEDLGVGGDEILYIGDHIYGDILRLKKDCNWRTALVVEELGEEIASQIRALPI
FT                   EKKIVEAMSIKKELEQKYVDLCTRSIDESSQQYDQEIHDLQLQISTVDLQISRLLQEQN
FT                   SFYNPKWERVFRAGAEESYFAYQVDRFACIYMEKLSDLLEHSPMTYFRANRRLLAHDID
FT                   I"
FT   gene            118420..119613
FT                   /locus_tag="LPC_0115"
FT   CDS_pept        118420..119613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54114"
FT                   /protein_id="ABQ54114.1"
FT                   /translation="MPKVIIFTDFDGTVTGRSGNETVFTDFYQSLLQGYKKDVEQDYKN
FT                   TPMKDPIEAQALFEAKYGKYNENFDHDQQDVDFLMSPEAVAFFHEVLKNDDVTVNIVTK
FT                   NRAEYIKAVFKYQGFSDEEIEKLTILESGYKFNDVNSRLNHPTERANRVYILDDSPTDY
FT                   AEMLRAVKGKGYNEEEIRGHRKNPGEFEWSQYLEDVREMFPPKENSPEEVRLPYEQGDE
FT                   VSIGEEIPVLLQEDNLSRREETATVLSNQPVPSSDFRTLKIMGAFAGIGFGFGFALGVT
FT                   LVATGVFAPPGVGLLGALTLGAISGTGAAALSSAIGFAVAKGTEITPEPVSEEPVPAVK
FT                   QSSHEAMRGLGGSQLLSTNNIHPVGHFPSVLSGRTPTKGKEEQCQKEYVLTNPLNNS"
FT   gene            119775..120116
FT                   /locus_tag="LPC_0116"
FT   CDS_pept        119775..120116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0116"
FT                   /product="alkylphosphonate uptake protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54115"
FT                   /protein_id="ABQ54115.1"
FT                   /translation="MNQLPNCPKCLSEYCYEDGDVLICPECTHEWPRNSNNNDEESAKI
FT                   IKDANGNLLQNGDTITVVKDLKIKGSSQVIKVGTKVKNIRLVDGDHDIDCRIDGIGAMK
FT                   LKSQFVKKI"
FT   gene            120231..120683
FT                   /locus_tag="LPC_0117"
FT   CDS_pept        120231..120683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0117"
FT                   /product="two component sensor and regulator, histidine
FT                   kinase response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54116"
FT                   /protein_id="ABQ54116.1"
FT                   /translation="MRVLIVEDSAFNAFCLRRLLESVVASISVTIVNNSQAALSFVNNY
FT                   CPDIVVVDGDLGASPDEMNCNGPELAGILLQKYPQLPIVAWSDSDAMREDFIKVFKSRG
FT                   LFLNEYNTWPKVIGLERIHKTWSYYFGEFIGGQNPSFASQTSINYY"
FT   gene            complement(120713..123403)
FT                   /gene="polA"
FT                   /locus_tag="LPC_0118"
FT   CDS_pept        complement(120713..123403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="LPC_0118"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54117"
FT                   /protein_id="ABQ54117.1"
FT                   /translation="MKPPLILIDGSSYFFRAFHALPPLTNSKGQPTGAIYGVANMVKKI
FT                   IKDYQPEEIAVVFDAKGKTFRDEWYPEYKAHRPPMPQELSSQFQPLIQLLQAMGLPLLI
FT                   IDGVEADDVIGTLAKQATEQGIPVVISTGDKDMAQLVNEHVSLINTMSNYSMDIDGVKA
FT                   KFGVTPEQIIDYLTLIGDSVDNIPGVEKCGPKTAVKWLTEYQTLDNLLAHANEIGGKIG
FT                   EYLRASIPHLPLSKKLVTIKTDLELPLNLNQLMPKPADNEQLIKLTRELEFKSWLKELL
FT                   QEEENQKSPKEMDASNNKSYEIITTHQQLNHWLNKLEQSQQFCIDTETTNLDVMQAELV
FT                   GISLAVEEENASYIPLAHTDGSTQLVKEEVLTALKPILENPAIGKIGQNIKYDYSVLKN
FT                   YGITLKGIRYDTMLESYVLNSGAGRHDMDSLALKYLGYKTISYEDVAGKGAKQLRFDQI
FT                   PVEKAGIYAAEDADITLRLHHKLYPMLDEPLRNVLHDIEMPLLTVLADMEIHGVLIDPV
FT                   ILEKHGSRLKEQMKSLEQEAVQLAGKAFNLNSPKQLQEILFDEQKLPVVAKTPTGQPST
FT                   AESVLQELAFDYRLPAVILEYRSLSKLVSTYIDALPKRINPKTHRVHTSYNQAVAATGR
FT                   LSSSDPNLQNIPIRSEEGRLIRTAFIAPEGSLIMAADYSQIELRIMAHLSQDDNLLRAF
FT                   ANGWDIHAATASEIFQTNLEAVSKEQRRRAKAVNFGLIYGMSAFGLAKQIGVERQDAQH
FT                   YIDTYFRRYPKVLEYMERTRKQAHQLGYVETLFGRRLYLPEINSRNLMRQKAAERTAIN
FT                   GPMQGTAADIIKKTMLAVSSWEHSQKNPSAKMIMQVHDELVFEVRKEAVEECHAIIHKL
FT                   MEQTVKLSVPLVVSIGIGSNWDDAH"
FT   gene            complement(123406..124461)
FT                   /gene="lpxD"
FT                   /locus_tag="LPC_0119"
FT   CDS_pept        complement(123406..124461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="LPC_0119"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54118"
FT                   /protein_id="ABQ54118.1"
FT                   /translation="MNSSLRDIANLVQGMVIGNDAITVSTLSPIDNILPGSLVFAEGED
FT                   NIKLAENSEAAAILIGQGTIDSPKPLIQVKNPFKAFIALLNHFYPPRRISPGVHPTAVI
FT                   GAEVQLGDEVYVGPFVVIESGSIIGNHSVLKSHIHIGHNVVIGDHTTIHPQVTIYDNCR
FT                   IGSNVTIHASTVIGSDGFGYTFVDGQHLKVPHSGYVVIENNVEVGANTAIDKATLGATV
FT                   IGEGTKIDNLVQIAHSVKLGKHNIICAFTGIAGSTTTGNNVIFAANVGVSDHVHIEDEV
FT                   ILGARTGVPPHKHLKKGTVYLGNPAKPKDVAIKHELSVNRIPLIRKNIKSLTEQVAVIN
FT                   KKLDIKAKEVE"
FT   gene            124725..125507
FT                   /locus_tag="LPC_0120"
FT   CDS_pept        124725..125507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54119"
FT                   /protein_id="ABQ54119.1"
FT                   /translation="MLKKILLTGLCVLFSMNLSASEPIYDEEIPLLWSSIITVSGGPSW
FT                   ATPGQNQYIYPMSPIYINNFNPNLPPNYYLYFTHDSPTTILANGEIFFGLQRAINPQMI
FT                   GQLGLGVAGVSDAKITGDVNLNGLLNVYTYDYKVNHARVELKGKLIGSAFTPVQPYLSG
FT                   SFGIAFNNAHDYRTLSINQFLFPAPWFASNTTYAFAYSVGAGVQKMLNRNWQVGVGYEF
FT                   ADLGKSYLGGDGVNITKGPRLTHLYNNQLLFSVSYLYS"
FT   gene            complement(125504..126733)
FT                   /gene="fabF"
FT                   /locus_tag="LPC_0121"
FT   CDS_pept        complement(125504..126733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="LPC_0121"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54120"
FT                   /protein_id="ABQ54120.1"
FT                   /translation="MKKRVVITGMEITSSIGSGIDKFWLAASQGQCGIKRIQSYDPSPY
FT                   STQIAGEITDLSLDHLPEFNKSKRYPRAAQYALFCAHHAIEKAGLEQAELNAAGTFIGT
FT                   SIGGQPELEAGYRLFFTDSWKKIPPLSVIRGMPNSIANHIAIAFGIGGPNSTISNACVS
FT                   SGEAIGMAYQQIAHGNLTTALCGGTESLVWESVMAAWCKLRVMSTNNENPSQASRPFDL
FT                   NRDGMVMADGAGILILEELQQAKARGAQILGEIIGYGASCDAFHVTAPNSQGQARAIVA
FT                   ALNDAKLSINDVHYINAHGTGTQLNDSTETETIKMVFGKRAYDIPITAQKAMTGHAIGA
FT                   AGAMEIIATTLSLQKNTLLPTINLHTPDPACDLDYVPNAAREKTIDIALSNHFAFGGAN
FT                   AALVLRKYIS"
FT   gene            complement(126858..127718)
FT                   /locus_tag="LPC_0122"
FT   CDS_pept        complement(126858..127718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0122"
FT                   /product="N-terminal acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54121"
FT                   /protein_id="ABQ54121.1"
FT                   /translation="MITQVNQLDELQLKALKALRAECKKNDGSIPNLYIHILKQHRSLP
FT                   TSFLYYHNGTLIGFLSVYFFYDDAVEVAVLVSPQYRRQGIAKQLIKEALILIKSQNYFN
FT                   LIFSCPSRLNDNWLTQKGFTYLHSEYFMERDDLNPILDYMRPLSFRMATLEDIPILCGL
FT                   DEVCFPDKNQDLVNRFQQILNEREYEIVIAMLNNHPIGKAHIRWQTKRATLSDIAILPK
FT                   EQGKGFGSALIAHCINMILSEGKSRVDLDVETHNKKALNLYIQLGFHIQNACDYWSINV
FT                   NQLAK"
FT   gene            complement(127823..128413)
FT                   /locus_tag="LPC_0123"
FT   CDS_pept        complement(127823..128413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0123"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54122"
FT                   /protein_id="ABQ54122.1"
FT                   /translation="MLRILLYFLLLINTTFCLAKTEKAIFAGGCFWCMEADFDHLPGVL
FT                   STTSGFDGDTLKNPTYEQVSAGNTHYAESVMVEFDPNKLSYKKLVEYFFMHIDPTVKNA
FT                   QFCDQGRQYRSAIFYMNDQQKKIAMEYKKELEQKFPTIYTEIVPSTSFYPAEEYHQNYY
FT                   KKNPIRYKYYRYRCGRDARVQEVWGNKKQENNS"
FT   gene            complement(128521..129117)
FT                   /locus_tag="LPC_0124"
FT   CDS_pept        complement(128521..129117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0124"
FT                   /product="cytochrome oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54123"
FT                   /protein_id="ABQ54123.1"
FT                   /translation="MLEQSLRHYYQLVLVDPILPALRDRITPLSITWLSGIFGLLFIPF
FT                   ILLDKPYIAISFLLLSGYLDTLDGSLARFQNRASDFGSAMDIVMDRIVEFSAVLALYLF
FT                   DPQHRATLAILMLGSILLCITSFLVVGIFSNNTTQKSFYYSPGIMERAEAFLFFIFMTL
FT                   FSSHFNFLAALFCFLVCLTALIRLFEFKKSVQAPG"
FT   gene            complement(129441..130721)
FT                   /locus_tag="LPC_0125"
FT   CDS_pept        complement(129441..130721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0125"
FT                   /product="xanthine/uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54124"
FT                   /protein_id="ABQ54124.1"
FT                   /translation="MPTLKSYFLKDTSLRTEILAGATTFLTMVYIVFVNPKVLHDAGMD
FT                   QGAVFTATCLITAFACALTGFIANTPIGVAPSVALNIYFSYSVVQGMGVDWQHALAMVF
FT                   ISGLLFLFLTLTKLRRLLIEAIPHNLQIAIVIGISLLIALIALENNQIIIGDQHNLMRL
FT                   GPIIRPETGLFFLGFILILTLDYHKIPGAIIIGILSISVLSLMLGLTSWQGLIAMPPSL
FT                   EPTFLQLDFSGLSSIVALKTIFTFFLITVFDATGSLIGLLSPTIFKHEKNYYKRLTRSL
FT                   TADAAASSLAGLMGSASTSPYIESATGIEAGGRTGLTALVIATGFILMLFLFPLAKMIP
FT                   SFAVGPALLYVACCMIKHITNMKLQDITETAPCMVIIMMVPFTASIVDGIGLGIILYTL
FT                   LKLFTRQKPNPLVIVLSLVFIVFFLIN"
FT   gene            complement(130739..131545)
FT                   /locus_tag="LPC_0126"
FT   CDS_pept        complement(130739..131545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0126"
FT                   /product="conserved hypothetical protein; DUF155"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54125"
FT                   /protein_id="ABQ54125.1"
FT                   /translation="MECLSFCVAKTIDLTRLDLHLKNVSKEFSAVKTRDVIRLNSHRNK
FT                   DHTVFIFKNGTVVSWGVKRYQIHEYLDIIKLLVDKPVALLVHDEFHYQIGDKTAIEPHG
FT                   FYDVDCLTIEEDSDELKLSLSYGFSQSVKLQYFETIIDALIEKYNPLIQALSHKGEMPI
FT                   SRKQIQQVIGEILGAKSELNLISNFLYHPKYFWQHPTLEEHFSMLERYLHIQRRVNAIN
FT                   HRLDTLNEIFDMFNGYLENRHSHHLEIIIIVLITVEIIIAVMNFHF"
FT   gene            complement(131644..131913)
FT                   /locus_tag="LPC_0127"
FT   CDS_pept        complement(131644..131913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0127"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54126"
FT                   /protein_id="ABQ54126.1"
FT                   /translation="MNSKVFSQRFNRELATLGFPEDLTEKTKAVSKVFGVTRHLANAMI
FT                   FGHVLPDKEQLDKIAEILEVCPQWLSGATDRKKAYSGRETADSV"
FT   gene            132521..134323
FT                   /locus_tag="LPC_0128"
FT   CDS_pept        132521..134323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54127"
FT                   /protein_id="ABQ54127.1"
FT                   /translation="MIQLGDLLKPTWAAEQSLNNAWSVLNDEEKETIKSRMEKIFYNEI
FT                   PFQLEHDKLIYIHLFSLFAQLETIGLRGLIKSLEKLRGTDLYQQMRQQITDEIFHATVF
FT                   AKVAFQLSAPYALPLGHQKSIKHFISSLEGEEDLATSITLVNLVGEGWVEELCIAMKEK
FT                   NIAVTIFETVLEDESRHMDEYDLYRQIGLPNKDYLRKKLAIFEDELINTVFAHEQYLTT
FT                   LGILLGKEGALKLLNNINNKHHWMLKKIGLTPSAHWQLFMDTMPLLMKNLSHDFEKDKA
FT                   IEPTNIRKLLSAIWNDPELPTESAIFNINVTPVCFFEKKFKPETITCLMLQALSKACFD
FT                   NPQTRNYIFNHKLYHSHNSYVALAVKIPGSDQLGAIELKNCHEMTMTELAQHIQHDMRI
FT                   MKYCYEKTQSLQKEHPYLIEVVNRLLTPRHERVYRDFLFARPAISLSNIGHWGYQAAVS
FT                   PLFPNETFKITLTEIERKQVWNKINNTFEVQDVLPVGMSVDHRVFDGNIPFPRYMQEAF
FT                   DQMFQDMEQSRIKPLSKPFSNLDNFIKYSNTLLENDLEFGFLYLFSLMHVWKNYISYDE
FT                   LSKTVEENYERIKQALSKSEHQLG"
FT   gene            134323..135360
FT                   /gene="fdfT"
FT                   /locus_tag="LPC_0129"
FT   CDS_pept        134323..135360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdfT"
FT                   /locus_tag="LPC_0129"
FT                   /product="squalene and phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54128"
FT                   /protein_id="ABQ54128.1"
FT                   /translation="MVMRSFSFYYQHLENVSRSFSFCISQLTSPAKEWVALSYLLLRVA
FT                   DSIEDAKWQDLQTQSDSFAAFKSFLVQTPANDQFTKWLSSFPSQLPLGEKQLLCAVPLL
FT                   LEEKDNLPESIKQSVIKTILQVVDGMHYFLNHYHMEGKIVFPSLVTTNQYCFFVAGLVG
FT                   KLLSHIFTDLLSNFKWTASLLNQAFHFGFFLQKINLLKDKVDDETSGRYFISSENSLRE
FT                   SLVIHAHHSLAYVKSIPIIEGRPYRLFCAWSLFIGLASLKWLDKYGHRQKIKPRETYYL
FT                   VNQINLLIDDNRALEKLFNSYLPGQYEEGSCYASESTKKIPTWFKKIYDDEMDSLILSE
FT                   LDVQV"
FT   gene            135377..135463
FT                   /locus_tag="LPC_0130"
FT   CDS_pept        135377..135463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54129"
FT                   /protein_id="ABQ54129.1"
FT                   /translation="MQTAQICVRFQTELYLKLAEQFPDLISP"
FT   gene            complement(135665..138934)
FT                   /locus_tag="LPC_0131"
FT   CDS_pept        complement(135665..138934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54130"
FT                   /protein_id="ABQ54130.1"
FT                   /translation="MFIYNSWNVKFILLFQIMIIRELFNWIHNDSATLHLSDQTIERDL
FT                   IEQEESQAKQAHRVLLGNARLLKYSGSSNTEAIKELEQHCLFMDYLQLYKQEFVKDRKN
FT                   TVFLIALKNLLSHPHEEQLRLMPKINELFQILLRDNKESALSFYDKNKELFRHCTEIQE
FT                   RVTFELLQQKIEADSKLVMTQLDYFNEHLAYQENPLGIIALCRNWIGETEKFTALILWL
FT                   LERKVSVEKILLTNLLQDFLKYHLFTLHSKDSEVSRLYSLLGHFPEAQELVMAAQKISC
FT                   GELMFQQYSLDGIFRGKNLPVVSPEIPPLQFSLRKDNFNALYRTFGQYFLTAGVATATN
FT                   HSDVAWLDMLRHTLNQPETLKLLPDIINIIAREYSPKVLKTLAELIAESTAHRLLTLNQ
FT                   SCVFHLLQHKPRLLHDITEENVIEYINLLVRLDTHDQEIIYQLMALFRVLLKKNHPATK
FT                   AVFEAILDNLVNHPQLLEDEEFLIQLKKYPDCELLIEERCENILKQLNFCIAEQTSGLL
FT                   FGKHNYYIIEDVWLGALRKFAVLQQINPQMKSSFGHKYALQARIAEVVFIHQGDLFDLD
FT                   TFIDALDLPPVTSSGEISLYERALIEILATIDNELIRKQIIQKLETTPFNRLDWYEREY
FT                   GNQTVFIKAAKKGNLGLINLLEDKMKPSVLNKALRVAAKNYQWETLAHLCSLPEVELSQ
FT                   EEMDDLVAHLAKHGRVENIKKLLKLYDYKPSTELISAILKKGIENDNLQVVMYFCKLPV
FT                   ESPKQAILDRLFKLAIQLQHWDIVKFLANSKHYSPSQTTLEKAFQQTALAMQHEAVEIL
FT                   GNVEKTPVRAIVIERALLKASKLGHTNIVQSICSLPSEVLTKRAIEDALEQAAAQGHLD
FT                   IVSCLCEPGNTALRPPGINSGMKIAVQAGKLSLVNYFCSMTGSNKPTPRLIDQTLVMAV
FT                   KKGQTAIFMAIHSNRQTPPGKHAIEQSFQLAITGGKLQILDYLCRHERYGLNQSKIDQA
FT                   LISAVKSKQLEIVSYLCESLEITPSRKALRIAVTKAISSDQNDLADYLRSCSSGKSKPV
FT                   DTPIDEIDSPCEIGKQLATNGLFKYKRKDDKGPPLLLNPSL"
FT   gene            complement(139120..139674)
FT                   /locus_tag="LPC_0132"
FT   CDS_pept        complement(139120..139674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0132"
FT                   /product="Predicted signal transduction protein containing
FT                   EAL and modified HD-GYP domains"
FT                   /note="COG3434"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54131"
FT                   /protein_id="ABQ54131.1"
FT                   /translation="MPIQRIEEIILQIPKLSYRILRLANSASLYMSKKIESLMDAISQL
FT                   GLMQIRNWLNLLLLASLDDVAPDLLERTLIRAKMCESLAKSMDYPNSHQAYTVGILSTL
FT                   DGILNEPMPSLLAKIRLSEALNEALLNYKGDLGKILKFAIDYEQANFNQLERIPVKSET
FT                   LSQSYLKGIEYANHVIDIINK"
FT   gene            complement(139761..140363)
FT                   /gene="yuxH"
FT                   /locus_tag="LPC_0133"
FT   CDS_pept        complement(139761..140363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yuxH"
FT                   /locus_tag="LPC_0133"
FT                   /product="hypothetical protein"
FT                   /note="similar to yuxH, E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54132"
FT                   /protein_id="ABQ54132.1"
FT                   /translation="MVVELDEPPVRTLLARQGIYDKNSAIFAYELLYRNSEAQNSQVDN
FT                   LNPLSGEAATSSVLLQLFANLDVNTIIGNKQAFINFTHNHLVQKIPMLLPKNRIVIEVL
FT                   ETVAIDQALLLNLMELKKQGYQIALDDFVFRNELAPLVDMADIIKIDVLHLDQQQIAEQ
FT                   LLPLKSFRGKLLAEKIEDKQQFNHCVNLGFDFFQGFF"
FT   gene            complement(140568..142022)
FT                   /gene="gcsB"
FT                   /locus_tag="LPC_0134"
FT   CDS_pept        complement(140568..142022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcsB"
FT                   /locus_tag="LPC_0134"
FT                   /product="glycine cleavage system protein P"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54133"
FT                   /db_xref="GOA:A5I9T3"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9T3"
FT                   /protein_id="ABQ54133.1"
FT                   /translation="MLIFELSKTGRQAKAQIPRAVGKNYSIPEEFQRKSPPRLPACSEL
FT                   QVVRHFTCLSQKNFSIDTNFYPLGSCTMKYNPRGVHKAASLPGFINRHPLAMDNESQGF
FT                   LETLYKLQNYISEITGMPGVSLTPMAGSQGEFAGVAMIKAYHQSRGDTARDEILIPDAA
FT                   HGTNPASAVMCGFKVVEIATAPDGDIDLDELKRKVGPRTAGIMLTNPSTLGLFMRQIKE
FT                   IASLVHQAGGLLYYDGANLNAILGKVRPGDMGFDVMHLNLHKTFATPHGGGGPGAGPVA
FT                   VGKRLIPYMPLPVVKKTDSGYHWATRQDYPQSIGRLSCFMGNAGILLRAYFYMLVLGKE
FT                   GLLRVSEFATLNANYLLKELTKVGYTAAYPDRRASHEFILTLNSEKKNYDVTAMDFAKR
FT                   LLDYGVHAPTTYFPLLVPECLLIEPPETESKEELDAFVAVMKTIREEASKQPDILKTAP
FT                   HTLPVKRLDDVKAARELDLNYFATHE"
FT   gene            complement(142016..142324)
FT                   /locus_tag="LPC_0135"
FT   CDS_pept        complement(142016..142324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="YCII domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54134"
FT                   /protein_id="ABQ54134.1"
FT                   /translation="MFIVQLTYLVPINEVNKYLQAHREFLDYHYKQGLLVASGPMKPPT
FT                   GGIIIAATNDRAHLESVFKQDPYYLAEIAEYQFIEFTPVKHRNELKELIQKTEGKLC"
FT   gene            complement(142324..143694)
FT                   /gene="gcsA"
FT                   /locus_tag="LPC_0136"
FT   CDS_pept        complement(142324..143694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcsA"
FT                   /locus_tag="LPC_0136"
FT                   /product="glycine cleavage system protein P"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54135"
FT                   /db_xref="GOA:A5I9T5"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9T5"
FT                   /protein_id="ABQ54135.1"
FT                   /translation="MPYIPHTPNDTKEMLEAIGAQDIQDLFDEIPASLQYAGFQNIPAG
FT                   INEMEMLKEAQNQAQKNRNGICFIGAGCYEHHIPAAVWDIASRGEFLTAYTPYQAEASQ
FT                   GTLQLLYEYQTMICELTGMEVSNASMYDGATALAEAVLMAVRLNKHSKTNRVLIAGTVH
FT                   PFYRETIETIVRNQHIEVITLPFDEQQGITDLGSLNQYTGEDITALVIAQPNFFGCLEQ
FT                   VDKMTSWAHHNKTISVACVNPTSLALLKPPGSWGEHGVDIVCGEGQPLGSPMASGGPYF
FT                   GFLSTRMAHVRQMPGRIIGRTVDKDGKTGFSLTLQAREQHIRRAKATSNICTNQGLLVT
FT                   AATIYMSLLGPEGLSQVATQCHQNTHELITALTQIEGVELAFKAPFFHEALIKLNQPVQ
FT                   YVLQQLADAGIAGGYAPEQHYPQLANTLLVCATEVRTAEDIAKYAKTLKTIMSKRGA"
FT   gene            complement(143697..144074)
FT                   /gene="gcvH"
FT                   /locus_tag="LPC_0137"
FT   CDS_pept        complement(143697..144074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="LPC_0137"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54136"
FT                   /db_xref="GOA:A5I9T6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9T6"
FT                   /protein_id="ABQ54136.1"
FT                   /translation="MNDLKFTTTHEWLREDEEEVTVGITDHAQELLGDMVFVELPEIGD
FT                   EVSAGQELGVVESVKAASDFYAPISGVVTAVNEAVGKNPALVNHDPYHEGWLVKLKPSH
FT                   PDEIKSLLSDEQYQNEIAEEN"
FT   gene            complement(144108..145190)
FT                   /gene="gcvT"
FT                   /locus_tag="LPC_0138"
FT   CDS_pept        complement(144108..145190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="LPC_0138"
FT                   /product="glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54137"
FT                   /db_xref="GOA:A5I9T7"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9T7"
FT                   /protein_id="ABQ54137.1"
FT                   /translation="MTAKTPLHTTHLACGAKMVDFHGWDMPLHYGSQLNEHHAVRNDAG
FT                   MFDVSHMTIVDILGAGGRQFLRKLLTNDVDQITHNGKALYSCMCNEHGGIIDDLIVYQR
FT                   ASDNYRVVLNSATRQNDVAWIRAKSEGFAVGLQERRELSMLAVQGPNAIAKTLSILAPA
FT                   HVDAVSTLTPFECVDVDHWFFARTGYTGEDGLEIIVPNEFITQLWNDLLNAGVTPCGLG
FT                   ARDTLRLEAGMLLYGQDMDETTTPLESGLAWTVKWEPEDRGFIGMGALVSQKQQGIKRK
FT                   MVGLTLLDKGIMRHGQKVIIEGCPDGIITSGSYSPTLQQSIALARVPVETGEQVLVDIR
FT                   GKLIPAKVGKPRFIKQGKPV"
FT   gene            145326..145793
FT                   /locus_tag="LPC_0139"
FT   CDS_pept        145326..145793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54138"
FT                   /protein_id="ABQ54138.1"
FT                   /translation="MVWPIIWRWILDLGWLCFLLILFWYFWKKRRDLVEARSWLKAKGH
FT                   VTRCEWTRVGHSVWPRIEYIYEVYEKDLTGEYLFLDTTFNTPNSKYSRSIAYKVAIAYR
FT                   DNSEIDVYYNPNRPEQSALDVTIPKKLTFILILISSLILLHIGIIVWRLLV"
FT   gene            complement(145768..146298)
FT                   /locus_tag="LPC_0140"
FT   CDS_pept        complement(145768..146298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0140"
FT                   /product="IcmL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54139"
FT                   /protein_id="ABQ54139.1"
FT                   /translation="MNKTITIALSLLLSIASKLTYAGPDRAQLAVWANEAIIATYTFDY
FT                   KNYMQQQKEIAKYFSADGWIAYSKALNQSKLPEVVQKNAYFVNAVATEPPKLITLDPTH
FT                   WQAIMPILVVYKNPQYEQKQNLKVILGFTVASPGQGVRGFSITSLQSTPTSPPCQCKFE
FT                   ETPENTKQGDAKQ"
FT   gene            146795..148534
FT                   /locus_tag="LPC_0141"
FT   CDS_pept        146795..148534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0141"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54140"
FT                   /protein_id="ABQ54140.1"
FT                   /translation="MGNSRFYFANPDKFSRFINRWDLLLLILTFSVLFFLGWAGSQMAT
FT                   PYQLGDQIPISLEPSNLPFYALRTVLRMFIALIFSILFTFIVGALAAKNRRAEQIVIPA
FT                   IDILQSIPVLSFLSITVTGFIHLFPNSLLGPECASIFAIFSAQVWNMTFGFYQSLKTVP
FT                   HDLIEVSAMLRLSAWQRFWKVEVPFSMSGLLWNMMVSMSASWFFVVLSEAISVAHQNIR
FT                   LPGVGSYIALAIAQRDLHAVGYAILTMVIVIFLYDQILFRPLIAWSEKFKMEQSPDESE
FT                   YQSWLIDLIRSSRLMKRVTEWLAVFTNSFVNARWLRIGEVKAVKEIDFKRQKRLDRLWT
FT                   ALVLIAVITGGWFLLKFILAELKVSDIFHVFLLGAATGARVIILILLSSMLWIPVGVWI
FT                   GLRPRLAQKIQPIIQFVAAFPANLFYPLFVIAIVKFNLSVEIWVTPLMILGTQWYILFN
FT                   VIAGASSIPRDLYLAADNFGLKGWIWWKRLALPGIFPFYITGAITAAGGAWNASIVAEY
FT                   VSWGNITLKATGLGEYIQASTTAGDFPQIALGTAMMCVYVLAFNHLIWRPLYRLAEERF
FT                   NFN"
FT   gene            148542..149840
FT                   /gene="abcT3"
FT                   /locus_tag="LPC_0142"
FT   CDS_pept        148542..149840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abcT3"
FT                   /locus_tag="LPC_0142"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54141"
FT                   /protein_id="ABQ54141.1"
FT                   /translation="MPETIINIENLSKSFKKAPSQHLLVLEDVNFKLQEGEIVALLGKS
FT                   GSGKSTLLRIIAGLIAPSSGTVTYRGKPVTRPVEGIAMVFQSFALMPWLTVLENVELGL
FT                   EAQGISREERRHRAIEAIDIIGLDGFESAFPKELSGGMRQRVGFARALVINPDVLLMDE
FT                   PFSALDVLTAENLKSDLLELWKEKKTNTNGILLVTHNIEEAATLADRIVIFGNDPGYIR
FT                   AELPVTLPQPRDPESPEYLALVDKIYTLMTTGPKEKAKRAQRERQIGLGYRLPDVEPSE
FT                   LSGLIETMKSFEERIDLPELADELMMNIDDLFPILETLEILGFAKVSAGDIQLSELGKQ
FT                   FSEADLQERKQLFAQRLLEKVPLARYIRRVLDEKAGHRVSEERFLSKLEDYLSEKEADR
FT                   VLKTMIDWGRYAEIFAYDFNTGILSLENPGKGA"
FT   gene            complement(150000..150614)
FT                   /gene="dsbA"
FT                   /locus_tag="LPC_0143"
FT   CDS_pept        complement(150000..150614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbA"
FT                   /locus_tag="LPC_0143"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54142"
FT                   /protein_id="ABQ54142.1"
FT                   /translation="MFKKLIALLFLMPMTALATQFIEGKDYQTVASAQLSTNKDKTPLI
FT                   TEFFSYGCPWCYKIDAPLNDWATRMGKGAHLERIPVVFKPNWDLYAKAYYTAKTLAMSD
FT                   KMNPILFKAIQEDKNPLATKQSMVDFFVAHGVDREIAKSAFENSPTIDMRVNSGMSLMA
FT                   HYQINAVPAFVVNNKYKTDLQMAGSEERLFEILNYLVRKSA"
FT   gene            complement(150625..151227)
FT                   /gene="cyc4"
FT                   /locus_tag="LPC_0144"
FT   CDS_pept        complement(150625..151227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyc4"
FT                   /locus_tag="LPC_0144"
FT                   /product="cytochrome c4"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54143"
FT                   /protein_id="ABQ54143.1"
FT                   /translation="MKKLALVLILCSSSMIFAQENPQEAGQSKSTVCTACHGPQGISTN
FT                   PEWPNLAGQHEKYFVKQLKDIKEGKSRSAPTMTAIVANLNEQDMDDLAAYYAKMPVAEG
FT                   STPKKYLKRGEQLYRGGDLNKHIAACIACHGPRGSGNAQAGFPLLSGQHAAYTVMQLQA
FT                   FKDGKRTNDLNQIMQDISSKMSPEDMEAVAYYIQGLY"
FT   gene            151302..151904
FT                   /gene="engB"
FT                   /locus_tag="LPC_0145"
FT   CDS_pept        151302..151904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="LPC_0145"
FT                   /product="GTP binding protein EngB"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54144"
FT                   /db_xref="GOA:A5I9U4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9U4"
FT                   /protein_id="ABQ54144.1"
FT                   /translation="MPINLYSKAVFLKSAARVNQLPEDSGYEVAFAGRSNAGKSSALNC
FT                   LTNNKNLARTSKTPGRTQLINLFSLDEQRRLVDLPGYGYAKVAMEVKLEWQKNLAHYLE
FT                   ARQCLRGLILLMDVRHPLKDLDQILVNWALHRELPVHILLTKADKLSRSEVKNAVLKVR
FT                   QYYELAEHLVSVQAFSSVKKDGVEELISLLDRWYEWN"
FT   gene            152018..155329
FT                   /locus_tag="LPC_0146"
FT   CDS_pept        152018..155329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0146"
FT                   /product="ninein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54145"
FT                   /protein_id="ABQ54145.1"
FT                   /translation="MTPLFPTQGPITIRQGIGGSCYLLSSLDCILNLGKDGEQLIKSLF
FT                   TQTEDGKVIVRIKRHEALKNNLQKNKMTGKYTHYVDELNNEDVFEISPERLKEIDNQYG
FT                   GVKSNSLAIKILERLVSYYYAGDWSNTNPLASVIAHDIPDRIAGFTSTAFLGKFFGIEA
FT                   EDIPYSKLDDIIKLKLMNPDEPVYISMSYGKVDGFGKFHGRHALRIDKIIPKGHGDYDF
FT                   VLINPHDNSKTETYKLDDLNKRNCRFCLFNTSIHRASLTKKLLTLSNDEGRYVFSNSGL
FT                   QKRLISLEEMNLLTDNKIISSCISLHKQIPYLEKLFLKLSVEEKKTLIACIANADGSKK
FT                   EFLKLFLTHIPAMDLLELVLREETSQELLGEVLAELALSSRVEENKLSPQAGINFNSEA
FT                   FLHLIVKSAIQQKINQFAYTPEKAKQEIESGVINFYFGGASSNLTRASGLRALFIANVF
FT                   SKKSIETLFPPKALFAKAIANYLTLKTLPDLLIEYLKSQDTSPIDEEFFDIVLTSATFK
FT                   DPDELFENLFRLSQISPEVAKALLVFASQKINVLFGISLEEYAKKIALKDSGEFKSWFE
FT                   SLSNPQPAIQIPEIDKVLRQQRVEDAKRVISDIVQRINSFSFSFEGFKTVAHLNLNAEE
FT                   LRSQLKKIVHSGELQNALQILDLPDGHPEVQKALERKLRMIDVAANRRLDFLKKYEADI
FT                   DEHVRRIKDFPIDFNGAGTIVAIESQRILLNKRLHTLVKAEDLLGERLIANPKIKMVYF
FT                   AQVEKINLRAELLQKQLLDEAQKVIDSVEKRIDNFVIRFNDISTSSAVEWQRNNLLQQL
FT                   DNLVKPNQALLGAEKVLDCNDLQPSIVRALQAKKQEINETADQLIIKINAEEVVKSYEK
FT                   QIREFPISFNRCQTVEEVITRKQDLIQSVRNLVGNKPDLLKAQEQLQLLSGEYHSDIKM
FT                   ALTDKVREINRQADAVSKRITDQIAATKETLNILAEIKFSDHLKIIESMVKTLEAKAVG
FT                   DKNYKRAAPIARAFYNNLLMAEERFKNSQLPKNVKCKDFHQACARAINAVIPVLEIHRG
FT                   WKQVFADLASALVTLCTLGGANLYAGRWRLFPVPTESEKIVKDFSVSMQPLAVRA"
FT   gene            complement(155426..157309)
FT                   /gene="acsB"
FT                   /locus_tag="LPC_0147"
FT   CDS_pept        complement(155426..157309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsB"
FT                   /locus_tag="LPC_0147"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54146"
FT                   /protein_id="ABQ54146.1"
FT                   /translation="MLPVHLKHPHLTPTEESLSEFWSEIAAQTIDWIQPWSITLQGGLH
FT                   KGDVKWFQGGLLNVSANCLDRHLPHKANQTAIIWEGDDENQNKTLTFAQLYSEVCKMSN
FT                   VLKSLNVRKGDTVGIYLPMIPEAAIAMLACARIGAIHTVVFAGFSAHALQQRLTASSCK
FT                   CLITVDAFQRGGKTIPLKKQADEASVDLNITKLVVKNSNVPMALNKNKEHWWHELKQTV
FT                   SDQCTPEPMNAEDPLFILYTSGSTGQPKGVVHTTGGYLVQAAYTHQLIFACQDNEVFWC
FT                   TADVGWITGHSYVVYGPLCNGITTLMFEGIPTWPDAARNWRIIDKHQVNVFYTAPTAIR
FT                   SLMRAGDQWLNSSSRNSLRLLGSVGEPINPEAWNWYHQKVGQGKCPIVDTWWQTETGAI
FT                   MISPRASDEVIKPGSARKPIPGIIPLLLNEQGHEINGSGEGFLAIKYPWPSMARTIAGD
FT                   HQRYCNTYLSNGYYITGDGAKRDEDGDYWITGRIDDVLNVSGHRLGTAEIESALVSHPK
FT                   VAEAGVVGIPHDLKGQGIFAYVILKQGNKPDAKLQTELMERVKDEISAIAKPDVIQFVN
FT                   DLPKTRSGKIMRRILRKIACKEVSHIDELGDLTTLANPQVVEELMKNVLRQ"
FT   gene            complement(157311..158207)
FT                   /locus_tag="LPC_0148"
FT   CDS_pept        complement(157311..158207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0148"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54147"
FT                   /protein_id="ABQ54147.1"
FT                   /translation="MANIGFVGLGHMGFPMAINLLKAGHSVMGYDLQQSALEHFAEQGG
FT                   AIAHNLQELAKDKDVIVTMLQTGQQVLHVCLGVDGIFSQLNAGSLYIDCSTIDVKSSRE
FT                   THQIAKENHLLVVDAPVSGGVAGATAATLTFMVGGEAEAYNAAHPILSAMGKKIIHTGG
FT                   AGSGQAAKICNNMILGTTMIAISEAFILAKELGLSDGKLFEVVNNSSGQCWAMSKYVPV
FT                   PGILENVPANNDYKPGFAANMMLKDLLLSQNTAKSVHIETPLGAKTTEIYQQFVDQGLG
FT                   DIDFSAIIKHIGKTQEV"
FT   gene            complement(158231..159730)
FT                   /gene="mmsA"
FT                   /locus_tag="LPC_0149"
FT   CDS_pept        complement(158231..159730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="LPC_0149"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54148"
FT                   /protein_id="ABQ54148.1"
FT                   /translation="MGYNVPHYIGGQLINETDTEAQAIYNPALGEIIGQVHFASKATCD
FT                   RAVAIAKAAGNEWSQTPAIKRARVLFRFRELLEKYQMDLARIVTREHGKTLDDAKGSVA
FT                   RGIEVVELHCGLVNELKGDFSAEVASHIDCHTFRQPLGVCAGVSPFNFPVMVPIWMMIP
FT                   AIACGNTFILKPSEQNPSAPVRLLELLSDAGLPPGVANCIQGNKTTVEHLLTHPDIAAF
FT                   TAVASTPVAEYIYTTAAAYGKRAHTFGGAKNHCVVMPDADLDQAANAIVGAAYGSAGER
FT                   CMALSVVVTVGQHTADALINKISPLIRAIRVDAGDVEGTDMGPLVSQAHRQRVLAAIEK
FT                   GVNEGARLIIDGRTFQHPQYPQGFYLGPCLFDEVTEEMSVYQNEIFGPVLVIVRVNHFE
FT                   EALALVNKHQYGNGTAIFTRDGFTAREYSQRVQAGLVGINIPIPVPIANHPFGGWKRSV
FT                   FGDTNMHGEESIHFYTRRKTVTSKWPITELKDSSFAMPTHD"
FT   gene            complement(159841..160017)
FT                   /locus_tag="LPC_0150"
FT   CDS_pept        complement(159841..160017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54149"
FT                   /protein_id="ABQ54149.1"
FT                   /translation="MKSIEDFTGFSESGIDDAIQNALKKAGNPTHFEVVETLGSQDSQS
FT                   DRRYRVTLKTLSD"
FT   gene            160195..162663
FT                   /locus_tag="LPC_0151"
FT   CDS_pept        160195..162663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54150"
FT                   /protein_id="ABQ54150.1"
FT                   /translation="MGKGIILRVLENTILSPQVFDTLERLLPGYKVEYFKEQPDYRKSI
FT                   ARRIDSLHDAFSFILKAYPLDPKHTSLTVATLSTYAAECKASCDLEKLTLEELHLELER
FT                   FTAKLVEAIAIAWKWPKGKAVKEAIASLNEAEQYVLMSRGRSDIATIMPIEMGSETKYV
FT                   LQYDESLSPVYEQWLTELKQLKEYNFPKTPAWFKNLPPYQQAYYCNLNLSSVDPKKALQ
FT                   HFNTFFGNWGDIAKRSLNLTTELNQIHTNSPPYPSWFNELSPAQQAMIRVLSATPHEIK
FT                   SSLKEFKKFMVEQARNDQYASTLSLVPKLPQWYWVLSEQQQYFLEYALKNAEKVEDVVS
FT                   YLSSRHRTLPAPANYGAHSLYLIDGEGKETLFYDKRYRSSHVASRDSLKFPEDVQQRHV
FT                   DSNLVKVMEFAKPQQPLLLQTLISPIHAVDYIPTVVTDFLPELPPDLELYKIAREAVTR
FT                   SKRRHEIFQHNHPFNIAKRYYYTQATDTDSEFLLKAAQKYVSSKLGLQALIDDYKAVLE
FT                   SPLGSATFWDYDGRELFLSSLEELIILNMGGYSYGSCVSGKDRKAVELLHTDAMILYKA
FT                   KYGNWPKFGIPKEKQERVNFINIVVDLYISRHQHELAGQNAPGSEGIKTPDWYWPNDIA
FT                   EAINERLGTEKALAYDDRLATDNEVKNISKDLRSFFLPENELHCLLIAKQLGEKMCTML
FT                   YDVLSALINEERRFQKSSKDSWKLRWFSDKDVSSTPTGILNIREVMHDENSGNDNVLRI
FT                   GKIFAAVLNRPESDSSRTTATNSVYDRIRKLLQPLSSESTLQTLAEEAILEWSSLFESS
FT                   KRENSGLVYM"
FT   gene            complement(162767..163498)
FT                   /gene="dapB"
FT                   /locus_tag="LPC_0152"
FT   CDS_pept        complement(162767..163498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="LPC_0152"
FT                   /product="dihydropicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54151"
FT                   /db_xref="GOA:A5I9V1"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9V1"
FT                   /protein_id="ABQ54151.1"
FT                   /translation="MRTRVIVNGANGKMGILACETLENHEQFEVVAKLSRQDNLGQSIL
FT                   DTKAQIVVDLTRADCVYENSLTIINHGARPVIGTSGLVETQIDELTKLCEIKQIGGIIA
FT                   PNFSLGAILMMMLATKASEYFSEVEIIEGHHQQKLDAPSGTALKTAEMIAAARKKPKNK
FT                   LPLKELTPGARGGSHHDINIHSLRLPGLLARQEVLFGNIGETLSITHNSIDRHCFMPGI
FT                   VLACQKVLNLTNLVYGLEHLL"
FT   gene            complement(163678..163863)
FT                   /locus_tag="LPC_0153"
FT   CDS_pept        complement(163678..163863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54152"
FT                   /protein_id="ABQ54152.1"
FT                   /translation="MRIILSILAIFMPWLVLLIKDNPGGAVVALIMQATLIGWPFASIW
FT                   AWRAVNPLTPASQSKQ"
FT   gene            164220..164912
FT                   /gene="proQm"
FT                   /locus_tag="LPC_0154"
FT   CDS_pept        164220..164912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proQm"
FT                   /locus_tag="LPC_0154"
FT                   /product="activator of ProP osmoprotectant transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54153"
FT                   /protein_id="ABQ54153.1"
FT                   /translation="MRKQALHPRTAVINKAQKNQSKRARSDALLWLAANFPEAFDNSLR
FT                   IRPLKIGIMSDILQHAEKAEQVGISKSKLREAVVLFTRRLDYLACLKAREVRIDLHGNP
FT                   VAEVTEEEAENASMKIKKRVEKSVKNARKQVNAKAANHSHVNNQPSTVSSVKPMNSFDS
FT                   HPEPLLPIYPLRSSTYASQNVAMQSAKSPSVVVKHKAPKQYDPDAVARLKEKLGLSRKA
FT                   EDKKETTE"
FT   gene            164913..165983
FT                   /locus_tag="LPC_0155"
FT   CDS_pept        164913..165983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54154"
FT                   /protein_id="ABQ54154.1"
FT                   /translation="MRIATLFSAVLFISPLWAAPKFFPSQPALNGVYDIKGTELCSTAK
FT                   HTLAYLNKGKNYDPQVIHDGKVIKISLDRVKKTLEFICQNQKKLNNPDFVKQHFDFIRW
FT                   YPDLRQAKQLSANKPLLQNIPKDKILMTKYFVHLAGASPKPSSAKPYPLYALPEDEQNL
FT                   TLDEANAKPGLIRFKYGKQAILSGALKNQPVSELAYLSRDDLEAALLQGTVVADFGPTA
FT                   GKKIFNVHRSNNITYDRTKTPYQQERFWYFKEVDGIKGYGKDAEYKITVNPKVTFAADL
FT                   AEFGLGKLLMIQYQDKSGRPMTKMGILADTGGAFNNNLYQIDYLAGSFAGKDALYRATR
FT                   DLPDYVDAYFMILKQP"
FT   gene            complement(166083..171680)
FT                   /gene="sdhB"
FT                   /locus_tag="LPC_0156"
FT   CDS_pept        complement(166083..171680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="LPC_0156"
FT                   /product="SdhB protein, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54155"
FT                   /protein_id="ABQ54155.1"
FT                   /translation="MPDKKSSETLLSQQINEVRGLLLQALKTQLDDLVAEKLIPQPSGV
FT                   PFVDFEKDPPQIATLKKVINCLYHAEEAFKSWESIDTSTLLGKAKAAPKLIHALTQIYK
FT                   SLGLLDEASPEIRSVIADNYHLLEPLFTQAYAIVQESGWLSEFMEMDVTDKASKVIFQG
FT                   MDLLGPDVDKWHDTHPLVDAFSKISKLVETISTLQEKDMPGKEKEQAVELIRALLDDLD
FT                   NNPFISKLSISDFEDSKAIKDLLEWFKNIQDDGFDFSKKSIKQYVSWANHYLPTLIAFA
FT                   DQLERQNYLKPGSLSANLCSQIEHLGKQVNDILSEPGFGVTERVVTIDSLQGQREQKIH
FT                   NAQVKSVQVIMATEKQLAATADFYQILEAYKGMNLSQITEPDRRVLRQLYPQIQTALAH
FT                   ASLDLENQLTSVLNTTGPEKTPAKPKSWWELAKDGLGYVASYVVNYNVDKILGTRESVD
FT                   RFLSSQIASEQFKILIAEKAREKLRTGSDKIKETALQYQAEARLNAIKSTLRKQPSQME
FT                   APPSEFVAVKPSKLVNLRGTLTAIQEMQLSTTVNGTRTSVDTLIHRHLPEKYQACFSTL
FT                   PYQINENDPELVKKIKTVENNLFQLEKALKDFEKIDLSYGIMIRLHYFIAIASAASKLK
FT                   SSVKELPPEGQKALAPLLQQIMTLGLSFSDTNYTANDLSALQQLKMEGEVRPKSPSVAS
FT                   PDTIGTLPEETGKRTVKKPKEKTTELLDYADKISNARASLLNKFKNTLSPALADSLNPQ
FT                   KNGVPFVHLDQDPPQIAAIKKIINSMYHAECALKTWHGIDTSTTLGKVAAAHQGVAALS
FT                   QVYKSFTLFTEDFSDIHNLIRENHDLIAPVIIEANKLVNQYGWARQFSELDIAQQLGSI
FT                   LGQGINTVQPKTDEITQTASLVKLFSEIPRLLNNISSSLDQKSEKSIDELKISNKKIEA
FT                   IGAVFELFFEENAHLMSMFKGFSAISGLIELNKKIQLEGTNLQEVTIRQYQSWLKEGYP
FT                   NLMMILDEIETRHYLTPGFLSAPIALELDQINDKLNEIIETKPDFKLQKIPLSFYMGDK
FT                   RIERLMTKKTEHCLAVLQIEEQKKAVNTFFGILKHYSDQPLSNIKPNELAQLRLAFVEI
FT                   QSAMANSNLELSNDFVAALNQLETSPPEKTKKIQVTVSQLLKVQPAVETYLNEHKKSSE
FT                   LKIAVIDKAIEHVKDKSFELKSGASKEINIPQLRKTFLETESKKPVVGPGELKPTSVSS
FT                   LNTVRGNLAYIQELKISSTVGMMREQFSALTRDNFSNRVQKYLIKPQDKPLHMINDNDP
FT                   LMVRQIKEVENGLYHLETALKQFEQMKKSDSLVSQTKALLEIANHALQLKMAVERFSPE
FT                   LKEHYGPLVRTVLSFSNKIQSINYNKEDWADLQFILNRAHKELLKRKTPRDHRIEKAFF
FT                   EAGVREVQIDRDESVGKKAAKLGVKYAHLASPQLEKARAYLSSRYKNAFGQQPKVIRSF
FT                   TREQLANEEFMDAEISRLKETLEEKYGFNIATIKVLLDLLEQIQRAGAQAAEVAGMVNT
FT                   LVTYDFPKIKENAYRDLLTKLSQEEDYLNLKPGTLINPAMAAVNQLFLSAALELDMPFS
FT                   KKLSILDDTTYVNILIRQTESDLQTLKEKLSEDPSNHEIAFEIEIKNDKLAFLRQQMVL
FT                   LEDKNPNQTRNVLMDMQFEVSLRNHLVYTTLKAPIAQEYEQIAIEYYKKNKNRFLYADD
FT                   CSKELLQGLKEFEKKHLPDHLIVFEAYDRLRLFSAKLPPKNQDVKEYIENINRELQNRD
FT                   IPIRQRALKVKLLPNDTVFIEKLISADKGTHFLRKFMQFITIITASITEAIKTGGSLVY
FT                   IYRQKQMEQSIKNIEKSISFKEELHTIKDPDGPSPRKEEGQEGEIEFTKL"
FT   gene            complement(171802..173226)
FT                   /gene="pykA"
FT                   /locus_tag="LPC_0157"
FT   CDS_pept        complement(171802..173226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA"
FT                   /locus_tag="LPC_0157"
FT                   /product="pyruvate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54156"
FT                   /protein_id="ABQ54156.1"
FT                   /translation="MLRRTKIVATLGPASKEPEILRSMLAAGVNVVRINFSHADSSALQ
FT                   LIALVRKIADELNHPVAVMADLQGPKIRVGRFQNKSITLIDGQNFTLDCMAPDTLGDIN
FT                   GVSVAYPNLANELSISDHLLINDGLIELEVIEISGSKIHCKVVEGGVLTDLKGLNRKGG
FT                   GLAARTLTEKDRNDLRTAIEAEVDYISLSFVKDAEDIRQARALMKDYGAQITPIIAKIE
FT                   RMEALDHLTDIIREADAIMVARGDLGVEVGAAEVPAIQKHIIEQTRLLDKVVITATQMM
FT                   ESMISNPQPTRAEVSDVANAILDGTDAVMLSAETASGLFPVKVITMVNKICLSAEKHAS
FT                   FFYHSDLETCHYQRADQAIAMATMHTANHFPIQAIITLTESGDTALWVSRHHSTVPIFA
FT                   ISANKRTIGRLSLVNNVFPIYIDFHQFNPEGLNQQILHELIKSGHLEKRGYVLLTRGTQ
FT                   IGMPGGTNCMEIIPVV"
FT   gene            complement(173210..174400)
FT                   /gene="pgk"
FT                   /locus_tag="LPC_0158"
FT   CDS_pept        complement(173210..174400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="LPC_0158"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54157"
FT                   /db_xref="GOA:A5I9V7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5I9V7"
FT                   /protein_id="ABQ54157.1"
FT                   /translation="MNLIKMSDIDLSGKRVLIREDLNVPIKDGMITSDQRLQAALPTIK
FT                   SALDSGAAVIVLSHLGRPEEGKYEKKFSLEPVADYLRENLEYPVRFVKDYLTGVDVNPG
FT                   ELVVCENVRFNPGEKGNDEALAKKLASLCDVFVMDAFGTAHRAQASTYGVAQYAPVAVA
FT                   GPLLIRELEALNQVLKAPKKPIVAIVGGAKVSSKLSLLKQLVGMVDVLIPGGGIANTFL
FT                   KAQGFEIGISLYEPDLLDEARHILILAKEKGCQIPLPTDVVVGKTFSETCPAFNKSLSN
FT                   VAADDMILDIGPETIRDYVDLIHEANTIIWNGPVGVFEFPQFAYGTRAIAIAIAESDAF
FT                   SIAGGGDTLAAVDLYDLNQQISYISTGGGAFLECLEGKTLPAVAILQERAKHVKTN"
FT   gene            complement(174411..175403)
FT                   /gene="gap"
FT                   /locus_tag="LPC_0159"
FT   CDS_pept        complement(174411..175403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="LPC_0159"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54158"
FT                   /protein_id="ABQ54158.1"
FT                   /translation="MTIRVAINGYGRIGRCILRSIFEYNRQNEFEVVAINDLSGIDVTA
FT                   HLTRYDSTHGPFRSDVSIEGNMLIVDGHGIQVIAERDPAKLPWKQLDIDIVFECTGFFT
FT                   SRDAAMGHINAGAKKVLISAPAKGVDTTVVYGVNHSVIKASDVIVSNASCTTNCLAPVV
FT                   KVLNDAIGIESGLVNTVHAYTKDQMLLDGSHKDLRRARSATQSIIPTKTGAAAAVGLVL
FT                   PELAGKLDGFAMRVPVLNVSVVDLTFQAKRATSVEEVNDIMRKAKSRILQINEDPLVSC
FT                   DFNHNPASAIFDTTETKVIGNLVKVVAWYDNEWGFSNRMIDTAHQMMNC"
FT   gene            complement(175485..177491)
FT                   /gene="tktA"
FT                   /locus_tag="LPC_0160"
FT   CDS_pept        complement(175485..177491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="LPC_0160"
FT                   /product="transketolase I"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54159"
FT                   /protein_id="ABQ54159.1"
FT                   /translation="MNSFTELANAVRMLSIDAVNQAQSGHPGMPLGMADIATVLWKKFL
FT                   KFNPKNPHWFNRDRFVLSNGHGSMLLYSLLHLTGYNLDINELKNFRQLHSKTPGHPEHG
FT                   HTPGVETTTGPLGQGLANSVGMALAERVLASHFNHDHYNLVDHYTYTFAGDGCLMEGIS
FT                   HEACSLAGTLGLGKLIVFYDDNGISIDGKVESWFTDDTTSRFKAYNWQVIGPIDGHDAA
FT                   QIEQAISAARENTTQPSLIICKTVIGLGSSVAGSEKAHGSPLSAQDINNVREFFNWKHA
FT                   PFEIPDSIYKQWDHREQGEKEEQQWLQLLHEYRQQHPSEHDEFLRRANGDLPDDWQEIS
FT                   AGFLKQCLNNEKAIATRKASQQCIEFFAPILPEMFGGSADLTGSNNTDWSGSKAITAHN
FT                   FSGNYLYYGVREFAMAAIMNGLAVHGGFIPYGGTFLVFADYARNAIRLSALMKQRVIYV
FT                   LTHDSIGLGEDGPTHQPIEHIAMLRMTPGMTVWRPADLMETAVAWQQSLEHHNGPSALL
FT                   LSRQNLPALAHGADAADLIKKGGYIIADCEGKPDAILIATGSEVQLAITAAEKAKARGL
FT                   QVRVVSMPCAERFLAQSDAYKNQVLPGQVRTRIAIEAASSAYWHQFVGFDGAVIGLDCF
FT                   GVSAPATDAFNYLGITVEKIINTLDTLTKQTMV"
FT   gene            177749..179083
FT                   /locus_tag="LPC_0161"
FT   CDS_pept        177749..179083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0161"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54160"
FT                   /protein_id="ABQ54160.1"
FT                   /translation="MTPIISHLLKIFPELNTQVKTDSLNWTFNTHLKQLGPDFYSKVAR
FT                   LHPILNVEYSVLCQRLRHNLSSPDYSSLEQIKEQLIDALKLAELLEYTYQHYLVVPREV
FT                   VRLRRHKAIYRELLTELSGYSFALDNPEPESLKTSLSLTQAIREKTAQSNWYRIFISRS
FT                   KRVINLLDNLDTGSKAFRDFVVLLDKYTNPFLAYLGWCFFAPRLFTNLFLILKHTIPGE
FT                   WMGEKEKSLDWSDRFYAHLQRRWFELANDSVWFTVGILNCFVLVGALAPLSVYLSLFAF
FT                   VFDVANTSLRAYIEIGRLQQLQKEYGELFDQEENEDQKKIIKEYQDSISYRIKFEILRS
FT                   FLSVGGAVAVVIAMALSVPALGIINPVIPLIGAVLLLALWGVSLYLNNKLDEYRPVDNI
FT                   EKPAPSVINKLSFFAPKNEKKESLHLSSKPEKDLEAEELIPTFTF"
FT   gene            179183..181198
FT                   /gene="prlC"
FT                   /locus_tag="LPC_0162"
FT   CDS_pept        179183..181198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="LPC_0162"
FT                   /product="oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54161"
FT                   /protein_id="ABQ54161.1"
FT                   /translation="MSTTVGLPQFSHIKIEHFKSHLDALLKNHLEEIDRLLKENHHYTW
FT                   DNLIYPLDSLADELERFWSPFAHMHAVMDSEAIRESYEACLPLLSAYDAAIGHNQDLYE
FT                   AIKSIDQHSLNPAQKKIIADSIQDFELSGVALSKANKKRFEAIQSRLAELSSKFENNVL
FT                   DATHAYTIHITEAERVAGLPEHALNTAKELAHEKGLDGFVLTLEYPCFQAVITHAEDRA
FT                   LREEMYRAYITRASDQGPNAGTFDNTPLIDEILSLRHEKAELLGFNNFAELSLATKMAA
FT                   STNQVTEFIYDLISRTRDKGKTEFRQLEVFAQDKWNLSPVNPWDVAYLSEKRRQDLYSL
FT                   SQEELRPYFPQPKVMQGLFAIVKKLFGMSIEEIEGVDVWHKDVQCYCIVDESNQTRGYI
FT                   YTDLFARPHKRNGAWMDSMQSRRKLEDGTVQLPIATLTCNFAKPSANRPAMLSHDEVVT
FT                   LFHEFGHCLHHVLTQVDYLGGSGINGVEWDAVELPSQFFENWCWDEHALSLLTSHVDTG
FT                   ETLPSALYERLIAAKNFQSAMAMLRQMEFALFDFRIHQEYQTGKASYVANILADVRSKT
FT                   TVVPIVPYNRFQHSFSHIFGGGYAAGYYSYMWAEVLSSDAFARFEEEGIFNPKTGHDFL
FT                   KSILEAGGSRKAADAFLEFRGRPATIDALLRHNGIL"
FT   gene            181312..181422
FT                   /locus_tag="LPC_0163"
FT   CDS_pept        181312..181422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54162"
FT                   /protein_id="ABQ54162.1"
FT                   /translation="MPAFYVIIKVYRMGGDLASTWVAKPEVHAEKEISRK"
FT   gene            181809..181970
FT                   /locus_tag="LPC_0164"
FT   CDS_pept        181809..181970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54163"
FT                   /protein_id="ABQ54163.1"
FT                   /translation="MSLQLIKRCFSWSFVGYKMPQKSPTILKFCPSGAPKAHSKIGNIG
FT                   LLFIQQLW"
FT   gene            complement(182031..183335)
FT                   /locus_tag="LPC_0165"
FT   CDS_pept        complement(182031..183335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54164"
FT                   /protein_id="ABQ54164.1"
FT                   /translation="MGDILPNSPDIQKPELQQHEIVLRLFVTQLNTGYKDGWLYYKCKE
FT                   KDLLSVYNEYRSKGFFNLLKSNAKDGFDKPKLTIELVPKTCWFSNVRSNVTPSQWNKLK
FT                   KISSQEANHRCKICGGKGPKWPVECHEIWEYDDSRLVQTLKGLISLCPSCHSAKHMGFA
FT                   QLCGREVEITCHLAIVNKWSYEFACEYISEQFKVWENRSKYTWLLDISWLEQHGILVEN
FT                   QDRIDTLYTNINKAKREYFLNNRKAAIDHFNQGANFEKSGNYKKAYSEYLAASNFGDFD
FT                   AAYNLAIFYSRGDLGEVDLRKSWYYLKKAACLGDKQASTLIQKGKQHFERSINKKADCV
FT                   KKESSQLPEDIEKHQAVLINNTSENDYTSMVHSSTLEEKDSNSNKQAAFNETSQSKLVY
FT                   EHAFKNYENVFLRSLKIIRKSFKKWANRSSPSNSS"
FT   gene            complement(183470..184129)
FT                   /locus_tag="LPC_0166"
FT   CDS_pept        complement(183470..184129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0166"
FT                   /product="phage repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54165"
FT                   /protein_id="ABQ54165.1"
FT                   /translation="MNIKKEIGKRIFEARKEKGLTLKELGELTGGLKQTRLTNWEQGTR
FT                   APGPEEIKLLAQALDVSPAFLMCLSDDQQVKRTKSYSHLIPLLDHHQACDAKSFIEAIS
FT                   DQGSAGDVVWISVSATLIQELSSEAFALKMPDESMMPELRLNDVLVVEPSVTPCPGDFV
FT                   VVKLANKLEAIVCQYRETTYTEFELVTLNDNWPNIKNTKEFRIEIIGKIIENMRLY"
FT   gene            184300..185184
FT                   /gene="lvrA2"
FT                   /locus_tag="LPC_0167"
FT   CDS_pept        184300..185184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lvrA2"
FT                   /locus_tag="LPC_0167"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54166"
FT                   /protein_id="ABQ54166.1"
FT                   /translation="MMDFVINGEELEAMSGLPHIQQLAYLRGIRPYMDVKTGITGIKRR
FT                   ISYQSIAEQLYIEPHQGIKSQSFSRDQVRRAISGLTRAGLIEVQSEGKQLILKCPLASR
FT                   HFSVQNKAAINPPQKATIKPHEKNLVNTGFSEKECTKADTVEPPKAATPLKDNNYIYLL
FT                   SAFEQFWNLYPEKKSRERAFEAFKQINPDQHLLRTMLQALQNQIKARNAKEAHGGWVPP
FT                   WKYPTNWLAQKCWEDEVNIDLKQEKRNAKRRSSTETTARDPFWNPETEDTASIAEEEYE
FT                   HDNVVNLQRYRQQ"
FT   gene            185201..185512
FT                   /gene="lvrB2"
FT                   /locus_tag="LPC_0168"
FT   CDS_pept        185201..185512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lvrB2"
FT                   /locus_tag="LPC_0168"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54167"
FT                   /protein_id="ABQ54167.1"
FT                   /translation="MFTRFAVFYGHLWRSQFKSDGFLEFAKKEWLEGLSQFNDEILHQA
FT                   IIECRDYCEMPPSLPQLIGICRDIKKRNHFYVTPKEYTPASKEVVKTNIKQCKAFLFK"
FT   gene            185531..185797
FT                   /gene="csrA"
FT                   /locus_tag="LPC_0169"
FT   CDS_pept        185531..185797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="LPC_0169"
FT                   /product="global regulator (carbon storage regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54168"
FT                   /protein_id="ABQ54168.1"
FT                   /translation="MLVLTRRVGESVVIHDDVYCTIVGYRDGEVRLAFDAPRSIPVHRD
FT                   EIQRRIHRARIKDNWFIDKAANKESIVDRLINKFKNSTSAVKA"
FT   gene            185810..186775
FT                   /locus_tag="LPC_0170"
FT   CDS_pept        185810..186775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0170"
FT                   /product="LvhB11"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54169"
FT                   /protein_id="ABQ54169.1"
FT                   /translation="MNVDNEPLVTVKDRAKEKLRRELGDLIGNVLNDPKTVEIMCNADG
FT                   KIWQERLGESMRCIGNITVARAESIIKTIAGFHGKEVTRFKPMLEGELPLDGSRFAGQL
FT                   PPVVSGPTFAIRKKAISVFTLDDYVQSEIMTPAQCEVIQQAVANHRNILVIGGTGSGKT
FT                   TLVNAIIDEMVKSAPEERIFIIEDTGEIQCTAENCIQYHTTLDVSMTQLLKTTLRMRPD
FT                   RILVGEVRGGEALDLLDAWNTGHEGGAATLHANNCIAGLHRLKSLITRNPAAPSEIEPL
FT                   IGEAVHCVVHIARTPAGRRIEEIISIHGFDKGRYRIEKLV"
FT   gene            186788..187165
FT                   /gene="trbC"
FT                   /locus_tag="LPC_0171"
FT   CDS_pept        186788..187165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbC"
FT                   /locus_tag="LPC_0171"
FT                   /product="Conjugal transfer protein trbC"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54170"
FT                   /protein_id="ABQ54170.1"
FT                   /translation="MTQVSTLNYKKMWMMGLVVLFLLFITHPAMASTAGGGLPFDSWLT
FT                   KIQKSITGPFAFSAAIIGLVAAGATLIFGGDMNGFMRTLVFFVLVLSFLVAAQNTMTAI
FT                   TGKGAEISKPSTEVNAAEHQL"
FT   gene            187162..187461
FT                   /gene="trbD"
FT                   /locus_tag="LPC_0172"
FT   CDS_pept        187162..187461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /locus_tag="LPC_0172"
FT                   /product="Conjugal transfer protein trbD"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54171"
FT                   /protein_id="ABQ54171.1"
FT                   /translation="MSLRTIPIRKCGNRPNLFLGGDRELVMFSGLLSAILVFAAQDWLA
FT                   AIAGMVMWFLSLKGLRLMAKSDPFMRAIYLRQRSYQAYYAPRSTPFRENKRGYQ"
FT   gene            187458..189995
FT                   /gene="trbE"
FT                   /locus_tag="LPC_0173"
FT   CDS_pept        187458..189995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="LPC_0173"
FT                   /product="Conjugal transfer protein trbE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54172"
FT                   /protein_id="ABQ54172.1"
FT                   /translation="MIPVITFLLSLTGLIFLSFLFYQTRLNSQTHHLKKHRQQKAGFVD
FT                   LLNYAALVDDGVIIGKNGSFMAAWLYSGEDHANSTDKAREMVSFRINQALSAMGSGWMV
FT                   HVDAIRRAAPSYSERGCSHFPDPISLAVDEERRQLFERLGTLYEGYFVITLTWYPPVLA
FT                   QKRFEALMFDDNQARLSQKAKTHQLIEEFKQSCRNFESRMSSALNLERLQSEKIINEQG
FT                   STVIQDNFLRHLQFCATGLNHPVNLPKNPIYLDALIGGQELLTGITPKIGKKFIQCVAI
FT                   EGFPMESYPGILTALTLLPIEYRWSSRFIFLDAHEAVAHFTKFRKKWKQKVRGFFDQIF
FT                   HTHSGAIDEDALNMVEDAQAAIAETNSGLVGQGYFTSVVILMDEDRALVEKAALFIEKN
FT                   INALGFTARLETINTMDAFMGSLPGHGVENIRRPLINTMNLADLLPTSNIWTGENKAPC
FT                   PLFPPLSPPLMHCITSGNAPFRLNLHVRDLGHGIMFGPTRSGKSTHLGLIALSWRRYKD
FT                   ARIYSFDKGMSMYPTCKATGGEHYTIADKDSKLAFAPLQFLSTSADRAWAMEWIDTILA
FT                   LNGLNTTPAQRNEIGHAVISMHKSGSKTLSEFVMTIQDEQIRETLKQYTIDGLMGHLLD
FT                   AESDGLGLSSFMTFEIEHLMGLGEKFALPVLLYLFRRIETSLDGRPTLILLDEAWLMLA
FT                   HPVFKNKIAEWLDSMAKKNCVVFMATQHLSHAANSGILDTIVESTATKIFLPNLYARDP
FT                   ETRLIYERMGLNPRQIDIIASAQPKRDYYYVSEKGQRLYQLALGPLALAFVGATDPDSI
FT                   ERMKQLEDKYGAEWVSFWLSEKGVDIKSHGVAA"
FT   gene            189992..190735
FT                   /gene="trbF"
FT                   /locus_tag="LPC_0174"
FT   CDS_pept        189992..190735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="LPC_0174"
FT                   /product="Conjugal transfer protein trbF"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54173"
FT                   /protein_id="ABQ54173.1"
FT                   /translation="MNKLKQWLNRLNTECKKSNLTDNPYLNAKRAWNVHTAGLMKSLQV
FT                   WQLVGLGSLLITLAAVGGLISIGSQSKFIPLVFQQDANGNTLSITRADRISQPSIDDYR
FT                   ATAAHFIENIRMVSADVELQKKAVFQVYSYLNQNDAALAKVQEFYNDKQHSNPFERAAH
FT                   EIVNVEIRSVLQESDKTWQVDWVETVRNRDGSIKEKPYVMKAMLTMYQDETLNDISSES
FT                   ILKNPHLIFIRDFNWSYDLKHGESR"
FT   gene            190732..191607
FT                   /gene="trbG"
FT                   /locus_tag="LPC_0175"
FT   CDS_pept        190732..191607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="LPC_0175"
FT                   /product="conjugal transfer protein trbG precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54174"
FT                   /protein_id="ABQ54174.1"
FT                   /translation="MKKIILSIGLLLPFSIFAQDNDELSNRYFSQSMPKLTYQETQALK
FT                   IAGKWQKGDKTSKPFQSSDGSVSFVYGSGQISIVCAPLQVCDIALQPGELFNDMNVGDP
FT                   RFIVEPSITGSGRNQQIHLIIKPKDVGLDSSLVVTTDRRTYHFRLKSERFEFMPYISFI
FT                   YPDEAKEKWRLIQKIQAENRKANTFPETNEYLGNLNFNYRIQGNARFKPVRVYNDGVKT
FT                   IIEMPKAMAQFEAPALLVLRKHGFLQKSKPVMVNYRLQGCRYIVDSVFDKAMLVVGSGS
FT                   AQEKITITRC"
FT   gene            191610..192020
FT                   /locus_tag="LPC_0176"
FT   CDS_pept        191610..192020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54175"
FT                   /protein_id="ABQ54175.1"
FT                   /translation="MKKLSILLLTVLLSSCASMRYGNFTNASTAKDAYLAKDAVSQLTR
FT                   VYPPAQNTFCFRQKICDGFGRHLIQAMRQKGYGVIENVHPRQKANFFYVVDEAEPGRMY
FT                   RVSLYIGPQILSRAYANTRGKLAPISPWSHKE"
FT   gene            192026..193267
FT                   /gene="trbI"
FT                   /locus_tag="LPC_0177"
FT   CDS_pept        192026..193267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /locus_tag="LPC_0177"
FT                   /product="Conjugal transfer protein trbI"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54176"
FT                   /protein_id="ABQ54176.1"
FT                   /translation="MHKNNDYLSPDSSPQKLQTTGVKRVNNMPLFIAIGVLTVFVLLIA
FT                   FVALKRANAQNLVTEPAKLTTAKKNTMSLAYEVIGNRKPETNQPVVNAPEPTLPVPPPQ
FT                   NTHENQSLDAQSVPDAEMERIRQEKTQAFEEAVNAKTSIMVDNARLNAREITNASTINH
FT                   DTTTEVNVVLNFKEQLNKLQARQNARPMPQTLGGEEGESRWHLNSRLESPNSRFELRAG
FT                   SVIPGVMVSGISSELPGQIIGQVSQNVYDTATGKYLLIPQGTKVIGLYSSDVSFGQDSV
FT                   LVAWQRLVFPDGKALDIGSMPGADNAGYAGFRDQVDHHYARIYGSALLMSGIVAGITYS
FT                   QNTNQTNPYGYNQPTAGSVLSQALGQQLGEVTSQMVSKNLNISPTINIRPGYRFNIIVI
FT                   KDLTFKSPYRQFAY"
FT   gene            193281..194021
FT                   /gene="trbJ"
FT                   /locus_tag="LPC_0178"
FT   CDS_pept        193281..194021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="LPC_0178"
FT                   /product="Conjugal transfer protein trbJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54177"
FT                   /protein_id="ABQ54177.1"
FT                   /translation="MKLRLMLIFLWSANAFSNGAPVFDFANWLENGKIIVNQVHQYKTQ
FT                   IDQYNNQLQQYQNMLDNTKSLTSFQWDNANGVINNLLDATNTIDYYKQEAGSLQGYLDR
FT                   FQTEEYYQKSPCFNGDRRCTPAEMRKINQNKMAASVAQKRANDAMLKGIDKQQQNLKSD
FT                   SEKLRMLQTQAQGAQGQKQALQAASQLASNQSHQLLQIRGLLLAQQNAQATKDAAALNK
FT                   EAIQTAGDERFRSGTYHKSSGKKW"
FT   gene            194051..194263
FT                   /locus_tag="LPC_0179"
FT   CDS_pept        194051..194263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54178"
FT                   /protein_id="ABQ54178.1"
FT                   /translation="MKILSLSIALLACLLSGCDNPETKARKKAAHLASLTCDSSKKGRT
FT                   KEELQAIADACFKRGSYSKSSGHKW"
FT   gene            194211..195683
FT                   /gene="trbL"
FT                   /locus_tag="LPC_0180"
FT   CDS_pept        194211..195683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /locus_tag="LPC_0180"
FT                   /product="Probable conjugal transfer protein trbL"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54179"
FT                   /protein_id="ABQ54179.1"
FT                   /translation="MPVLNEAVIQKAQAINGNLMKKKTITYLAVFLLIGFSVNCHAHNS
FT                   SIDSRDLLDNILYRFSATASMWSQTILSYARYLFWSLATISMVWTYGLMALRKADIQEF
FT                   MAETVRFLVVVGFFYWLLDNGPAIATAIMDSMRKLAANAAGIDAHISPSDIVDVGFDIV
FT                   SKAIDNSSIWSPAATTVGLIVAGVILVVLALVSINMLIILITAWILTYAGVILLGFGGG
FT                   RWTQDIAIQYYKTMLGTALQAFSMILIIGIGKSFVDQYYAAMSNDILLKEMFIMLVVAI
FT                   LLLVLINKIPPVLSGIVSGGGPSGGGNGIGLGGALGAAGIAGTALAGAAGAASAHSAGG
FT                   LSALHAAFKAASQSVGAGDSGSFSGGNSGSKLGGLAQAMGQASKFAGSFSSHLASGAFD
FT                   VASEKLGSMKDSFSAKTAETTGGKIADAIQQRASSNAHSVTSNKTPATDNVTSMGAPEG
FT                   SFSSGSGEYNQESGGADEVSQFVNQKASGESL"
FT   gene            195680..197569
FT                   /gene="traG"
FT                   /locus_tag="LPC_0181"
FT   CDS_pept        195680..197569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="LPC_0181"
FT                   /product="Conjugal transfer protein traG"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54180"
FT                   /protein_id="ABQ54180.1"
FT                   /translation="MSMSKPNKSIGPQVRKKRVEKTNKQIVFLVVLALFVSMQIGTQFV
FT                   AYKLHYHQSLGFSVAHIYLPWQLLWWNLQYHSIYPDYFNAAFGLVAMSGSLFLMIILFV
FT                   SKQLTQENVSEYLHGSARWANQDDLKDAGLIGNEEGVYVGAVENEKGDIHYLRHNGPEH
FT                   ILTYAPTRSGKGVGLVIPTLLSWKQSCVITDLKGELWALTAGWRQKHANNKVIRFEPAT
FT                   LKGSARWNPLDEIRVGTEYEVGDVQNLATLVVDPDGKGLETHWQKTSQALLVGFILHAI
FT                   YKLKNQGEPATFPNIDRMLVDPNTNIADLLIEMTQYPHIDGKTHPVISASARDMIDRPE
FT                   EEAGSVLSTLKSYLALYRDPVVAHNVSASDFCIKDLMHHNNPVSLYIVTQPNDKARLQP
FT                   LVRVMLNMVVRLLADRMEFERVDDGKGNRFVRTKRNYKHRLLCMIDEFPSLGKLDILQE
FT                   SLAFVAGYGLKFYLICQDINQLKSRERGYGPDETITSNCHIQNAYPPNRIETAEHLSKL
FT                   TGQTTIVKEHITTSGKRVSTFLNQISKTKQEVSRPLLTIDECQRMPGPKKDANGLITEA
FT                   GDMVVYVAGFPAIYGKQPLYFKDPVFIARASVESPEQSDILRTRLSEDEEIRL"
FT   gene            197566..198111
FT                   /gene="traF"
FT                   /locus_tag="LPC_0182"
FT   CDS_pept        197566..198111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="LPC_0182"
FT                   /product="Conjugal transfer protein traF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54181"
FT                   /protein_id="ABQ54181.1"
FT                   /translation="MKKFMAWVAVVLLGLISLSFLLIIMGFRVNITDSIPVGLYRITNL
FT                   KNLKNAFVIFCPDDRPAFKQGLDRGYVEKGLCPGGYGYLMKKVVATSGDKVSVISEGVF
FT                   VNRQFLPYSKPKLTDGMNYALPQWRAIDYQLKEDEILTMTNQSEWSFDARYYGPIRLGQ
FT                   IKGVITPVWVKAKMERKT"
FT   gene            198108..198272
FT                   /gene="traD"
FT                   /locus_tag="LPC_0183"
FT   CDS_pept        198108..198272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="LPC_0183"
FT                   /product="Protein traD"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54182"
FT                   /protein_id="ABQ54182.1"
FT                   /translation="MNKDTELMDVITDKLEDLMVPGFVAEISPLEAEIMGAFSEEALSE
FT                   MDAKEAAYD"
FT   gene            198265..200451
FT                   /gene="traC"
FT                   /locus_tag="LPC_0184"
FT   CDS_pept        198265..200451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="LPC_0184"
FT                   /product="DNA primase traC (Replication primase)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54183"
FT                   /protein_id="ABQ54183.1"
FT                   /translation="MTKLSHHQIVGNQIIESLKQGTAPWIKPWEPGIGNGQVPFNPVTG
FT                   KRYRGINALYLMLNQSNDNRWLTYKQAQSIDAQVKKGEKGTTVQYWKFHDEKIKKDEAG
FT                   NPVLDEQGNPVKVQVNLERPKVFYARVFHASQIDNMPELIQKEQDWSLIERAETLLLNS
FT                   GAKIFHSEADRAFYRLSTDSIHLPPKEQFKSAANYYATALHELGHWSGHPSRLDRDLSH
FT                   PFGSEAYAKEELRAEIASMLLGSELGIGHDPSQHTAYIKSWIRIIEDDPLEIFRASADA
FT                   EKIFNHICALKQVQEIQYAQSVEIRDEQLREENLMEIDKKISDKIWLNIPYKQKDTAKS
FT                   VIGKLPDGTPGIAWDKEQKCWYAKPGVSFDRIKAWLPENQVASEDKALSPVDEFKEALI
FT                   NLGAMVTGEHPIMDGKTHRIQMEGDKPGEKAGFYVAHLDGIPAGYIKNNRTGTELKWKC
FT                   KGYVLTDEQRAAFKAQALENQKNRDIELDEKHRSTALKLKHKLSQMSEAFEQTPYMKSK
FT                   GIQVHSGVYTDNDKKLTCIPATDIEGTIWTVQYIAEDGTKRFAKDSKKEGCFHVLGGIE
FT                   KLADSPVIVIAEGYATAATIKEACELPAVVSAFDSGNLKSVAKALHEKYPHTPIVMAAD
FT                   DDRHLEQSKGINPGKDKAGEAANAVNGFIVIPTFAPDEQSSNPRQFSDFNDLANHSKLG
FT                   IEGVRRQIKPKVEKIAKRYSWLRRSIKNNVVSLA"
FT   gene            complement(200533..200904)
FT                   /locus_tag="LPC_0185"
FT   CDS_pept        complement(200533..200904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54184"
FT                   /protein_id="ABQ54184.1"
FT                   /translation="MKVLLSIKPEYAEKILNGKKKFEFRKVIPKAGAKTVLLYATKPIG
FT                   KVVGEFEVDSFLSEKPNKLWDLTSSFSGISECFFYKYFEGYETAHAFKISKVYRYKEPV
FT                   DIKTVLASGVIPQSFCYLK"
FT   gene            complement(200882..201940)
FT                   /locus_tag="LPC_0186"
FT   CDS_pept        complement(200882..201940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54185"
FT                   /protein_id="ABQ54185.1"
FT                   /translation="METVNLEKVQFKTIDLSDPFFDSLKSDYLEFPNWFKKKSEEFAYI
FT                   FRNDSGLIDGFLYLKQESEAIPDVIPPLPPKQRIKVGTMKINAHGTKLGERFLKKIFDH
FT                   AIFESVSEIYVTVFPHHTNLVTLFERYGFNCTAEKITQNGKELVLIKKMFGPYTDIISN
FT                   YPLINIAGQKIYLLSLYPKWHTRLLPDSILKGENSNVVQDISYTNSIHKVYLASMREMD
FT                   NLKKGDVLVIYRTNDNKGPARYRSVVTSICVLEEYKSIYEFKKLEQFLAYCDPYSVFEK
FT                   SELEDFWKNKKFAHIIRFTYNLALKKRIIRDDLINQIGLNEHDYWGFMPLTNEQFLEII
FT                   KRGEIDESLIVH"
FT   gene            complement(202055..203929)
FT                   /gene="traI"
FT                   /locus_tag="LPC_0187"
FT   CDS_pept        complement(202055..203929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="LPC_0187"
FT                   /product="TraI protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54186"
FT                   /protein_id="ABQ54186.1"
FT                   /translation="MIIHHIPMKSARLSSFSGLVKYITDHQNKQERVGKVRISNCNSVD
FT                   PTWAVQEILATQARNQRAKGDKTYHLLISFAPGENPPEEVLNIIEDRVISSVGFKDHQR
FT                   ISVIHHDTDNLHIHVAINKIHPKTFNMIEPYRAYRTFAEVASTLEIEFGLEITNHQARK
FT                   GRSENLADDMEQHSGIESLINWMKRNCREQIESANSWNDVHRILTDHGLEILIRANGFV
FT                   FCDKKALTVKASAVSRSFSKKNLEERLGEFIPSPFGNEYYTQNVYRYEPLNKKVIGSEI
FT                   YARYLYEKEHSKTHLSKKLKQLGEAKARLIDKAKKRGRIKRKALKLMKASRSQKKYLYQ
FT                   QISKTLLKDIEKTRQNYAKERKHLLESHQTKIWADWLRQKAELGDKDAITALRYRNRKN
FT                   QSKYALSAASSNFSFANIAQVDSITKEGTEIYKLDKAVIRDDGKEIKISKGGSIATLKK
FT                   AIEMAQQRYGDCIQVNGSPLFKKIILQIVTQNNIPITFADSELEAQRQKMISEQENQNE
FT                   QSRRYGFNDGRRTSRSNEAAGEAIGESGSHFRSQPNAVSIRQGPPAKGQNSLRDLSQLD
FT                   VVQFTGRGKVLLPDNAHDQLERERLQPDNHVRRDVSGLKKKGKILNNK"
FT   gene            complement(203926..204279)
FT                   /gene="traJ"
FT                   /locus_tag="LPC_0188"
FT   CDS_pept        complement(203926..204279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="LPC_0188"
FT                   /product="TraJ protein (Relaxosome protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54187"
FT                   /protein_id="ABQ54187.1"
FT                   /translation="MVEKIKKPIRKHGRHLRVPVLPDEEIAIKSHAAQAGLSVAEYLRR
FT                   IGLGYQIQSAIDKEYILQLSKINADMGRLGGLFKLWLTQDRRVAHFDYRKVKALLDRIK
FT                   TTQDVMFEVVRKL"
FT   repeat_region   204840..207425
FT                   /note="TP1"
FT   gene            207613..208338
FT                   /locus_tag="LPC_0190"
FT   CDS_pept        207613..208338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54188"
FT                   /protein_id="ABQ54188.1"
FT                   /translation="MAKIHITMQGKGGVGKSFVSATTAQYKIHKEQSPLCIDTDPINAT
FT                   FHSFKSLKVERLNIMEGDEINPRHFDALIEKIANTQNDVIIDNGASSFVPLSHYLITNQ
FT                   VPTLLKDMGHELIIHTVITGGQALLDTINGFSQLVNQFPEDVRYVVWLNPYWGKIESEG
FT                   KPFEQLKVYKETKDRIAAIINIPDLKEETFGLDLSNMLQQKITFNEAIDSPERNIMTRQ
FT                   RLKLIRDQLFSQIDNAMVI"
FT   gene            208338..208793
FT                   /locus_tag="LPC_0191"
FT   CDS_pept        208338..208793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54189"
FT                   /protein_id="ABQ54189.1"
FT                   /translation="MPHKINEAIQDIAIKHGVVLGKDDPILILQTMNDRLLEENRKAQQ
FT                   EMLAQFKEEMENISSQWKDDAKEKAEKVLNAALAGSKETMDTILRLTTTEHVHAMKNLV
FT                   SDSLAEARDLTQKTRKFSLLVLSSSFAMLAASCFFILFFSCFGIVVN"
FT   gene            208807..209451
FT                   /locus_tag="LPC_0192"
FT   CDS_pept        208807..209451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54190"
FT                   /protein_id="ABQ54190.1"
FT                   /translation="MCVNNVKNYLKKCSSCNDSGTITGIGGIRSNCSKCKFKRALVNFF
FT                   EKFWAFIINKPIQKYPVGFTIVVFLFYYFISKNFSELMRASSIIGLLGLLFAALKYKLD
FT                   QANYHKSLFDERYKLFCQIEEVIRRANALDATDEGLRMIDEIINRCQFLFGKITLEFII
FT                   EIRSNFIQLICLKKSNKNSAPEADKAMEFFASLITLRSLPSKFPELIISNY"
FT   gene            complement(209495..209956)
FT                   /locus_tag="LPC_0193"
FT   CDS_pept        complement(209495..209956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0193"
FT                   /product="cytidine/deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54191"
FT                   /protein_id="ABQ54191.1"
FT                   /translation="MIESHIYDFMTATIAVAGENPMAPYGAIIVYDDKEILLKSVNSAH
FT                   HHPLMHGELSVIHTLFNNGFDGDVSKLSLYTTAEPCPMCAAAIYWAMIPKVVYGSSIAF
FT                   LHDLFGRQIQVGAEEVLSKTPDFYSCRLIGGVMEEECNQLFLEAKKLRI"
FT   gene            complement(209934..211376)
FT                   /locus_tag="LPC_0194"
FT   CDS_pept        complement(209934..211376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54192"
FT                   /protein_id="ABQ54192.1"
FT                   /translation="MNNQFKAKSKTPLQFKVFHTLLGFAVFFSLITVPAEAQVIIFFEI
FT                   PVSSELLWWPIVFFSFQLIHSIYGFSYLRHALYLVILFHAIYILFLKFAIWLPASSFWQ
FT                   MQETYTQVLGRDFLYIAMSSLCLWACTLLPLKFINDIKENQRRLLFFAGLMLFSLLDRA
FT                   LLNPQSSSSEAQFIVPILIYYFLNIFSGTLFQFISRVEGITRQKDLARDLFKFQIPDIT
FT                   NAIDQKFKYHHILFCSSIVFFIASKTMAAKFISIGFLTINVGGIVFSLAYLTADMMTDV
FT                   YGIERTKQMVLFIIFCNLLLVGDVWITNLLAIGENDPFKSILHNQARMFIASATAFFLG
FT                   MTINSTVISIIKARQRKRGISLKKEFITTVWTRIATSSAFGIIIDVSLFSLVAFYGIVP
FT                   NEKLGSVIIFEDAYKISYEIVLAPVSILLIYFLKIKEKVDIYDELSNLNPFRINTSYNI
FT                   NANKFAENYVQPERRNDRKPHL"
FT   gene            complement(211369..211728)
FT                   /locus_tag="LPC_0195"
FT   CDS_pept        complement(211369..211728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54193"
FT                   /protein_id="ABQ54193.1"
FT                   /translation="MEEKKFTGRFLRFVYQQIVLRFIGQVREPYLVRIDRIFTHPDTNE
FT                   LSVAFHIANKRVNQVQSVADFVKSDMIYLIDPRIVFDIGQQFGAHSEKLTILEKKQPDL
FT                   KTKCIAGLKRVFIDE"
FT   gene            complement(211746..212399)
FT                   /locus_tag="LPC_0196"
FT   CDS_pept        complement(211746..212399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54194"
FT                   /protein_id="ABQ54194.1"
FT                   /translation="MSTTILNESSQLLLAQTLNELIGRDEKLSPAALARQLGIPTNKIT
FT                   RILNGDVTDPKASTLLQIANYFDITIEQLLGLEPIARQEEIEQQQATRQLPIFEFSKVN
FT                   QSNAAKEWYRWVENEIAGEYYALAIDTDLYEPTFPKNSILIINTDIEPEDRSYILIKKK
FT                   NDPSYCSIKKYVLEGNQIYLYPINPKLPVEIFDDHLYTIAGVILEVHQRLRSKK"
FT   gene            212528..212776
FT                   /locus_tag="LPC_0197"
FT   CDS_pept        212528..212776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54195"
FT                   /protein_id="ABQ54195.1"
FT                   /translation="MRAMEHDSKLIIYKGMIQYILDSTHYTLKHIAQLSNASLDNIRAI
FT                   HCHDLLPINFKSEVQLLKLYQIVLEVNMNQKSCSIAE"
FT   gene            212810..213016
FT                   /locus_tag="LPC_0198"
FT   CDS_pept        212810..213016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54196"
FT                   /protein_id="ABQ54196.1"
FT                   /translation="MNWVKLKKYCEISGDTSNAVHAKRKRGMWLDGVQCKVGPDGNIWI
FT                   NLVEVERWVENGNKATNIRLRAG"
FT   gene            213091..214170
FT                   /locus_tag="LPC_0199"
FT   CDS_pept        213091..214170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0199"
FT                   /product="Putative lambdoid prophage Rac integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54197"
FT                   /protein_id="ABQ54197.1"
FT                   /translation="MKIEPTKANIKYAERLRGEILNAISLGTFNYQDYFPNSQRSKMFG
FT                   FSVVKSTVGELLKQYMEIAEKTLEPSTFNGYRKACEAHLYPAFGDIPVKDLSSMMIRNY
FT                   VTKLQLTLKTIRNILTPLRNTLDQALNDGMITSNPLDRLVLSKLVDKKTRRSNWEVDPF
FT                   NQDEIKAILSEAKGQARNLFQFAFYSGLRTSELIALEWGDIDWLNGIVRVSRAVVLKKE
FT                   KGTKTKSGQRDVLLLPPALEALQNQKKFTFLEGGRVFYNPRTNTPWETDGQIRKTCWAH
FT                   ILKKAGVRYRNPYQTRHTYASMMLSAGENSLWVAKQMGHKDTEMIIKNYGRWIPDTSTL
FT                   AGYTTVNDWSSPLTGVVKK"
FT   gene            complement(214176..214991)
FT                   /locus_tag="LPC_0200"
FT   CDS_pept        complement(214176..214991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54198"
FT                   /protein_id="ABQ54198.1"
FT                   /translation="MIPSRFITQWRAYAPWAFERQIEQDLIISRALVELFNDPLISESI
FT                   AFRGGTALYKLFVDKPARYSEDIDLVQLKAEPIGPVLDAIRAHLDPWLGKPNSKRSQGR
FT                   VTLIYRYIAEGLPAIPMKLKIEINTQEHFTVLGQHQKLFSISTDWFRGEANILTYQLEE
FT                   LLGTKLRALYQRKKGRDLFDLWYVDEHIDCNHQEIVRIFQHYIQQQNLNISKAQFEENL
FT                   ALKLSSELFIRDMDPLLVSGLSWDINYAAKHIKEKFLSSLPGESWKGAD"
FT   gene            complement(214988..215779)
FT                   /locus_tag="LPC_0201"
FT   CDS_pept        complement(214988..215779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54199"
FT                   /protein_id="ABQ54199.1"
FT                   /translation="MNANQYLNHLATQGQHYFTTKDMIHALKMSHTAAWAAMIRLEKKG
FT                   VIATPHRGFHIIIPPEYQRLGCLPPDQFIPDLMDYLQIPYYVGLLSAAQYYGASHQQAQ
FT                   TFQVIAPKNRKKIQCGQIRIEFIARKNIADIPTTNFNTPKGYVKVSSPEATALDLANYP
FT                   MYCGGLSNVLTTLEELAEQIDPQALERFASQLPHSPQLQRLGFMFESGQLDELALIIET
FT                   ILRKRTIRSVALVPNITNQEIDTPINKRWKIIQNEIVESDL"
FT   gene            216356..217576
FT                   /locus_tag="LPC_0202"
FT   CDS_pept        216356..217576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0202"
FT                   /product="Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54200"
FT                   /protein_id="ABQ54200.1"
FT                   /translation="MTENKRKGPLQDTTIRNAKAEKKPYKMPDERGLYLEVAPSGGKWW
FT                   RFRYRFEGKDKRISLGIYPDVSLKQARDRRDECRTMVANEIDPSEHRKAKKAAKIENAA
FT                   NSFEVVAREWFLKFSSSGLWSEGHADKIIQRLERDIFPWIGNIPISDINAPKLLSVVRR
FT                   IESRGALDTAHRALGNCGQIFRYAIATGRAERDPSQDLRSALPPVKETHFAAVTEPKDV
FT                   AKLLRALDDYEGTLIVKCALRLAPLVFVRPGELRSAEWEHIDFDTAEWRYKVTKTDTLH
FT                   IVPLSQQALDILKELHPQTGRDRYVFPSARDKKRPMSDNAILAAMRRMGINKEEMTTHG
FT                   FRAMARTILDEVLQFRPDIIEHQLAHAVRDPNGRAYNRTAHLPERKKMMQAWADYLDEL
FT                   KLRKSEL"
FT   gene            217598..218434
FT                   /locus_tag="LPC_0203"
FT   CDS_pept        217598..218434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0203"
FT                   /product="DNA-damage-inducible protein D"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54201"
FT                   /protein_id="ABQ54201.1"
FT                   /translation="MKTEIIHILTTNFESHAHKTDEGVEFWLARDIQKLLGYEKWDNFL
FT                   NVVSKAKTACEISEHNVADHFADVGKMVELGSGSQREINDIMLTRYACYLIAQNGDPKK
FT                   QEIAFAQTYFAYQTRKAELIEQRLLEAERVTARKKLSDTEKELSQVIYEQTNGNENFAV
FT                   IRSKGDHALFGKSTQAMKKQWNVPDSRPLADFAPTIILKAKDFATEITIFNAKEHGMTT
FT                   EQAISKEHVTNNEAVRKTLIDRGITPEKLPPAEDVKKVERRLESEKKKSLKKPDAL"
FT   gene            218455..219234
FT                   /locus_tag="LPC_0204"
FT   CDS_pept        218455..219234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54202"
FT                   /protein_id="ABQ54202.1"
FT                   /translation="MKNERKFLDVASHAFIEATNGLLDLYHEQPAKITLTEEFSKIVLN
FT                   VYQNFMLDVLPSSQCLVDKKNFFSFAILCRSSLDIIIQILWILSLEEDEKLKAIEYFLN
FT                   FEGVDVGQNGKKIYEWQRVFRPTYSSKKTAMELGIDKECIILPLTQHKNKELKLTVFDY
FT                   LSKITHWNPRLLNDLVGCNSEKHLGNAVEHTRMAAISVETFIFCAITFTEIFLKLCLKV
FT                   DEESVNQKTSKIKEKFRGAFAPFYNDIEQETEVVIEV"
FT   gene            complement(219385..221175)
FT                   /locus_tag="LPC_0205"
FT   CDS_pept        complement(219385..221175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0205"
FT                   /product="Probable protease htpX like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54203"
FT                   /protein_id="ABQ54203.1"
FT                   /translation="MNIYGLVKVFLVALVIPAIGFAVSFFIINDVNQSLKSKGIGDVTL
FT                   FCEVLQSGQLEKKATAELQEACQEVTNIVLLGQGSVITAAIGILIPVLYWLASIITGES
FT                   RKRIALLFPIVLRISVLLIAISVLLQGAILTYAVYIGESYFYGRIHPVLIGLIGLGALI
FT                   GGLSLIVVAMSFGRKLKLSTMGKVLAASDAPQLFRFVRSLAEKLGAKEPQNIIVGLEPT
FT                   FYVTNSDIQVPGYEKQITGETLYISAPLARLLSKEEFASVVGHELGHFRGNDTIYSMRF
FT                   APVYAGLGMALGALAIDENEGASGLAKVPAIAMLSYMYELFSTNVAKISRDREHKADEA
FT                   GAEAGSALALATALIKVSLYSSLWNHARQENIERLNQGKIATNLSIVFQDTAKYDIEHE
FT                   NIEQIMKSTLEQSISHPTDNHPSVSLRLKALGVNTETITKDMLLIPEDAAIHLLDKSQK
FT                   IEEEITLLEHKLMIAYGVASPPKEAERNHLLHATYSLAAAMISADGRVDLGEVAVAEGI
FT                   GKKLFEDFDSIEFREYCNNPEQIPDVVQLSEAMKEILEDEHKYLIIQYLKAISETDGSV
FT                   SKDEELLLQKVASGLGISIT"
FT   gene            complement(221543..221800)
FT                   /locus_tag="LPC_0206"
FT   CDS_pept        complement(221543..221800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54204"
FT                   /protein_id="ABQ54204.1"
FT                   /translation="MDDSIFVKGIEELKRLIATQYDLTVSAHKIENGKIIISLANKRKN
FT                   LVLNELNFRDAIEFLPNSPTNDKDKEDRHSLFLEIKNQLS"
FT   gene            221942..222466
FT                   /locus_tag="LPC_0207"
FT   CDS_pept        221942..222466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54205"
FT                   /protein_id="ABQ54205.1"
FT                   /translation="MNYKKKDRIRVPENHAEKALTLGINSKLKLLVMSKASEWVELPPG
FT                   EIQSISNKHPTKALVIVVRAPMVNGEYVGNHPDLQELTYRDLWLYSSDYYLLEELEKPT
FT                   TGEALEQNQYWLQLRSKAGRAIEKFEPWAAKQQGKINITDDLKGWIKKEITSKAFEIQT
FT                   ISKILQNHYKF"
FT   gene            222604..222804
FT                   /locus_tag="LPC_0208"
FT   CDS_pept        222604..222804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0208"
FT                   /product="Prophage CP4-57 regulatory protein alpA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54206"
FT                   /protein_id="ABQ54206.1"
FT                   /translation="MAYKILKLPEVKERTAISRSRIYNLISEGLFPKPILLGGARAVGW
FT                   IESEINEWIEQQIDASRNQKC"
FT   gene            222820..222945
FT                   /locus_tag="LPC_0209"
FT   CDS_pept        222820..222945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54207"
FT                   /protein_id="ABQ54207.1"
FT                   /translation="MSQLREGRIGWNQATLILIKLQLEFIAIWCDFASKGRKENV"
FT   gene            222938..225343
FT                   /locus_tag="LPC_0210"
FT   CDS_pept        222938..225343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0210"
FT                   /product="5' DNA primase traC (Replication primase)"
FT                   /note="3' similarity to Hypothetical protein yfjI"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54208"
FT                   /protein_id="ABQ54208.1"
FT                   /translation="MFDTISQFRAAIETSGLVPPENIIPGKMHRFPGIGKTKENKAGWC
FT                   LLFLDQLGGCYGDWSTGLSEIWWGKRNQKLTPDEKAQFKCQVQEAQLKALNEAAAIHQE
FT                   AAKRALSIWNSSKPAEANYPYLLSKNIEPKGIRCYKGLLVTPLRADGKIYSLQFIDPEG
FT                   NKQFLRGGRVAGCYFSLGNPRGADVICIVEGVATGKTINMATGYPVAVAFSSSNLLAIA
FT                   QVMSEQFPEHTLIICADDDADKEGNPGLTKANQAADILGAKVAIPYFGIDRPNKASDFN
FT                   DMAAFSGLDAVAETIRAVLFQSDDNNWPEPFPLSEEINAQPYPLDALPNTVRNAVEEVT
FT                   AFTKAPTPLVASAALAALSLAIQAHVDVKRTEGLISPVSLYLLTIADSGERKSTCDSFF
FT                   MKAIRDYESIAQEKAKPLIKDYQAEISIWEEKYRGVKEQIRILAKTNKPTHEQELRLVN
FT                   LEYEKPVSPLVPRLVYCDVTPEALKWNLAKVWPSGGILSSEAGTVLGSHGMGTESVMRN
FT                   LATLNQLWDGSPIPTERRGSESFTVNGARLTVGFQVQEVTLKHFLDRSNGLARGTGFLA
FT                   RFLIAYPESTQGNRFFTEPPESWFNLAKFNTRISEILNQEVTIDKNGSLSVIQVSLSPE
FT                   AKKAWICFHDVIEGELGVGGELSEISDVASKIADNAARVAALFKVFNQGVTGTINFDEF
FT                   ENASRIVAWHLHEAKRFFSGLALSDDQADIVKLDSWLVRYCHKKKTNIVSRRDVQRNIV
FT                   PIRLRDKKTLDIALNVLVEAKRIRQMQSGKKKGIYINPALLTGDVHDN"
FT   gene            225333..225644
FT                   /locus_tag="LPC_0211"
FT   CDS_pept        225333..225644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54209"
FT                   /protein_id="ABQ54209.1"
FT                   /translation="MIINNLIKKGFLTNNIMLTSATIATDEPVKISTVAEVATVAVGNL
FT                   NNSCGSLTSNEKQKILSWLEYIGEKDPLIIIEVLEFCRNNVDSRQYFLQRAKEVPEIK"
FT   gene            225704..226078
FT                   /locus_tag="LPC_0212"
FT   CDS_pept        225704..226078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54210"
FT                   /protein_id="ABQ54210.1"
FT                   /translation="MKFKPGESGNPSGRPKGSRNIQTQLIKLLEPHAEQLINKMVEKAL
FT                   EGDPHALRLCIERLLPKAKHNPIESDLLTLEEDNYMETIESILQEMLLGNIASDEGKKI
FT                   IDLIEEHQNRKRFDSLIHIP"
FT   gene            complement(226092..226850)
FT                   /locus_tag="LPC_0213"
FT   CDS_pept        complement(226092..226850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54211"
FT                   /protein_id="ABQ54211.1"
FT                   /translation="MNTFKEIAYQILLEAGKPLHSKEITALALKLGRLNSAGKTPDLTM
FT                   NAELNVDINTKKAASCFIKVAPSVFAINNDKYLSSDLKLMADKEYKISPNISTQQKGHI
FT                   AEARIAELITLYGDTTLSCYRPVSDDEGIDLIVKEKGSLKTIYLQIKSRFESNPSRSFT
FT                   STIRSCNLHDHHAMAVIFCLFDTDAGDLCNQLWFVPACSLIKNAHKLQNGDFFGFVAGK
FT                   RKKESNKWDEFLIDKRDLANQIIASIKRIS"
FT   gene            226936..227196
FT                   /locus_tag="LPC_0214"
FT   CDS_pept        226936..227196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54212"
FT                   /protein_id="ABQ54212.1"
FT                   /translation="MSTFLMKEKHPNLIKIGKLIRDTRKEKGYSQEDFASQAQLGRTYM
FT                   GRIERGEQNMTIQTLIQIALILGVEVATLIPKLNELTPPKA"
FT   gene            227257..229413
FT                   /locus_tag="LPC_0215"
FT   CDS_pept        227257..229413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54213"
FT                   /protein_id="ABQ54213.1"
FT                   /translation="MMNEIRSEKEIFEDLEALCCSDGYVHVIAYFCFKDNTILASENGQ
FT                   MISSNENPSNRLIRTEIATLIGLMVKKEIKLPIPPPDIFDTYINQTQALLHELHQTMYP
FT                   SIGQSTEEVSLKKRMDLFTMGTFLKEGIFYAGESAFPFQYRDLSLKKYEKDDSWFIEKK
FT                   GFSFADAILVITAVINFQNEKLTQTLSELKDKDVNDWSVLDGYIFSANDITQESNLTPE
FT                   VVSNVLDSFCLPQEGSNDSFNELGDFNLTNAYPLIFLNDSNYLLLQHYTLLEALYETPF
FT                   FWLKDDEAYKDEAATNRGAFVENVAVEWLSRVFGKHNVFKNVEIKASKKEKSGEIDVLV
FT                   LYADRAIILQAKSKKLTLAARKGNDNLLKDDFKKAIQDAYDQGFSCAELLNNKQHKFYI
FT                   NGTDEIEVPDNLKKIYIFCTISEHYPSLSYQSKLFLNFKETEQIAAPFVMDLFLLDVMA
FT                   EMLNSPLYFLSYVDRRCKNLEKFGASHELLILDHHLKRNLWLDGDNTFMYVADHDCLEL
FT                   YEALLTRRENYPGKETPEGILTRFKNTSFEKLIKQITHLEHPEAVNLGLILLTCSGEFI
FT                   NGFNSDINRLLKLVKTDGNGHDITILLYNNCGLTIHINFDSEFIAQKVLKSHCERRKYI
FT                   AKATDWYGLCLNPVNLDIRLALSLSYDWKYSEEMEKTVKPLIANQEKVAKSGKKKKRKI
FT                   GRNEFCPCESGKKYKKCCINKKYL"
FT   gene            complement(229443..230015)
FT                   /locus_tag="LPC_0216"
FT   CDS_pept        complement(229443..230015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54214"
FT                   /protein_id="ABQ54214.1"
FT                   /translation="MWPESVIKSSGIRTPVVHLYFSFLTNTHSFAETKFISLSQALEAY
FT                   HRLSGYNQDAMAAEEFEELKSNALTSCTTTQKEWLNNQFTYLNKINLRKRLKELINPIK
FT                   QYYGNKAAREMLIDNIMDTRNYLTHITSENMKKLHEKNNLTELCLKIDTILCFLVLIKL
FT                   GFSENMINKFAEYDRIDFYLKWKQQDD"
FT   repeat_region   complement(229976..232561)
FT                   /note="TP1"
FT   gene            complement(232516..233283)
FT                   /locus_tag="LPC_0218"
FT   CDS_pept        complement(232516..233283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54215"
FT                   /protein_id="ABQ54215.1"
FT                   /translation="MRIKRKIIRHGFFWLPNSKKEVKGTLIILDGGKISLRLENLLHPQ
FT                   NELIKIIHGRIGETAITLVDSYCKVYNDLISMISGGYGFEMHVHEAIFGQFFPSEEITT
FT                   VEVYFWLEGIDNWINEINHLDVSNKLNISKDYNFILQKHAGGIKFKLSSHNPQLLSEYR
FT                   KIIQKIILFFYFILNKPTNLQKIIIKSAGNKKLPIYYQSIPFNHKKYPSKSGFIQPGDI
FT                   DNLPRIIENWFNFYDSYSPCVFRSEMITDSGHT"
FT   gene            233982..234959
FT                   /locus_tag="LPC_0219"
FT   CDS_pept        233982..234959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0219"
FT                   /product="Mrr restriction system protein (EcoKMrr)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54216"
FT                   /protein_id="ABQ54216.1"
FT                   /translation="MRSLGYTYFNELNIKRNFMTIPTYQECMLPMLKVLKDNSNIKSTR
FT                   LISLMGDWFHLSDDEREELLSSGRTTILRTRVHWAKVYLKQAGLVEYPKRGYVAITEKG
FT                   IQVLQKNPSNIDTNYLKKFPDFIRFIERSKTESQQVSNSEYSENYSPDEVLTRTFERMK
FT                   NQTCEELLEVIKSSSPQFFEKLVVQVIVSLGYGGSLQEAGQAIGKSGDGGVDGVIKEDR
FT                   LGLELIYLQAKLKKDDKYNVGRPDIQKFYGALQGKQAKKGIFITTTDFSNEAREYLKVI
FT                   DKKIILLNGKELIELMWEYNIGLNVSATYEVKDLDLDFFKEELE"
FT   gene            235158..235505
FT                   /locus_tag="LPC_0220"
FT   CDS_pept        235158..235505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54217"
FT                   /protein_id="ABQ54217.1"
FT                   /translation="MVRLLRIEFSGGLYHINSRGNRKEAIYLSDADRENFLSVLGDVCL
FT                   KYQWLCHSYCLMTNHYHLLIETPLGNLSKGMRYLNGVYTQKFNKSHKRIGHVLQGCYKS
FT                   ILVTTQEFAEL"
FT   gene            235601..235786
FT                   /locus_tag="LPC_0221"
FT   CDS_pept        235601..235786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54218"
FT                   /protein_id="ABQ54218.1"
FT                   /translation="MNYLLLIILGFVTALGFAANTPCSGKKGGISHCLGEYFVCKDGSI
FT                   SQSKNKCIDLDKKNGQ"
FT   gene            235776..236246
FT                   /locus_tag="LPC_0222"
FT   CDS_pept        235776..236246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0222"
FT                   /product="Putative endonuclease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54219"
FT                   /protein_id="ABQ54219.1"
FT                   /translation="MVNKFHSILLFISLLFSCTAYANTISGLVIKISDGDTLTILTKDN
FT                   VQLKIRLSEIDAPEKKQPFGNKSKQSLSNLCFNKVAIVDILKIDRYGRSVGRVKCDNVD
FT                   ANEYQVKNGLAWVYDKYVTDHSLYALQEQAKSKGIGLWSEKSPIPPWIFRHN"
FT   gene            236835..237590
FT                   /locus_tag="LPC_0223"
FT   CDS_pept        236835..237590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54220"
FT                   /protein_id="ABQ54220.1"
FT                   /translation="MAITTTHIEPREKAQIAKLVVTYAGFSEIPVYAGIGTTRNDPREL
FT                   FLQQNPLWPPFFGYPDSLPEESPWFPQQAVPYRQMNHSIFDEMNIEEESAPEYLARIAK
FT                   NYSPQHKLVIVSLGPLHNISAALKINPSISSNLKIYSMGGIYPKGYNWLVSPEVTAPVL
FT                   GSTEVISIVSQFVDAHDFYITPEEFLEIEKSAQSEFGLAVIQDWKNWYNIDKRNLNKTH
FT                   LSDPVTLYLALHPEEITHMSSKLLTFPCH"
FT   gene            237637..237777
FT                   /locus_tag="LPC_0224"
FT   CDS_pept        237637..237777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54221"
FT                   /protein_id="ABQ54221.1"
FT                   /translation="MPGLENKLMKVEDSEESHIKFVSQVESSSAIRRKIINSIKQILGN
FT                   S"
FT   gene            238077..240572
FT                   /locus_tag="LPC_0225"
FT   CDS_pept        238077..240572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54222"
FT                   /protein_id="ABQ54222.1"
FT                   /translation="MKLPFKEPVAPRYIYINPQTNVVHLLMPVMSGTEIGLDNTCKSVY
FT                   SLLEFFCLLGANQQSAASMILKNYQEGLAFDIKYHPNSEQKALKEQRLVQINMYLRLLQ
FT                   QVQQEEQITNPLKLIFPTYPAALESLMQASEANLHSVILRPEEQDVQLRTTAISPVFSA
FT                   HHDTMVNGQRIEKKSSLYEILSNSYEGLVFIPKSKEQLIERVLSKCADSPVDFEHIRAM
FT                   LTQETKAYLGIEESFNQTQGNRYAPSAPVNQAYIDGELMISAEYPATPQDYLNALLEYC
FT                   TPNLFDNIEESPFYTINNKERLSILTQFFLAELNIICREEGIAETNFGQILEANPELIN
FT                   NLAKCVKQALTGYQSVEDALINYVNQHRDDFQFTSPIPQYSFPKLKERFNSHYKQIKDS
FT                   PHFDEFMLLSTKKGLFFAHQGCIATHFAHFMNALFFNDILDENTKTFLQSVQQDFETID
FT                   KFENTIPHQNTHINAGMKEAVLDLSSMDNEALQDLYEDINSYQDSNLKEALLAQLKQER
FT                   PDFKLQMNAKIFLQHVAYGEQDEAEELLNKDPELTQELLRANNIFFTDYSGRTFTCTAY
FT                   EYAYWAKDSHMQRMLEKYIRQDDETRQFMLERVKAIEELVNPPEAERFFAHPKPRGLHY
FT                   TTQNKEGKTIDHWEAHVDLTPLKKALQHFLDEFKKLYNNPKPNNYREVLNNIWVKEVGM
FT                   AQRCVPAHIAQEYCRVGWDLFLGLKDNKALFDASNPNNLKRQLKIFDWNTYTYDLWFTP
FT                   GSHAVDCGLGFSCALIRGGNNCPRPTNMYDRWTTPNEVVEQDLEMISIIDEVRTCDLKQ
FT                   SLENLSQPLIAQAAQYLSI"
FT   gene            complement(240854..240946)
FT                   /locus_tag="LPC_0226"
FT   CDS_pept        complement(240854..240946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54223"
FT                   /protein_id="ABQ54223.1"
FT                   /translation="MGELLDETGSVDKELKNLIAGFSASSTGLE"
FT   gene            complement(240970..241161)
FT                   /locus_tag="LPC_0227"
FT   CDS_pept        complement(240970..241161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54224"
FT                   /protein_id="ABQ54224.1"
FT                   /translation="MLDKIPPVFVIVDEIKKADSTLQEYLIKSLREIMISPSFKGSISG
FT                   YFAQLWSIANELFQKYCT"
FT   gene            241325..241840
FT                   /locus_tag="LPC_0228"
FT   CDS_pept        241325..241840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54225"
FT                   /protein_id="ABQ54225.1"
FT                   /translation="MFNVSIRKATSLDAEAIASVHVHSWKKAYQQFIPEIVLNSLSIPE
FT                   RTQLWNELLNNGVTVLVLEIDNQIIGFASICTFRDGIEDNSKGEISAIYIHPNFWHQGF
FT                   GKKLSLAALKTLKELGYTEALLWVLSDNHQARSFYEGMGFELNDKSKLAEFYDGGALLK
FT                   EVLYKKKL"
FT   gene            complement(242290..242514)
FT                   /locus_tag="LPC_0229"
FT   CDS_pept        complement(242290..242514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54226"
FT                   /protein_id="ABQ54226.1"
FT                   /translation="MKPIKNSKEQEHIAPEAQDPRLSYTEDDRRPLTSTTSAKHPSSLF
FT                   GKSEERSARESYDQYGNNVSTHWTQGPWN"
FT   gene            complement(242731..243045)
FT                   /locus_tag="LPC_0230"
FT   CDS_pept        complement(242731..243045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54227"
FT                   /protein_id="ABQ54227.1"
FT                   /translation="MKLTLFLVLVWICTESFGTTIMVKGLPSPLEYRNDLYYWPPNVAI
FT                   SPDTTNLFITMDGIDKVCFLNTGLQGGLEQISEISIIINGAKKDWNCFPYTTTILEARP
FT                   "
FT   gene            243449..244885
FT                   /locus_tag="LPC_0231"
FT   CDS_pept        243449..244885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54228"
FT                   /protein_id="ABQ54228.1"
FT                   /translation="MTPLFPQKGQPIAIKQGRSGSCFLLACLDCLLNGEAEGAGVVRKK
FT                   FKQTTSGVTLRIKRTDNTMKVQWEKMAGKYTYSYDPRTDEDVIFIDNEKLKEIDNSKKG
FT                   SSSNSLAVKILEHISAYYYQIAWDGESLLAHKLHPKFRNNPIAKQSDTAFLAKLLGVHV
FT                   TSFYDPHKLVKLKTIDPMIPVYVGMNFGKLDRLGRHRRHALRVGNIKPLDDGEYEVTLI
FT                   NPWNNQKQTTCLLTDLRKRKCHFAVFDSSPQKKLLTEIFLEYKTEIGCELFRNKELAFL
FT                   LCEMKQCGLLDSELAKYPLSSCMVLYKKLPNLVANYRCLPYSERYNMLMCVASTNGHVR
FT                   LFNKLMQGSSVVDKPSVARSPQRPYLSAKSFFADLFASLEASLERVHYNDLLKTLRVNY
FT                   GHLRSVNTALNQVENRQGIYSKMELKNMNQRLDRLGFFMKCHTDPRGHRNSDLGQQPNF
FT                   FDQSTQKVNVKNHQNKGVSL"
FT   gene            245146..245892
FT                   /locus_tag="LPC_0232"
FT   CDS_pept        245146..245892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54229"
FT                   /protein_id="ABQ54229.1"
FT                   /translation="MKRYIWFHPSYVLESAEATLLGQQTNAKDHGYILLNDQELGQVTC
FT                   EDHLTIMGHSSLESTPSEDTGLYMQGDTADGLIRRLTANGLKEAPKILSLESCRAGISG
FT                   GLAQQLSCSLFFKYTLIEANLNSVGRKPMDTQWNFPTDSLGRAVLKLDNSPWMFYLGGF
FT                   LVGRLTHDTYTMENLFSLLSPPTFHKHFFANYQPGFFGGRSGRHCLFNKTTITLEKASN
FT                   FAHEDQDSASAKALEVVLKKLYSQPG"
FT   gene            246366..247076
FT                   /locus_tag="LPC_0233"
FT   CDS_pept        246366..247076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0233"
FT                   /product="ABC transporter, ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54230"
FT                   /protein_id="ABQ54230.1"
FT                   /translation="MSPIPAFVIRNLTKTYLMGEVVIHALRCINLDLYQGELVVFLGPS
FT                   GSGKSTLLNIIGGLDVPSSGEVIYKDHLITSASQHDLTRYRREHIGFVFQFYNLISNLT
FT                   ALENVSIVTEIAENPMHPEDAIKLLGLEHRMHHFPAQLSGGEQQRVAIARAIAKNPDVL
FT                   LCDEPTGALDCETGKIVLATLALANQKLKTTVVIITHNIVISEMADRVIHIADGVISNI
FT                   SKNKFKRKPEELEW"
FT   gene            247070..249436
FT                   /locus_tag="LPC_0234"
FT   CDS_pept        247070..249436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54231"
FT                   /protein_id="ABQ54231.1"
FT                   /translation="MVTALNKKLWRDVIKLRSQIITIALVVCSGVSVLIASVNTYVSLR
FT                   NAQQEFYSKYHFADVFASLKRAPDYLEKRITEISGVSRVETRIVKDVVLDLPWMPEPAV
FT                   GRFISISDKNKSGLNQLYLRQGRWPDSNRYDEILVNESFANSHDLKPGDNIIALLNGHR
FT                   EQLKIVGIALSPEYVYAIRGEDLLPDNRHFGVFWMDRKALSTTFGMQGAFNDIIIKLAP
FT                   NASEQFVMTQLERMFRSYGLTITYSRKDQVSDRFVTNEIKQQKIIATYIPPVFLLVAAF
FT                   LLNLVTGRLVSKEREQIATLKALGYGDLAIAYHYIKIILIIIVIGSLAGVSLGAWFGNL
FT                   MTELYAEYFRFPRFSYLFSNLAAFIGILVCFLAALLGTLRAIYQVINLMPAVAMKPPAP
FT                   IVYRATLIEKIKFFSRLPSSVKMVYRYIFRHFLRTMLTCVGIALAMAIIILGLFWQDAI
FT                   RYLINTQFIMAQREHAMVSFNNPVNKIAVTELNKITGVTSSEGYRIVPARLTYQHRSEL
FT                   SSLFGIAENAELKILLDKHLNRMIIPEQGLLISEGLAERLRLAVGDRLDIELLEGNKAK
FT                   TQLKVQGVINDYVGMFAYIEIKALNRLLNEDRLVNAAAITVDTKHVKHLYKKVKEIPKI
FT                   GTITFKTSIIRTFEETFAKHILVFTTILASFAIIIAVSVVYNNASITLAERARELTTLQ
FT                   VLGFTQGEVSTLLFLNHIFEIIISTPLGLVIGYLMSWSILQLMQTDWFKIPFVIELKTY
FT                   VISIMVIFFSSLISFYIIQRKASHLNLTAVLKVAD"
FT   gene            249436..250635
FT                   /locus_tag="LPC_0235"
FT   CDS_pept        249436..250635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54232"
FT                   /protein_id="ABQ54232.1"
FT                   /translation="MKIMNLNLKKLIGYFLAIVIFFSVVLWFLSHQGISVERAKVKYDH
FT                   FIQYIEDDAKTRAIKIYSIVSPVSGELLRINLTEGDKVKKDDVIATIKSKIPALLDIRA
FT                   KQELEHELGTAEALYEQAKAESIRAEAALETAQSDFKRKEPLAKKGFVSETELEHAQLE
FT                   YQLRQKEHNAALRKLHAAEHYILKVKASLSASEGSEASQQDKIEIRSPVTGSILRVIEK
FT                   SSTTVEPGTKIMDIADVVGLEVVADILSDDAAKIPPYARVIIKRWGGPYPLEGRVRIVE
FT                   PSGYTKISALGVEEQRVNVIIDITTPYELWKNLGDGYRVDVEIILFESNHALVVPMSAL
FT                   FRDGEDWAVFVVKGHRAYKKKLTIKYHNPDYAVIERGLELGDEVILYPSSLIHDGVLIK
FT                   "
FT   gene            complement(250707..251585)
FT                   /locus_tag="LPC_0236"
FT   CDS_pept        complement(250707..251585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0236"
FT                   /product="sensory box (GGDEF/EAL domain)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54233"
FT                   /protein_id="ABQ54233.1"
FT                   /translation="MLTNIERAKLQLIDETSDMVIITKADPLDAPNGPEVVWVNKAFEK
FT                   ISKYKANEIIGQTPRILQGKETNQNTLKMIREAMKAQTSINVELLNYTKDGTPYWINFS
FT                   IVYLRDGQGNLCYLGAIERDITAIKNLNFQLSEKAKTDPLTNVYNQENFFIAGNEAIKN
FT                   FHQNQEAVGLLFFDVDDFKGINDTQGHIYGDKILKKVAQESLKLVRKTDNVFRYGGDEF
FT                   AIIFSGIDVKILERKAQQLQKKLAKSHISVSIGGTISKQSDKSINTLLARADEALYYVK
FT                   ANKKGLFFIRE"
FT   gene            complement(251569..252021)
FT                   /locus_tag="LPC_0237"
FT   CDS_pept        complement(251569..252021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54234"
FT                   /protein_id="ABQ54234.1"
FT                   /translation="MPCRKCDSATTYHLSGTYQLLTLPPRGHCYSKLLKYLTENNFDIK
FT                   IKDSAIIELLFTAEKAQDIGHALERCYSQAELEDSKAVLLPIDIADRNVERVLNHTHSL
FT                   KKIMPSIFIKVFCLRDLCLTKKYPTISKQAHKNGLAIGCMTNAYKH"
FT   gene            complement(252126..252887)
FT                   /gene="map-1"
FT                   /locus_tag="LPC_0238"
FT   CDS_pept        complement(252126..252887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map-1"
FT                   /locus_tag="LPC_0238"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54235"
FT                   /protein_id="ABQ54235.1"
FT                   /translation="MLVKTSEEIKKMRVAGQLAASVLEMIEPYVIAGTSTRELEQICRQ
FT                   YIVEDLKAIPSTLNHYGFPACVCTSINHVVCHGIPSEKKLKNGDIINIDVTVQKDGYIG
FT                   DTSKMFLVGNIKPFAKKLVEVTQECLYKAISIVRPGAYLGDIGNIIQTHAEQHGYSIVR
FT                   EFGGHGIGKSMWEDPHIMHFGKPNTGLRLQAGMTFTIEPMLNLGRKEVKTLGDGWTVVT
FT                   KDHKLSAQWEHTILVTDNGHEILTLRADEHF"
FT   gene            complement(252868..253080)
FT                   /locus_tag="LPC_0239"
FT   CDS_pept        complement(252868..253080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54236"
FT                   /protein_id="ABQ54236.1"
FT                   /translation="MGIVKISDELHEATKLMARAMSRSINSQAEYWIRIGKLAEENPSI
FT                   TYTDILKILVHQASLGEIYDVSEDV"
FT   gene            complement(253256..253735)
FT                   /locus_tag="LPC_0240"
FT   CDS_pept        complement(253256..253735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54237"
FT                   /protein_id="ABQ54237.1"
FT                   /translation="MKEKTAKQLKLFIIYLISYWLLSIISCLIAFGYDDSLRMLLASPK
FT                   SDLSGALLFFSSFIATALLFVFRYKTFSDKPYPYFIFGFYVGNVSLLMLFILDAFIREL
FT                   IVWKFPEFLLVFISPFVELVLSYLFFGFAFLAIIPAVTSAFILYGVQRKLLLPPI"
FT   gene            complement(253748..253987)
FT                   /locus_tag="LPC_0241"
FT   CDS_pept        complement(253748..253987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54238"
FT                   /protein_id="ABQ54238.1"
FT                   /translation="MIAWIIESSQYLSHLQDSRKEQSKEWEVLVLSSPVNAALCLIGKE
FT                   EKIDSVARSGSCPCINAPKSRVKIPKIEAPFKTA"
FT   gene            254047..255024
FT                   /locus_tag="LPC_0242"
FT   CDS_pept        254047..255024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54239"
FT                   /protein_id="ABQ54239.1"
FT                   /translation="MNLKAEVFLNQNCAEMMIKKAAQLILGSDLDFEYTRGVQDIQVDL
FT                   GPAFMFSPDEEKTLWVSGKNQETLEKDLATLNKSSVYFFRTGTQGGAGHWQVLYYEAAK
FT                   SGWVSYSSQSNHFQVTDSNGKLTASGKGLLVPHANWGKENGNYAFLLVNASAENIIHAA
FT                   NFVYILRTQNEVAAIEYCALNHEFHPEIKRTARAKAEPETRTKGEIHNHPKDLSCENLK
FT                   TIYSKHVALLHVINRLETGSKSYNPYWMGSQAKLNTILGALGACYQKGLDVESELSNSN
FT                   SELSKAINIRRLPSLFSFWGGKIESPVESRKIIDENRTYRRNNP"
FT   gene            255117..255854
FT                   /locus_tag="LPC_0243"
FT   CDS_pept        255117..255854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0243"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54240"
FT                   /protein_id="ABQ54240.1"
FT                   /translation="MNNVNGQSMTRIDEIVPDIYRISTSISQEIIPGGFSFNQYLIIDK
FT                   KPVLFHTGPLQLFPAISQAVATVIPVESLCFIAFSHFEADECGSLNEWLKVAPDAVPMC
FT                   GRIAAMLSINDLAIRSPKVMNDLEQVSLGKHNVQWLDAPHLPHGWDCGFLFETTTKTLF
FT                   CGDLFTQPGAEHQPITEEDILESSEMMRQAMDYYAHSNNQRQLFEKLASTHPKILACMH
FT                   GSAWKGNGFQLINALADRVCSNI"
FT   gene            complement(255992..256450)
FT                   /locus_tag="LPC_0244"
FT   CDS_pept        complement(255992..256450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54241"
FT                   /protein_id="ABQ54241.1"
FT                   /translation="MPDIDLLPNHCHIMKTYRKELWFNIPERMGFINITDKVIECLKES
FT                   SIQEGLILINAMHITASVFINDDESGLHQDYKKWLEQIAPHEPIRQYRHNDTGEDNADA
FT                   HIKRQIMGREVVVAITEGRLDFGPWEQIFYGEFDGRRDKRVLVKIIGQ"
FT   gene            256837..257610
FT                   /locus_tag="LPC_0245"
FT   CDS_pept        256837..257610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0245"
FT                   /product="hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54242"
FT                   /protein_id="ABQ54242.1"
FT                   /translation="MYKTVHFYSNNLKLEGKLEEPTGKCLGYVLFAHCFTCGKDIAAAS
FT                   RIASALVSNGFAVLRFDFTGLGSSEGSFSETNFSSNVEDLVAAADYLRTHYRAPVLLIG
FT                   HSLGGAAVLLAAKKISEVKAIATIGAPASAHHVKHHFSADLSKIESDGEAQVTLGPRSF
FT                   TIKKQFLQDIDRYQDTINSDAGKALLILHSPIDKVVSIKEAEKIYKAAKHPKSFISLDK
FT                   ADHLLSDKRDSQYAAEVIAAWASRYLTPSSEDQSG"
FT   gene            complement(257692..258147)
FT                   /locus_tag="LPC_0246"
FT   CDS_pept        complement(257692..258147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54243"
FT                   /protein_id="ABQ54243.1"
FT                   /translation="MPDIKHYLKPMVLFSGLLVTPFAMAEATKAEETSTVKLSTILQQL
FT                   SDQGYKNIHDAEIDDGVLTVEGSNEQGVKFEIHLDPATGKILKKQEHPQPKYSIIDITK
FT                   KIENEGKFKIIEIEFDEGIYKIKGETDSHEKKELHIDPNTGETKTDH"
FT   gene            complement(258316..259200)
FT                   /locus_tag="LPC_0247"
FT   CDS_pept        complement(258316..259200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54244"
FT                   /protein_id="ABQ54244.1"
FT                   /translation="MAGTSLLTLIDDIATALDDIAAMTKVATKKTAGVLGDDLALNAEQ
FT                   IIGIHANRELPVIGAVAKGSAVNKLILIPLAILINFFAPALVGILLILGGLYLCFEGFE
FT                   KIVEKIFHTKNEPAKKKIDIQTIDMRQFEKEKISGAVRTDFVLSAEIIVITLGTVAATS
FT                   LVNQIAVLTLISLIMTIGVYGLVACIVKLDDLGFILREKKHPLKQIGILLIGAAPILMK
FT                   ILSVAGTIAMFLVGGGIITHQITAIHHFTENLSAMMSIGIDFFIGIISGAITAALYFIF
FT                   KKMKSKFKLMNTK"
FT   gene            complement(259476..259886)
FT                   /locus_tag="LPC_0248"
FT   CDS_pept        complement(259476..259886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0248"
FT                   /product="peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54245"
FT                   /protein_id="ABQ54245.1"
FT                   /translation="MIGKDKWEILTEKMTNLHIYETDLSEKFILGSGKGGQKLHKTAST
FT                   VYLKHLPTGMEVKCQESRSREDNRYFARQRLCEKLQAVFSDEKTKTQQRIEKIKRQKRR
FT                   RSRRSKQKMLDEKSRQSQLKTLRKNPRSHDIE"
FT   gene            complement(259987..260697)
FT                   /locus_tag="LPC_0249"
FT   CDS_pept        complement(259987..260697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0249"
FT                   /product="conserved hypothetical protein containing DUF330
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54246"
FT                   /protein_id="ABQ54246.1"
FT                   /translation="MKNQKHFLKFYCIRDRSWPASARASFEGIRFLSFSNYAEFRKKPV
FT                   KLLLLLLIVLTLCDCGRSKETQFYLLTPISPQKNSHNSYNHLQIGVDEVSIPDYMKKPQ
FT                   LMIHQTPHHLTLEEFNQWAGALDKNITLVLTTNLSTLMPGVVVQTSPWDNKFHPDYHLQ
FT                   VMISQFEIDIHGNSILRAEYLIYRKEELIYKGNAYYHIKVPLISIETLVQSMNTNLTHL
FT                   TEEIARFFIKNTTK"
FT   gene            complement(260694..261380)
FT                   /locus_tag="LPC_0250"
FT   CDS_pept        complement(260694..261380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0250"
FT                   /product="probable transmembrane protein; conserved
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54247"
FT                   /protein_id="ABQ54247.1"
FT                   /translation="MILGGTFFYIEYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIG
FT                   EVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVA
FT                   EIELIKPTPTVKYRQTYYHSYPVFPTHNSAEKYTSMEEAFEAAKKAFEDVSELVRSKEI
FT                   QDTLEAIQKVSENLGQLASSLNQDVPSVVAYLNQSLKQITSAAYSTQNLTDYLSRYPES
FT                   LLRGKR"
FT   gene            complement(261448..262203)
FT                   /locus_tag="LPC_0251"
FT   CDS_pept        complement(261448..262203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0251"
FT                   /product="probable ABC transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54248"
FT                   /protein_id="ABQ54248.1"
FT                   /translation="MYVFRRFSKHIITFLHSLELAFRFLGHLVDSTIKVIFGKLSIVWP
FT                   NTLEMIYYSGARLVILLSFIGILLGATVSQTVYALLKPFQLHQRVLPIVQNILTHEILP
FT                   VLIGFILCIQAALHMVNTRLEHYQENPEAIILAQVLPIIVGMNIASLLLYVYLVSAIFF
FT                   SFYLTFHFMLGFTNNEFLSYVVSSTTLFDLIYSVVKTLILCIIVGLTSGYYYYEASIRH
FT                   IYLRKAVSRILTRGSFWLIIASMYITLTF"
FT   gene            complement(262507..262650)
FT                   /locus_tag="LPC_0252"
FT   CDS_pept        complement(262507..262650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54249"
FT                   /protein_id="ABQ54249.1"
FT                   /translation="MKAKYAPTEPGLQKLPPEIKAMHIAVLFNSFPNPVKVLYNKTRKK
FT                   KI"
FT   gene            262869..263567
FT                   /locus_tag="LPC_0253"
FT   CDS_pept        262869..263567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54250"
FT                   /protein_id="ABQ54250.1"
FT                   /translation="MTTLYIKNLRYNEVAVCRALFEAAEKTEEGIKTKRYGMQLTADMP
FT                   GLWSPLSNYDIENDLRMARIHRNGRMREIGYLTVNLVFQFDSLDVTEYETKYGISAKDV
FT                   LEKAGFTCSQDAAGYSEPVSTSTRLLGQESKPEKPTQTSVVNTSFFSLKSVDTDKRFTK
FT                   STKPGILYEARSYGKIEDDTLKSYGFTDGQWERQKEGIENIVIIKKLTQSISPGPAVLD
FT                   EAVDNIPTLS"
FT   gene            complement(263692..264552)
FT                   /gene="oxyR"
FT                   /locus_tag="LPC_0255"
FT   CDS_pept        complement(263692..264552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="LPC_0255"
FT                   /product="transcriptional regulator, LysR"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54251"
FT                   /protein_id="ABQ54251.1"
FT                   /translation="MSLLLDDIKYFIAASDTLNMTRASEIIGISQPALSYSIKRLENKL
FT                   GGLLFIRLKNGIQLTKLGEEFKRRSHRLLYEWEQVQNIANPESGFVQGNYTIALHPSVA
FT                   LYTLQYFMPKLQVNYPGLGINFIHGHSREMTEKVISWEADFGIVVNPIQHPDLVILKLS
FT                   TDEVTVFYANDAQNKLIYDRKLAQSQYILKKIGKKITFNGVINSTSLEVVAKLTALGLG
FT                   YGILPTRVTYPYKHLKKVLNAPVFRDEICLVYRPEKHNNPVSKKIIQIIRSSISNDNDK
FT                   ENYFD"
FT   gene            264663..265712
FT                   /gene="pvcA"
FT                   /locus_tag="LPC_0256"
FT   CDS_pept        264663..265712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pvcA"
FT                   /locus_tag="LPC_0256"
FT                   /product="pyoverdine biosynthesis protein PvcA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54252"
FT                   /protein_id="ABQ54252.1"
FT                   /translation="MKNTAFLITKNRYTKDYRLKKSPDSDSAMGVAKRILAEVMIFRRV
FT                   PETISLCGTGCQKCASPHLPKIISAVNKNEPVTFILPAFPGKSPNPEKVLGHLPDHAER
FT                   LSLNFLGTLCQRIKNFYTPGIKIILCSDGRVFSDVVGMNESDVTAYQLELDRLIKEMSL
FT                   ADLSTFNLDYFYKDLHFVQMREELMKSYGQSLDFLKQKIRNGAKPSASPDEQEANRMYS
FT                   GITRFLFEDAMHAGQTKSRTAIQKESRFKAYEVIRRSNAWSALIAERFPKAVRLSIHPQ
FT                   TCGSKKLGIRLIGNESWMTPWHGVAVESNKGYVLLRRSEAEALGAKLICSSDGRHSHYQ
FT                   LMAEVSYEL"
FT   gene            265702..266538
FT                   /gene="pvcB"
FT                   /locus_tag="LPC_0257"
FT   CDS_pept        265702..266538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pvcB"
FT                   /locus_tag="LPC_0257"
FT                   /product="pyoverdine biosynthesis protein PvcB"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54253"
FT                   /protein_id="ABQ54253.1"
FT                   /translation="MNYKVTSLKPFGVLLEPVSEKTKVTDVDIENLRHLFAKNQLVVLR
FT                   GFCAFQNAEDFSNYCELWGEVSLWPFGKVLELIEQEDPEDHIFDHSYMPLHWDGMYRPQ
FT                   VPEYQIFHCVKAPLPGQGGRTTFSNTILALQFASSEIKELWNKVCGTYQRKMEFYNSKT
FT                   VSPIIMKHPQKDFSVIRYNEPPSADKGHFVNPPDIEFTGIDQEELDFFHRSLNKALYSA
FT                   DNFYAHEWQNGDIVIADNFSLLHGREGFVSRSPRHIQRVHVLSNPPFDNPGLESYQ"
FT   gene            266535..267977
FT                   /locus_tag="LPC_0258"
FT   CDS_pept        266535..267977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0258"
FT                   /product="FAD monooxygenase, PheA/TfdB family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54254"
FT                   /protein_id="ABQ54254.1"
FT                   /translation="MSAQVADVVIVGAGPVGLMCAYLGQRCGIHTVIVDKSDGPLEVGR
FT                   ADALNARTLQLLELADLFDELYPLGKICNTSSVWADGQFISRQSSWWEELEGCLHKHFL
FT                   MLGQSYVEKLLDEKLKETAAAVKRSTAIVNIEINEAGCLTTLANGECIQSRYVIGADGA
FT                   RSFVRNHFAIPFEIIRPQIIWAVIDGMIDTDFPKVPEIIVFQAETSDVAWIPREGEIDR
FT                   FYVRMDTKDFTLQEAMDKINHAVRPHSLNFKDIVWFSQFSVKESVAESFFIQDRIFLAG
FT                   DACHIHSVNGGQGLNTGLADAFNLMWKLHMVMHFGAPKELLHSYEAERKPVAHGVIETS
FT                   GELVRSTKYSLNGTHAQDYVRIVQKRAGYITGMGIRYGETGLCGSRLFDFEIFNGIAKT
FT                   RLYSLLDYMKFTLLIFGDCEVELEPPEFVKVIPIYPTQCQENFWTDNTHYANQAILVRP
FT                   DSYIQYSVPLDKMESLFELAQL"
FT   gene            267974..269122
FT                   /locus_tag="LPC_0259"
FT   CDS_pept        267974..269122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0259"
FT                   /product="chloramphenicol resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54255"
FT                   /protein_id="ABQ54255.1"
FT                   /translation="MKKSLIFLAIGMFTVGCNTFLIAGLLPQIGETLGQPVAVTGQGVS
FT                   LFSLTYLFSAPLFSLIFVNQPVKRMIQLAFTVFMLGNLITLLSENIMLFLIGRSLAGVG
FT                   SGIFTPLCISIAVHFASPSAKGRILSFIWSANSAGVVFGVPAGLYLSSSFHWQLSIASL
FT                   IILSLLALVGFSMQNIDIRLPKPSPFGGRLRLLVEPKTLSVIGITCFTALASLGLYSYV
FT                   TLIQSGSPNSLSMTLLSWGLGGFMGSSLIGVCIDRTGKPRVIMALILVGLMFALIAIPF
FT                   TRNLPYLGLIPFFMWGACGWAIVTPQQHILYELHENQGTILAAINSSALGLGAALGTLL
FT                   GGLLISSGFRGIYLPFSAATLLFFVLITQLIVINTSHKVNNT"
FT   gene            269119..270351
FT                   /locus_tag="LPC_0260"
FT   CDS_pept        269119..270351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54256"
FT                   /protein_id="ABQ54256.1"
FT                   /translation="MNRPVVIVDPLSSGIELAPAFKARGIPAIAVTLKPLDWIGFGANM
FT                   QTSDFIEIIPDQPNLVEVLAKYDPIAIIPGTEEGVPLAEALAITLTPQFANDPEKSQNR
FT                   LHKALMQKALQEAGVPALKTLNTASESEVEAWIRTNGLIDSPLIIKPPVSAGSDKVFHI
FT                   PARGDWKKEFNRVLSEPSKITGKNNETVVVQEQAIGTEFAVGTVSANGKHYLAHLIQYN
FT                   KTSFNDRKTVYNYVEFVPYSQERYGELFEYTQKALDALGVRWGAAHNEIMLTKDGPRLI
FT                   ETGARMCGGPVVGFAREATGSSQADKLVEIYVDGGVSTEEYVFKKTVVPVFLKSPAKGK
FT                   ISNVEAFAELSKLPTFLNEHIWFKNGDLVPQTVDYLTSIGIIGLAGDRKSILLDYEKIR
FT                   NMESKLVIQTF"
FT   gene            complement(270519..271661)
FT                   /locus_tag="LPC_0261"
FT   CDS_pept        complement(270519..271661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54257"
FT                   /protein_id="ABQ54257.1"
FT                   /translation="MLSKYDKLIYINLAQDQVTANIDTLIIHESPTILVKIPDGSDLKT
FT                   LVDPDFFPGPITNRTKIYFSAHGHEELDDMVLDRQKENPKIYKLDDVAAYFGKLLTNPD
FT                   FKNPDIKPRLTLVMSVCEGLGFAKNLQKKLFDDYGLLVDVIANKNVIHEQFVKPHHETT
FT                   AYLTHRETSIKGVGREHKRPHSKVLLTIDKEGTQQEIDAYELKWIEKVLNTIHQQVATF
FT                   GKWADFEKPENIKIQEGLNAFCHDVDALISLFINQDINLTANNLLALLLSCQKTTADPL
FT                   YKQAMNYEMFQIMTKNLINEGLRYINPKIEMQEYSHALEELQSQKDKMIRDEVAPNIFR
FT                   AKKAIFSALLAEASEYGIDSVLEQLEKAKQELSQGKMNPS"
FT   gene            complement(271827..271988)
FT                   /locus_tag="LPC_0262"
FT   CDS_pept        complement(271827..271988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54258"
FT                   /protein_id="ABQ54258.1"
FT                   /translation="MLLTNQSLIQNYYKKRNFIKKITFFGNLDQLDEKAENHSVGYTHS
FT                   LACFFISL"
FT   gene            272210..273184
FT                   /locus_tag="LPC_0263"
FT   CDS_pept        272210..273184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0263"
FT                   /product="O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54259"
FT                   /protein_id="ABQ54259.1"
FT                   /translation="MNKFPQSFSEANERIGNAIHHVCLNALDAKFIKSNIQESYQSWAN
FT                   VLYDRVFLNWGLCDKKIYRELSSLNFDFSTVGFFPHVYGQSLLFYLIRPLIKIHFFNKR
FT                   LLDVGCGNGVGLKISSELLKTRYALGIDLVNKLVTNSNNNFYIEDKINYMQADAENMAI
FT                   ANESFDIVTNLESSHLYPQIEHFFSEVERVLAPNGFFCYADVNFDVKRQAERFETFVKT
FT                   RKNLRIIEKHNITKMIQASIYQRLIVNEKRFYQLAQYLLGPDKINYTSELANVASSMGL
FT                   MFLPWWRIRFKNPALQALGKFARRYKHWNKKYYFYYLIQKIDS"
FT   gene            complement(273310..274152)
FT                   /gene="htpX"
FT                   /locus_tag="LPC_0264"
FT   CDS_pept        complement(273310..274152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="LPC_0264"
FT                   /product="heat shock protein, protease HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54260"
FT                   /db_xref="GOA:A5IA60"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA60"
FT                   /protein_id="ABQ54260.1"
FT                   /translation="MINNLKTFILLASLTALLVVIGGLLGGSTGMLVALLFAGIMNFSA
FT                   YWYSDTLVLKMYNAEPLSNNHFVYHIVSELAHRAGTSVPKVYLINNSTPNAFATGRNPE
FT                   NASIAVTTGLLDRLTQEEITGVLAHELAHVIHRDTLINVVSATIAGAISGIANMFMWLS
FT                   MFGHNSNNEEGVHPVVGMIMMIVAPLAAGLIQMAISRSREFEADAGGARISGNPQWLAS
FT                   ALLKLDQANHEQYFDEAETHPATAHLFIINPLNGEKLANLFSTHPSTAERVARLRAMY"
FT   gene            274273..275265
FT                   /locus_tag="LPC_0265"
FT   CDS_pept        274273..275265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54261"
FT                   /protein_id="ABQ54261.1"
FT                   /translation="MIVIRGYFYFEINVVYCCANLYVIKHLMYSKYPVFFPNKNIKSFS
FT                   GVRFSNVVGIPSAIESLYRGDNNLADIIFLLPTLITGVFCQNFPEVVDMEQVRLHKLTN
FT                   LSNDFHMVSMSEDPQIALDWGKGCFITIDPVLFSDYIVDVHATFRKNQLNFPDRMEQER
FT                   EHIALAVPFCSIEKITIHNQELANPFYLSIPQDNHEARMEFNTLYSELISLLRKKYTQE
FT                   ADGEEEKVALRAYAIRYLDFYSKFGSCNNPFNKSLAQLVELYPEFMSNFLQSSHLSSKT
FT                   GLMKDVVLNSSENLFKEHPYTQSIDASYIFRVKESTTCYEDDWAKPVYD"
FT   gene            275470..276948
FT                   /locus_tag="LPC_0266"
FT   CDS_pept        275470..276948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0266"
FT                   /product="amine oxidase, flavin containing"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54262"
FT                   /protein_id="ABQ54262.1"
FT                   /translation="MNIAIIGGGTGLTTAWALENQRTFHVTVFEENDRLGGHIHSIKIN
FT                   NVILEGGAEFIGPPALYPNVHRLFQYLGMALDQFELNMDFDNLKQRDHIVLPPLYHTSS
FT                   GKSEDVSSILYTLSCGLFGKRRKQNETRISVDTMLTEMYNLLEMNHLIMDARNKLLHPD
FT                   NLMTLEQFIKEFKEKCVHILSPVDKFAEEFVYPLIASGWGVSIETIKKFGAHYAMNYLA
FT                   AGMNWFDAPEGLSSYIDKMVAQCTNTQFKVNTAIKKLIPITIDGKIKYQLLKRDDTFVC
FT                   DATGSPIIYDDVVISTPAYVTNELLSDIESNTIKVLREKLANVTYYDTTVVFHQDPEYL
FT                   SPYRTVVHSRFDGTQSANTMCKPWKFNKDEIPIMKTWVLPGQEMPKNVLREVHYKHPVM
FT                   DKNYYEAQQALHAAQGEAGLWHGGILAGFNDSHESGVTAALQVAAQLNQREHCLDKNER
FT                   LALFPHILDSVLSSKLSTDMRVEVAAVAAYPSMP"
FT   gene            277208..278617
FT                   /locus_tag="LPC_0267"
FT   CDS_pept        277208..278617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0267"
FT                   /product="zinc metalloprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54263"
FT                   /protein_id="ABQ54263.1"
FT                   /translation="MIRKKITQISFFMILALIVGTVEAKTARPADEQQLARSIYKQFIE
FT                   VQSGFTTGSTTPLVEVAVKYLKKAGFSNEDIFVGGASPQKANLVVRYRGTGEMKPLLLL
FT                   AHTDVVEAKASDWSMNPFQLTEKDGYFYGRGTLDDKAQAAIWIANLIQYKQEGFKPKRD
FT                   IIVALTADEEGSSPYNGISWLIKNHKDLIEADFALNEGGWGDLANGKKISQNIQVSEKY
FT                   IVNYNLEVRNKGGHSSLPTKDNAIYRLAGALERLSKFNFPLKTNDVTAAYFKQMAAIET
FT                   GPLKTEMIEASKGSKQAMQRLANSSPQWNAILRTTCTPTLLEGGHAMNALPQLAAVTIN
FT                   CRVLPEDSPEMVEQSLKTAINDPEVTLKRIGKLSRGPSSPLSPEILKTITHLTQTYWPE
FT                   VPAIPIMVTGATDGRYLRSAGIPTYGVMGLFLDRDDFRAHGRDERISVESFYEAHAFLY
FT                   DLVKQLSSNVT"
FT   gene            278756..279808
FT                   /locus_tag="LPC_0268"
FT   CDS_pept        278756..279808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0268"
FT                   /product="acyl CoA transferase/carnitine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54264"
FT                   /protein_id="ABQ54264.1"
FT                   /translation="MLKGLKVIDLSTVLAGPSVGTFFAELGASVVKIEHPVHKDVTRTW
FT                   KLPGEDPHSEISAYFASVNFGKDYLFLDLMKEEDYLCFLNLIAEADILIMNFKKGDDIK
FT                   LRIQADHLLSINPRLIIGKINGYGEESERVAYDLVLQGESGFMSINGTPDSGPVKMPVA
FT                   LIDVLAAHHLKEAILLALYNREKSGKGKVVSVSLYDAAVSSLVNQASNYLMTGQVPQRI
FT                   GSLHPNIAPYGELFRTDDAALIILAIGSDRHFAKLCAVLGLNDLPDNDEFKHNQNRVRN
FT                   REKLALLIAEQTAKWQSNKLLELLHSENVPAGKIMDLKDVFDDERAKSLIRKELIGDIT
FT                   TARVTSVVFK"
FT   gene            complement(280005..280871)
FT                   /locus_tag="LPC_0269"
FT   CDS_pept        complement(280005..280871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54265"
FT                   /protein_id="ABQ54265.1"
FT                   /translation="MKPGYLLGALLLSPLLAFANSDNNADGLIFSPLPQNKNTVVRHYS
FT                   NEQDMSNLNQMTQRSIDFPTQIVRVSGNLTGLELSCDDVENEIDQIFSKKISPNLFTYN
FT                   TYVSCGFDEHDPEQYATNFSIQSYFDPLTDNAVDYLKNYLKEYNGYNLFNTTTLQIENA
FT                   KGIIVSMNLNAGLKNNPDKTPFMLYRQDRNNFYFKSNFDMRKELITDIYQRFYSNDPDM
FT                   ILPFFDKWIFSYAGSVYYSILKASNYLELQPERIFVMENEGDIFVSDLRYYFANLCMKR
FT                   NPNKHCL"
FT   gene            complement(281537..281935)
FT                   /locus_tag="LPC_0270"
FT   CDS_pept        complement(281537..281935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0270"
FT                   /product="heat shock hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54266"
FT                   /protein_id="ABQ54266.1"
FT                   /translation="MKNKLLPNLIIIALAATISANSITAQAKQNDQIQNSNEQFTQDPF
FT                   DTDPFFQSHDDVLLQIHKMQQAMDQFIKSQFSQMQNTLANDPHHNPFGSAKNIQITENK
FT                   DELIYKIKLPQGSDSKVDITVKKRAVSS"
FT   gene            complement(282419..284668)
FT                   /gene="katG"
FT                   /locus_tag="LPC_0271"
FT   CDS_pept        complement(282419..284668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="LPC_0271"
FT                   /product="catalase/(hydro)peroxidase KatG"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54267"
FT                   /db_xref="GOA:A5IA67"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA67"
FT                   /protein_id="ABQ54267.1"
FT                   /translation="MFKRTIPLFAAFTLAISPSVFPNYAHAQEDKPKTNQYWWPKMLDL
FT                   SPLRQPNATSNPMGEKFNYAEEFNSLDLNAVIEDLKKLMTTSQDWWPADYGNYGPLFIR
FT                   MSWHAAGTYRIYDGRGGANGGFQRFAPQNSWPDNANLDKARRLLWPIKQKYGRKISWAD
FT                   LLVLAGNVAMESMGFKTIGFAGGREDAWEAININWGPEGKWLESKRQDKDGKLEKPLAA
FT                   TVMGLIYVNPEGPNGVPDPLAAAEKIRETFGRMAMNDEETVALIAGGHAFGKTHGAASG
FT                   KYLGPAPEAAGIEEQGFGWKNSYGSGKGKDTITSGLEGAWTVTPTHWSHNYLQNLFNFN
FT                   WVKTKSPGGAIQWVPENSNASSMVPDAFDPSKRHAPVMLTTDLALKFDPVYSKIAKRFL
FT                   DNPKEFDDAFARAWFKLIHRDMGPRSRYLGSLVPKEVMIWQDPVPPVDYKLVDANDIAN
FT                   LKGKILNSGLTTSELVKTAWASASTFRGTDMRGGANGARIRLAPQKDWPANDPQELAKV
FT                   LKTLESIQNNFNNAQADGKKISLADLIVLGGNAAIEQAAKQAGYDIIVPFMPGRTDATQ
FT                   GMTDVKSFEVLEPKADGFRNYFDKSNNMSPPEMLVEKASLLKLSVPEMTVLVGGMRVLN
FT                   ANTGQNQYGVFTDKPGILNNDFFVNLLSMSTEWKKSSETEGIYEGYDRKTGKLKWKATS
FT                   VDLIFGANSELRAVAEAYATDDAKDKFIQDFVNAWVKVMTADRFDIKAANANINS"
FT   gene            complement(284799..285791)
FT                   /locus_tag="LPC_0272"
FT   CDS_pept        complement(284799..285791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54268"
FT                   /protein_id="ABQ54268.1"
FT                   /translation="MPKTKYALPPVVLYESHADRATSDFLIKQLPDLKKAGYTTICVDG
FT                   MEPGASLEENISMMKILIKMQIKKLSELPLEHPEYEQGIAKLRSVVAKLDLFEAMKEQG
FT                   FKLGGIDLPVSEQLKEKSLNSIRREQTLTDNTLRHVKENDGGVVVVLGFGHCIFQQMIK
FT                   EQDENADQYLWYHVHNPDNETQAYKELVESYTKKGLSTYFPLGVNIFKSSDKKLDTDFW
FT                   NKVSANCYNYDPKALETSTASILKSLLGPEVTAHLRTDGQHHVDALISLETVQKKHQVK
FT                   SSDFLRSLSKTLGDIHFEVAKIKTKDQVIIRGINEPEVAEQISKLSKKM"
FT   gene            286272..286589
FT                   /locus_tag="LPC_0273"
FT   CDS_pept        286272..286589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54269"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA69"
FT                   /protein_id="ABQ54269.1"
FT                   /translation="MTMMITTGNSFEGKVIKQYLGIVRGIVVRSPTISQGLMGGLKSIV
FT                   GGKIGAYSQMCEHAREEAFQLMIEHAQALNANGIIAMRYDTGEIGQAGTEVLCYGTAVI
FT                   I"
FT   gene            286787..288157
FT                   /gene="qxtA"
FT                   /locus_tag="LPC_0274"
FT   CDS_pept        286787..288157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qxtA"
FT                   /locus_tag="LPC_0274"
FT                   /product="cytochrome D ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54270"
FT                   /protein_id="ABQ54270.1"
FT                   /translation="MLVELLSRIQFGFSIGFHILFPTLNLGLAVFLVIMEALWLKTKNP
FT                   VYLEICKFWTKIFALTFGMGVVSGIVLAYQIGTNFGPFITQFGNVLGALFAYETLTAFF
FT                   LEAGFLGVMLFGWKRVPPALHFIATLLVTIGTTVSAFWIMSANSWMQAPSGYQLIEGKY
FT                   VVDSWWAVVFNPTFIPRFIHMLLASYVTTCFVIMAVSGFYFLRKQSTAIAKKSLSFSLW
FT                   ASLILVPLQIGVGDVVGINVHHYQPLKTAAMEGIWETQKGAPLLLFAIPSQTQQKNFYE
FT                   VGIPKLASLINTHEWNGEMIGLSSVGNEEQPRMAPVFFSFRIMVGIGLIMLFTAIAGFI
FT                   LRLRGTLFENSWFHRWCIVMAPLGFIASIAGWLTAELGRQPWVVHGLLKTRDSVSAIGV
FT                   EEVIISFVLLIVAYGVVFGFYLYYLLRLISHGPGILEEDEVEHHAFQYMTDFPKEKK"
FT   gene            288157..289146
FT                   /locus_tag="LPC_0275"
FT   CDS_pept        288157..289146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54271"
FT                   /protein_id="ABQ54271.1"
FT                   /translation="MLPFIFATLLGFIVLMYVILDGFDLGIGILFPFTSSESERDKMMN
FT                   SIAPVWDGNETWLVFGGAMLYGAFPQVYGLLLPILYMPIMLMLIALIFRGVSFEFRYKA
FT                   KRSKTLWNWSFSISSVAATFLQGVILGAFVQGFSINESSMTINDPDWLTPFSLCTGIAL
FT                   VCGYALLGATWMIIKSTGRLQRKMVHYARGLLVLVSFFLLFVSIWTPLHSEEVFHRWYS
FT                   FPNMLLLSPLPLIALIAIYLVWQNLSSGSEYKPFIYSIIIFLCSYIGIAISVYPYLIPH
FT                   HVTLWEAAAPDSTLVFILIGVAIMLPILLAYTLYAYYLFRGKSSENYH"
FT   gene            complement(289147..289923)
FT                   /locus_tag="LPC_0277"
FT   CDS_pept        complement(289147..289923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54272"
FT                   /protein_id="ABQ54272.1"
FT                   /translation="MIILLVIAIIFLHMCLIWLWYRYTNNPSVVDVGWASGLTLAGLIY
FT                   LNNQEFSLRSLLLVLALLTWGIRLGGYLWWTRIRLKKIDKRYLALSNDWKLAKPLGFFL
FT                   NFQLQGVLICLVSIPWYFSSSETQTTLNLLDGLALMIFLTALILETVADNQLQDFKKNY
FT                   PGKVCNQKLWRYCRHPNYFYEWLVWCSFTLFALSAPYGWIAIISPLTLYLIMTKITAPM
FT                   TEQGSIESRGNLYIEYQKVTPMFFPKWLKNNSTPRK"
FT   gene            complement(289929..290465)
FT                   /locus_tag="LPC_0278"
FT   CDS_pept        complement(289929..290465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54273"
FT                   /protein_id="ABQ54273.1"
FT                   /translation="MIINPVHTVHYLSYYLCWIFCIYLASYGYPLLGLIITVLIMGLQI
FT                   IVQILNQLPWRDALYFSIGLTLLGAITDAIWLYTGMIYFKANFFGSHFPPLWMVALWLS
FT                   FGFNLVVLYGSWLTHYFLWGLVMFPSIIFAYWLGVQFGAATLIGSEVVFYLTLGLTWSL
FT                   FLPLSLYLFNYQHRK"
FT   gene            complement(290455..292242)
FT                   /gene="yfhG"
FT                   /locus_tag="LPC_0279"
FT   CDS_pept        complement(290455..292242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfhG"
FT                   /locus_tag="LPC_0279"
FT                   /product="fusion of two types of conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54274"
FT                   /protein_id="ABQ54274.1"
FT                   /translation="MPLDKLTGITFHAAIIAGCHRLIRHKQILNDINVFPVADGDTGDN
FT                   LSSTGMAIIEFSSAKTKLRGTLESIADASIIGARGNSGIIFSQFFNLLAKHLPLKEELY
FT                   FNDFSKIMVQVGKEIASVVTNPVQGTMITLIQKWATVCEIKQPNSLLAQAMLELLPLLS
FT                   VEVEQTKNSLNILQKANVVDAGALGFYYFVEGFTQFLQQSHTTDTANTHSPLSITEHPQ
FT                   LTCTTTEYRYCTEAVLKSASIDKNKLLHFLKEQGECASVTGNDRITRFHVHTNNPREIF
FT                   TSLYKDYTIQYPKVDDMQRQHELQFGKKYKIGLVTDSSADLPQDLIDEYQIHQIPLNIH
FT                   VDEHHLLDKHCFEANYFYTQLNSFRTYPKTSCMNPNFIEEKLAKIASHYDHVLVLSISS
FT                   KMSGTYDAFLTATKKYTNITVLDTKTNSGAHGLLLHYAGQLIASGNDIDTIAKLLGKAI
FT                   KNTYIFVMVNQFESMIRSGRVNKISGRIAQWVNIKPLVSIDSAGQGIMVSKCFSASRAR
FT                   NKLINFLQEKKDEAQLILEDYCIIHAGDKNQALLLAEMTTQAFNKPPTYIEPVSLAIGL
FT                   HAGQGCIAIAGRLRERNDY"
FT   gene            292325..293023
FT                   /locus_tag="LPC_0280"
FT   CDS_pept        292325..293023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0280"
FT                   /product="2-deoxy-D-gluconate-3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54275"
FT                   /protein_id="ABQ54275.1"
FT                   /translation="MARYLVIAASSAIGQSVTTLLKNRGDTVFTTARDNHKINPDFQLD
FT                   ATHFDAVLDVFRQTGPLDGVVNCAGSLLLKNAHSTSFDEFQAAINASLTTSFATIRAAG
FT                   LTMNQGGSVVLISSAAALVGLANHEAIAAAKAGIIGLAQSAAATYASNNLRVNVVAPGM
FT                   VNSPLTSSLLSNQLVLNASKAMHALGRIGVPEDIAHAIVFLLNPDNSWITGQVIAVDGG
FT                   LSRVRPKMKI"
FT   gene            293040..294542
FT                   /locus_tag="LPC_0281"
FT   CDS_pept        293040..294542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54276"
FT                   /protein_id="ABQ54276.1"
FT                   /translation="MTTLCFILGDQLNETIASLAAINKQKDIVFLCEVAEETSYVPHHP
FT                   KKIAFLFSAMRHFAQQLKKKGYRVRYTAFDDPRNQGSFAKELLRAIEEEQVSAISLTEP
FT                   GEWRVLKIFHDLKSQLTIPVTLHEDNRFLCKINEFRNWAKEKKQLRMEFFYRMMRQKYH
FT                   LLVDNDGKPVGGSWNYDAQNRKNANRISSFPKRLEHARDVITDEVLGLVSAHFAKHFGQ
FT                   CYPFNLAVTREQALEEADYFMEHFLCNFGAYQDAMLKDEISLYHSKLSSYLNAGLLLPL
FT                   ELCQMAEQAYFSKQMPLNSVEGFIRQILGWREYVRGIYWLFMPDYGEMNYFNACRPLPS
FT                   FFWGEETGMFCIKEVVRQTSNEAYSHHIQRLMITGNFALLAGLDPKQVCEWYLAVYADA
FT                   YEWVELPNTLGMALYADGGLMASKPYAASGKYIHRMSNFCQSCYYNPNDLLGEKACPFN
FT                   ALYWNFLHQNQEKLKDNPRLHYAYMNWQKMDFDKQKKTIHKA"
FT   gene            complement(294583..294996)
FT                   /locus_tag="LPC_0282"
FT   CDS_pept        complement(294583..294996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0282"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54277"
FT                   /protein_id="ABQ54277.1"
FT                   /translation="MNGWTLKVFAIALFIFIVTDMIWLGFIARNLYFDQYQQWLRLSEG
FT                   QLKPIWWSALLVYLLFALSIVVFVIPLAKTSLPYAALYGALLGAIIYGIYDFTCLAIFK
FT                   DFPVGMAFLDWLWGIVLCSWSSIATIYVAGYIK"
FT   gene            295371..298256
FT                   /gene="pkn5"
FT                   /locus_tag="LPC_0283"
FT   CDS_pept        295371..298256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pkn5"
FT                   /locus_tag="LPC_0283"
FT                   /product="serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54278"
FT                   /protein_id="ABQ54278.1"
FT                   /translation="MKLLRSHELKSLPSMDEKALELLIKVLSNKGIRKLIKSADGKPIS
FT                   REIMIREFGIDCQILFITTEESLKPIIVPTENKISGGGKSYCEQFKVYALDDGKTYFLK
FT                   SVKIDPESLIEFTNEKDTLSKLGRLVGTFFNEQTQVHYILTTFIKGIDLSRYKNSLPLS
FT                   VNLKHFWEVLGIMISVCHQVKQFHELGLIHRDLKPGNIMLDADMQCHLVDFGSSSSDKE
FT                   PKPASWGTSSYLAPELNAQEDFIAFSQASDLFALAYSLDELFNPFRQVKFAKVDIGIKN
FT                   KHLVLLHAEIEACITGLMSNETSARTLYFSRILQLQRVPDSFKSRPEAFTYMIMLLTQW
FT                   KSCYKIPEMNKELDEIIAEIKVAYENHEQDVVKIIALLEQLSKADGLLNSHKALLSVLI
FT                   KSLANVKQQEPGHDDILPRRFESDVVSRLIKTPTAKMMAAIKQVSDAIVKILEQYEHSP
FT                   TESFEHEVLQDFLEQMVQSDILFGAPKEKIEISDIIKILKANRTEDFVQIQHISFKFAQ
FT                   VALRDLALHDLPKHEPKGAFLEILQKYQAKYAPEETSLFELYHHMAGVRDHNPSKVKKG
FT                   EGYRFRAFICDELFYGDEIFSTGDNRGREGKPNQRLQTNQVGLMKFEHSAHTKGLLTLN
FT                   GQSWYADCKTQLPNYDSIHYLSALKTDCPYITGPSGMTSLFMNMMFLLLNPKDQDVILS
FT                   YSLGVMTYVVGAGYHSIKEILIPMVKCVGIMPDYPQHKGIEYLTASPLYNHYFKAIEEF
FT                   DKEFAEVHEKIWQEHLAYFHMTYMPVCMRDHCLPHQVPSMEDISSEVKEMLEIVSKSVK
FT                   NCLEEHQVKRTGDMGLFLSTSCGQTKALEVLSHVCQQQVGLTAIFRQIQAYFKGTFETE
FT                   EGITINREMQLKFIAHFFDVLKESPTLLSQFNLTLRIENTIGVHQCELGSSKRKELFLE
FT                   IKKTSIAANEERMVANHEPRKENCNVIILPY"
FT   gene            298275..300245
FT                   /locus_tag="LPC_0284"
FT   CDS_pept        298275..300245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54279"
FT                   /protein_id="ABQ54279.1"
FT                   /translation="MLSKEKINPSLKNTKRQGSDNLAAMADPTSLKNTSDYRCFNSKPE
FT                   AYTYFIFLLNQWQTNYMADKREAIAKAIDSIKMAYENHEQDTLVVHKTLHGLSHLLEQE
FT                   HADELNALCLVPIKDSQSNANNILPRRFESELACRLIESPTKSMMEAIDLVSQAIINLI
FT                   EEYSKLDSKSSERAALNFFLQELEGSDIEFGAFKKRPTLEEVIAILKENNPKNFIQIQF
FT                   ISFMFARNVIGPFPLRNLPPFKPTGLFAQVLDKYLQDHPDLKEEEEGFSYQLMAAKNEA
FT                   EEFRTFITKKLFYQDELYTQGENRGRQGPRKTYLKTNQLGLMKLDHSAHSRGLTVIPEQ
FT                   TWCADAQAQEANQNSIYYKTALTNDCLYVTGPSGMTSIYMNMMLLLLNPQNIELIQAYS
FT                   LGIIAYIVGAGFHSVNEILIPLVKCINLLPNYPSYEGLEYLTHPPLYHEYFKQIAQFDS
FT                   DFIQLRDQVWIHYLNYFKSCYMPLCMRDFCEAEQLANCPDAAPEVKILCSIVLKSIEDC
FT                   INFHNLNRHLDSRFLGTTTADIDALNQLKEACASQSSISGIMRLLQKYFSGENIARPTA
FT                   MHKFETRSYIRFFLDALKDNPQIISHINEKMKLDPPLTISTKAEIFSDDFRIECFNVHR
FT                   ILKREHQVSEDCNNTSQFLKL"
FT   gene            300326..300913
FT                   /locus_tag="LPC_0285"
FT   CDS_pept        300326..300913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54280"
FT                   /protein_id="ABQ54280.1"
FT                   /translation="MKNAAIIKNRIFLNLDKPVKRFLASDKADTPMTAEFYAEKDYEQL
FT                   FLDFLSQATGSYDEQISMLIAELDSGADRVAQKLMSALYSPWQKNLFPKAIKTIANKSE
FT                   EYPLMSDLLIKFCQQHVGSIDAVDEFGETALAKILKKDQQRRSPLLFLVKHGAKHCQLT
FT                   SALQDSLIVNNPDIYNVAEDNTMDWVSNRSQA"
FT   gene            complement(300918..301046)
FT                   /locus_tag="LPC_0286"
FT   CDS_pept        complement(300918..301046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54281"
FT                   /protein_id="ABQ54281.1"
FT                   /translation="MNKKSWMELIAWIITFEAIGFFLGMLTQANIPSSLSQHRIAI"
FT   gene            complement(301079..302494)
FT                   /gene="phrB"
FT                   /locus_tag="LPC_0287"
FT   CDS_pept        complement(301079..302494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="LPC_0287"
FT                   /product="deoxyribodipyrimidine photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54282"
FT                   /protein_id="ABQ54282.1"
FT                   /translation="MTIALVWFRQDLRLTDNPAFIEACSHHEIVIPLYIYDDKCSVLGQ
FT                   AQAWWLHHSLIALGKSLNQQGLSLVLRKGSPQEIILELVSQYGVESVYWNRCYEPPVFA
FT                   RDKKIKLALGEREIKAQSFNGNLLHEPWAIKNKNGDFFKVFTPYWKQCRQILNIPSPLM
FT                   LTKRPRGIEITSDDIDKWKLLPAINWAARFSEYWTPGEKGAQKKLDEFIIHHLSGYKRD
FT                   RDFPAKNATSRLSPHLHFGEISPWVILRALELTKLEQTCDLASVEHFLSELGWREFSVY
FT                   LLYHFPKLDCENFRNEFDAFPWQNDEQLLTRWQKGMTGYPLIDAGMRELWATGYMHNRV
FT                   RMIVASFLTKDLLIDWRLGAQWFLDTLVDADLANNSASWQWVAGCGADAAPYFRIFNPV
FT                   LQSQKFDPDGVYIRQWIPELAQLNSQSIHQPWTDASASSIFLGNKYPKPIINHQEARTK
FT                   ALSYYQQIKKGMD"
FT   gene            complement(302590..303297)
FT                   /locus_tag="LPC_0288"
FT   CDS_pept        complement(302590..303297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0288"
FT                   /product="inner membrane protein, LrgB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54283"
FT                   /protein_id="ABQ54283.1"
FT                   /translation="MPSSILSESMIQAFFWSLITIGMYFITQKLYRRWPFWWLMPLALT
FT                   PILVASIVLLLHVNYQDYFRGTKWLVLLIGPATVAFAIPIYEKRALIRQHWPVLLIGVI
FT                   VGSFTAIASSWGLAILLGLDDNLRLSLLPRSISTPFAIEISRGIGAAPDLTAIFVIVTG
FT                   ILGAILGEFILSRLPFNSALARGALLGVGAHAAGTAQAHKIGNTEGAIASLAMILVGLF
FT                   NILLLPLISYLLK"
FT   gene            complement(303275..303664)
FT                   /locus_tag="LPC_0289"
FT   CDS_pept        complement(303275..303664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0289"
FT                   /product="murein hydrolase exporter, LrgA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54284"
FT                   /protein_id="ABQ54284.1"
FT                   /translation="MANKIQQNSFFQIILVGLFWLASELLLKLVKLPLSGGILGLGIVL
FT                   LLLATNCLKLNRIRRGAELLLANMLLFFIPGVLAILEHQEFIGLLGLKILFIILLSTIT
FT                   VMLVTALVVDYCYRWRTHHAKQHSL"
FT   gene            303770..304654
FT                   /locus_tag="LPC_0290"
FT   CDS_pept        303770..304654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0290"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54285"
FT                   /protein_id="ABQ54285.1"
FT                   /translation="MEFKLLQTFIEVVRQGSFSKAAENLFATQSTVSKAIKQLEEELGI
FT                   TLIERFKKRNVPTTAGEIVYQRGTKLLADRDDLLKELDEIRGLKQGRLRLGISPVGSST
FT                   LFAPLFVLYRQRYPGIEVELVEHGSDKLAECLRAGEIDFAGTLLPISEEFDCQLVRSEP
FT                   LVALLASGHPLATKHCISLPELKEIPFILFGSGFALHRIILDACRHAGFEPKVVAQSSQ
FT                   IDFMLELVAAGLGVTFLPRMIATQRHTTQIRSLLLNGSEFQWNMAMTWRRNSYLSEAAK
FT                   AWLALVREVHVDN"
FT   gene            304641..304751
FT                   /locus_tag="LPC_0291"
FT   CDS_pept        304641..304751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54286"
FT                   /protein_id="ABQ54286.1"
FT                   /translation="MLIISFRLGNARDLFSYCPKEAGVLKIIAAVAILHI"
FT   gene            304776..304988
FT                   /locus_tag="LPC_0292"
FT   CDS_pept        304776..304988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0292"
FT                   /product="conserved hypothetical protein; DUF329"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54287"
FT                   /db_xref="GOA:A5IA87"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA87"
FT                   /protein_id="ABQ54287.1"
FT                   /translation="MNNQKKIKCPICGKQNTWRPDNQFRPFCSERCKLIDLGEWASESR
FT                   KIPGSSIDPESIVTTNNKQDNVDEQ"
FT   gene            complement(305074..306153)
FT                   /gene="purK"
FT                   /locus_tag="LPC_0293"
FT   CDS_pept        complement(305074..306153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="LPC_0293"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54288"
FT                   /protein_id="ABQ54288.1"
FT                   /translation="MKLGILGGGQLARMLALAAYPLGINTVCLDPSPDACAGQLTKLIV
FT                   SDFNDELALKQFLSEVDCVTIETENIPFSCAELAAQIKPFYPSTQALKITQDRLYEKNF
FT                   FRTLNIPVPEFLPVESEDELMQAISVIGMPAVLKTRRFGYDGKGQYVLRTQADISKSWS
FT                   LLGSQALILEKLISFESEFSLIAVRNKSGETSFYPLIKNHHRKGILHFSEAPVHQDTLQ
FT                   QEAQTHAFKILEALNYVGVLTIEFFYQGNQLIANEIAPRVHNSGHWTIEGAHTSQFENH
FT                   LRALFDLPLGSTEVSGSCFLLNCIGNLLPLEPCLSIPGVHYHAYGKAPRPDRKVGHVTL
FT                   VDTDLERYTKSKDLLLDIS"
FT   gene            complement(306150..306650)
FT                   /gene="purE"
FT                   /locus_tag="LPC_0294"
FT   CDS_pept        complement(306150..306650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="LPC_0294"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit PurE"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54289"
FT                   /protein_id="ABQ54289.1"
FT                   /translation="MKPILIGLIMGSQSDWQTLIHAAQTLDALNIGYEAEIVSAHRTPD
FT                   KLFQYAEQAEERGLEVIIAGAGGAAHLPGMVAAKTSLPVLGVPVMSQTLNGVDSLLSIV
FT                   QMPAGIPVGTLSIGKAGAINSALFAAAILANKYPDIRAALKRYREQQTQKVLDNPNPKE
FT                   EKS"
FT   gene            complement(306710..307549)
FT                   /locus_tag="LPC_0295"
FT   CDS_pept        complement(306710..307549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54290"
FT                   /protein_id="ABQ54290.1"
FT                   /translation="MHYQNQRVLLASKHQKEKAIQPPFEEKLGCRIHVPADYDTDQFGT
FT                   FTGEIPRKASAYETLILKAKAAAKQFGYRYVISSEGSFGPHPQLYFCPADTELMAFVDL
FT                   DNDLIIAEHEVSTETNYSHIDISATDDYEAFLNKAKFPSHGIIVRALNSEENYIQKGIC
FT                   EREQLKTAIQKAFTYSTTIRLETDMRAMMNPLRMNVINKLAVKLVHRIQQYCPQCHTPG
FT                   FGKISSEGHLACISCGTPTELYLRKVLNCLKCEFKTYQARDDGLEFADQRYCPYCNP"
FT   gene            complement(307574..307927)
FT                   /locus_tag="LPC_0296"
FT   CDS_pept        complement(307574..307927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54291"
FT                   /protein_id="ABQ54291.1"
FT                   /translation="MNIIKVSEKKEMNISLHPMKKIEVIVSGDNENMVATMMEKANISG
FT                   FTLLRNVSGKGHHGFHEGKVLFNDKASFVMFIAVASEEAIANIALGMKTLFQKNSGVLF
FT                   VSDVSVARVDYFS"
FT   gene            complement(307941..310229)
FT                   /locus_tag="LPC_0297"
FT   CDS_pept        complement(307941..310229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54292"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IA92"
FT                   /protein_id="ABQ54292.1"
FT                   /translation="MSSHITLIKTNTNNENQMTQFNYKVDNDVMIIRAMVNNVAKQITP
FT                   VWPLEKFIACNSLHGFESMSFEEAVIQNQTAKKGTPFNEKLERVNWHMIKWCGSFLDIG
FT                   QGTLEMPHRDKGLYFGFLKLAPFDSELHQNNKSTKSWLSNLPEMPEQAIRLCLNKLGVL
FT                   NQKQEKFLKSTLSHLPGWAGYIKWISEWKNRNGKEENPVSLADFLAVRLIITCVLWPEA
FT                   SQEEKKKKKDNAYTKQLIQNIKNKEDDYRQLLLNKLLPELDKVQIKENRANAQMVFCID
FT                   VRSEPFRRCIEKLGHYETLGFAGFFGLPVSIKDYDGETIKDSCPVLLKPRFNIHEKAIA
FT                   ANEHCIEHHEKGKEFKNILNRIYQQLKYNFSTPFALVESLGIWCGITMFLKSCSPIFAR
FT                   RLTKDLNEMICPSIQTQPVFELDLLEKEVGISLQEQIAYAEMALRLMGLTDNFAKLVIF
FT                   CGHGSSTQNNPYASALDCGACGGNQGGKNAQLLASILNKIIVRRALAENGINIPQDTLF
FT                   YGAQHDTTTDEVEIYHSNVSQFIHQDILDQLRTDLNIAKHNNNLERINYLNSIDCAEKD
FT                   IARRSTDWSETRPEWGLARNAAFIVAPRQLTKNINLEGRCFLHSYDWSQDKDGALLETI
FT                   LTAPMVVAQWINTQYLFSTIDNVAYGSGSKITHNVAGKIGVMQGNASDLMHGLPLQSVM
FT                   SHDDKSFHEPQRLLTLVYAPREIISELVEKHDVLKTLFFNEWVHLVAIDPRSHLFYKLE
FT                   KTNTWSVIQ"
FT   gene            complement(310244..311764)
FT                   /locus_tag="LPC_0298"
FT   CDS_pept        complement(310244..311764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0298"
FT                   /product="NADH dehydrogenase subunit 5"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54293"
FT                   /protein_id="ABQ54293.1"
FT                   /translation="MDKLLNGLSISLMLSPLIAMLFYSLLGKTRNIQATYYGTTVIGFG
FT                   FGLSLLALIVSANTVNQNSYFLFHASTLSLLLSTLILFISFIIHRFSLRYMHGDKCYRR
FT                   YFFKLSAITLTTVVMALADNLLLFWLAWSASNLLLINLMIHKSQWKAAYNSGILTLKTL
FT                   LPGSLLLITAFWILFTLNNTLSIETITSEVSNKSSPAIAVALGFIILTAMTQSAIWPFH
FT                   RWLISSLNSPTPVSALMHAGLVNGGGFLIVKFAPLFVMQTNLLTILFIFGALTALLGTL
FT                   WKLLQWNIKSMLASSTMAQMGFMIMQCGLGLFPAAIAHLCWHGLFKSYLFLNSGSAVQQ
FT                   KKYQNKSRPEKLTTLLTAFFGGLLGMYGFALITGKPILSLHASTFLLGFAFITGTQFTL
FT                   GLIAYEKHFKKVILALALVFSIGIFYGGSIHLIESLLPDLTGFPQHQLSSLQVLTLIVF
FT                   FSLWLVFSMGLFKKIRETRLWDWFYMYMFNASTPHPKTITANRHTYYY"
FT   gene            311866..312717
FT                   /locus_tag="LPC_0299"
FT   CDS_pept        311866..312717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0299"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54294"
FT                   /protein_id="ABQ54294.1"
FT                   /translation="MSIDTITLQCFLAVAETQSFTKAAQRVGRTQSAISQQIAKLENLI
FT                   EKPLINRGRELSLTTDGEIFLGYAKRIYELHRESLDRFKAPELQGEIRFGLPEDFASII
FT                   LSDVLVEFSRLHPRVLLNVECDLTLNLIERFNEGKFDLILIKTTQQQVGSESIHVCTEP
FT                   VEWIGKKELLPLLDKPGPIPLVLSPTPCVYRGNVIDTLDKNHIDWRLVYSSASYAGKMA
FT                   AVRAGLGITAIQRSMIPNYLERLDYDFLPVLNDVHVSLLKKSDSNKAIESLEFFILQKL
FT                   KH"
FT   gene            312759..314348
FT                   /locus_tag="LPC_0300"
FT   CDS_pept        312759..314348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0300"
FT                   /product="toxin secretion ABC transporter HlyB/MsbA family
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54295"
FT                   /protein_id="ABQ54295.1"
FT                   /translation="MNAKPINSIIDVLDRQTISSIAMISVIISLLSLSIPIAAQTLVNL
FT                   IAFGKLLQPVITLSLMVLVLMMALGALHIWQIVIIEVIQQKLMVKVSLSLTRHFTHMSL
FT                   DNFSTHHGPELVNRFFEIVTIKKSLASLLLYGINLGLQLFFGLLLILIYHPLFLLFDIF
FT                   IIIGILLIIFIPYKKALDSAKKECSEKHVVGAWLEEILINRYLFRFNLHHRYVTQQTDK
FT                   KLVAFLKARNTHFKQLIKHQIGFYMLSALASSLLLGLGGYLVINNQLSLGQLVAAEIVL
FT                   GALIYSFRRFGALLENYYDLVASENKIDAVLNLSLEQVKEDEHGELLTPINSIQLEMDS
FT                   KNKALIAVDKPLLVFSEKSDLCQLFVEQLFGFQDPVSLHVLINEIPCAKRTLISLRRFS
FT                   LLIAEPQWFTGSIYDNLVLNHRNMSNKIIIEQLQNVGLADKIIQLPEGLHTIVYEWQDV
FT                   FTSVELTKLMLVRALLLQPELIVIDRAFDILNHQEVNEMMELVLSLKNTLLLIVSQRSD
FT                   FNYLNNRLVISS"
FT   gene            314345..315331
FT                   /locus_tag="LPC_0301"
FT   CDS_pept        314345..315331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0301"
FT                   /product="RND efflux membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54296"
FT                   /protein_id="ABQ54296.1"
FT                   /translation="MKLHAYSMISKLPKPQKIAKIIFIVFVAIILFLSFTPWQQFALGN
FT                   GKVIAFSPTERQHTVNSPVSGRIKKWYVDEGMRVKPGDPIVDITDNDPELLSRLEVEKK
FT                   AILLRIEAAKQAIAAGKANVDRQKKLYEQGINSRRQYELAQIEYAKYQNDLAQANIDKV
FT                   NVDVRIARQKTQIIKAHVAGIIFRRLTGQESVVVNAGDVLAQILPETESRAVELWVDGN
FT                   DIPFVRLNQKARLQFEGWPAIQFRGWPEIAVGTFGGTVSFIDPTDNGFGLFRVVIVPNE
FT                   PWPSVRFLRQGVRVHGWIQLGQVPLWYELWRQYNGFPPESNRENKAS"
FT   gene            315328..316725
FT                   /locus_tag="LPC_0302"
FT   CDS_pept        315328..316725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0302"
FT                   /product="multidrug efflux protein, outer membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54297"
FT                   /protein_id="ABQ54297.1"
FT                   /translation="MICFPSGKNRLMVLCLFLMLSFKCFPIPAKPLLLDAVLKSVDRSY
FT                   PQIVIARLEIRKAEGDYVNALGKFDPSFDVNPRFQPVGGYINNYADNLFNVPTLYNGLK
FT                   LFGGYRIGRGDWPIYYQNYLTNSGGEYRAGLSLPLLRDRRIDKERTELFTREETIRMKQ
FT                   QDAAATKIKIYQETIKAYWQWVEAGFQLRTFRHLLNLAKERQNAIIQQAQQGDLPRLAI
FT                   AENLQLIVQREQLVNQGEMLLAQAGINLSLYYRDANGKPQKPDESQLPATFPAQPIRVS
FT                   NSISQLQRHPVLRKLENYSKIVKLKQNLARNELLPNLDATAYTFKQYGTGGYPLLIPQA
FT                   AMIGVNFKFPIFQREARGKLISTTSELQQVKTEMKFTYEQLNNELSNLLVAIRIYQQQV
FT                   VLLNKELNLARQVEKGETKRFYEGDSTLFLVNQREQTTAQVKLNWINAEVNLQEATALA
FT                   RFFSSTQ"
FT   gene            316987..318009
FT                   /locus_tag="LPC_0303"
FT   CDS_pept        316987..318009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54298"
FT                   /protein_id="ABQ54298.1"
FT                   /translation="MNTTSRKSKTYDRWKQVEGIYGVRLQDILNVDLTKLHDSPYTYKS
FT                   ELLFLLQMSLRNIAVIVNKEDLIKRIIEEGRSKDQTKIEGSNAYCKFMELVQLYLYRRD
FT                   SLARISQFNELALSPEIVQTAQDIARILGPILRNQPFHQVQKIENAFVKEVLLNDVLSG
FT                   NTINSNSIILKSLEKIKEQGRWATHDDLKEIADLLKINLNVVGQPNGKPLPEYPTVTLK
FT                   NLSNTHWITQVESLQGPRQYSTPRKRAFGYETVSDRAVPLKEEQTLDRTFRTQTQSERA
FT                   KRYRQHFETLFDTLSPYGFFTYEQNKRNTQVSGKVQTGLESDESLAARLQEAELRRILY
FT                   "
FT   gene            complement(318424..319257)
FT                   /locus_tag="LPC_0304"
FT   CDS_pept        complement(318424..319257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0304"
FT                   /product="heme oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54299"
FT                   /protein_id="ABQ54299.1"
FT                   /translation="MFSKALISATYKNGKPGQLTEEHEKAEHHRFKTEFLFKNAEISKE
FT                   LYASRLIQHFFIIKAIETKLQSLSKTEQSEISAFFAISYLEHLWRSPAIENDLRQLNIN
FT                   PDEIDKDEITKTTENYLENIGKFTPKILLAHFLLHIAGFMHGGNIIRSKYIEPSNRLTS
FT                   YQIAADQYDFSSAISFLSSGRHSPLALYQDMMKQIDNIALTDGEYDEILEQCKGIYETM
FT                   SNIYDDLCDMHAHHLKLPTYSLAAISVSLVALGLILKLLMDFLNPVTNPIANAPR"
FT   gene            complement(319469..321613)
FT                   /gene="pleD"
FT                   /locus_tag="LPC_0305"
FT   CDS_pept        complement(319469..321613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pleD"
FT                   /locus_tag="LPC_0305"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54300"
FT                   /protein_id="ABQ54300.1"
FT                   /translation="MNNTWHQTATGNRSISNYLRLSRTLLNVIFIIALSLLLIINIISY
FT                   NQVKNLLLAINWVSQSYEIIQTIDTCLYEVVSIESRQRFYLIRDSNNQHMVDVDEMKSA
FT                   LKLNLDKLEKLTRNNLEQNKRTNRFTDLIERRLNLLNQIVQLKAIGKFNTHENYDLLNQ
FT                   SQDMSNQVKSLGQEIKSVELVLLSERKASAVRRADRSSFTLISGGITSILFLLIAFILA
FT                   NSELSSREKTELQNQNTQTQLKKIIESTSDMIAAFDKEHRFITFNEAYQREFKRLFDKY
FT                   ISINLSLEKALVDIPENKKELAEIWKNSLQNNEENKTIELNTEHEKIVYEMSSKLIQNG
FT                   DNEINGVVHSVRNITKRVQEHTELQESYQKLANGMKELQEKNEQITLLVEMSDIMLACS
FT                   SQQELSDVLSKYSQRLLRFSSGYLFIMHPSKNYLEKTTSWGDPQPHELTFTPEQCWAIR
FT                   RGRVHHVDSSHIELLCGHVSFSLEQQDLSLLCVPLMAQNDIYGLLYLEVNLKQLPLFDE
FT                   NQRLLITAFAELTALALANVRLGESLRYQSIRDPLTGLYNRRYLEDFLFKQLHQAERTK
FT                   ASFAILMLDLDHFKKINDTFGHEAGDFVLKEIGQILNNDIRLGDVATRYGGEEFVLLLF
FT                   DVDANAAKTRADNLRSAISKLQVKYGAQYVGQVTASIGISIYPDDAKSPDELIEAADKA
FT                   LYQAKNKGRNMVLLFSEISS"
FT   gene            complement(321758..324316)
FT                   /locus_tag="LPC_0306"
FT   CDS_pept        complement(321758..324316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0306"
FT                   /product="heavy metal transporting P-type ATPase, cation
FT                   transporting"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54301"
FT                   /protein_id="ABQ54301.1"
FT                   /translation="MLYSNYRFYLAKDAQLLNPEESREAIEQILAKTKELELIRVAVDL
FT                   TSSNKSICLLSASKESHVIKTKVTQILKEQGLSIIDMMEVEVLQDIEKIEHHHPTHKSK
FT                   DTHLHPIKKHPKKAKHDHSHGHGHHHGHHHENHWIKAALGLIWGIGLLVLSIGTFNIPL
FT                   VAYYVITGLTSLMTLYLGHTVYQSAWQALKEKKWDTTTLYSISTLTILAVSIASVFVPG
FT                   LPMMFEAAPLVLGFWHLGEGIEHTLVGKINKKLDVRDCVPPLVLLKGNPDKEISVKTLI
FT                   PNDMIIVKKGQVIPVDGVLTQKALLYTTRIDGSPKLKEFHPGDVVKAGMQLADHIPSLE
FT                   MQVTKTYQNSYLSLIAENINKANDEKAPIEMFANKVLKYFIPGLIAVALLSGIVIGSLF
FT                   NPALAIQCVVSVLVSACPCALSLITPMAVKIGMKKASENGIHFNNGKALQAAADIDTVV
FT                   FDLNGTLTQGKMVVKSLHITDKKYLRPIALLESQSDHPVAKIIKSYIEQQDTVSTEPLE
FT                   IASIDKSHHSGMKGIINGEAFMIGNKDMLAANGITSIDKPYDNPEKGSVYIVRGTTVIG
FT                   QIALIDPLREDAIATVKQLKRLGKSVHICTGADQATAEKYAALLGIPKDNICANTVGAV
FT                   TQKGEVSKTSYIQQLKQKGFKVAMVGDAANDATAIAYSDIGIAVKSSIGDSITEQHAGI
FT                   VVQQGLLFPIATAFDVAQKTKQNIFQNLFVSLSYNSIITLVAAGLFVALGFALNPVLGV
FT                   ALMVLESTIVLTNLYLFKQQDIVSSTSPNANNAVEVEPTVNTTSKVLHALGHRSQPQEN
FT                   LAIVTESKLVNPKVINLFAPKELSSNRPDVTQQKLGCVTC"
FT   gene            324561..325094
FT                   /gene="np20"
FT                   /locus_tag="LPC_0307"
FT   CDS_pept        324561..325094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="np20"
FT                   /locus_tag="LPC_0307"
FT                   /product="transcriptional regulator np20, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54302"
FT                   /protein_id="ABQ54302.1"
FT                   /translation="MIGCCLIIFPCNRDYDKIVRTNYSLERRLMKHNLLDKAYKHCVNH
FT                   GYRFTEPRERVLKILVDERKPLGAYDILQRLSMEVDNPKPPTVYRAIQFWHQEGFIHCI
FT                   DSLKSYVACLHGHHVGQAQFLICNQCDFVKELECVVDFTSVTEAANSIQFSIINCTVEI
FT                   KGLCSDCNLTNLKN"
FT   gene            complement(325212..326804)
FT                   /gene="mdlC"
FT                   /locus_tag="LPC_0308"
FT   CDS_pept        complement(325212..326804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdlC"
FT                   /locus_tag="LPC_0308"
FT                   /product="benzoylformate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54303"
FT                   /protein_id="ABQ54303.1"
FT                   /translation="MKKTGSDVLKEFITTFEINYIFGNPGTTELKFLEAIEQCDNATYF
FT                   LTLQESSTVGIAAGYAMITRKPALINLHNYVGLANAVCNMYNAFTSGIPLLIIAGQHSR
FT                   PYLIHSPVMSGDLTSLAQTAVKYAYEVNSASDLAVALQRGYAQAILPGPGPVFLSIPMD
FT                   IWQEETHETTIKKTRFLHACINAEIEQICEVLTNTPKGKLAFIADYEVGASNSIYLLHT
FT                   IADRLNADIYAAPYHVREVINPLSVNYKGRLSDKSGEVHNLLLQYETVVLLGEKVKGYL
FT                   YTGQSSIPQGIQFIQISAASEHLAFDYPCDLAILGNLEATLTAISKHLKIIGVSVPLKP
FT                   ATNIKNLEKKYKQHPLHSLIVTLLNQVNRSVHLITEGSSEDAVVQDIATTLGFLNVNFS
FT                   PRGGGLGWAMPLAIGISLATRHHSICFVGDGGSMYAIHSIWSAAKYKIPVIFICFVNRE
FT                   YRVLKTDMSQNRSFTEEDFFRLDLNHPPIDVQQIALSFGAQVKAIKSKEEVETVLKSSF
FT                   AFQGPTFITLYHQ"
FT   gene            complement(327100..331590)
FT                   /gene="sidE"
FT                   /locus_tag="LPC_0309"
FT   CDS_pept        complement(327100..331590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sidE"
FT                   /locus_tag="LPC_0309"
FT                   /product="SidE protein, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54304"
FT                   /protein_id="ABQ54304.1"
FT                   /translation="MPKYVEGIELTQEGMHAIFERMGHPNITSGTIYNGEPTIDKGALD
FT                   RQGFMPVLTGVSPRQDSGHWIMLIKGQGNQYYLFDPLGESSGKYYQNILAKKLPGATLS
FT                   VIPNNAGLNMGLCGYWVASVGLRAHAALTQPIPPSLRNLGQTITQEMRDELTQDGSEKI
FT                   TQWLRAVGNEFPDGDIQPDATALRRATEKNLRIDELQPVFAGTTPKEISINPTAPQETS
FT                   VPTWNGFSLYTDEIVRNAARYAYDNYLGKPYTGTVEATPVNFGGQMVYRQHHGLAHTLR
FT                   TMAYAEIIVEEARKAKLRGESLKTFADGRTLADVTPEELRKIMIAQAFFVTGRDDEESS
FT                   KNYEKYHEQSRDAFLKYVEDNKSALIPDVFKDEKDVKFYADVIEDKDHKWADSPAHVLV
FT                   NQGHMVDLVRVKQPPESYLEYYFSQLQPWIGSKAAEAVFAAQRQFFHATYEAVAGFNSE
FT                   NTEPHLVVDGLGRYVIGPDGNPIREEPDDEDEEESGELKFFSQKKKLEENQRYMRVDEY
FT                   LKLDEVQKRFPGAGKKLDGGLPGLNEYQYLQRLNSINRARCENDVDFCLGQLQTAHHQT
FT                   KITPIKRAFQSSSEKARRQPNMDEIAAARIVQQIMANPDCIHDDHVFLNGQKLEEKFFR
FT                   DLLAKCDMAIVGSLLNDTDIRNIDTLMQHERNTEFHSTDAKAKPVKLGETWEKTIRSGG
FT                   GVTQIKHDLIFLMQNDAWYHTRVNAIAQNRDKDSTFKEVLITALMTPLTNKSLIDTSRS
FT                   PAPKTLFRGLDLSEEFKNKLINQAETIIANTTEHLFTDLSTEAFKQIKLNDFSQVSART
FT                   CASTSTNIAVPRTIFGSNTIFEILDPDGLLHPKQVGTHVPGSESEYSIYLPEDVALVPI
FT                   KVSFDGKTVKGKDRHIFTLVAVKSPDFTPKHEIGYAVGPLLRMQTPKLEEIQRLVEQAR
FT                   EEPDLERVFNLQSRVARQAKLFSTEPGYKTFLNEKVAPVLEQSLNGLLDNNVTILGKVL
FT                   SAFPSDGQWSAFNSVEARQMKIQMDAIKQMVEKKAVLEGRILPALAQCQDALEKQNIDG
FT                   ALQALKNIPSEKEMQTMLSISSGLRGQIQRAKQNLTENLEPLQRAMTAKLVSDKEKVKV
FT                   RYEKLIAGIPQQITDLEKAALSDLAGVKKVVSHFNHLQEELKLLRNEKVRMHTGSEKVD
FT                   FSDIVQLEAQLQKIHTKLYDAYLVELTKEISALAKEKPKNLSDVKRMVSNFYAMSADIE
FT                   QLRQEKIKEHGESKDPIDMSDIDKLKKELQKINQFLVKAMGTNIRVSLNQMEVKTFDAQ
FT                   EKEAQQNLKQLDELINKLESSDAVQKQKEELEKLNQLLIEKRKAYPAMVQLQFRSEALI
FT                   IHLRELCEAHQAQMAKTRKARAQEITNGRWKVQWLTDWVGLTTDERVTLANKEKELAKF
FT                   KEDLNNDEYDLQELISNLAEKTPSELEEAIGISKESAQKLHKLLTHLNHSTTFMSKIEQ
FT                   RLQSIDELLNEFGKQSPRTEMIKTVEEKQGTLLRL"
FT   gene            complement(331845..332024)
FT                   /locus_tag="LPC_0310"
FT   CDS_pept        complement(331845..332024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54305"
FT                   /protein_id="ABQ54305.1"
FT                   /translation="MPTDKPYPMPLSFQNIQHISLIWLSYFSIRQNTVLPKLIQTGLTK
FT                   NLKVKAKNVFNEEV"
FT   gene            complement(332014..332496)
FT                   /locus_tag="LPC_0311"
FT   CDS_pept        complement(332014..332496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54306"
FT                   /protein_id="ABQ54306.1"
FT                   /translation="MATYYGQCACGKIQFICTGEPVFTQYCHCNKCREIASLSQKKQDK
FT                   SGYSLTAAYLTRDFRIVSEENDFEEIIKEKAKLFLCSYCHSLVYGISLDPRQQDSIGIN
FT                   VNNFKFDTNIPDSFKPIRHIWYACRIMDCDDQLPKFKDAPKEQFGSGELFELPNAN"
FT   gene            complement(332590..334569)
FT                   /locus_tag="LPC_0312"
FT   CDS_pept        complement(332590..334569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54307"
FT                   /protein_id="ABQ54307.1"
FT                   /translation="MRYVNFELLKRIPQHLKGVMEYYPDVLLFQLNQIQYTHLWHELSS
FT                   AKYLYTNGFVIKPTHWLMYAFQTVKGWLGFDNHCQREKISYVLNKLSYYGYTKQFLQPD
FT                   FSSITNFSISPEISALVVKSRDDLTTAQLQNKLVNNYFKVEPHLGIDYSYQKLNPNHRF
FT                   GESWTHAHEWGLIPQLDPQDDSLIAEVISTLDKNGISAKDVFFLQHSKYAKAAAQYYCD
FT                   KAKNTIVPSFFFRLLWTDPRPRYLALALAYDPEIAKRDAQKFIEYHLAQKEYDNAFNLL
FT                   GILNDSNLVLKFLLAIPETERHALIQKDTAIAAIMAKYYIEKKQYLLATQFYTNIEEIS
FT                   PNAAFAIEIQEQNYEKAYDIFKKYNSPDLFSMPERKSLAKIFYSEAETAYVAGKTYRGN
FT                   KSWEKAKQYYLQSLEQKKAAHHLDPSDEYLEDLYVHKRLYALLLIDADIDLHKAEDSDI
FT                   ASIQKAITLLRECRSNNKEEQEHHKRALAAGLMRRVDTLREKIAFNYYSSDFESIRKHK
FT                   IEHQQDIAILIKTLGELIALLEGTQDKALRLQLGKAHYLLADVQCFFDINAPDINQHYK
FT                   MAMKAVPGNPFYVLRVAELFEEEKSKLQKIGIIQLKNMGYQVFDFLHWSEERWCKRDDI
FT                   IHNIKDIHMPPAEPINSSSWNFTF"
FT   gene            334851..335645
FT                   /gene="mhpC"
FT                   /locus_tag="LPC_0313"
FT   CDS_pept        334851..335645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="LPC_0313"
FT                   /product="lipolytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54308"
FT                   /protein_id="ABQ54308.1"
FT                   /translation="MATLKIHDVDIYYELYGQGKPLVLIAGYCCDHTFWNAMLHELAEE
FT                   FQVLIFDNRGIGQTRDNGDSFTLEAQADDIMAFLEQLGFRNPSILGQSMGGAIAQLLAR
FT                   KHGKKISKLVILNSVAKFNTRANQAMESLLNLRKENISFDLLIEAGIPWFFSSEYLAEP
FT                   KNIATFKENLKNNPYPQSLQDQVRQFRSIPPFDSRGWLHEIKVPTLVIAAEDDILTLPA
FT                   ESQQLAQRIPNAQFITIPGGHSSPLEHPALVNDAILKFLTSS"
FT   gene            335661..337127
FT                   /gene="gbsA"
FT                   /locus_tag="LPC_0314"
FT   CDS_pept        335661..337127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gbsA"
FT                   /locus_tag="LPC_0314"
FT                   /product="glycine betaine aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54309"
FT                   /protein_id="ABQ54309.1"
FT                   /translation="MEIYEMYIDGKFTLAKSGTTRDIFDPANGELIARVPESAKEDAIL
FT                   AIKAARKAFDEGEWRKSLALDRGKLLFKLADLIRANAKMLAELETRNCGKPLPEAEFDV
FT                   TDAANCFEFYGGLATKIHGETMSVPANSFSYVVREPIGVCGQIIPWNFPLLMAAWKLAP
FT                   ALAAGNTVVLKPSELTPITALELFKLIDQCGFPAGVVNLITGPGMGVGEELASNSMVDK
FT                   VAFTGGSATGRKIMQAATGNLKKTSLELGGKNPNIVFADCDLEMAIDGALFGAFANQGE
FT                   VCSAGSRLLVERSIHKKIVEGMLKKIPNIKLGHGLDAGVKMGPLVSSAHREKVESYVKL
FT                   GMEEGAKLLCGGKRPTGSEFAKGHFFEPTIFDEVKSTMRIAREEIFGPVLVVIPFDTEE
FT                   EAIRIANDTDYGLSGAVWTKSVTRAHRVTSQIRAGILWVNHYHPTYNEMPWGGYKQSGA
FT                   GRELGLYGIESYLEVKQVNINLDETPIGWY"
FT   gene            337132..338454
FT                   /gene="gabT"
FT                   /locus_tag="LPC_0315"
FT   CDS_pept        337132..338454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="LPC_0315"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54310"
FT                   /protein_id="ABQ54310.1"
FT                   /translation="MKKIHIKTSIPGPKSQQLMELRRQHVARGPFHATPIFVKQAKGSF
FT                   VEDVDGNVFLDFSSGFGVVNTGHCPDSVVNAIKLQAEKFIHTGFNIIPYEAYIKVCEKL
FT                   NYHTPGHFEKKSLLLNSGAEAVENAIKIARAYTGKQAVICFDHAFHGRTYMAMTLTSKN
FT                   KPYKHGFGPFPSEIHRAPFPYEYRWKGANCVEECFNEFTDLANFRVGVENIAAVIIEPV
FT                   LGEGGFIQSPALFLQKLREFCTTNDIVFIADEIQSGFGRTGNLFAMNTLGVTPDLTISA
FT                   KGLGGGVVLAGVTGKAEIMDAAMEGGLGGTFGGNPLSCAAALEVFHIFEEGSLLQNVTH
FT                   LAKILQSRLSGFKEKYKVVGDVRGLGVMQAIELVKDKNTKEPNKEATVQLAQFCLEHGL
FT                   IILTCGTYGNVIRLHMPLSTGVKDLEIGLSIIEEGLKRLSI"
FT   gene            338543..339310
FT                   /gene="recN"
FT                   /locus_tag="LPC_0316"
FT   CDS_pept        338543..339310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="LPC_0316"
FT                   /product="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54311"
FT                   /protein_id="ABQ54311.1"
FT                   /translation="MWYQNIMRNLLEKLPEASRKDGEIFLSKLFLAVKKVDNKPEMEFF
FT                   LGLIEKSFLKFENEKSGSVTLAKFSRYILGLTLLYLKSSNDLAIWNSDFIPSLTEIKKC
FT                   LEAEKAGKPFYKFINQLEVETFASLNHQLAIDFNHFSAILKRNSDLKTIQSFTEACKGL
FT                   GNDVSQGFSQVMQDAEAHMINLQFAVDFDSGFGHESTDENQGNTKLQKPSHVNYMSMSA
FT                   NNLHRLGIFKLLAMSDGLSDQSNLFINQNNELR"
FT   gene            complement(339289..339420)
FT                   /locus_tag="LPC_0317"
FT   CDS_pept        complement(339289..339420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54312"
FT                   /protein_id="ABQ54312.1"
FT                   /translation="MHQPNMSFPAQVETPFYPGYQDRFIPEKIQEQIDENHYLSSLF"
FT   gene            339669..340478
FT                   /locus_tag="LPC_0318"
FT   CDS_pept        339669..340478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54313"
FT                   /protein_id="ABQ54313.1"
FT                   /translation="MSKGKILSYAVMTIISSTALAGAMGETKTCPDLGCMPWFVEFGTG
FT                   VSWSTKSHINPDPSRWDPANEGYNSTLGNEPLYMAGIGYTINPLLSVDANYTFRGIYKY
FT                   RKHQTALGASAVNPLGNKTRYFDLISNSLMFSGTLYGQGWSENLAYSMGNYGIIQPFLG
FT                   GGVGVAYNTVSNFRTVTDNTNFVTSVLQDYTKASFAWQLNAGLELKKNRFGLDLGYRYF
FT                   NAGSFLSNNALITRVNSVGTPITTNLIPAWSSNLSANELYLTAKIAF"
FT   gene            340620..341552
FT                   /locus_tag="LPC_0319"
FT   CDS_pept        340620..341552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0319"
FT                   /product="glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54314"
FT                   /db_xref="GOA:A5IAB4"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IAB4"
FT                   /protein_id="ABQ54314.1"
FT                   /translation="MSSKLLTIQLLEELVHAAELNQEGKTADYIPELANVNQELTAIAV
FT                   QPLGEKTLAYSNNPLHPVTLQSTGKMIPLIGLLEEFGADQLFEWVKVEPSGDDFASITR
FT                   LEQFGPKPSNPMLNAGAIALCSRIPGVGEQQFRWLEHWVQKLFNQRLSINPLVFASEKR
FT                   TGNRNRALAYLLKSRNNLGADVHETLDLYFALCSYEAMLDQMLYLPAVLANRGQDPDTG
FT                   EQILSIETCKITLAIMATCGLYDETGTHMVKTGMPAKSGVSGYTIAVVPGKAGIVVLSP
FT                   RVNAKGNSIRGEIMLEGLSKAMGWHFALP"
FT   gene            complement(341654..342253)
FT                   /locus_tag="LPC_0320"
FT   CDS_pept        complement(341654..342253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0320"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54315"
FT                   /protein_id="ABQ54315.1"
FT                   /translation="MKIVVIGATGIIGKAIVAELNPRHEIISASYKNSDIQVDITSKQS
FT                   IDAMYKKLNTIDAVVLATGKVHFAALKDMGEDDYKIGLTNKLMGQVNVVLAGLEYINDN
FT                   GSFTLTSGILNRDPILYGSSAAMVNGALDGFIKSAALEMPRGIRINGVSPTVITEAMEN
FT                   YGPYFRGYEPVSAARAALAYSKSIEGAQTGQVYCVG"
FT   gene            complement(342584..343978)
FT                   /locus_tag="LPC_0321"
FT   CDS_pept        complement(342584..343978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0321"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54316"
FT                   /protein_id="ABQ54316.1"
FT                   /translation="MVLKFDTIILGGGKGGKTLAMDLAKSGQKIAMVENNQIGGTCINV
FT                   ACIPTKTLVQSAKVAHYCRKAKDYGLNTTLHPIDFKAIRARKDAVVNGMREANLKQFLD
FT                   SGMDLMLGHGHFIGPKMIEVTLSSPRDNQKTLHITADKIIINTGALPYTPPIAGLDKVN
FT                   YFTNDSLMNTDSVPQHLLIIGGGYIGLEFAQMFRRFGAEVTVIEASSEFLGREDKDIAE
FT                   QVFQTLSNEGIQFAVDTKINAIRQEQTEVIIEANRQGQSEIIRGTAVLVAVGRIANTAG
FT                   LHLDKTGVELDERGFIKVNEFLETTAAGIWALGDVKGGAQFTHLSLDDYRLVKHNLQNP
FT                   QKKLSSQNRLIPYTVFLDPELARIGLTEAQARSQGRPIKIAKIPAAAIPRAKTQGETTG
FT                   VLKAVIDAETDLILGVSIFCAEAGEILGVIQLAMELRIPYQKLRDMMFAHPTLVEGINL
FT                   WFAQII"
FT   gene            complement(344030..347392)
FT                   /locus_tag="LPC_0322"
FT   CDS_pept        complement(344030..347392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0322"
FT                   /product="NAD-glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54317"
FT                   /protein_id="ABQ54317.1"
FT                   /translation="MMTNSWKDKLQKQLTQQFGSPKGKQLIDKYTETMSMSYCEQHTPE
FT                   EAIQDILQIEKLSKDNPLVIDFYEKTHLQYPLHIKLYRYETPIPLSDILPMLENMGLRT
FT                   YTERPYKIKTRDGQLFWISDFNVTYSQTDSLNITQVKDVFAEALINITLGVCENDGFNK
FT                   LVLCAGLSWQEITILRAYAKYLHQIGIRYSQSYIEKTIEMHAAIARDLIHFFYLKFGLK
FT                   RKSTIHKDISALEQKIQINIDAISSLDEDRIMRYFWSLMKATLRTNYFQKNHAGLSKDY
FT                   LSFKLKSSEIPDLPPGQPLYEIFVYSTRFEGIHLRSTKVARGGIRWSDRPEDFRTEILG
FT                   LMKAQKVKNAVIVPSGAKGGFVLKKPLLAASREQIQQEVISCYKSFINGLLDLTDNLIN
FT                   DKTIPPQNVICYDEPDPYLVVAADKGTATFSDIANSIAKEHGFWLGDAFASGGSAGYDH
FT                   KKMGITARGAWESVKRHFRELEINIQQQDFTVVGIGDMSGDVFGNGMLYSKHIRLLAAF
FT                   DHRHIFLDPNPDPLKSYEERLRLFNLPTSSWEDYNLQLISKGGGVYKRSSKSIPISPQV
FT                   KKALAIEANALTPNELIRALLKAPVDLLFNGGIGTYVKATTESHADVGDKTNEFCRING
FT                   AELHCKVVGEGGNLGFTQLGRVEFALKGGLINTDAIDNSAGVNCSDHEVNIKILLDKEI
FT                   REKKLTEKKRNQLLSRMTDEVADLVLQDNYNQALILSISAAHSSHYSGLYQDYMKELEK
FT                   WVNLDRNVEFLPDDKKLLERKTTGAGLTRPELAVLMAHTKIHIANELLKSHLPDDSYFT
FT                   TFLETGFPISLRKPYAKALPKHPLSREIIATQLSNKLVNNMGITFMYRMLMETGMSIAD
FT                   IACAYTISACIFQTDVLQNLIDSFQDKISLSTQYELLHHIRQLLNLATRWFLHNNRLTG
FT                   GIEKNIKNYGKSVKKLEQLIPKLMGGVTKEYLEKLISQFVSIGIEKDMAQKIAITRALY
FT                   TSLNIIEVTTQNEFDLSLTAETYFKVGSQFNLVWFRDQIANDSREGHWNTMARLSLRDE
FT                   LDNLQRRLTIAILTTNTKERTSEKLINYWLEQNHPIQKRWEKLLEMLLGSENIDYTIFF
FT                   IALRELSSLIQVL"
FT   gene            347742..348314
FT                   /locus_tag="LPC_0323"
FT   CDS_pept        347742..348314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54318"
FT                   /protein_id="ABQ54318.1"
FT                   /translation="MLFQPVTASFSMLVAGAFAQLLVPYSIFMLCMGEAGFAGRTLINY
FT                   FEITIVALAMPFIALLSTVGRCIATVKCLVEDQYNLAEMVEDKEVKPNKIYLDCAEVNY
FT                   TVRDENNNQFIRKYYKFQYKMRGLNDELCQGIFTFRDLERAPDNDDFNGKLSSLTLYKY
FT                   DILDLIKRVHKDKFEEMEDENLIRISI"
FT   gene            348554..349507
FT                   /locus_tag="LPC_0324"
FT   CDS_pept        348554..349507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54319"
FT                   /protein_id="ABQ54319.1"
FT                   /translation="MRLSYGLLGFMIFNLVACEKMALLTTPPKKQQLSNSPLATRAERY
FT                   FWRTLHEGRYQDIPQADYLLMAAYLENPYDSKLAAHLGFIHIWKITERERVKNNSPLLP
FT                   NEIILSKKYFADALQLDPENPIYQGFYGDTQLVEGQIFKDKQEEVRGYFTLQKAISNWP
FT                   EFNYFTAGYPMSSLSADSDHFKKGLDWQWKTLDICAGEKISRQNPDFTPYMKRETTIGT
FT                   QRACWNSEIAPHNFEGFFMNMGDMLVKSGDPETGIKIYNNAKLAKNYNKWPYKDMLEKR
FT                   VLNAKANVQHFNQKSNDPNQSIMFNSGYGCVVCHQR"
FT   gene            349583..350008
FT                   /locus_tag="LPC_0325"
FT   CDS_pept        349583..350008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0325"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54320"
FT                   /protein_id="ABQ54320.1"
FT                   /translation="MCFCKADRIKAKESVIVLIHFGKQFKKNMEKITIYHNPRCSKSRQ
FT                   ALEILQNKGFEPIIIEYLKTPLDLEQLKRLRTHLALEDLVRTNENVFKELGLSLANEAQ
FT                   VLEAMVKEPILMQRPIVTFKGKAAIGRPPEKILELFD"
FT   gene            complement(350094..351245)
FT                   /locus_tag="LPC_0326"
FT   CDS_pept        complement(350094..351245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0326"
FT                   /product="stearoyl CoA 9-desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54321"
FT                   /protein_id="ABQ54321.1"
FT                   /translation="MFGFLNMTLWGYLLTGFVLTHITTTAVTIYLHRYQTHRALTLHPL
FT                   VSHFFRFWLWLTTGMTTAEWVAIHRKHHANTDMEGDPHSPQVFNIRKVFWQVPELYREA
FT                   SKDKDMIKKYSYGTPNDWIERKLYSPHANKGIFLMLALNLFLFGIPGLTLWAIQMMWIP
FT                   LVAGVVNGIGHYWGYRNHESSDSSTNVFPWGLLIAGEELHNNHHTFASSAKFSIKWWEF
FT                   DLGWFYIRCLSFLKLAKVKKLPPKLIIDKNKSHIDVDSVKAILGNRFQVISDYYKLVIF
FT                   PTLRDMQYRIKNRDLKNARHLLKKPNEQLSHADQLRLKTLLKQHDNLQAVHNYRELLQQ
FT                   IWLKTSLSNKDLLNLIQKWCSQAEESGLLVLRQFASQLKSYSL"
FT   gene            complement(351367..352611)
FT                   /gene="rhlE"
FT                   /locus_tag="LPC_0327"
FT   CDS_pept        complement(351367..352611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhlE"
FT                   /locus_tag="LPC_0327"
FT                   /product="ATP-dependent RNA helicase, DEAD box family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54322"
FT                   /protein_id="ABQ54322.1"
FT                   /translation="MSFKQLALIEPLNRAVSELGYTNPTSIQLKAIPLILNGHDLLGSA
FT                   QTGTGKTASFVLPILQKASQQTQTSRNRVKVLILTPTRELAIQVHESIIQYGKYLTLRS
FT                   AVIYGGVKSHNQIKQLDSGLEILVATPGRLLDLYQQGAVKFDEIDTLVLDEADRMLDMG
FT                   FIHDIKKIIKLLPLKRQNLLFSATFTPEVRTLARNILNKAVEIDIAPRNTAVKTIKQTV
FT                   YSVDRNHKLALLSHLLHKNNWGQTLVFSRTKHGANKLVKQLAESQIYSVAIHGNKSQAQ
FT                   RTKALADFKSGKVQTLIATDIAARGIDIEKLACVVNFDLPHVPEDYVHRIGRTGRAGAS
FT                   GLAVSLVSTEEIKLLLSIEKLINQKLERIKIKDFEFLHNFSDLVSAKIQKFAPPKAGYK
FT                   GNISRKSRTAFNKSA"
FT   gene            352942..353217
FT                   /locus_tag="LPC_0328"
FT   CDS_pept        352942..353217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0328"
FT                   /product="RNA binding protein, cold-inducible rrm"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54323"
FT                   /protein_id="ABQ54323.1"
FT                   /translation="MKQKKIYVGNLPFGTTEEALSIQFSQYGKIEEMFLIKDRLTGQMK
FT                   GFGFITFSAQQEAESALEMNGQPFDGRSLKVCMAQKKTNSVSRSRW"
FT   gene            353394..354071
FT                   /locus_tag="LPC_0329"
FT   CDS_pept        353394..354071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0329"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54324"
FT                   /protein_id="ABQ54324.1"
FT                   /translation="MKAKGFFDEQSSLQKSKIGLNLVWMFSLGHIFLITLSNVLVQYPF
FT                   AMMGFHTTWGAFTYPAIFILTDLTTRIATANKARKIIMLSMTPGLILSYLVASYIEAGN
FT                   NLNENGLSVLHLMPLRIALACFIAYVVGQLLDVAVFQRYRNRPAWWLAPTLSAVAGNFI
FT                   DTALFFTIAFYHCSNPFLSQNWPEIAMVDVFFKIMISLIAFVPVYGLVLSILGIKTTNK
FT                   LMV"
FT   gene            354109..354747
FT                   /locus_tag="LPC_0330"
FT   CDS_pept        354109..354747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0330"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54325"
FT                   /protein_id="ABQ54325.1"
FT                   /translation="MLTGLRLLTKDLKILNGKYIQLEPITSQHREELRKAANHEQIWQY
FT                   MPQKATGKLFNSWFDDCLEKMSARDQITYAVRCKKEGNLKGATSFYDIQPENKRLALGY
FT                   SWYIPKVWGTTTNPESKLLMLYQAFDAWGINRVELGTDSRNIHSYRAIKKLGATEEGVL
FT                   RQHMILHNQVITDTIMFSILFSEWPAVKERLMQRLNYAAADKDHLAVSI"
FT   gene            354882..355409
FT                   /locus_tag="LPC_0331"
FT   CDS_pept        354882..355409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54326"
FT                   /protein_id="ABQ54326.1"
FT                   /translation="MYNKMFKPLDTDPILYFKMYSNYTEGRVDDCCAFILMPSGLQREW
FT                   VCLQSIQFAFNKRGDVLGINIIFSGNESNIHKKVRETMEGMLKLKLQYGRGEELFVFDE
FT                   EKKTFHMGIVPGKDTQAYLEGIIAFIKDSYRLQPDFAQDIKSQLLSKEYLAQEYSRLRW
FT                   KPPEKETVCVLM"
FT   gene            355564..356910
FT                   /locus_tag="LPC_0332"
FT   CDS_pept        355564..356910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0332"
FT                   /product="outer membrane channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54327"
FT                   /protein_id="ABQ54327.1"
FT                   /translation="MYRKRWLILLCALLNNGCLWLGSEYRKPHVNTPQKWPHKYSIQTE
FT                   QAAYLPDLHWWKQFNSKELNASIQKALQNNHQIHLAMANIESAQGQLRQVQLSWLPNLT
FT                   GLAGYTQFPVLGNPGTTAIAYPAYIINIFQQYKQQKSAQAMLEASIYAQYSARLVVIAQ
FT                   TAASFFTLVAQNEALHLYNKLLKDYRTYLKLTQSQYRSGLISLDNITQIKSHIQRIEAQ
FT                   IKVVQHNIVVTKNALHFLFNENPGDVETKTLFENIDSNQLVPGNLPASVLRVRPDIHEA
FT                   EALLKAAHADVGAIAANLLPGINLGAYLGEGSNVDGAIKLGQAYLNGPIIDLPLFAQVD
FT                   VSKARYKAIYIKYITTIRKALRDVANDLSAYSTSSQQLNNNLSALSDEKQQCHLAEVRY
FT                   RHGIDDYLNLIKCQILLDEFKLVINQNKLEKLLSIVALYQDLGGGYRGH"
FT   gene            356900..357937
FT                   /locus_tag="LPC_0333"
FT   CDS_pept        356900..357937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0333"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54328"
FT                   /protein_id="ABQ54328.1"
FT                   /translation="MGIDQQKTVRTLRLSLTCIFLFLITWYYQVPESAWTLVTIWFVMY
FT                   EYSTVGGVLTKSFLRFAGTALSAIYGMIVVYFCANNPLINIMALVPGLFLYAYFFMGGD
FT                   KTYIGTIGAVTLTIVLLNYNDIDTAVLRVFNVIIGVIGSMFMIRFFYPQYARDKVLEIQ
FT                   LNFITQLANLLESYLNPTQPLAAIQTKYLDYERKMLDGFTLYNRYIGEAKIEAKKAPFF
FT                   IPHSIAAMQHFRRLFRLFSVFVYYLSTEEIRSDPWVCDQLSKLLLNLQSLQRKLLKQDA
FT                   GPIGGDVVAAEPEEEIVIETPNIENKIATEAIVNNMQKEIALLDAEIKEIILIYDVYDI
FT                   RLNEM"
FT   gene            357994..358986
FT                   /locus_tag="LPC_0334"
FT   CDS_pept        357994..358986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0334"
FT                   /product="multidrug resistance secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54329"
FT                   /protein_id="ABQ54329.1"
FT                   /translation="MSDKPKAGFPVIILLCVFLFILIYHYSYLFPFTNNAFVVANVRPV
FT                   AANVKGYITNIYVKNEQEVKKGQPLFTVFKAPYELAYRKAVSDVQEAKAQLLLFNKQVE
FT                   KTKYLLQAQKELYEKFRFDYEHNHSALRDHAVSKLTVNTMLKEKNAALSKLKALEKELE
FT                   VNQQQVIVQKKKIDSLIAVMKNAKIDLDETTVYAKQNGAVQDMFVALGTPIKTRKPVFA
FT                   IADTDTLFIQANFNETDLRRVQPGDKVSIFPRMYFGSKIYHGVILSRNWAASRLETHRA
FT                   TQIQIVRNSESNWFLLPQRLPVQIQITDYDPVHYPLSIGASAYVYIHTH"
FT   gene            359162..361105
FT                   /locus_tag="LPC_0335"
FT   CDS_pept        359162..361105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54330"
FT                   /protein_id="ABQ54330.1"
FT                   /translation="MKIPFEGKWRATITKREAGFSQRVVVGGATSGNGSYNGVVGNSFV
FT                   FEDGWVELQWNNNAGSGWQESAVISSVGMTSPLVVVKFVSADDNFPNQRDGDYDDLQVR
FT                   FEHLDAPFEVTQRPYALDRGSLVMFPDGIFDASQGIQYMGVRIKNTWFFDWQGNFPATG
FT                   MKIGIAPVSRSALSAAGIVVIDSWTPQEQEGLGQIMDGGFVRVPDLKINEETTIYFKLD
FT                   VSNANPSKPEIGFVAQRDAYDPRYDEPTRIVDKKIFISRSSYNPATRELVTAIPEGTLY
FT                   LKLNKIAIDRKGATKAAQELKKCLKQHGGGIKGMSKWLHKLSRGFWQNSKDKERWCKEQ
FT                   GNDALRKLLKQLLAGKDIDICHLKAILDQCCERPGGDCECCPCGDGDGRPGGWDDGTGV
FT                   DGWCRVKPVFWLPLDFEYKVVPNPAYIGQFGPLAFEDPWWKVVLIILAIILAIASVIYD
FT                   YVYASEDDQYIIGQVVRNGDAPINLVDAAVSNLNGSRGVDLGQLDAQGNDINNGSPITA
FT                   LDSIIQLDRTAAGSYFGTLDAVLGNVVWKSGATSATTRGFISTLGTSVSIPYDEHDTLS
FT                   GTVTYTNEVVISELAAIPQTLSDPGDSGSVWVDLATARPVALNYGSPTDSSDNRAFANP
FT                   IRSVIDVLNLRF"
FT   gene            361124..362908
FT                   /locus_tag="LPC_0336"
FT   CDS_pept        361124..362908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54331"
FT                   /protein_id="ABQ54331.1"
FT                   /translation="MKREFFQKLDKILDIASEHKQMLLQYPDVVMVGVGPERRKGKITG
FT                   EPAIIVTVRKKRSSNELKKRGEKPLPQTIKGIPVDVIELGKAVEAPEIIAVQEKAKKTI
FT                   SKIRAKWLQTPNITAIGYGYKEKGGEIDFNTIAIQFFVKKKFPMVELQKQQITPIPEKI
FT                   NGVSTDVIQLSPIRPAAASGSRGDRHDPLKGGVAIGVGSKPFHYGTYGATVFDRTTGEQ
FT                   LFLSNQHVLDASPGTDTIQPSPVLLDDSVEVGFQLDVCLPIHFIRLDTPNTTVGTVLAG
FT                   AAVAAAVAAALSDEIDPTRRGQEATMPATGSKTLFETQKVKMDYPELPIPGTPFKVKTA
FT                   WDYERHTDAGIKTFSVSEEKKNPHVLRDKLLITDKKLYHPGDTIRIFGLILPEECAPAS
FT                   QSRNDRQPINPRELEDITHYPNVASSINLDLVASMDSDIASSPARRTNTRAAVINPKRC
FT                   RCDRYHPVAILTPTTEDRAFPVVLRESVFAQKNQIFQDLLTVVKQRDDEKLLERVFVLV
FT                   RYGCIYTGTLRVNNIPAGPWKHFFYVQTVNIATSDMKPLLAAQIIGGLPVSQNAKADLD
FT                   IACGPLTWEDGEFDIELI"
FT   gene            363157..363477
FT                   /locus_tag="LPC_0337"
FT   CDS_pept        363157..363477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54332"
FT                   /protein_id="ABQ54332.1"
FT                   /translation="MAVLYSLWSNPEADPSEYVIDISIHALTAITLMCKQAPESVKAVA
FT                   MALNTYRGFDALFKAITSLPSTIPGIANAVDVLNHRFNFKELEKLGNEETAETTSAVQH
FT                   TM"
FT   gene            complement(363563..364201)
FT                   /locus_tag="LPC_0338"
FT   CDS_pept        complement(363563..364201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0338"
FT                   /product="bacteriophage related DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54333"
FT                   /protein_id="ABQ54333.1"
FT                   /translation="MPDVLNNYYLQTMGIEVWVMRKSTPSCEKHLAALADEVASCVRCS
FT                   LHKTRTQTVFSRGNPKAKLMIIGEAPGFYEDQKGQPFVGKAGFLLNKMIRSIEMTENDV
FT                   YIANVLKCRPPNNRDPALEEISQCSSFLTRQIKLIKPHLILALGRFAGQFLLDKPLPLK
FT                   QLRNHIHYYDNTPFIVSYHPAYLLRNPSDKKKAYIDWLAVKNFLVDYGQ"
FT   gene            364458..365732
FT                   /locus_tag="LPC_0339"
FT   CDS_pept        364458..365732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0339"
FT                   /product="MFS transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54334"
FT                   /protein_id="ABQ54334.1"
FT                   /translation="MNSQKDLKQLDIKQVIAWAFYDFANSSYFVVIFTFVFATYFTSYI
FT                   APNTILGTELWGYTISVSALLIALVSPIVGAIADFSGHHKSWLFVFTYLGVISTGCLWF
FT                   AYPDSHSIPLVLTCILISNFALEVATVFYNSFLANLAPENYLGRISGWAWGCGYLGGLL
FT                   CLILSLFVFVKGELGGLWFGTENFANIRAVTVFVALWISVFSLPLFLVVQQKTGEHLTV
FT                   GTAIRKGLQELWLTIISLPKQRDLFLFLIARIFYIDGLNSILALGGIYVAGNFHLSVSD
FT                   IMVFGIILNITAGLGAGLFAWFDDWIGSKKTILIALACLTLTFCFLLTIHSNTLFWVFA
FT                   PVFGIFVGPVQAASRTFLARLAKPEEMTRMYGFYSFSGKATSFLGPFLVSTTTALADSQ
FT                   RLGMAVLIPFFIIGGGLLLLVHENE"
FT   gene            365811..366509
FT                   /locus_tag="LPC_0340"
FT   CDS_pept        365811..366509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0340"
FT                   /product="N-acetylmuramoyl-L-alanine amidase; amidase 2"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54335"
FT                   /protein_id="ABQ54335.1"
FT                   /translation="MFLQVISYDKLCSNMKIIISILFAFISASGHAFSCYDPQTIIQKP
FT                   IQFDKKRIALTREYQLTHYGIDSESIEIEPKMIVLHWTCIPSLDTTFRIFDPPALPTSS
FT                   PRRNELPGDLNVSSHFLVDRDGTIYQLMPETWMARHVIGLNHYAIGIENIGGVDSKDDL
FT                   TDEQVKANAFLVCYLKNKYPQIKYLIGHNEYLQYKGTALWLEKDPNYQTDKTDPGPTFV
FT                   KKVKQLVLAS"
FT   gene            complement(366564..368105)
FT                   /locus_tag="LPC_0341"
FT   CDS_pept        complement(366564..368105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54336"
FT                   /protein_id="ABQ54336.1"
FT                   /translation="MTNTTDFYSITPLDKARWQKILINKITVRTLGKIFVFIMAITIMI
FT                   TLFNFSYATDSKLKPTVITVSEEEFQVDGKGKKTKEFKLTFTHPDGTKDNKGYFANKGD
FT                   MFHVLVENKSASPITLHWHGLIVPSDQDGVPGVSQILIPPGQNKLFNYRLLQAGTYWMH
FT                   SHQKFQEQKQLSAPLIIYDTDDPHKNLQEVILFLEDFTYKDPQLIFDQLRTAKMDMKKM
FT                   DSGNDLNDVTYDAFLANKKTLAAPDVISVQPSKKVRLRIINASSSTNFKIDTGKLSATL
FT                   IAVDGENIEPIVDSSFPIGVGNRMDLLVEIPSAGGAFPVKAMAEGTNKQTGLVLTTDNT
FT                   PTPILSPNTTNKTGRVNYYELEKKLKGKNALTNKKINARLHYVLDGQMNGYIWTMNKQS
FT                   WPDVTPKVIHFGDRVEMIYENKSSMSHPMHFHGHVFQVTEIDGQPLDGAMRDTLLVQPH
FT                   STVKVQFDALNPGIWANHCHNLYHLNAGMFTTFEYQHYPKPDFYLKTIGQPKSNN"
FT   gene            368334..368768
FT                   /locus_tag="LPC_0342"
FT   CDS_pept        368334..368768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54337"
FT                   /protein_id="ABQ54337.1"
FT                   /translation="MKRIFLISIIGIVLNSAYAFEHLGECGAHTWHEVTSKSGSWKITL
FT                   KMISQNGQFVDPSCAEIIETGLAQNNPLSYGLKFSKDADFNLAYTLTAVSEEQGFQSKA
FT                   CVFVITANGPAQPDIQALSYHGAECTWRVIKGIGENFSVG"
FT   gene            complement(368783..369763)
FT                   /locus_tag="LPC_0343"
FT   CDS_pept        complement(368783..369763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54338"
FT                   /protein_id="ABQ54338.1"
FT                   /translation="MHSFDSIAVEFDLKNHSMQKIAIEDLNIDYQDKDKIYWIHSDLNQ
FT                   KNIFKKLREKLRLPEEVIQLCGEKDNRSTTIEIDEALTLQIQGLCSMKLNDNYDADFGN
FT                   LIIHLTPNYCFTASKTLSSVLFDLLKSCPKSLPYAKTSCFLLFLLLEGVINDYAKIHLA
FT                   YEELADQLDAQARTTNKNTYSQVLELKHGVMKIKRYTIAIREILMRLTSRNILVISEQC
FT                   RTSLYNLSNHCHLIVNEIDSLRDMLNGLLGQIDNQLMQNMNETMKVLTAFAAIFLPLSL
FT                   ITGIYGMNFYWMPELGWKYGYFWALGLIVLCALLLFLIFRKKKWF"
FT   gene            370042..370638
FT                   /locus_tag="LPC_0344"
FT   CDS_pept        370042..370638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54339"
FT                   /protein_id="ABQ54339.1"
FT                   /translation="MSQDIEKIEKMYQLIMEINKLKLVFRNTITNPQRNESTAEHSWSA
FT                   SMITLILMNELKSEFVNVDELKIIKLVLIHDVVEIYAGDVLAFDLKARKDKEKVELEAL
FT                   EKLSAVYPSFGIELDSLWHEFEERKSLEAKIAKAADAICPIFQRLQAKQSYIPFDISMA
FT                   QLEKTKYPYFQFSKTFSNLFEKLKADLLKEQLIFL"
FT   gene            370773..372272
FT                   /locus_tag="LPC_0345"
FT   CDS_pept        370773..372272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54340"
FT                   /protein_id="ABQ54340.1"
FT                   /translation="MYDDLWKPYASAELPSLKLGGIVLNGQLLSETPIHLVLKAFNRHG
FT                   LIAGATGTGKTKTMQVLAEQLSLNGVPSLVMDIKGDISGLAMPGETSTKLQDRGQQLHI
FT                   DFTPRGFPVELLTLTPQDPGVPLRARIDDFGPLLFSLMLDLNDTQAGVVTVLFEYAKAN
FT                   QLNLVNLDDFKSLLQFAQTDRGNQLIAAQYGGVASTSIGTIVRKIIELESQGGKQFFGE
FT                   PSFVIQDLLRTDANGYGVISILRLLNMQDKPKLFSSFMLKLLSDVYRQMPELGDPDKPR
FT                   LVLFIDEAHLIFNYSSKALLNLIETIVKLIRSKGIGLIFCTQTPNDIPEAVLSQLGLKI
FT                   QHSLRAFTAKDRKALKLVSQNFPVSSYYNTEQLLTTLSIGEALVSALDAKGQPTPLVHA
FT                   MIRAPESRMGPLSNEELKVLLDQSFLFGKYSQIIDTPSAKEKLAELISEQQVAKQQTSQ
FT                   KENNSSVLNSLSKNTLFRQVVRQVFRELTRAILSLFKSKRN"
FT   gene            372353..373756
FT                   /gene="pncB"
FT                   /locus_tag="LPC_0346"
FT   CDS_pept        372353..373756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="LPC_0346"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54341"
FT                   /protein_id="ABQ54341.1"
FT                   /translation="MINITGTYTDQYQLAMAQVYFLKGHHERIATFDYFFRALPFKGGY
FT                   AIFAGLEDLLDVLEQLRFEQQDIEFLQHQNMHPDFIDYLQQFKFTGAVYASREGDVVFP
FT                   TRPVVIIEANLIEAQIIETLLLNILNFQTLIATKARRIRQVAGERILIDFGLRRAQGAG
FT                   GYFASRAAIVGGFDSTSNVRAGRDYSIPVSGTMAHSFIQSYDSEIQAFSDYAEAWPENC
FT                   FLLVDTYNTLQSGVPNAIKIAKEMEKRGHRLKGIRLDSGDLAWLSKRARHMLDEAGLNY
FT                   VAITVSNQLDEYVIKNLLEQDAPIDAFGVGTNLAIGAPDAALDGVYKLAFINGQPSIKL
FT                   SDTPAKITIPYQKQVYRVFERDGTYRGADVVCLKTEKKIDMMHHPFEILKSLSIKHYKK
FT                   EALLHKVMENGKRLLPKKSLREIVRFSQQCFDRLPLEYKRFINPHIYKVGLSTELKMKR
FT                   DQLIAEHSR"
FT   gene            373761..374381
FT                   /gene="pncA"
FT                   /locus_tag="LPC_0347"
FT   CDS_pept        373761..374381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncA"
FT                   /locus_tag="LPC_0347"
FT                   /product="bifunctional pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54342"
FT                   /protein_id="ABQ54342.1"
FT                   /translation="MKTLIILDVQNDFMPGGSLGVPNGDAIVPVINSILHCFDLIVASQ
FT                   DWHPSNHISFASNHPGKKSFEKIKLGNLEQTLWPDHCVQGSIGAQFHAQLNTNPIEAIF
FT                   RKGTDPNIDSYSGFYDNLHKKTTGLAGYLREKGARELYFCGLCADICVYFTIKDALSQG
FT                   FDCYLIEDATQALVKDDFIKIKKELIKQGTNIINSSNLLNNLQ"
FT   gene            complement(374463..374846)
FT                   /locus_tag="LPC_0348"
FT   CDS_pept        complement(374463..374846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0348"
FT                   /product="cysteine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54343"
FT                   /protein_id="ABQ54343.1"
FT                   /translation="MSIQLNHTIVWVKDRDKSAHFLTEILGLPEAIPYGPFMVVEMSNH
FT                   VSLDFCKTDKEITPQHYAFLVTETEFDDIFKRICEFKMDYWADPGQTRLGQMNYNDGGR
FT                   GLYFNDPNGHLLEIITKPYGSGS"
FT   gene            complement(374846..376060)
FT                   /locus_tag="LPC_0349"
FT   CDS_pept        complement(374846..376060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0349"
FT                   /product="major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54344"
FT                   /protein_id="ABQ54344.1"
FT                   /translation="MYPKTKLSFMTLLLLISFASVNAVLFTPALPSITAFFRITEHAAQ
FT                   QTITSFLVGYALGQLVYGPTANRYGRKKTLYIGIGLQIISSLLCVLAGMISMYPLLVLG
FT                   RFLLALGSGVGLKMTFTLVNECYEPQLAAQKTSYLMLAFAIAPGLSVALGGILNSHYGW
FT                   ESCFYAGTVYGAILLAMVRQLPETQKSLQLEAFQMKHLLQGYVSQFKNKPLISGGALMG
FT                   GASCFVYIFAATAPFIAINLLGMSTTEYGAANILPSLGLTLGSIWSAQFAKKYSQRAGI
FT                   QLGILISGFAALAMMMAALTHHSALIKLFFPMIFIYLGLSFIFANASTFAMSHTSDKAH
FT                   GSAVMNFINMGLVTVVIWGLSLLPMSQYLLPAIYIILCILMMWLFFSFIKSNEIISSID
FT                   RNKES"
FT   gene            376178..377041
FT                   /locus_tag="LPC_0350"
FT   CDS_pept        376178..377041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0350"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54345"
FT                   /protein_id="ABQ54345.1"
FT                   /translation="MGKFDQITYFIAVVEEHGFAAAARKFGVSTAAVSRQIARLEAELK
FT                   AELLVRTTRKLSLTDIGARYYQQCKKTLLELNEAEIAIANSRNEAVGILNVTSSRYFAM
FT                   RFLLPYLPEFMELNPKLQIKIELAERFPDLAQENVDVLFGVSMEGPPELVRKRVSTTRY
FT                   VLCASPDYLAKNGIPKTPSELGKHRYITHSMRNPDNLVTFKDNEQIYVEPVLWLNDSRA
FT                   LCECALLGMGIIKLHEYIVAEALQDGRLIEVLPEFQESSLSVYLYYQASRYLQPKIRRF
FT                   IDFFTK"
FT   gene            377462..378172
FT                   /locus_tag="LPC_0351"
FT   CDS_pept        377462..378172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54346"
FT                   /protein_id="ABQ54346.1"
FT                   /translation="MHKKYNYYSLEKEKKTFWQHILDILKAPFRLPGWVVSFFLARNIT
FT                   HVALNPNNIPQQRLIHLTKTSNRPEDDIVVINFKKRPPHKWFNDTLIKIANTIAALPFV
FT                   TPRLRTRLHYDNENDINHVNKLLAEIDALVQGKSKQKYCKGRAFDWSKIHLKGLEFLDP
FT                   KMRGYVYEQLHEKYGYVSYTTKREPNIEFFTLKTPDGSELDSVQVTGEDEEKKPMRERK
FT                   FIITCIARDQNFIN"
FT   gene            378239..380812
FT                   /gene="sdbA"
FT                   /locus_tag="LPC_0352"
FT   CDS_pept        378239..380812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdbA"
FT                   /locus_tag="LPC_0352"
FT                   /product="SdbA protein, putative substrate of the Dot/Icm
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54347"
FT                   /protein_id="ABQ54347.1"
FT                   /translation="MDYSRGLVWTENNLVDDILAQVQRLISLGADPKNICLDGMCIGGA
FT                   VATIAAAKLHEKGMKVKLNNERSFTSLSSLVFGFIVPELQTANWWSPLTYGRFLLAGVV
FT                   YALLTPLIWLAGWPVDVTKAWNRIPAQDKMYSVVRDKDNGLYDGVIHDHFCSIASLVDS
FT                   QINSILYKLSTDQLLTEEEKQILCDDQLSHHFKPSQSVLKNPKYKGPHFISRQDLVAEL
FT                   GHREEYTNHDYFLDRLREKFQLDRTIRPVALAEDGEKDIDGIPPQLSNHKERPLIIASS
FT                   GGTGHISATHGIINDLQSKTDNVVITQHHAELYKNKPFSITSVLIRIGVWLTSLPVLED
FT                   ILKGVMRFIGYPVLPSSSIFWDQMSKIQQSETKKENGIETGRTRPYVDMLLDIYPEGYE
FT                   YTAFNNATHLTSSIEDIQTMISFKGHVEEDNRNIVYQNILQRLMHAAKQSTPYTRLIST
FT                   QALSLGAICDAVKYYNTVFLPVYNAERGTSYQPITIDQYMTDLPSLGCIHFMNNLEELT
FT                   SEQRQLMEIHAVNMSEPFKEAHFGKEQGFKAVHNIDPRNNPMIRNAFKDLSLTKYLDKT
FT                   QSFDLHFNVYKKEKQNALPVLNGKEKITIKPHAKIASIMIGSLAANASADYAQYLLNQG
FT                   YDHIFLFGGLNDSIAARIDQIINSYPDSRHDEIRKKIILLGNQSDVEMAPIMTRSNCVV
FT                   IRGGGLSVMEQMAMPIMDEKIVLLHHEDNEEGPLTSGLSWEDGNADKLIEYLSEKGAYA
FT                   KKTSPGLCSGHLNEAEKDFEKKYITQLKSKGTKEKVDLTIPQQKKPPLKKEWGRKTGYT
FT                   ELGHVLSHQHRFFETIPEVREPFCSKEDLHHHELSSQSLVSVTVG"
FT   gene            380892..382445
FT                   /locus_tag="LPC_0353"
FT   CDS_pept        380892..382445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54348"
FT                   /protein_id="ABQ54348.1"
FT                   /translation="MIGMRAEQCNLKSFFVHSLKNKSNLLPLIACFNNREINMPKILDS
FT                   NAYREMENELNNLFEQIYKHGKNDRTAITLQVQQFLDNLSESIRDHSRLLLTNIAREEL
FT                   IYFKEKKPGDSREKFQNIDKMSDYFNNLSALINFSVMQQEDPTLRVFYYDMYIQLMNFC
FT                   YLKGDLFGAGAIYTGLIANNLPNSIDRKQLSSESRLIFKDCEEKFKRLFNLSTTYNEHT
FT                   NLKRQFKTALIPALPSLLTVQIYTKDAYDNSVSDFERVQEKLRQLDIEHNRFLNQLQND
FT                   HSTWSKAYYDYMSNVYLPQSIFEYTTLLREYEELITTHGGPIAKQFHEDKNSEHLVSFV
FT                   ESTLLENQSDLKLSPFQNERIVEMLSEIDVVKSECSSPDVFDDISWKLREMNCTLVKAK
FT                   SIGDYTSKIFANLDTPYMEENTDEDPKPVLVEELQTDDVYQLHHSGMKLIRELEQAIED
FT                   HKPKVIYHCSGEANYGFFKEARRRGRHLSPEPMDIEVMDVDVMDYDENDLRNQTVMITV
FT                   "
FT   gene            complement(382511..384736)
FT                   /locus_tag="LPC_0354"
FT   CDS_pept        complement(382511..384736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0354"
FT                   /product="sensory box protein, GGDEF family protein, LssE"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54349"
FT                   /protein_id="ABQ54349.1"
FT                   /translation="MSTESFRILVIDDNPAIHQDFMKILNVSKNSALLNKFDAELFDDE
FT                   TEQLGISLPEFEIDVATQGIEGIEKVKRSLEEGRPYPLAFVDIRMPPGIDGVETIKRIW
FT                   AIDPQIQIVICSAYSDYSWESTVNTLGLSDNLLVLKKPFDVIAVRQLASALTQKWVLAR
FT                   ETQKHTEFLNQLVEERTESLQQSFSLLRATIESSSDGILVVDLQGKIVDYNSQFVKLWN
FT                   IPESIIKKETSEPQLIQYMSTQLLNSEQHAQHVKEFSIHIDDSSMQIYHFRNGKVVECC
FT                   SKPHRVGLQTVGRVWSFRDITEQTRLKEKLEYQATHDALTNLPNRLLLIDRIEHAISGY
FT                   ARHKMKFAILFFDLDRFKMINDSLSHEAGDQLLCAVAERLRSLVRKEDTLARLGGDEFV
FT                   MLFQSFNSEEQIAGVAQKILKSFQKPFHIAERDINIHVSIGISVYPTDGKTVNTLLSNA
FT                   DMAMYQAKFRGGNQFSFYTEKLNKKTNQQFQLELDLQKAIVHHEFFLLYQPQFTVNTHE
FT                   IRSMEALIRWNHPQKGIILPLDFIPTAESSGLIVPIGEWVLRETCKQIGAWRTMGLPEI
FT                   RVACNVASKQLRQRDFPAMVEDLLKEYSVEPHCLELEITENVIIDKEIQRTIKKLKSLG
FT                   VLIILDDFGTGNSSLNLLKQVAVDSLKIDQSFIQNISKSPGDEAIIDAIIAIAQSMNFN
FT                   IIAEGVETQNQLKFLKKRRCNDIQGFLMSKPIPPEEIEKLLQGNRTK"
FT   gene            complement(384739..386154)
FT                   /gene="fixL"
FT                   /locus_tag="LPC_0355"
FT   CDS_pept        complement(384739..386154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixL"
FT                   /locus_tag="LPC_0355"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54350"
FT                   /protein_id="ABQ54350.1"
FT                   /translation="MTEMHRLLQRQLKKFGFTADGLPQNLESWTQFIAHINKTYYENDQ
FT                   DRYLLERSIDISSKEMRDINSKLEYAQDIAQMGYWHYDADTDTATWSKGLFKILGLPPS
FT                   NVVLNLSSFLELVHPNDIAGLKKVVEKALKEKEDYDYELRVRNQDNDYKWFRTIARANP
FT                   HKNEISGVLMDISKRKIIEEQVLELNNKLVSTARLAGMSEVATSILHNVGNILNSVNVS
FT                   AIILKKNISKIHYKKLSAIKTMLDENINQLSEYLLNNPKGKLVLPYLDALSKTLHEEYE
FT                   ENMKEANSLETNINHIKEIIAMQQSLSGLSNLTEKISIHDVILNAVKSVILDKHQIDVR
FT                   IEIEPDINEFITDKSKLFQILTNLLANAKDSVLLHEANASRTIVISIGRTEKNHIMIKI
FT                   NDNGIGIQKDNLDRIFSFGFTTKKNGHGFGLHCSAIYARDLGGTLYAESNGNGEGAQFV
FT                   LDLPINPKTLSPR"
FT   gene            complement(386179..387345)
FT                   /locus_tag="LPC_0356"
FT   CDS_pept        complement(386179..387345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54351"
FT                   /protein_id="ABQ54351.1"
FT                   /translation="MMKIESFQYIQNQGWSIPTFPALDSENTLILVFASPIFRANSKPI
FT                   EELAQAYKKSKIIGCSTAGEIFGPNIFDNSISVAVVQFESTKLQLAKTEVKSTEESYEA
FT                   GIHLSKSLHQKQNPQSIFVLSDGLNVNGSELIKGLNQHAGKGVIITGGLAGDGADFKNT
FT                   WIIYDGKIVDHCIGAVGFYGNQIHVGHGSRGGWDIFGPERIITRSKANILYELDNQPAL
FT                   KLYKTYLGDRASELPAAGLLYPLAIRNPSAPDSQHIVRTILGVNEEEQSLIFAGDLPKG
FT                   YYAQLMRANFDRLIVSANEAGENANDRLFKNGSLNTQPVLAIDISCVGRRLVLGELTEE
FT                   ETETTLQSLPPKSIQIGFYSYGELSPLATGTCELHNQTMTITTLLESP"
FT   gene            complement(387515..388396)
FT                   /locus_tag="LPC_0357"
FT   CDS_pept        complement(387515..388396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0357"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54352"
FT                   /protein_id="ABQ54352.1"
FT                   /translation="MDIRDIKSFLAVVEYHSLTLAAKKLHVTQSAISKRIRKIEDELNI
FT                   RLIISEGSRLIFTEAAKQLIPYARQMLSAHQNMVHTLKNSQQFTQSIIIGASVYVSHYV
FT                   LPGFFKYLKETHPTIQAHLKTISEKEVEYILNHGTVDLVICPAREASEKLLSNSLLWEE
FT                   KLNLVVAINHELAHRTSALSLSELSEYPAILTEKGAALRDKLDTLFEKNQLILNLGFEM
FT                   STIDAIKSLVEYGLGWSYLPDSLLSEKLKILKIKDLELTIPFHAFYLKKRISDRLINDL
FT                   LCDFKKWQNRDN"
FT   gene            complement(388618..389802)
FT                   /locus_tag="LPC_0358"
FT   CDS_pept        complement(388618..389802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0358"
FT                   /product="amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54353"
FT                   /protein_id="ABQ54353.1"
FT                   /translation="MHLKRTLSLTLLAFYGLGTILGAGIYALVGEVAKEAAQFTPLSFL
FT                   IASIIALFTAISYAELSSRLPHSAGSALYVRRAFHQKWLSGLIGWIVVLTGIISAATLS
FT                   HGFVKYFQLFLPLPPSLIITILTVILAGVAIWGIRESATLILFMTLMEVGGLLMIIYYG
FT                   RYSLASIDIKSFSFPHSFDGVLIGAFIAFYAFIGFEDMVNTAEETINPEKTLPKAIFLA
FT                   LISATILYIAVAWVIVLTIPSNTLVKTDMPLIEIIKLQGQSPLLFSIIALISITNGILV
FT                   QIIMASRLIYGMANQQNAPQIFSSVYSKTQTPVYSTLLVFLMILLFAYALPITTLAKLT
FT                   SSIILCIFIIIHASLIKIKLTEKKPTNAISFPIVFPMISILLTLAFLIIQFFLK"
FT   gene            complement(389870..390646)
FT                   /locus_tag="LPC_0359"
FT   CDS_pept        complement(389870..390646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54354"
FT                   /protein_id="ABQ54354.1"
FT                   /translation="MSEREWPANDYAIGSYIQATVAEKYLAYLKVNPTDKILDIGCGNG
FT                   AFTKNILLQVPQGSVLGIDASENMLHLAQDMSKKFPNFSVQKADVLTMTFNSQFDYVVS
FT                   FWCLQWACANIQKAFFNIINALKTGGKFLTLFPAGDDPFIMSYYALRKSGQFASLHNFI
FT                   PPVDYSHLNNLEKKLESLTCRDLNVKLCRQSITLPSLDTFRKFVNGIAFYQGQLPNEEI
FT                   KQINEAMVRYYDSECQTKYHGEYQFNFTIYLVTGEK"
FT   gene            390854..392065
FT                   /locus_tag="LPC_0360"
FT   CDS_pept        390854..392065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0360"
FT                   /product="NAD dependent formate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54355"
FT                   /protein_id="ABQ54355.1"
FT                   /translation="MFSQSQQKIVCVLYDDPKGGFPPNYARESIPELKQYPDGQCLPTP
FT                   DSIDFIPGEMLGSVSGELGLRQFLESNGHQLVVTSDKDGSDSVFARELKDAAVVISQPF
FT                   WPAYLTRDRIESAPKLKLAITAGIGSDHVDLQAAMEHNITVCEVTYCNSISVAEHTVMM
FT                   ILALVRDFIPQYNTVIDGGWNIADCVSRSYDLEGMQVGCVAAGRIGLAVLRRLKPFAVK
FT                   LHYTDRHRLPLHMEQELNLTYHPSVESMVKVCDVVSIHCPLHPETEYLFDDRLIKQMKR
FT                   GSYLINTARGKICDQHAVADALESGHLAGYAGDVWFPQPPAKNHPWRSMPNHAMTPHTS
FT                   GTTLSAQARYAAGVREILECWLGNKPIREEYLIVSQGRLAGVGSHSYSAGNTTTGTEQA
FT                   VELV"
FT   gene            complement(392171..393295)
FT                   /locus_tag="LPC_0361"
FT   CDS_pept        complement(392171..393295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54356"
FT                   /protein_id="ABQ54356.1"
FT                   /translation="MFTKSCAKATDQNRQELLMDSLLGDFQKMKEKALNQQQEKRSKKR
FT                   EFNSLSSEKTKKPNQYAALTHSQVQEVKAKARTVNDKFHLNAEEKKLWELILLGNQLAQ
FT                   NISSCDLPTDNEDDASLVKLTQIFADETLERTDLTWLNKILKIALYSRGSGFGNCQEKA
FT                   FFAFALLLHQAQKPESLIHSLRLATFNNHFILIVNEQFLMDPWLNLAFPLSKGNQQLEI
FT                   GYVFEGFGRLVNYFSINQEGQCFTHAVREGDTTERDLSSEKDMANCIHSLLDHRDYFDL
FT                   SIVSEREIHTKTKRRKYETQEQEVPQPRQETSNQPKETVYTDSNHNTWDNEGAADDFLE
FT                   HFEQTHPVYNPGFFSFGQDDVGFKPDLPKNLFKF"
FT   gene            393552..394214
FT                   /locus_tag="LPC_0362"
FT   CDS_pept        393552..394214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54357"
FT                   /protein_id="ABQ54357.1"
FT                   /translation="MSKEQIKKTALEIVEYIHGNIKACNIPNQKRENKFFAPLVYLCQT
FT                   ECDKILSNTKISLLERLLKCAKIVDDLQSGNCMQQAFLAFQRLLTRLIEDKLSNFSTCI
FT                   PISIMTISKHAFLIIDNDIVCDPWLNFVGDLRDYRFAKMKRKEYFGIRSDWTCFTNTEV
FT                   YDEDSTEFTIQFVNALGVGISGFSEVKLANQLMQSSSMASDLGEDPVISIPKEFHQI"
FT   gene            394228..394341
FT                   /locus_tag="LPC_0363"
FT   CDS_pept        394228..394341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54358"
FT                   /protein_id="ABQ54358.1"
FT                   /translation="MIVMNSIAVVFVQVPVRFNGKYIVLDNDGGEDEFFKQ"
FT   gene            394322..395095
FT                   /locus_tag="LPC_0364"
FT   CDS_pept        394322..395095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0364"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54359"
FT                   /protein_id="ABQ54359.1"
FT                   /translation="MNFLNNKIVMITGASSGIGQACARLFAAQGARLILAARRVERLHE
FT                   LSSELKHHNNQEHYILPLDVCKKDLVRQQIESLPGQWNSIDVLINNAGLALDTLPLHQG
FT                   ILEHWDTMIDTNIKGLLYISRLILPGMLERNSGHVINIGSIAGHECYPNGNVYSATKHA
FT                   VHAISKSMRLDMLGSAVRVTEIAPGAVETEFSEVRWKDKQRAIDFYKDFQPLMAEDVAD
FT                   AALYCATRPLHVDIEQMIIMPTVQASANHLSRKGR"
FT   gene            395614..395844
FT                   /locus_tag="LPC_0365"
FT   CDS_pept        395614..395844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54360"
FT                   /protein_id="ABQ54360.1"
FT                   /translation="MNKLIVAVTAGASLLLLTGCAVDGVAVDDVSYDSGYSNDYVYSVG
FT                   YYSNRPYWGNNYYSSPSFVGPYGYWGGDYDF"
FT   gene            complement(395898..396467)
FT                   /locus_tag="LPC_0366"
FT   CDS_pept        complement(395898..396467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54361"
FT                   /db_xref="GOA:A5IAG1"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IAG1"
FT                   /protein_id="ABQ54361.1"
FT                   /translation="MAVYSTNEFKNGLKVMVDDAPCSILDCEFVKPGKGQAFTRIKIRN
FT                   LKTGRVVERTFKSGDTLPSADVADVEMQYLYNDGEYWHFMVPDTFEQYAVTENVLADAA
FT                   QWLKEQDVCVLTLWNNEPIQVTPPNFVILAITETDPGLKGDTSGGGGKPATLETGAVVR
FT                   VPLFVQTGELIKVDTRKGEYVSRAKE"
FT   gene            396539..397519
FT                   /locus_tag="LPC_0367"
FT   CDS_pept        396539..397519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54362"
FT                   /protein_id="ABQ54362.1"
FT                   /translation="MRDTSLSWQKILAQGFTSTADLLDFLELPRSEGNLFAEKQFPSRI
FT                   PLGFAERMQKGNPKDPLLLQVLAKEDELTVADDYVIDPLSESNTLIKGLLHKYHGRVLL
FT                   TLTGVCAVNCRYCFRRHFPYQANNPGRRGWKEVCAYIANDPSITEVILSGGDPLLAANL
FT                   VLEELLQSLEEISHVHTLRIHTRIPIVLPERIDKGLLDLLTNTRFKKVIVVHCNHPQEL
FT                   DESVLRACSDLKKATCYLLNQSVLLAGVNDDAVILSKLSHALFDYGIMPYYLHLLDKVK
FT                   GSAHFDMPLPRAQSIYHQLQSLVPGYLLPRLAREEPGRSSKTLLI"
FT   gene            complement(397588..399660)
FT                   /gene="ppk"
FT                   /locus_tag="LPC_0368"
FT   CDS_pept        complement(397588..399660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="LPC_0368"
FT                   /product="polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54363"
FT                   /protein_id="ABQ54363.1"
FT                   /translation="MDTTLDNPDYYINREFSAVAFNQRVLMLANDERVPLLERMRFLSI
FT                   CSSNLDEFFEIRVAGLKEKIAMSSGKLTIDGLRADEAFSQISHKAHALIDQLYNIFNKQ
FT                   LLPALRKENIHFLETDQWTDDIHLWAKHYFKHEILPVISPIALDLAHPLPRLINKSLNF
FT                   IISLSGKDAFDRNINYAVVHAPRSIPRMIHLPSELCGDAHYFVYLSSIIKTHINSLFPG
FT                   MEISGCYSFRLTRNSDLFLREEEIDDLAKAVQREIFSRHYGHVVRLEIENKCPEKIVDF
FT                   LLQKYHLRHEDTYYCDGPVNLQRYMSAINSIDRPDLNYPAFTPQYPKFSKSQRNLFNIL
FT                   DEQDILLHHPYQAFDLVIDFVRQAASDPNVLAINQTLYRTHSESVMVDALVNAAHSGKE
FT                   VTAVIELRARFDEESNLKLANKLHAAGILVLYGVVGYKTHAKMTLVVRRTHGKLKRYVH
FT                   LSTGNYHEQTAKRYTDLGLLTSEPTITSDAQLIFQQLTGLGKVVKLKALSHSPFTLQKT
FT                   LLQFIEQCSTAATGGIDTEIILKVNGLTDKVMIQALYKASQAGVKINLLVRGVCCLKPG
FT                   LPGVSENIRVLSFIGRFLEHHRVFYFRINEEEHYFCSSADLMERNLYNRIEIMFPIYDE
FT                   GCKKRIKNEIIKNYLKDNNNVWEMQSDGTYKHLMQNGGCAQEKLIALYEEEDKSI"
FT   gene            complement(399701..400906)
FT                   /locus_tag="LPC_0369"
FT   CDS_pept        complement(399701..400906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0369"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54364"
FT                   /protein_id="ABQ54364.1"
FT                   /translation="MKRIFFVVFLLCLETACNTAKNNPLPAQLSDKALVPGFKEVRTEF
FT                   TRSDDPIIKKQSLERVKQLAKAYPDTMFHQKGSFSLLIISGGGDYGAFGAGLLNGWTKS
FT                   GSRPTFTTVTGISTGALIAPLAFAGPKYDATLKKVYTTITTKDVLSNKPVLWTLLTGGS
FT                   ALKGTKPLQDLIARHVDEKLLDDIAKGYYQGRRLYVGTSNLYSRKLVVWDMTRIAASKN
FT                   PERVQLFRKILLASASIPVVMPPVYFDVMANGKPYTEMHVDGSTTFAVFLSRLGSDIKT
FT                   AKKHFKLKQKPNVKIYVIRNNQNQFHYKVIKPKLLVIGKRAIESVTASQGAADVIFIYL
FT                   CALIEGVDFNLANVPNEFDSNSEELFDTQRMNQLYQIGYSKAVKGYPWQKIPPDVRALH
FT                   GD"
FT   gene            complement(400982..401515)
FT                   /locus_tag="LPC_0370"
FT   CDS_pept        complement(400982..401515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0370"
FT                   /product="chromate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54365"
FT                   /protein_id="ABQ54365.1"
FT                   /translation="MIKTFIEIIYSFGKIGLISLGGGNSMLKLLEYEAVTYRHWIGKEE
FT                   FVGMLGSSFLFPGLTGIKLAALIGYKAAGITGLILAIICLNLPGLIMALVGYQWLNSHN
FT                   GPITRKIMISVQYGALALLAAATFSVVQGVIDVYYSIPMAICCILFFLALAFWNLSPFY
FT                   GFLAFIAVCFFVVR"
FT   gene            complement(401512..402132)
FT                   /locus_tag="LPC_0371"
FT   CDS_pept        complement(401512..402132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0371"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54366"
FT                   /protein_id="ABQ54366.1"
FT                   /translation="MQRLVWNFEFSSEQTTPLTTLDHDAQDNLKWEKRYFWPADQIIRL
FT                   NTIDSSLLDLANYQKKHKEDYYYLLPDSDHNIKQRRNELLYKPVIKQSGSALGFGPKVH
FT                   LENPQTLSCHGDAGQLNRQELLKKIKEKGIVVFVKKEAFVFKFPTTPTVKLELARLEVK
FT                   DKVYFSACIEGRSLKLVETISVLLFGTQPSFEYVTFLKKTLKI"
FT   gene            402308..404746
FT                   /locus_tag="LPC_0372"
FT   CDS_pept        402308..404746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0372"
FT                   /product="long chain acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54367"
FT                   /protein_id="ABQ54367.1"
FT                   /translation="MAIVFFLIYLAFTLVVLSRRINPLIWEIGSIIYLIPATFYFGFPW
FT                   IIGLFIWFFIIAAVLVVRVEPLRFFIGDYLYKTAGKSVPKLSKTEEEALNAGDTWLEQD
FT                   IFTGKPDWQRLSAVSTELTAEEQAFLDNETHTLCSMLDEWEISQEYDLSPKVWNYIKEK
FT                   GFLGLVIPKEFGGKGFSARAHSDIVMKIATRSRVAAVTVMVPNSLGPGELINYYGTDEQ
FT                   KAYYLPRLAKGVEIPCFALTEPGAGSDATSIQSEAIVVKKKIDGKSVLGLNITLDKRWI
FT                   TLAPVATLIGLAVNLKDPDGLLKGEGEEGITCLLIPRDTENLEIGNRHLPADQPFMNGT
FT                   LRGKDIFVPIDTIIGGQKKAGSGWQMLVECLSIGRSISLPALGAGSSSISYLTTGAFAR
FT                   IRRQFNVEIAQFEGVEEKLAEIAGLNYLINSTRLLTVAAVNEHKKPSVASAITKYFNTE
FT                   LARITVNASMDVHAGRAIVVGPRNYLNSLYQSVPISITVEGANIMSRNLLIFGQGSMAC
FT                   HPFIRDEFYAISSENKEAFREIIWKHIHYFMQNFAKTVCSAWTSGLFIAVPENSMKREY
FT                   KKLARLSYAYSWLADLSLIYLGGDLKRKERLSARLADGMSYLYMAMAALRNVQLNQDHP
FT                   DEQLHARWAVSYCFYHAQKSMIALCHNFPSKFLGFIARVVAFPFGQTMRYPSDKLDHQL
FT                   ARLMTGNNHYRDRLKKSVFLSGDSKQPVDRMEHALQLIIEADGLSKKVSDLKRYKWSKL
FT                   KGKLKEKVESGQLSQQEMEELLAVEDARWDAILVDEFTFDSMKKKTLHSVIEKMKSPLA
FT                   "
FT   gene            404860..405552
FT                   /locus_tag="LPC_0373"
FT   CDS_pept        404860..405552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54368"
FT                   /protein_id="ABQ54368.1"
FT                   /translation="MPKYTLPTRDALLKAMQVGETSIEAAEYMATRFEQILTQAKLLPE
FT                   CNDMLEKIQEYAQFVKFKLLSSAQVWSGQERPISDYQNMQENKAEFLASHLKELPSGLK
FT                   LEIAIGDDAKILRGFSSNGKMVEGEQLKTMDGLLEGWLAKNNLAISGGAVVQRNSTGNQ
FT                   TSVDPEEIRKLINDSEKGVAKYFADKGVSMEVVQRTYQEPKALETKREEIRQEIESGAE
FT                   APTTQSIR"
FT   gene            complement(405589..406251)
FT                   /locus_tag="LPC_0374"
FT   CDS_pept        complement(405589..406251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0374"
FT                   /product="mannose-1-phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54369"
FT                   /protein_id="ABQ54369.1"
FT                   /translation="MKTAMILAAGRGERLRPLTDKIPKALCTVRNKPLIEHHIINLANA
FT                   GFDRLIINHAYLGGQIRQYIGNGKQWGLNVIYSPEPPGGLETGGGIVNALPLLGEGPFL
FT                   TVNADIYTDFDFTKLQLKNIDTFHLILIPKNPSLLHHGDFGLINGSHLTNTNQAYTFSG
FT                   IACYNPKVFANCRQGRYSVTPLLRKYVEQNSATGSVHSGIWYDIGSFDRLHAANQFP"
FT   gene            complement(406248..407225)
FT                   /locus_tag="LPC_0375"
FT   CDS_pept        complement(406248..407225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0375"
FT                   /product="hypothetical phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54370"
FT                   /protein_id="ABQ54370.1"
FT                   /translation="MHERENALKEWLAQTIQQKDFVLLPLAGDASFRRYFRIQYNGLTQ
FT                   VVMDAPPEKENIESFLHIANVLDKIKIPVPDILAINKREGFLLLSDLGDQLLLNKLNHE
FT                   TVDNYYNQAMNLLLQIQKCPTDDPELPLFDKSFMLKEMNLCLEWFLKAYLSLDLKQDEL
FT                   QLFQHTIEWIASEVATQPRVFIHRDYHSRNLMLVKNKDSCLATIDFQDAMLGPVTYDLV
FT                   SLLKDCYISWPREKVLEWITYFHEKSPHTNIYSLTDFIRAFDLCGLQRHLKVLGVFCRL
FT                   YLRDNKAGYLGDLPLTLKYALECAETYEELHPFFNFLQKRVYLP"
FT   gene            407333..409987
FT                   /gene="ostA"
FT                   /locus_tag="LPC_0376"
FT   CDS_pept        407333..409987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ostA"
FT                   /locus_tag="LPC_0376"
FT                   /product="organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54371"
FT                   /protein_id="ABQ54371.1"
FT                   /translation="MRFYKKLIISGFISFIALLRGLLYCHLKRLFKKWPGSLFSVKWVL
FT                   MAIGITACVLSLINYQGLAYSAALINEPIQACVIAREVDLTDDIRTKFAQCLGWQADQS
FT                   SPVCLGFYKPITVTPLASPDEVRILADTASFYRTQRSTLSGHVEMQQGQRVVNAQTAYV
FT                   YRDPKTNEVTKIEFLNHVRYLEPDRMMIARKAVVYPQDKSGEVEDVLYRFNTNRSNALL
FT                   PAWGRASLIKRFANQDYFLKEATYTTCAPQDKAWAIEAESISIDNEKGKGIARNAKLRI
FT                   HEWPVLYTPYLSFPTNRDRKSGFLMPIVGYSNVGGADLGIPYYWNMAPNYDMTLVPHLY
FT                   TKRGLMLGGQFRYLTSKSTGTFNGNFLPKDKAFGRFLQDNEVEFPQIRGLSTNRWEVNF
FT                   VDSTQFLSDLQLNVNFQQVSDDYYLQDFSTNLASVTQRQLLRQADLTYTTENWTFRGMG
FT                   QSYQTLHPINEIPVSPVYERLPQLMARGYYDDLPFNAQFNILGQYDQFHWPNDSWNIAL
FT                   NNMPQGPRFHLNPILSVPMMKPWGYVTPSVQFVENYYDISRNYTWGTSRANYNLTIPRY
FT                   SLDGGLYFERDLHLKGTYYIQTLEPRLFYLRVPYYNQTLIPVYDSGFMIFNVDQLFRTN
FT                   RFSGFDRIGDANQLSYALTTRWLEDESGAEKANFSIGQIKYFSERRVQLCQSPTGFCTD
FT                   NPDTFGNLSSTFGTSPVASRAVYKFNPAWGITGDYIWDPATRATNNADLNLHYQPARNA
FT                   IINGGYSYLVNGDVTQVRNNDTENNALHQAILSAAWPLSEKWSGIGAYSYNISKNYSMM
FT                   SFLGVQYDSCCWAMRILGGRTFRSLNEEFEPQYNNNIYLQILLKGLGSVANSDPSGILN
FT                   TYIPGYYDPFRRR"
FT   gene            410163..411452
FT                   /gene="surA"
FT                   /locus_tag="LPC_0377"
FT   CDS_pept        410163..411452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surA"
FT                   /locus_tag="LPC_0377"
FT                   /product="peptidyl-prolyl cis-trans isomerase D (SurA)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54372"
FT                   /protein_id="ABQ54372.1"
FT                   /translation="MFKRIALVCALFSGICFAEGKQLLDKVVAIVNDNVITSSELNAQV
FT                   ELSKKQIIAQNMQMPDESVLRKQVLQHLIDVDLEMQMAKQNGITIENAEIDEAIEKIAA
FT                   SNHLNLSQMRDEITKQGISWQEYRQNIRKEMLISRVQQKAVGKDIIVTNEQVEQYLKTA
FT                   GRIENSNLTYHLKNIVIPLSEEPTTKQLQRAKIEAENLLNKIKKGEDFSRLAIEESSGE
FT                   FALEGGDLGERHLAELPEVFAKEVVHMKVGQVAGPIRAGNGFHLIKLVAVGGENQRHVI
FT                   TQTHVRHILLKPDASMVPSEAIKQVNNIYRQIQSGKDFALMAKQYSLDAASAVKGGDLG
FT                   WVNPGELVPEFEKTMNSLPLHKVSKPVKTQYGWHLIEVIARRQKDDSEAFKKQQVRQFL
FT                   QQRKFVEAVQNWQQHLRSQAYINIVDKDLA"
FT   gene            411449..412423
FT                   /gene="pdxA"
FT                   /locus_tag="LPC_0378"
FT   CDS_pept        411449..412423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="LPC_0378"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase
FT                   PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54373"
FT                   /protein_id="ABQ54373.1"
FT                   /translation="MNPLLISSGEPAGIGPDLCLALAETDLPVVILGDLSLLEARASEL
FT                   NLSIKFLEYGPHQSFEKKAGYLTVWPVPCAAPVISGELNPQNAAYVMELLTLGASLCSK
FT                   GEFSALVTAPVHKANINAAGITFTGHTEFFADFFEVETVVMMLACSQMKVALVTTHLPL
FT                   RMVPDAINSLLIIKVIQQLHHSLKHDFGIQSPRINVAGLNPHAGESGYLGREEIEIITP
FT                   ALNTLKNQGIDVLGPLPADTMFITNNINHCDAYVAMYHDQGLPVLKYAGFNEAVNITLG
FT                   LPIIRTSVDHGTALELAGKNKANPGSMLAAVKMAKDMALTRIK"
FT   gene            412425..412916
FT                   /gene="folA"
FT                   /locus_tag="LPC_0379"
FT   CDS_pept        412425..412916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folA"
FT                   /locus_tag="LPC_0379"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54374"
FT                   /protein_id="ABQ54374.1"
FT                   /translation="MSVISLIAAIDETGGLGINNQLLCYLPADLQHFKSITMGKPIIMG
FT                   RKTYESIGKPLPGRLNIVISQSIQSIPGVVVVDSLGQAIKETTGASEVMIIGGAKIYSQ
FT                   AISMANRLYITRIHHQFTADVFFPKINELVWSCRSKEYRQHDDKNQYDMTFCIYERISI
FT                   "
FT   gene            complement(412923..413468)
FT                   /locus_tag="LPC_0380"
FT   CDS_pept        complement(412923..413468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ54375"
FT                   /protein_id="ABQ54375.1"
FT                   /translation="MSKLVYLLLMIFFLNPAWANTHYHQHPVSPLANALRTGTDTNGNA
FT                   LYLCKAKLFNSIQPGKTWAGYGRCNVPYGGKEYVLSQFTIPNQNEFGRYSWEPNVEHAL
FT                   LMGKDTNGNPLFVCQSNFNGSIQPGKTWPGYSHCNISYGGREIITDNYRILSRPTEIIV
FT                   RTQPPVHRHPSQNRHYHY"
FT   gene            413757..415231
FT                   /locus_tag="LPC_0381"
FT   rRNA            413757..415231
FT                   /locus_tag="LPC_0381"
FT                   /product="16S ribosomal RNA"
FT   gene            415373..415449
FT                   /locus_tag="LPC_0382"
FT   tRNA            415373..415449
FT                   /locus_tag="LPC_0382"
FT                   /product="tRNA-Ile"
FT   gene            415629..418530
FT                   /locus_tag="LPC_0383"
FT   rRNA            415629..418530
FT                   /locus_tag="LPC_0383"
FT                   /product="23S ribosomal RNA"
FT   gene            418632..418748
FT                   /locus_tag="LPC_3033"
FT   rRNA            418632..418748
FT                   /locus_tag="LPC_3033"
FT                   /product="5S ribosomal RNA"
FT   gene            418854..418929
FT                   /locus_tag="LPC_3032"
FT   tRNA            418854..418929
FT                   /locus_tag="LPC_3032"
FT                   /product="tRNA-Thr"
FT   gene            419002..419086
FT                   /locus_tag="LPC_3031"
FT   tRNA            419002..419086
FT                   /locus_tag="LPC_3031"
FT                   /product="tRNA-Tyr"
FT   gene            419107..419180
FT                   /locus_tag="LPC_3030"
FT   tRNA            419107..419180
FT                   /locus_tag="LPC_3030"
FT                   /product="tRNA-Gly"
FT   gene            419233..419308
FT                   /locus_tag="LPC_3029"
FT   tRNA            419233..419308
FT                   /locus_tag="LPC_3029"
FT                   /product="tRNA-Thr"
FT   gene            419343..420533
FT                   /gene="tuf2"
FT                   /locus_tag="LPC_3028"
FT   CDS_pept        419343..420533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf2"
FT                   /locus_tag="LPC_3028"
FT                   /product="translation elongation factor Tu (EF-Tu);
FT                   tRNA-Ala"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56927"
FT                   /db_xref="GOA:A5IHR6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR6"
FT                   /protein_id="ABQ56927.1"
FT                   /translation="MAKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTIMAKKYGGTAK
FT                   AYDQIDAAPEERERGITISTAHVEYESASRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDDPELLELVEMEVRDLLSSYDF
FT                   PGDDIPIVVGSALKALEGEDSDIGVKAIEKLVETMDSYIPEPVRNIDKPFLLPIEDVFS
FT                   ISGRGTVVTGRVESGIVKVGEEVEIVGIRDTQKTTCTGVEMFRKLLDEGRAGDNVGVLL
FT                   RGTKRDEVERGQVLAKPGTIKPHTKFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGTCDLPSGVEMVMPGDNVQLVVSLHAPIAMDEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            420595..420670
FT                   /locus_tag="LPC_3027"
FT   tRNA            420595..420670
FT                   /locus_tag="LPC_3027"
FT                   /product="tRNA-Trp"
FT   gene            421058..421606
FT                   /gene="nusG"
FT                   /locus_tag="LPC_3026"
FT   CDS_pept        421058..421606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="LPC_3026"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56926"
FT                   /protein_id="ABQ56926.1"
FT                   /translation="MVEENKAKQWYVVHAYSGYENFVMREITSRAKHHNLEDKIGEVVV
FT                   PSEEVVEMRSGQKRKSTRKFFPGYVLVHMVMDDQTWHMVRGIPRVLGFIGGTSQTPTPI
FT                   SDKEAQAIMQRVEDGVTKPRPKILFEPGEVIRVKEGPFVDFNGVVEEVNYEKNRLRVAV
FT                   LIFGRSTPVELEFSQVEKT"
FT   gene            421716..422150
FT                   /locus_tag="LPC_3025"
FT   CDS_pept        421716..422150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56925"
FT                   /db_xref="GOA:A5IHS5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS5"
FT                   /protein_id="ABQ56925.1"
FT                   /translation="MAKKVEAYIKLQIPAGKANPSPPVGPALGQRGVNIMEFCKAFNAA
FT                   TQQMEQGLPIPVVITVYSDRSFTFITKTPPASVLLKKAAGIQSGSGTPNTKKVAKLNVS
FT                   QLEEIAKVKKPDLTAADLAAAVRSIAGTARSMGIEVEGLE"
FT   gene            422160..422855
FT                   /locus_tag="LPC_3024"
FT   CDS_pept        422160..422855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56924"
FT                   /db_xref="GOA:A5IHS4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS4"
FT                   /protein_id="ABQ56924.1"
FT                   /translation="MSKLTKKQKKIAEVIKPNQLYTVADAVAILKQFASKKFRESLDIS
FT                   INLGVDPRKSDQVVRSSTNLPKGTGKTVRVAVFAQGDNAAKATAAGADIVGFEDLADKI
FT                   KAGEMNFDVVIATPDAMRIVGQLGQILGPRGLMPNPKVGTVTTNVEAAVNDAKSGQVRY
FT                   RTDKNGIIHCTVGKADFAPEDVLENVVALINDLKKAKPASSKGQYLKKISLSTTMGPGL
FT                   PIDISSIPV"
FT   gene            423028..423561
FT                   /locus_tag="LPC_3023"
FT   CDS_pept        423028..423561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56923"
FT                   /db_xref="GOA:A5IHS3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS3"
FT                   /protein_id="ABQ56923.1"
FT                   /translation="MTLNLAAKKAVVEEVTAVASKAISAVVADYRGLTVNQMTQLRSEA
FT                   RKSGVYLRVVRNTLTRRALKNTEFECLNDLLVGPVFIALSLEAPSDAARLLKDYAKTFE
FT                   KLEIRALSVGGKVYNANQIDAVASLPTRDEAISKLMYVMKAPIEKFVRTLAEPHAKLAR
FT                   TLAAVKDKKAGNPA"
FT   gene            423592..423972
FT                   /gene="rplL"
FT                   /locus_tag="LPC_3022"
FT   CDS_pept        423592..423972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="LPC_3022"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56922"
FT                   /db_xref="GOA:A5IHS2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS2"
FT                   /protein_id="ABQ56922.1"
FT                   /translation="MAVSKNEILETISNMTVMEVVELIEAMEEKFNVSAAAAAVAVAAP
FT                   AAGAGAAAAEEQTEFTVVMTSFGSNKVNVIKAIRGITGLGLKEAKDLVEGAPSTVKEGV
FT                   SKDEAASIKKELEEAGATVEVK"
FT   gene            424064..428170
FT                   /gene="rpoB"
FT                   /locus_tag="LPC_3021"
FT   CDS_pept        424064..428170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="LPC_3021"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56921"
FT                   /db_xref="GOA:A5IHS1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS1"
FT                   /protein_id="ABQ56921.1"
FT                   /translation="MAVAEAKPQYSHAEKKRFRKSFGKQTDIMPIPNLLEIQLKSYRDF
FT                   LQTDTKLSEQLNTGLHAAFSSVFPIESFSGNARLEYVGYKLGEPAFDVRECKLRGLTYS
FT                   APLRVKIRLVVLDKDASDDPKPIKDIREQDVFMGEIPLMTDVGTFVVNGTERVVVSQLH
FT                   RSPGVIFEHDKGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVYVRIDRRRKLPVTIL
FT                   LRALGYEAEDILSEFFETTRCHLKNGEYHIDLIPQRLRGEIASFDIHVPETGELIVEQG
FT                   RRITARHIKQMEKSQMQDLVVPRDYLIGKTLAKNIIDTSTGEFLAQANDEITEELLDAM
FT                   ANHGILQIDMIYTNDLDHGSYISDTLKIDPTGSQLEALVEIYRMMRPGEPPTKEAAEAL
FT                   FKNLFFVEERYDLSAVGRMKFNRRVGIKSDEGPGTLTKEDILSVIKTLIDIRNGIGMVD
FT                   DIDHLGNRRVRSVGEMTENQFRVGLVRVERAVKERLSLVESENLMPQDLINAKPVSAAI
FT                   KEFFGSSQLSQFMDQVNPLSGVTHKRRVSALGPGGLTRERAGFEVRDVHTTHYGRVCPI
FT                   ETPEGPNIGLINSLSVYARTNEYGFIETPCRKVVNGRVTDEVEYLSAIEEVDQYIAQSN
FT                   VELDAQGNILADLVPCRHQNEFSLTTPDKINYMDVSPKQIVSVAASLIPFLEHDDANRA
FT                   LMGSNMQRQAVPTLRSEKPLVGTGMERIVASDSGVSVVAKRGGVIDLVDASRIVVRVND
FT                   DETTAGETGVDIYNLTKYFRSNQDTCINQRPIVSTGDRIQRGDVLADGPCTDMGELALG
FT                   QNLLVAFMPWNGYNFEDSILISERIVHDDRFTTIHIEELTCIARDTKLGTEEITADIPN
FT                   VGESALSNLDESGVVYIGAEVKAGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKD
FT                   SSLRVPSGMNGTVIDVQVFTRDGLEKDARAKSIEEEHLARVRKDLIDERRIREEDIYHR
FT                   VSHLLLDKVATGGPGSLKPGSKITQDYLDKVEREKWFDIRIEDDAVSQQLEQLSKQLEL
FT                   LTKEMEKRFNDSRKKIIQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISIV
FT                   VPVEDMPHMEDGTAVDIVLNPLGVPSRMNIGQVLETHLGLAAKGLGRKIAQMLDERQTP
FT                   EAIKAYLEKIYNHDGVQRVNLKCLNDDELMTLADNLRAGVPMATPVFDGATEQEIKSML
FT                   QLADLPADGKTVLIDGRTGNKFDNPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVGGRTKIYKNIVDGDHRMDP
FT                   GMPESFNVLLKEIRALGIDIELEHD"
FT   gene            428241..432464
FT                   /locus_tag="LPC_3020"
FT   CDS_pept        428241..432464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56920"
FT                   /db_xref="GOA:A5IHS0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHS0"
FT                   /protein_id="ABQ56920.1"
FT                   /translation="MKKAPVMSDLLGILKQQGQSEEFDAIKIALASPELIRSWSYGEVK
FT                   KPETINYRTFKPERDGLFCAKTFGPVKDYECLCGKYKRLKHRGVICEKCGVELALAKVR
FT                   RERMGHIELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFEAFVVVDPGMTELERG
FT                   QLLNDEAYLDAMEQYGDEFDARMGAEAIRDLLRQIDLEDEIRNLREELPTTNSETKIKK
FT                   ITKRLKLLEAFYESGNKPEWMIMDVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINR
FT                   NNRLKRLLDLNAPDIIVRNEKRMLQESVDALLDNGRRGRAITGTNKRPLKSLADMIKGK
FT                   QGRFRQNLLGKRVDYSGRSVIVVGPTLKLHQCGLPKKMALELFKPFIFSKLEFRGLATT
FT                   IKAAKKMVEREESVVWDILDDVIREHPILLNRAPTLHRLGIQAFEPVLIEGKAIQLHPL
FT                   VCTAYNADFDGDQMAVHVPLTLEAQLEARSLMMSTNNILSPASGEPIIVPSQDVVLGLY
FT                   YLTREKVNALGEGKIYSSAQEAQNFYEAGHLDIHAKIKIRMPKEDGETGYHLVETTVGR
FT                   AILAEILPKGMPFDYINRTMTKKVISKVIDSCYRKFGLKETVIFADQLMYTGFKYATRS
FT                   GASIGIEDMEIPDDKASIIEHADNEVREIESQFRSGLVTNGERYNKVIDIWSRTNELVA
FT                   KSMMSKIATEEVTDAKGNKVRQESFNPIFMMADSGARGSAAQIRQLAGMRGLMAAPDGS
FT                   IIETPITANFREGLNVFQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDVVITED
FT                   DCGTDTGILMQPLIEGGDIVEPLHERVLGRVVASDVYIPTQTEPVVKAGTLLDEEWVEK
FT                   LEKHGVDQVMVRSPITCQTRFGLCAKCYGRDLARGHLVNTGEAVGIIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRATAANNIQIKTKGVIRLHNIKTVTHENKNLVAVSRSGEVTIVDEFG
FT                   RERERYKVPYGAVISAQDNSPVEAGQVIATWDPHTHPVISEVSGRLKFVDLIDGITMNR
FT                   QTDELTGLSNIVIIDAKQRSAAGRDLRPMVKLVTDEGDDIYLAGTNVPAQYYLPVDAIV
FT                   NFEDGSLVGIGDVIARIPQERSKTRDITGGLPRVADLFEARKPKDSAVMAEVSGLVNFG
FT                   KETKGKRRLIINVSEDQCHEELIPKWRHISVFEGEHVERGEIIAEGALNPHDILRLLGV
FT                   GALANYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKRVITFAGDSKFLVGEQVEESAM
FT                   LQENDKLLAEGKQIARGTPILLGITKASLATESFISAASFQETTRVLTEAAVSGKVDEL
FT                   RGLKENVMVGRLIPAGTGYTYHQSRKAKRARAAAGGDSSATHTVTASDVEHALSEALNA
FT                   DNHEH"
FT   gene            432578..432958
FT                   /locus_tag="LPC_3019"
FT   CDS_pept        432578..432958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56919"
FT                   /db_xref="GOA:A5IHR9"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR9"
FT                   /protein_id="ABQ56919.1"
FT                   /translation="MATINQLVRKPRVDVKKKSNVPALESCPQRRGVCTRVYTTTPKKP
FT                   NSAMRKVARVRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
FT                   SGVNDRKQGRSKYGTKKPKDKK"
FT   gene            432979..433506
FT                   /locus_tag="LPC_3018"
FT   CDS_pept        432979..433506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_3018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56918"
FT                   /db_xref="GOA:A5IHR8"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR8"
FT                   /protein_id="ABQ56918.1"
FT                   /translation="MPRRREVPKREILPDPKHHSELLAKFINVLMVSGKKSIAEKITYG
FT                   ALSVMEERVKKIKKNEEDGSETGSSGSAGAVLRYFEEALDNVRPSVEVRSRRVGGATYQ
FT                   VPVEVRHDRSIALGMRWIVQAARTRGEKGMMLRLAGELMDAYENKGSAVKKREDTHKMA
FT                   KANQAFAHFRWN"
FT   gene            433521..435605
FT                   /gene="fusA"
FT                   /locus_tag="LPC_3017"
FT   CDS_pept        433521..435605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="LPC_3017"
FT                   /product="translation elongation factor G (EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56917"
FT                   /db_xref="GOA:A5IHR7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR7"
FT                   /protein_id="ABQ56917.1"
FT                   /translation="MATPLKLYRNIGIAAHVDAGKTTTTERVLYYTGMSHKIGEVHDGA
FT                   ATMDWMVQEQERGITITSAATTCYWSGMDKQFESHRINIIDTPGHVDFMIEVERSLRVL
FT                   DGAVVVFDSVAGVEPQSETVWRQANKYGVPRIVFVNKMDRMGANFLRVVSQIKQRLGST
FT                   PVVLQLPIGAEEEFKGVIDLIKMKAIHWDEENKGMTFKYVDIPADLKATCEEYRAHIIE
FT                   AAAEYSEELMEKYLEGEEFTEAEIKKALRHLTITNKVVPVFCGSAFKNKGVQAVLDGVI
FT                   EYLPSPTDIPDIQGVDEHGDEIHRKTSYDEPFSALAFKIATDPFVGTLTYFRAYSGILK
FT                   SGDTVYNSVKGKKERIGRLLQMHANSREEIKEVRAGDIAAAVGLKTVTTGDTLCDQDKV
FT                   VILERMDFPDPVIAVAVEPKTKADQEKMGIALGKLAQEDPSFRVHTDEESGQTIIQGMG
FT                   ELHLEIIVDRMKREFNVEANVGKPQVAYRETLKQAVEQEGKFVRQSGGRGQYGHVWLKI
FT                   EPQEPGKGYEFINAIVGGVIPKEYIPAVDKGIQEQMQNGVIAGYPVVDVKVTLFDGSFH
FT                   EVDSSEMALKIAGSQCFKQGALKAKPVLLEPIMSVEVVTPEDYMGDVMGDLNRRRGLVQ
FT                   GMEDSPAGKIVRAEVPLAEMFGYSTDLRSATQGRATYTMEFCKYAEAPTNIAEAIIKKQ
FT                   "
FT   gene            435626..436816
FT                   /gene="tufA"
FT                   /locus_tag="LPC_3015"
FT   CDS_pept        435626..436816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="LPC_3015"
FT                   /product="translation elongation factor Tu (EF-Tu)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56916"
FT                   /db_xref="GOA:A5IHR6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR6"
FT                   /protein_id="ABQ56916.1"
FT                   /translation="MAKEKFERKKPHVNVGTIGHVDHGKTTLTAAITTIMAKKYGGTAK
FT                   AYDQIDAAPEERERGITISTAHVEYESASRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDDPELLELVEMEVRDLLSSYDF
FT                   PGDDIPIVVGSALKALEGEDSDIGVKAIEKLVETMDSYIPEPVRNIDKPFLLPIEDVFS
FT                   ISGRGTVVTGRVESGIVKVGEEVEIVGIRDTQKTTCTGVEMFRKLLDEGRAGDNVGVLL
FT                   RGTKRDEVERGQVLAKPGTIKPHTKFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDV
FT                   TGTCDLPSGVEMVMPGDNVQLVVSLHAPIAMDEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            436822..437139
FT                   /gene="rpsJ"
FT                   /locus_tag="LPC_3014"
FT   CDS_pept        436822..437139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="LPC_3014"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56915"
FT                   /db_xref="GOA:A5IHR5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR5"
FT                   /protein_id="ABQ56915.1"
FT                   /translation="MSSNQNIKIRLKSFDHRLIDLSTREIVDTAKRTGAQIRGPIPLPI
FT                   RKEKFTVLTSPHVNKDARDQYELRTHKRLVVIVHPTEKTVDALMKLDLAAGVDVQISLD
FT                   D"
FT   gene            437174..437824
FT                   /gene="rplC"
FT                   /locus_tag="LPC_3013"
FT   CDS_pept        437174..437824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="LPC_3013"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56914"
FT                   /db_xref="GOA:A5IHR4"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR4"
FT                   /protein_id="ABQ56914.1"
FT                   /translation="MMIGLLGRKIGMTRVFTPEGVSVPVSVVEVQPNRVSQVKTAANDG
FT                   YSAVQLTGGTKKSSKVSKPVAGHFAKAQIDAGDMQVEFRIDSEDAFTPGQVISVADVFT
FT                   AGQYVDVSGLTKGKGFAGTVKRHNFRTQDASHGNSRSHRVPGSIGQNQTPGRVFKGKKM
FT                   AGHMGNARCTIQSLELVKVDSERNLLLIKGAIPGAPGSRVEIKPAVKKQARGE"
FT   gene            437824..438429
FT                   /gene="rplD"
FT                   /locus_tag="LPC_3012"
FT   CDS_pept        437824..438429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="LPC_3012"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56913"
FT                   /db_xref="GOA:A5IHR3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR3"
FT                   /protein_id="ABQ56913.1"
FT                   /translation="MEITTIDTKSKLKLNKEIFAYTYNEGLVHQAVVTFMNNARSGNSA
FT                   QKTRSEVSGGGKKPWNQKGTGRARAGTIRSPLWRSGGVTFASKKRDYSQKLNKKMYKRA
FT                   LRSIISELCRTGNLVVVSDFQCDNHKTKDFLKKMNQMEISNALIIMSEVGENEYLGSRN
FT                   LIDYDICDVTTIDPVSLLRFEKVVVTEAAIKKIEEQLQ"
FT   gene            438426..438722
FT                   /gene="rplW"
FT                   /locus_tag="LPC_3011"
FT   CDS_pept        438426..438722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="LPC_3011"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56912"
FT                   /db_xref="GOA:A5IHR2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR2"
FT                   /protein_id="ABQ56912.1"
FT                   /translation="MNAERLMMVLREPHTSEKATVMADKFKQFTFKVLKNATKTEIKLA
FT                   VEHIFNVKVKSVSVVNVKGKSKRFKQTSGKRSDWKKAFVSLHADQDIDFTVTE"
FT   gene            438734..439561
FT                   /gene="rplB"
FT                   /locus_tag="LPC_3010"
FT   CDS_pept        438734..439561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="LPC_3010"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56911"
FT                   /db_xref="GOA:A5IHR1"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR1"
FT                   /protein_id="ABQ56911.1"
FT                   /translation="MALLKSKPTSPGKRGEIRVVHHDIYKGKPHAALVEKLKKTGGRNN
FT                   QGRITVRHIGGGQRQKYRIIDFKRNKDGILGRVERLEYDPNRTALIALISYKDGEKRYI
FT                   IAPSNLEVGATIQSGADSPISVGNCLPLKNIPVGTTIHCVEMKPGKGAQMLRSAGCSGQ
FT                   LVAKEGVYATLRLRSGEMRKIHVLCRAVIGEVSNSEHNLRALGKAGAKRWRGIRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGLPTKGYKTRSNKRTDTFIVRGRKKK"
FT   gene            439580..439858
FT                   /gene="rpsS"
FT                   /locus_tag="LPC_3009"
FT   CDS_pept        439580..439858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="LPC_3009"
FT                   /product="30S ribosomal subunit protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56910"
FT                   /db_xref="GOA:A5IHR0"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHR0"
FT                   /protein_id="ABQ56910.1"
FT                   /translation="MARSIRKGPFIDHHLISKVEAAIESKSKKPIKTWSRRSTIVPEMI
FT                   DLTIAVHNGKDHVPVFITDNMVGHKLGEFAMTRTFKGHSGDRKAKGK"
FT   gene            439868..440203
FT                   /gene="rplV"
FT                   /locus_tag="LPC_3008"
FT   CDS_pept        439868..440203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="LPC_3008"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56909"
FT                   /db_xref="GOA:A5IHQ9"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ9"
FT                   /protein_id="ABQ56909.1"
FT                   /translation="MEVTAKLKGAPLSAQKGRLVADMIRNMNVSGALDVLKFTPKKGAK
FT                   LMLKLLESAIANAENNNGADIDDLKVGMVCVDEATTLKRISPRAKGRANRICKRTCHIT
FT                   IKVSDEE"
FT   gene            440206..440862
FT                   /gene="rpsC"
FT                   /locus_tag="LPC_3007"
FT   CDS_pept        440206..440862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="LPC_3007"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56908"
FT                   /db_xref="GOA:A5IHQ8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ8"
FT                   /protein_id="ABQ56908.1"
FT                   /translation="MGQKVNPIGIRLGIIKDWNSKWFAGKRYAEFLIQDIKLRNDLKKK
FT                   LMAAAVSKILIERPANNAVVTILTARPGVIIGKKGGGIETLRKEISDNLGVPVHLNIEE
FT                   VKKPELDATLVAEGIAQQLEQRVMFRRAMKRAVTSALKAGAKGIKICVSGRLGGAEIAR
FT                   SEWYREGRVPLHTFRADIDYGTAESKTTYGIIGVKVWIFKGEILPQKKRSTESAQ"
FT   gene            440879..441292
FT                   /gene="rplP"
FT                   /locus_tag="LPC_3006"
FT   CDS_pept        440879..441292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="LPC_3006"
FT                   /product="50S ribosomal protein L16/(L10E)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56907"
FT                   /db_xref="GOA:A5IHQ7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ7"
FT                   /protein_id="ABQ56907.1"
FT                   /translation="MLQPKRTKYRKQMKGRNRGLALRGSKISFGEFGLKAVERGRLTAR
FT                   QIEAARRAMTRHIKRGGKIWIRVFPDKPITQKPLEVRQGKGKGSVEYWVAQIQPGKVLF
FT                   EMEGVSKELAMEAFDLAKAKLPFKVMFEERTVM"
FT   gene            441292..441486
FT                   /gene="rpmC"
FT                   /locus_tag="LPC_3005"
FT   CDS_pept        441292..441486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="LPC_3005"
FT                   /product="50S ribosomal subunit protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56906"
FT                   /db_xref="GOA:A5IHQ6"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ6"
FT                   /protein_id="ABQ56906.1"
FT                   /translation="MKKIDELRNMSVEELQNELLSLRKDQFNLRMKKASGSLDKTHLIT
FT                   MVRKSVAKVKTILTEKAGK"
FT   gene            441488..441742
FT                   /gene="rpsQ"
FT                   /locus_tag="LPC_3004"
FT   CDS_pept        441488..441742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="LPC_3004"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56905"
FT                   /db_xref="GOA:A5IHQ5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ5"
FT                   /protein_id="ABQ56905.1"
FT                   /translation="MSTNSESNARTMIGKVVSDKMDKTIVVMIERTVKHPKYGKIMKRR
FT                   TKLHAHDENQVCRVGNTVKIRESRPLSKTKSWVLVEVIS"
FT   gene            441831..442196
FT                   /gene="rplN"
FT                   /locus_tag="LPC_3003"
FT   CDS_pept        441831..442196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="LPC_3003"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56904"
FT                   /db_xref="GOA:A5IHQ4"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ4"
FT                   /protein_id="ABQ56904.1"
FT                   /translation="MIQMQTVLEVADNSGARKVMCIKVLGGSHRRYARVGDVIKVGVKD
FT                   AIPRSKVKKGAVMRAVVVRTAQGVRRDDGSLIRFDDNAAVLLNNQNEPIGTRIFGPVTR
FT                   ELRERFMKIISLAAEVL"
FT   gene            442209..442538
FT                   /gene="rplX"
FT                   /locus_tag="LPC_3002"
FT   CDS_pept        442209..442538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="LPC_3002"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56903"
FT                   /db_xref="GOA:A5IHQ3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ3"
FT                   /protein_id="ABQ56903.1"
FT                   /translation="MKRIKSGDEVIVIAGKSKGHIGKVLRVIDDAVVVEGGNLIKKHIK
FT                   PNPQKPENKGGIITREAPLHVSNVAHYNPVTKKADKVGFKYLESNGVSKKVRYYKSNNE
FT                   IIDRI"
FT   gene            442554..443105
FT                   /gene="rplE"
FT                   /locus_tag="LPC_3001"
FT   CDS_pept        442554..443105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="LPC_3001"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56902"
FT                   /db_xref="GOA:A5IHQ2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ2"
FT                   /protein_id="ABQ56902.1"
FT                   /translation="MARLKEFYKKDVVTMMMKRFNYSSVMEVPRILKITLNMGVGEAVG
FT                   DKKVMNHAIEDMTLISGQKPVVTKARKSIAGFKIREGWPIGCKVTLRRERMYEFLDRLI
FT                   SITLPRVRDFRGLNPKSFDGTGNYSMGIHEQIVFPEIDYDKTDGIRGLDICITTSAKTN
FT                   EEAKALLEAFNLPLKDKDRK"
FT   gene            443118..443420
FT                   /gene="rpsN"
FT                   /locus_tag="LPC_3000"
FT   CDS_pept        443118..443420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="LPC_3000"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_3000"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56901"
FT                   /protein_id="ABQ56901.1"
FT                   /translation="MAKKSMLMRESKRAKLVEKYRQRRNELKQLIKSSDDFQVIMESQA
FT                   KLAKLPVNSNPVRYVTRCKQCGRPHAVYRKFNLCRICLRQQLMVGNIPGGRKSSW"
FT   gene            443449..443838
FT                   /gene="rpsH"
FT                   /locus_tag="LPC_2999"
FT   CDS_pept        443449..443838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="LPC_2999"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2999"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56900"
FT                   /db_xref="GOA:A5IHQ0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHQ0"
FT                   /protein_id="ABQ56900.1"
FT                   /translation="MHDPIADMLTRIRNGQQAKHQQVTLVSSKLKEEIARVLKEEGYIQ
FT                   DFFTETLPNGLKSITLKLKYYHGRPVIEFIKRISRPGLRVYKSYKDLHSIPGFGVAILS
FT                   TSKGIMTHVSAKVKGVGGEVICEVA"
FT   gene            443856..444395
FT                   /gene="rplF"
FT                   /locus_tag="LPC_2998"
FT   CDS_pept        443856..444395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="LPC_2998"
FT                   /product="50S ribosomal protein L6/(L9E)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2998"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56899"
FT                   /db_xref="GOA:A5IHP9"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP9"
FT                   /protein_id="ABQ56899.1"
FT                   /translation="MSRVAKAPVIHSANVEVTFVDGVITVKGPKGILTQKINKLVNIQH
FT                   SKESNKLEFSPASNDPMGWAQAGTARALVRNMVQGVTEGYTVTLELVGVGYRAQSKDKS
FT                   ISLSLGYSHSIEYDLPKGVTVETPNNTTILLKGVDKQVLGQIASEIRAFRPPEPYKGKG
FT                   VKYAGEQIVRKEAKKK"
FT   gene            444406..444765
FT                   /gene="rplR"
FT                   /locus_tag="LPC_2997"
FT   CDS_pept        444406..444765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="LPC_2997"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2997"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56898"
FT                   /db_xref="GOA:A5IHP8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP8"
FT                   /protein_id="ABQ56898.1"
FT                   /translation="MNKQNARHRRGLKAKALIRKTGRSRLVVYRSGVHIYSQIVKSDQL
FT                   GDKVLVASSTIDKELRSSLTGKSKVEQASLVGQLLGKRAKAAGITQVAFDRAGYKYHGR
FT                   VKALAEGAREAGLDF"
FT   gene            444775..445281
FT                   /locus_tag="LPC_2996"
FT   CDS_pept        444775..445281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2996"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2996"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56897"
FT                   /db_xref="GOA:A5IHP7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP7"
FT                   /protein_id="ABQ56897.1"
FT                   /translation="MSFDELPKSDGYQEKLVSVTRTAKVVKGGRVFGFAVLVVVGDGKG
FT                   KVGFGRGKAREVPIAIQKAMDQAKKNMVYIPLSGTTIFHEITWNYGASKVFMKPASEGT
FT                   GIIAGGAMRAVLEVLGVQNILAKSIGSTNPSNIVRATIGALTHIGTPDYVAAKRGKTVE
FT                   EVMAG"
FT   gene            445469..445903
FT                   /locus_tag="LPC_2995"
FT   CDS_pept        445469..445903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2995"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56896"
FT                   /db_xref="GOA:A5IHP6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP6"
FT                   /protein_id="ABQ56896.1"
FT                   /translation="MNLNTLSPDPGSRPSRRRVGRGIGSGLGKTCGKGHKGQKSRAGGY
FT                   HKINFEGGQMPIQRRLPKMGFKSREGRTIDEVSLGELAKLNDEVIDLVALRKAGLINNS
FT                   IKDVKVILSGELTAAIKLKGLRVTKGARSAIESLGGSIEE"
FT   gene            445906..447234
FT                   /gene="secY"
FT                   /locus_tag="LPC_2994"
FT   CDS_pept        445906..447234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="LPC_2994"
FT                   /product="preprotein translocase SecY"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2994"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56895"
FT                   /protein_id="ABQ56895.1"
FT                   /translation="MKNQKHNGSKPRGGLAELKSRLLFVVLGILVYRLGAHIPVPGLDP
FT                   AKLANFFSEQQNTIFGLFNMFSGGALSRVTVFAIGIMPYISASIIIQLFSVVSPKLEQL
FT                   KKEGESGRRKINQYTRYLTLLLSIFQSMGMARWLASQQIAMQPDFSFYFTAVVTLVTGT
FT                   MFLMWLGEQITEKGVGNGISLIIFSGIVSSMPNAIGSVLQQVKEGQMQALTLVIIAAVV
FT                   IVVTGFVVFMERAQRRIRVNYAQRTQGRKVYAAQTSHLPLKINMSGVIPPIFASSIILL
FT                   PATLAQFFSQTKGLGWLSDVGMALSPGQPLYLIVYAAAILFFAFFYAALVFNPKDTADN
FT                   LKKSGAYIPGIRPGEQTTKYIDSVMTRLTLVGAIYLVLVCLLPQILMYTWHVPFYFGGT
FT                   SLLIIVVVIMDFVAQVQAHLMTQQYDSLLKKANFRGTKLPGLL"
FT   gene            447442..447798
FT                   /gene="rpsM"
FT                   /locus_tag="LPC_2993"
FT   CDS_pept        447442..447798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="LPC_2993"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2993"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56894"
FT                   /db_xref="GOA:A5IHP4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP4"
FT                   /protein_id="ABQ56894.1"
FT                   /translation="MARIAGVNIPDHKHVVIALTAIYGIGKTTSLKLCKTVDIDPSVKV
FT                   SQLSDAQLESLRTEIAKITVEGDLRRVVTMNIKRLMDLGCYRGLRHRRGLPLRGQRTKT
FT                   NARTRKGRRKGTSS"
FT   gene            447822..448220
FT                   /locus_tag="LPC_2992"
FT   CDS_pept        447822..448220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2992"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2992"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56893"
FT                   /db_xref="GOA:A5IHP3"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP3"
FT                   /protein_id="ABQ56893.1"
FT                   /translation="MAITKSKQQKTRKKVKRVVSDGIVHIHASFNNTIVTFTDRQGNAL
FT                   CWATSGGSGFRGSRKSTPYAAQVATERAAAVAKEYGMKSVAVFVHGPGPGRESTIRELI
FT                   TQDFKIVEITDVTGIPHNGCKPPIKRRV"
FT   gene            448237..448857
FT                   /gene="rpsD"
FT                   /locus_tag="LPC_2991"
FT   CDS_pept        448237..448857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="LPC_2991"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2991"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56892"
FT                   /db_xref="GOA:A5IHP2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP2"
FT                   /protein_id="ABQ56892.1"
FT                   /translation="MARYLGPKCKLSRREGCDLLLKSGVRDHKSKCKSEKLPGQHGDKK
FT                   PRLNSYGIQLREKQKIRRLYGILEKQFRNYYKKAARQKGSTGENLMALLERRLDNVVYR
FT                   MGFASTRAEARQLVAHKAILVNDKVVNVPSFLVNPGDTVSVRQKAKNQGRIQAALALSE
FT                   QRAPCDWITVDTGSFKGTFSTAPTLMDLSSDYNVNLVVELYSK"
FT   gene            448876..449868
FT                   /gene="rpoA"
FT                   /locus_tag="LPC_2990"
FT   CDS_pept        448876..449868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="LPC_2990"
FT                   /product="DNA-directed RNA polymerase alpha subunit RpoA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2990"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56891"
FT                   /db_xref="GOA:A5IHP1"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP1"
FT                   /protein_id="ABQ56891.1"
FT                   /translation="MYTEINEMLTPKVLKVQAESPYKARIVLEPLERGFGHTLGNALRR
FT                   ILLSSMPGSAITEASIDGVLHEYSTIEGVQEDVVDLLLNLKSVAIKLTVGNEAQVTLNK
FT                   EGPCQVTAGDIQLTHGQEIINPELVIANLNEKGKLNMTLKVERGIGFHNTDAFVRYHED
FT                   EIEKKTVGKLKIDNSFSPVKKVAYFVDSARVENRTDLDKLTIELETNGTIDAEEAIRIS
FT                   ASILQRQLHAFVDMKFEESRADNKERNDFDPVLLRSVDDLELTVRSANCLKAENIHYIG
FT                   DLVQRTESELLKTPNLGKKSLTEIKDVLASRSLSLGMKLENWPPASLGE"
FT   gene            449887..450270
FT                   /gene="rplQ"
FT                   /locus_tag="LPC_2989"
FT   CDS_pept        449887..450270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="LPC_2989"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2989"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56890"
FT                   /db_xref="GOA:A5IHP0"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHP0"
FT                   /protein_id="ABQ56890.1"
FT                   /translation="MRHRNSGRSFSRTSSHRKAMFSNMCCSLIEHELIRTTLPKAKDLR
FT                   RYIEPLITVSKSDSVASRRRAFDILRSKSAVGKLFTDLGPRFAKRPGGYIRIIKCGYRD
FT                   GDNAPMAIVELMDRPVSSDDTEE"
FT   gene            complement(450337..450816)
FT                   /gene="ssb"
FT                   /locus_tag="LPC_2988"
FT   CDS_pept        complement(450337..450816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="LPC_2988"
FT                   /product="Single-strand binding protein (SSB)
FT                   (Helix-destabilizing protein)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2988"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56889"
FT                   /protein_id="ABQ56889.1"
FT                   /translation="MARGINKVILVGNVGADPDVRYLPNGNAVTTLSVATSETWKDKTT
FT                   GEKQDRTEWHRVVCFNRLGEIAGEYIRKGSKLYVEGSLRTRKWQDQQGQDRYTTEIVAS
FT                   DIQMLDSKGNGATNYDDMPSFQGTSTPQQASTKNQATPTSTAQDAFDELDDDIPF"
FT   gene            complement(450900..452267)
FT                   /locus_tag="LPC_2987"
FT   CDS_pept        complement(450900..452267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2987"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2987"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56888"
FT                   /protein_id="ABQ56888.1"
FT                   /translation="MKYSWNKTVFPIAAIFSFRLLGLFLLIPVFTLYATNLKGATPTLI
FT                   GLALGSYGLAQGLLQIPFGMLSDKLGRKPMIAIGLLLFAGGSLLGAVTHSIAGMITARI
FT                   LQGAGAIGSVLIALLADLTLDEQRTKAMAIVGITIGTSFSLAMIISPALTHYYGLSGVF
FT                   YLTAALAVLGIMILYLIIPNPSKEQFHADSEPSLSLIKPVVTDQHLQRLNFGIFCQHFI
FT                   LTATFFAIPMLLKYQIETGHLHQQWHFYLPLMLFSFILMVPFIIISERKKRLKTVFVIS
FT                   VLLTTFTQGLLVFTSQNWYWFCILMFVYFVSFNVLEATLPSLVSKLASPGSKGTAMGIY
FT                   STSQFLGIFFGGSLAGILYQWYDNQAIFLINMILSCLWLIISLSMKSNVYFSTLILPFT
FT                   ANNEESKLVVNQLLKVTGIKEVILSKDENTLYVRVDNEEYSTGSAEKILHQSTIYQ"
FT   gene            452429..453187
FT                   /locus_tag="LPC_2986"
FT   CDS_pept        452429..453187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2986"
FT                   /product="glucose-1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2986"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56887"
FT                   /protein_id="ABQ56887.1"
FT                   /translation="MSSLVFSGKVGLITGGARGIGKATALKLAHSGCDIAIVYYNSSDE
FT                   AQSLVNEITSMGRKAIALQADVADCQSVKEMFSQFREHFKHLNFLVSNAASGVLKPALK
FT                   MSTKHWRWCLETNALALNHLVTEGLDLMPKNSRVIALSSLGASRAIPNYAFIGASKAAL
FT                   EALVRSLSLELASYGITVNTVSAGVVDTDALKHFPNREQLLDEYQAHALADRALTPEDV
FT                   ANAIYLLCLPEAAMINAHTLYVDAGYSQVG"
FT   gene            453258..453671
FT                   /gene="acpP"
FT                   /locus_tag="LPC_2985"
FT   CDS_pept        453258..453671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="LPC_2985"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2985"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56886"
FT                   /protein_id="ABQ56886.1"
FT                   /translation="MNVAEVYPKVREIIADVLVIDEEEISLNSSLIEDLGAESIDFLDL
FT                   VFQLEKEFKIKIPRGQLEKNARGDLAEDEFEKGGILTTSGLQALKNYLSEVPADRFKEN
FT                   MKVNEIPVLFTVETFCKLVISAIAQQQATETVA"
FT   gene            453671..454567
FT                   /gene="fabA"
FT                   /locus_tag="LPC_2984"
FT   CDS_pept        453671..454567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="LPC_2984"
FT                   /product="3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl
FT                   carrier protein) dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2984"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56885"
FT                   /protein_id="ABQ56885.1"
FT                   /translation="MRFLFVDRIVQLSPGEWIKGIKHVTRDDAYLTTDDQGRLCFMPSL
FT                   IGETLGQLAAWNVMQHNHFTSRPVAGVVSSARLYRPAYVGETILLESNIDSLDEKAVQY
FT                   HSIAKVGNDIIFTIDGALGPMLPMTEFISTEVIRQQFAEIYRPGEWSSVLALSSPVLIE
FT                   ENCSDCGMINSSMQFDRVLASEPGISLIAEKRITRSASYFPDHFPNRPVLPMTVLLECK
FT                   LNLAKEFIARAKYDRAYRISELRKIKMNEFVHPGDVVVCQVKVKQQMDDELILSYRCEV
FT                   DGKRVCVVDIVLIPKGK"
FT   gene            454572..455864
FT                   /gene="fabFc"
FT                   /locus_tag="LPC_2983"
FT   CDS_pept        454572..455864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabFc"
FT                   /locus_tag="LPC_2983"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase II,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2983"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56884"
FT                   /protein_id="ABQ56884.1"
FT                   /translation="MKRRVAITGLGVVSPLGNDVSTTWNNLIAGYSGIDSIKQFDASAF
FT                   PTTIAAEVKNFSPDTSISGKHTRFIMSFTHFALEAARQAFEDASIFPTKQTSDRWGIVT
FT                   GSGMMTAEFEYLTRFQQTCAADGEIDWGKLQSNSRDFYNLVDFGKTTSNSGLSLLIQQY
FT                   GITGYASSVHTACASGGQALGLAMQVIRRGEADFMLAGGFDSMINPLGLSSFCLLGALS
FT                   TYNETPQTASRPFDATRNGFVLGEGAAFLILEEWSKAKARGAKIYAELAGEGNSLSSYR
FT                   ITDSHPNGDGAIQAIKRALEDAGVQPRDVDYINAHGTSTKMNDLSETNAIKVVFGDRIA
FT                   NLPVSSTKSQTGHLIAAAGALEAVLSVKSIEQAQVPKTANLKTPDPECDLDYVVDGPRE
FT                   KSLGVVLSNSFGFGGSNSCLLFKHPEFEEAK"
FT   gene            455865..457142
FT                   /gene="fabFn"
FT                   /locus_tag="LPC_2982"
FT   CDS_pept        455865..457142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabFn"
FT                   /locus_tag="LPC_2982"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase II,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2982"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56883"
FT                   /protein_id="ABQ56883.1"
FT                   /translation="MSQANRVFITGRSALTASGATADETWNAIISGQCGIDEINFWELS
FT                   EWSHRLGGEIKDFQPSKMLPDRKLIKVISRQDIMGINAAVQAVEHSKMIAYRDSLADAD
FT                   LFNEQTAIYVGSPGNKYFQQYDFIPLLAKTHGDMRSFANQLFDEVHPMWLLRILPNNVL
FT                   AYTGITYGFKGPNHNVTNHAVGGTQAILEAYHAIRSGQAERAVVVAYDIGTEPQGLFYY
FT                   EKLGVVSNRHLKPFDKEHDGTILAEGAAALVLESEASVKSRAATCYGEIVGGLSASEAT
FT                   GLFSIEADGQHLASLMRQTLSTSGISSEEIGLIVTHGNGNSKSDDSEALAIKSVFKQEE
FT                   VPATAFKWSMGHTLCASGVLDAVLTTYALETKCVPGIANFQQIAPTCEGLSVSREHRET
FT                   ISNSYAMMINRGFASMNVCLVIKACE"
FT   gene            457135..457980
FT                   /gene="waaM"
FT                   /locus_tag="LPC_2981"
FT   CDS_pept        457135..457980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaM"
FT                   /locus_tag="LPC_2981"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2981"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56882"
FT                   /protein_id="ABQ56882.1"
FT                   /translation="MNNLAQQIEALPITLAGRFIYRFLPYRRRLIFSNISQVYNDQLNE
FT                   SQKKRLAKAYYSHLAKSLKEALQLRFMSEKKLRAQVEVIGHEKMLAVVAQKKGVLVVTG
FT                   HFGNWEFAPLGGVLNFKEFKGQFHFIRRTLRFKFIERIMFKNYYQAGLNVIPKKNSLEQ
FT                   VCVALEQNHAVIFVLDQHASLVNRDGIAVEFFGKKAGTYRSLATISRHTGIPVIPAASY
FT                   RLPNGKHVLEFHDPIPWKDYDTTQESLYRNTLAYNQALEKIILAHPEQWNWMHKRWKLS
FT                   "
FT   gene            complement(458089..458394)
FT                   /locus_tag="LPC_2980"
FT   CDS_pept        complement(458089..458394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2980"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56881"
FT                   /protein_id="ABQ56881.1"
FT                   /translation="MDERRKYFRLKNHGEINASLDNNPIEIVEISSNGAVVVKQKTDIP
FT                   KEGVLKLQIHNFIMELCYEVIRAEDNNIVLHFTKEDETNKLFLVLKRLRDERKNKT"
FT   gene            complement(458580..461270)
FT                   /locus_tag="LPC_2979"
FT   CDS_pept        complement(458580..461270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2979"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2979"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56880"
FT                   /protein_id="ABQ56880.1"
FT                   /translation="MVDFDKPVSKNDILASLLLIADLNRPSLNQTLSWEQALKSFLSLN
FT                   DPLIKTEIFIKWLSQLNPDQLQSSPEIVLILKHIVEQKLLPYTLKKILIQRKNFTTSQI
FT                   NWLCNHCLIVAPDQTTLPDIIKLGSWSWLENHMKRNELLNFDLLKIAILNKDYLASINN
FT                   SKESQLDFIYALNANKFNYQQILELIALAQDSQIKSLLITCLLSKKEYLDNLKEKSFLA
FT                   HLNQSEFHSPPRLNALVHQLNLSCLTVAQIELLQPEACVTLLCSIPHFHQLSEKQVEKI
FT                   LLKYPKPDMIAYWLNHYSSRPNAHFILAHLMNLVDVHVVDELNKMDSTKKETIIMNMVE
FT                   HLELFDPTHPLLINQNEEKRLITAIQRYLYGQHHDAYVTYIKLLVYKLLNRNYQFSPQA
FT                   MQLLICLNNLEELKELNNKIAYLTNYYLRASAQSGDSSLFYNDSRINITSMTQLVQLAP
FT                   KIPTKSKEKSLLSSLFCGIKISESSVMTPTNDIPEHPLINKLIKSKRTVKSIDYFLMHY
FT                   KGDKQVLSKIINDYLSYYVQEGCTEIHRRSIYHLIVLMSLSDISASVREAIYTAFLNYP
FT                   ELHDEQINFSLFIYDAKRTIRHFGAQASEDSYARVIDLCEGALKKLNPNKHKEIISIAT
FT                   QALTEAKIELSFGENTGFIAQLISRLKRCWYYGWTGFFSPNLPAFVAAIDSPIKQSEKK
FT                   ASPLLQQRKYFTTKLETNLSIILDDIKSGYTQQKLNELIEALSIFSLQSNPKNELKIRQ
FT                   KLHRLFHYLLLESKNDLTLDAWLIKNQQLLIANRFRLLEMQLMKGARNEVESLLKEFDE
FT                   DSTHFSPIIKEFTHSLPEQNPYRCESVSSNQTPGITILDSATELATSLKSTLGNLGVFF
FT                   SNNIMSAIYPNNKSTPQSTSTMISP"
FT   gene            complement(461583..462416)
FT                   /gene="dapF"
FT                   /locus_tag="LPC_2978"
FT   CDS_pept        complement(461583..462416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="LPC_2978"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2978"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56879"
FT                   /db_xref="GOA:A5IHM9"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHM9"
FT                   /protein_id="ABQ56879.1"
FT                   /translation="MGIKFTKMHGLGNDFIVLDGVNQSIQLTVEQIQKLANRHTGIGFD
FT                   QCLLIESSQTEGIDFNYRIFNADGQEVGQCGNGARCIALFARYYGLTAKNKLTVATKTT
FT                   LMDLIINEDNSVSVNMGVPRLAPGEIPLLADRQSPEYSLELNNGNTVNLHAISVGNPHA
FT                   VLLVENIDTAPVNSLGQQISFHPQFPEQVNVGFMQIVNHEKINLRVYERGCGETIACGS
FT                   GAVAAAAIARLFYNLSDKITVHLPGGDLCIQWPCPTAPIILTGPAAFVYEGTLLS"
FT   gene            complement(462713..463075)
FT                   /locus_tag="LPC_2977"
FT   CDS_pept        complement(462713..463075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2977"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2977"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56878"
FT                   /protein_id="ABQ56878.1"
FT                   /translation="MSILFLARKLASDYGFIEQIQQSHNRNQINYRFYSPRTDLHGSNT
FT                   NRLYGNPGKGVISQNTIFIYWYRDGKNSYFIECSNRLPKKELEVLHQLLMDNQHSLEEI
FT                   LEASNNRFLSFQTRHT"
FT   gene            463265..463912
FT                   /locus_tag="LPC_2976"
FT   CDS_pept        463265..463912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2976"
FT                   /product="carboxylesterase/phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2976"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56877"
FT                   /protein_id="ABQ56877.1"
FT                   /translation="MKEPLEKAQACVIWMHGLGADASDMMGLADQLTVEDTALRHVFLD
FT                   APRRPVALNGGMVMPAWYDIYGLGFVDEEDKSGIEQSELLIRKVVDAQYNCGFKPHQIF
FT                   LAGFSQGGAMALHTALHMTERLCGVIALSAYLPLAKHNKPQLDKNTPIFMGAGQFDPLV
FT                   LPKWTLQSKDWLLANGYNEVSFHQYPMEHSICFEEIKDLSLWLNKQVQGVLQ"
FT   gene            463909..464343
FT                   /locus_tag="LPC_2975"
FT   CDS_pept        463909..464343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2975"
FT                   /product="oligoketide cyclase/lipid transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2975"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56876"
FT                   /protein_id="ABQ56876.1"
FT                   /translation="MTIVKRSRTVPYSCEQMYGLVNDVEHYSEFLPYCAESKILHRDND
FT                   EVQATLVIAAAGMSKSFTTRNRLQTNKMIEIRLVDGPFSHLEGFWRFDQEEKGCRISFD
FT                   LEFEFAGKIFSMLLGPIFDQITDKMVDAFCERAEVIYGKG"
FT   gene            464330..464602
FT                   /locus_tag="LPC_2974"
FT   CDS_pept        464330..464602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2974"
FT                   /product="conserved hypothetical protein; UPF0125"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2974"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56875"
FT                   /protein_id="ABQ56875.1"
FT                   /translation="MVKVELVYIADSKNCLHYKMDLKQGATVEEALIESNIYSTCPETR
FT                   ELPVGVYGKRVSVDQVLKEGDRIEIYRPLILDPKEKRRKLAQFKK"
FT   gene            complement(464690..465034)
FT                   /gene="smpA"
FT                   /locus_tag="LPC_2973"
FT   CDS_pept        complement(464690..465034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpA"
FT                   /locus_tag="LPC_2973"
FT                   /product="small protein A, tmRNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2973"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56874"
FT                   /protein_id="ABQ56874.1"
FT                   /translation="MAKFFMVGKKMRIMTFFICFILTLTLTQCASYDFSRRITQQGNLL
FT                   PQSKIARLKTGMSKNDVAILMGTSLMSPTFNNDRWDYAYTWRRGKGNLEIRNVVLYFSK
FT                   GSLVKIEHKP"
FT   gene            465232..465642
FT                   /gene="fur"
FT                   /locus_tag="LPC_2972"
FT   CDS_pept        465232..465642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="LPC_2972"
FT                   /product="Ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2972"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56873"
FT                   /protein_id="ABQ56873.1"
FT                   /translation="MEESQQLKDAGLKITLPRIKVLQILEQSRNHHLSAEAVYKALLES
FT                   GEDVGLATVYRVLTQFEAAGLVSRHNFEGGHSVFELSQGEHHDHLVCVKCGRVEEFVDE
FT                   IIEQRQKAIAERAHFKMTDHALNIYGICPQCQ"
FT   gene            465780..465923
FT                   /locus_tag="LPC_2971"
FT   CDS_pept        465780..465923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2971"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2971"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56872"
FT                   /protein_id="ABQ56872.1"
FT                   /translation="MEFDYIIVSDGSPGWAFASRLSANPANKLLLLEAGDSVFLEMPIR
FT                   LQ"
FT   gene            466082..467152
FT                   /locus_tag="LPC_2970"
FT   CDS_pept        466082..467152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2970"
FT                   /product="components of sensory transduction system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2970"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56871"
FT                   /protein_id="ABQ56871.1"
FT                   /translation="MHQKKRSSLELEALLSLFEGSLRTIPFNILAVMVLSLGFIYTNQI
FT                   PIKLVIICFFLILILSVVRWVTSRIIISKEFYITKGKQALIGFLLLNFFMGLAWSLSYF
FT                   IFSPYLNDTSEFIFVFILGGLSTGAIASLSIYLPAYYAYVLPMNFPIIAYNLYLFQFDK
FT                   AIFAVMYSLFLIIVLLTARLNSKLLSKVRVLSITDSLTGLFNRRHFDVVFRNELSRAKR
FT                   NKYPISLVFIDIDNFKYINDTFGHSVGDSFLIHVSNILKQTLRRSSDSLFRIGGDEYAA
FT                   ILINMPPSEAITVCALLQEQFNKKNQYKNVSLSMGVISIDSIRVIDQQSAITAADKTLY
FT                   QAKKAGKNQIKSKSLG"
FT   gene            complement(467470..467856)
FT                   /locus_tag="LPC_2969"
FT   CDS_pept        complement(467470..467856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2969"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2969"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56870"
FT                   /protein_id="ABQ56870.1"
FT                   /translation="MKKWTVLAASSLLMVNAYANESFCGYKDFFHLGDKTHPGIYVVSG
FT                   YNDSDVVLQIVGPRSFVIRDGFDCRAGYAHVTVAYDNANWCVLDINDGPFMNHPVVSAS
FT                   CNGLRYINTTYDGFGSYSYSINIE"
FT   gene            468112..468711
FT                   /locus_tag="LPC_2968"
FT   CDS_pept        468112..468711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2968"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2968"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56869"
FT                   /protein_id="ABQ56869.1"
FT                   /translation="MYSSLFLKKDLGCLPEKVIFLDFDGTVALPARKGNGEYDIQPDGS
FT                   IGATHLNKEKFRRLVQFAIQTDIPLYFLSGRPDLQSCVDLMTDFIASVDGFHSGIGGFK
FT                   KDSLFFISKMIIEEGKLVRKEITTKAQVIQSVHHEKYSYLPKESILLVDDIQEYLDPAQ
FT                   ELGYNTLLANPESLEHFDEVEKFIGVTLQKTIAFNT"
FT   gene            complement(468751..473040)
FT                   /gene="sdhA"
FT                   /locus_tag="LPC_2967"
FT   CDS_pept        complement(468751..473040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="LPC_2967"
FT                   /product="SdhA, substrate of the Dot/Icm system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2967"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56868"
FT                   /protein_id="ABQ56868.1"
FT                   /translation="MISEKIKLLESFKQNQFSKLIEKINSKILATLKSGHFNPRLAPYL
FT                   EKMNKDGVPFTDFDLDPENISQIKKLINALYHARLAFLDLENIDIGNIKRTIPDLKLLY
FT                   SNTIHQAYQAGYLITNLDVDLQEMFKEEIDLILPVIGKLQAFAGEHQECTKHLAESLKD
FT                   FPISYKAGEVTGIALEQMQPRTGDWDYQFLTQFSAVLPGYIEKLTQYIQQYSSQIKEKE
FT                   PTLNNEKLEELQNASLKLLNDLEHLKGNDFFISLKVLKYIHIIRNIITLATSSVEQMGH
FT                   FSDSSQDVIRDNLAQLKYVVLPTLFGLVDKIEDNAMLKPGTLSIPLMEKIKPLYQLLIY
FT                   YASKPVNFKEKGEELLSIEDSRFLALRLERTYQRIDEANKALFKIQKAQEALDNFYKIL
FT                   DTPPYNKQPIHQLPKEIKNQLITYYKIISPYMMDVNPDLNILLIDSFQGPESWSSYLKK
FT                   PWRWLRGTLPADHASFVLAQKEALQTLISKKKATQQFHIELNRDLIESVHKQTNLVLFP
FT                   YSEKTNVFLLDETKALNPANGATDKLKFRPEKGHNILVNPEDLTSEQALDLYQWYRNKR
FT                   EKFRVASKAYNEFITLLKKQTKTIAETEGRILHLNNLDKETKTRCRNLYNIFQPYFIDG
FT                   IPPELRASAISFDKFLVHSFSNESSTYDAPAVDLFEKLDEHFQIYFTEIDLQWGKKSNQ
FT                   YLKWAQEKFASENNSTELEHDEKLESRAHHLIKHTNFSKCIHEFRTELNQVISFFNNAM
FT                   RAQLKQQPNGIPYPELQDQNKELAQSEQVVAIKRIFNSLYHVEKIVVELEKLDTRSYES
FT                   IYVYHLIQAYDHINEIKKLALKLAVDPHFKLIASELLEKAQTLIATIQEHSDAYQVSPL
FT                   EVPYNQDIKYNALWYTLNAFYISPKHIRSLRNTNYLTTEELNDLHLKAKKATVTVENII
FT                   KSSNSYFKLFLQTPAMYSLYREMTNKLNEFISTSHDAVMNNLDQFRSKIFTPMLMEADA
FT                   WEDKLGLVPGTISGPLKTITDEYYKGLLHPLALHSKAHIRMICDKTPIDQRIKTTNKKL
FT                   ENATQHLDKIEKNYKHIIKLYEIIKTKGGKTTDDELIETYKKALYKLVKLQKRLPQNTD
FT                   HDPKDYELDTLLNSELKEYEPKLTLIKPLIISSYHHYEGLKATYLMKANTAREKLSYLK
FT                   ELRSTQEQEDLLYIEEYTTESFNKQLDAFCNRHIGLQYTDKEYRTKLREYLLTFKESII
FT                   QRSKSAEDINLTIKNLLKEKIKNFERDNFEKYYHLDAVRVALAQFKNYFSLSTAAIEQN
FT                   NSTFESEETLAKKTELINKLVDISEDGTLTPKERVDQISFHVKNPNFERIIMDYKQESY
FT                   FSFTYLKQCILSLLEALCLYTPERRKLFNNLESSVKTQPKINELTKRFGLFAGNESAIS
FT                   TESRAITPVSSVENNGTIELNQLAPST"
FT   gene            complement(473203..473922)
FT                   /locus_tag="LPC_2966"
FT   CDS_pept        complement(473203..473922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2966"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2966"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56867"
FT                   /protein_id="ABQ56867.1"
FT                   /translation="MKNIALLISCEHAVNTVPYEYQTLFEPHKDVLESHRGIDFGALEI
FT                   AQSIHKNNHCSLFQATCTRLLVDCNRSINHPHCFSEITKNLSSDKKKKILDEFYLPFRN
FT                   RVMDHIHQLISQGLQVWHLSTHSFTPVMNNIIRTTDIGLLYDPRSNSEKILARQWQKEI
FT                   KILHPQLKVRMNYPYKGISDGFTTSLRKKYSHHEYIGIELEVNQKLVFHNHSLDTLKNT
FT                   LSLSVSNTIKAYQKSER"
FT   gene            complement(473927..475147)
FT                   /locus_tag="LPC_2965"
FT   CDS_pept        complement(473927..475147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2965"
FT                   /product="conserved hypothetical protein; AF2307 from
FT                   Archaeoglobus fulgidus"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2965"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56866"
FT                   /protein_id="ABQ56866.1"
FT                   /translation="MSDFPIFSVLGIEIEYMLVDKESLNVQPKSDLILRTLAGHQVNEI
FT                   ELGDIAISNELVLHVLELKNNGPKPLHVPVAEHFQKTIRELQPLLAQHNLLLLPTGAHP
FT                   WMDPNTETIRWPHGNHDIYNQFNSIFNCQGHGWANLQSMHVNLPYSNEEEFCQLHNAIR
FT                   LILPLLPAIAASTPFLDGQATGLLDSRLYFYSRNQQRIPSISGDIIPEFIRTEREYQEQ
FT                   ILEPMYRDISPYDPKGILQYQWLNSRAAIPKFDMKAIEIRILDSQECVEADIAIAKAIN
FT                   AILKYWQSTSNFYLDNPCDTKSLKYVFDETIKNGLSCHIDNKKLLEQWQLPLQGMSVNT
FT                   IWSLLIERISHELDRKQQLALELILKQGNLSERILKACSSSINHDSLKQVYTQLAHCLL
FT                   RNEQFTP"
FT   gene            complement(475140..476594)
FT                   /locus_tag="LPC_2964"
FT   CDS_pept        complement(475140..476594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2964"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2964"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56865"
FT                   /protein_id="ABQ56865.1"
FT                   /translation="MQTVIVTDDLDSWSFLSELAPIVHALEYLSGDEYHQNKSFRVINL
FT                   CRSYNYQSIGYYVSLLAQARDHKALPSVHSIQDVLNVSLSKLISQDTHEEIQHSLHDIK
FT                   GNEFVLSLYFGQNLAKRYATLAKQLHGLFPLPLIRFYLEKKKQWRIKTVVPLSLSDVPE
FT                   HHLEFMRQSAENYLSKKRVHQWRKKQRFHDLAILVDPSEPNAPSNKKALELFVSCGEEL
FT                   GLNVDIIDKNEAKAIAEYDALFIRATTSVNHYTYRVSRRAAQENLVVIDDPQSIIKCSN
FT                   KVYLAELLSSHQIMTPDTLFISKYDKELPKIEFPCVLKKPDSAFSHGVVKIDDEKSLQK
FT                   SLNQFFKNSDLVVVQPFIPTEFDWRIGILDNKALFACRYFMAKGHWQIYDWHCQEENKE
FT                   GDSETLPLHEVPEQIIKIALKSTRLIGDGLYGVDIKSHGNKYYVIEVNDNPNIDHGLED
FT                   KILGQNLYEQIMSVFLQRIRRKHGYV"
FT   gene            complement(476598..477311)
FT                   /locus_tag="LPC_2963"
FT   CDS_pept        complement(476598..477311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2963"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2963"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56864"
FT                   /protein_id="ABQ56864.1"
FT                   /translation="MIDLIIQTQPDDETCGPTSLHAIYLYYGLDLPLNEIIQGVDKSLS
FT                   GGTLTPMLGKHALLHGFRTTVYIYNLNIFDLTWFHNGEVNNSFLMDKLEAQMKYKNDPY
FT                   ITKASLAYLDYLKLGGTIRSKSLNVDLLKNYFNKKIPILTGLSATYLYRSAREYFTPEG
FT                   KSVYDDIRGEPCGHFVVLCGYDVKKRLVIVADPHAENPLSHNNYYKVSINRLINSIMLG
FT                   VLTYDANLLIIEPKE"
FT   gene            complement(477506..477979)
FT                   /locus_tag="LPC_2962"
FT   CDS_pept        complement(477506..477979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2962"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2962"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56863"
FT                   /protein_id="ABQ56863.1"
FT                   /translation="MSPLTQFKFFLWFFSHFKVALIGYLKPKLIQLTDNEIVVRLPLTR
FT                   RSRNHLHSMYFGALAVGADIAGGLHGFYHAKQAKCKVSLAFKSFQAQFLRRPESDVYFI
FT                   CTEGEVVKKMIEESKKSGERINKPIHIKAYINYLTHPEEIADFILELSLKVIK"
FT   gene            complement(477976..478527)
FT                   /gene="osmY"
FT                   /locus_tag="LPC_2961"
FT   CDS_pept        complement(477976..478527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="LPC_2961"
FT                   /product="osmotically inducible protein Y"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2961"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56862"
FT                   /protein_id="ABQ56862.1"
FT                   /translation="MPKCMHFILATALIFVTSTFYASNLREIEQEVSDSVITAKITAKF
FT                   AESRHLNPLKISIDTEKGIVTLSGYAPDKQAFIDALQIAKNTKGVKAVHAKDLHIKKVN
FT                   TAFTDAFITAEVETAVLKAKILDDESIPLVGINASTTNGEVTLSGHVKSARSIAAIIKR
FT                   VNEIPGVKKIVTNLEIQENA"
FT   gene            complement(478786..479244)
FT                   /locus_tag="LPC_2960"
FT   CDS_pept        complement(478786..479244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2960"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2960"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56861"
FT                   /protein_id="ABQ56861.1"
FT                   /translation="MKSLIKNLLFIVVFSINSSALYAANGNTRVIQWAQQTLMDTLSVS
FT                   YTSKAQDFVTVRKNYSLNAWSGITGFLGGNMQTIREKQLTLHPVLLPDTQILSTGLYSG
FT                   MSYWIIRQSVAIDELNTKLTFTLTILGRSGAAGYPYIVHSLSILLNAL"
FT   gene            479339..482194
FT                   /gene="uvrA"
FT                   /locus_tag="LPC_2959"
FT   CDS_pept        479339..482194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="LPC_2959"
FT                   /product="excinuclease ABC A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2959"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56860"
FT                   /protein_id="ABQ56860.1"
FT                   /translation="MHTITIRGARTHNLKNLDLELPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSMMEKPDVDSIEGLSPAISIEQKATSHNPRSTVGTITEI
FT                   YDYLRLLYARVGEPRCPTHHTSLHAQTISQMVDQVLALPEDSKVMILAPVIRERKGEHV
FT                   QFLQQLQAQGYVRARIDGELYELDSPPKLGLRTKHTIEVVIDRFKVRPDLAQRLSESFE
FT                   NALNLADGLAIVSSMDGHFKELLFSSRFACSECGYSLSELEPRLFSFNNPVGACSSCDG
FT                   LGVDQFFDPSRVVHDATASLAEGAIRGWDRKTTYYFSMLESLARHYGFDTSTPFCDLSE
FT                   AMQQIVLYGSGREIIEFQYHRPHGGYMVKRHSFEGIIPNMQRRYRESDSGMIREELAKY
FT                   LSSRPCQSCQGARLREEARHVFIDNKNLPEITSYSIEQAYQFFKELKLSGYRGEIAAKI
FT                   NKEIVERLGFLVNVGLDYLSLARSAETLSGGEAQRIRLASQIGSGLVGVMYILDEPSIG
FT                   LHQRDNDRLLSTLMHLRNQGNTVIVVEHDEDAIRSADFVLDIGPGAGVHGGEVVASGSP
FT                   QEVMNNPASLTGQYLSGKEAIEIPKARIPVNHDRMIHLKGVSCNNLQNVDVSIPLGLLT
FT                   CITGVSGSGKSSLINDTLYPIAANALNRASLMTTGEVQDISGLHLCDKVIDIDQSPIGR
FT                   TPRSNPATYTGLFTHIRDLFSGTPESRARGYQPGRFSFNVKGGRCEACQGDGLIKVEMH
FT                   FLPDIYVSCDVCQGKRYNRETLEIHYKGKNIHEVLDMTVEDACAFFAAIPVIARKCQTL
FT                   MDVGLSYIKLGQSATTLSGGEAQRIKLARELSKRDTGNTLYILDEPTTGLHFHDTKQLL
FT                   TVLTRLREQGNTIVIIEHNLDVIKTADWIIDLGPEGGSKGGKIIATGTPEMVAENPQSF
FT                   TGQFLKQILSKSNEFLLQKCK"
FT   gene            482378..482959
FT                   /locus_tag="LPC_2958"
FT   CDS_pept        482378..482959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2958"
FT                   /product="LemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2958"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56859"
FT                   /protein_id="ABQ56859.1"
FT                   /translation="MKTFFIAILIIIALAFIWAISIYNTLIGLIEAINNNKKQIDIQLD
FT                   RRFKVFESLIEAVKKYMDYEKTTLKDVVALRNQAQAAKEAGDEQGRIAAENGISKIASN
FT                   LNLVFEQYPDLKASQNVMQLQEEIVNTENKLAYAKQAYNDGIERYNAKKKSFFESMVVA
FT                   MFSSALDKEFIYWGLPEEQIQAKENYTVKL"
FT   gene            482970..483989
FT                   /gene="htpX"
FT                   /locus_tag="LPC_2957"
FT   CDS_pept        482970..483989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="LPC_2957"
FT                   /product="heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2957"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56858"
FT                   /protein_id="ABQ56858.1"
FT                   /translation="MGIADYHATAGDWRAQLRRNEKKTRRVIAVFFLVYILVGLIVDAF
FT                   VLQGMYPHASLENIIRALITFKVVPIATLLMIAFAGISLLITYALYDRIMLLGTEYYQI
FT                   TPETARSLQEKQLYNVVEEMKVASGLQYMPKVYIIEASYMNAFASGYSEKSAMVAITRG
FT                   LMEKLDRAEMQAVMAHELSHIRHHDIKLTLMVAVLSNILLIVIDILFYSVIYKRDRRGD
FT                   NRLLMVIIILRYVLPIITVLLALFLSRTREYMADAGCVELMRDNEPMARALLKINQDHV
FT                   QNAEQYAKAYGDTPHEQVRQASYLFDPSHIDPVKSLNNAFSTHPSIEQRLEALGFKRK"
FT   gene            complement(484016..484789)
FT                   /locus_tag="LPC_2956"
FT   CDS_pept        complement(484016..484789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2956"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2956"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56857"
FT                   /protein_id="ABQ56857.1"
FT                   /translation="MGFKYQLIALYTLVRREVVRMFRISSQVFLPPVITTTLYFLIFGS
FT                   LIGPRIGDIEGVDYSQFIAPGLIMMSVIINSYGNVSNSLFSVRFQKSIEEMLISPMHNG
FT                   LLLLGYVIGGVLRGLIVAILVFVISTFFLPVELDHLPMTLLVVVLVAAIFSLAGFTNAM
FT                   VARNFDDIMLIPTFILTPLTYLGGVFYSINMLPPFWQKISLFNPILYMVNALRHTMIDQ
FT                   EEVSITLAMIIIFLMLIALTVGNMILLKKGVGFRE"
FT   gene            complement(484779..485693)
FT                   /locus_tag="LPC_2955"
FT   CDS_pept        complement(484779..485693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2955"
FT                   /product="ABC transporter, ATP binding component"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2955"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56856"
FT                   /protein_id="ABQ56856.1"
FT                   /translation="MHALEINQLSKTYSNGVEALKGIDLTVNTGDFFALLGANGAGKST
FT                   TIGLITSLVNKTSGNIKIYGFDLDAYPEKAKSCLGLVPQEVNLNIFENCEQILLNQAGY
FT                   YGISRKKALPRAEALLEQLGLWDKRRSIVRHLSGGMKRRLMIARALIHQPKLLILDEPT
FT                   AGVDIEIRHSMWDFLARTNAEGTTIILTTHYLEEAEQLCKNIAIIDKGQIIKNTSMKAL
FT                   LQTLRHQTFIFNTENPIDYLPDIHPFNVTPIDPTTFELRVDNNFSLNEVFAVLTKQGIK
FT                   IHSMRNKTNRLEELFMDLIKNGI"
FT   gene            complement(485924..486943)
FT                   /locus_tag="LPC_2954"
FT   CDS_pept        complement(485924..486943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2954"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2954"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56855"
FT                   /protein_id="ABQ56855.1"
FT                   /translation="MPISNAFLKLFSEFVDNYARNGTPSFYHWAKEQNHEVINKFFHEL
FT                   LEIIKSNTETFHDVSIIEHLNATVLLSAKTNPYLLDCWISFITKYNAETNSFTPIGASM
FT                   HIKIGPEGTPSERIIRELKESLVMTQQAFILAQKANATEVDSLKRQLERTKLENERLVT
FT                   QNQFLKDQVRAEKTFADINPQINNARHQLSALTELIQTLSEITNAKPKIETVSSLSIPA
FT                   VTENKSELLKENSCSVAPVSKEVTPAISQEPKKRPVPPPPNDMDSQALFPNIPPKEDVS
FT                   IKVTIPSMPKPNSTQPVAKNSGFFSGDGFLKELNAKIKERKERPKDEPHTTPVEKKNL"
FT   gene            complement(487069..487707)
FT                   /locus_tag="LPC_2953"
FT   CDS_pept        complement(487069..487707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2953"
FT                   /product="SM20-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2953"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56854"
FT                   /protein_id="ABQ56854.1"
FT                   /translation="MFNPDLIAHNICTQGFHIIDEFLEEAHYYSLRDMAYELKQQNLFR
FT                   NAKIGQNLQAQQNDKIRSDQIFWIDADSPYPPIQAYLKKLISLGNVLNQTMYLGLAEFE
FT                   THFAIYLPGTFYRKHIDQFESTKTRKISFVYYLNDTWQKEFGGELLLYNIEDELIQNIS
FT                   PLGNRFVCFDSQLPHEVHPTQRTRFSMTGWMKTRSTSVLADNKLTQITQ"
FT   gene            complement(487793..488500)
FT                   /locus_tag="LPC_2952"
FT   CDS_pept        complement(487793..488500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2952"
FT                   /product="zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2952"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56853"
FT                   /protein_id="ABQ56853.1"
FT                   /translation="MHIQIDGIPIEILRKPIKNLNLRIYPPDGLVKVSVPLKYSEQLIK
FT                   QQLQEKSEWIRAQCERIRARSFYREPSLQTGATIPFKGKNYLLIVEEHHGPSQILIKDE
FT                   LIYCYTKPDLTPQQKQNILERWYRKEMNLVIPRLIQQWEAIMKVKINQWGIKKMKTRWG
FT                   SCNPRAQRIWLNLNLIKKPLECLEYVLVHEMVHILEASHNKRFYALMAQFMPKWQEYQR
FT                   ILEGTPNANTFAR"
FT   gene            488553..488666
FT                   /locus_tag="LPC_2951"
FT   CDS_pept        488553..488666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2951"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2951"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56852"
FT                   /protein_id="ABQ56852.1"
FT                   /translation="MILIVEFIEEPQVQRPLILNKKFAGNNNIPFFSHCLF"
FT   gene            complement(488685..488966)
FT                   /locus_tag="LPC_2950"
FT   CDS_pept        complement(488685..488966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2950"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56851"
FT                   /protein_id="ABQ56851.1"
FT                   /translation="MKNKLAMSILLFLLPTAAAMANCDLTKFRWDCDLPVQVKPSPGAS
FT                   SLVYCGSSYGYITKQQYDILARYQRASVNMVLDINGEYIDSPCIGAER"
FT   gene            489115..489978
FT                   /locus_tag="LPC_2949"
FT   CDS_pept        489115..489978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2949"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2949"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56850"
FT                   /protein_id="ABQ56850.1"
FT                   /translation="MLSSTKEYLQALRDGKYLLFLQWPKFIAEYYGKNDKNQEADEMVS
FT                   LLIFEWLNNGFCLDDIKKFAILYAVHEMESRPLREGLSYALTTISIALFPCMVYLTNNL
FT                   QERYITSKKLSSKEVLQLMTMNNAYLEKQRFVEFLGQEQDKFFTWVKEADSSAVSKAFD
FT                   QIYSVTYLKYLIEDYLNLLESAHLPNDQLKSSRISLVIRLAKYLNEQTELTQDVHDEIA
FT                   VYVKKLWEMQPAEFEEEFLKKISPLPFIDNTVRILTGLSARFFSILQPPSPPLNINSDA
FT                   DKNPKV"
FT   gene            complement(490079..490546)
FT                   /locus_tag="LPC_2948"
FT   CDS_pept        complement(490079..490546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2948"
FT                   /product="methylated DNA protein cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2948"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56849"
FT                   /protein_id="ABQ56849.1"
FT                   /translation="MNGKMLLVSIFNTPVGNLEVTHDEHFIFNASFTDKSGTPAQNQLS
FT                   HLIASELKAYFDDPHHRFQLPLKPQGSLFQQKVWNTLLVIPVGRTVTYGELATKLQSSP
FT                   RAVGQACKRNPLALFVPCHRVVGKHDLGGYMGNPNAISYKKNLLAHEAKII"
FT   gene            complement(490550..490915)
FT                   /gene="rplS"
FT                   /locus_tag="LPC_2947"
FT   CDS_pept        complement(490550..490915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="LPC_2947"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2947"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56848"
FT                   /db_xref="GOA:A5IHJ8"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHJ8"
FT                   /protein_id="ABQ56848.1"
FT                   /translation="MTNIIDQINAEQMQGKEIPDFNPGDTVLVQVKVIEGNRERLQAFE
FT                   GVVIAKRNRGLNSAFTVRKISHNVGVERVFQTYSPIVDSITVKRRGDVRRAKLYYLRNL
FT                   AGRAARIKEKLSGKKGD"
FT   gene            complement(490942..491694)
FT                   /gene="trmD"
FT                   /locus_tag="LPC_2946"
FT   CDS_pept        complement(490942..491694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="LPC_2946"
FT                   /product="tRNA (guanine N1) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2946"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56847"
FT                   /protein_id="ABQ56847.1"
FT                   /translation="MALHLGVITLLPEIIQGIHYGVTGRAIEQGLVKIDCWNPRDWSSR
FT                   PYKQVDDKPYGGGPGMVMMYEPLHAAIKHAHSEMKENCKTIYLSPQGKVVRQNDLKQIA
FT                   TQKQSLLFVAGRYEGIDERIINHHIDEEWSLGDFVLSGGELAAMVFIDAIIRLIPGSLG
FT                   HLGSAEQDSFMNGLLDCPHYTRPATINGLGVPDVLLGGNHKEIERWRRKQSLGKTWLKR
FT                   PDLLEKIQLSETDKQLLAEFKCEHGDSC"
FT   gene            complement(491694..492203)
FT                   /gene="rimM"
FT                   /locus_tag="LPC_2945"
FT   CDS_pept        complement(491694..492203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="LPC_2945"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2945"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56846"
FT                   /db_xref="GOA:A5IHJ6"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHJ6"
FT                   /protein_id="ABQ56846.1"
FT                   /translation="MNNKTNWVIIGRFGRPHGIKGFVTVHSFTDPADNILRYNDWHVFL
FT                   NKQWQPLKLLTIEVRSKAIIAQIEGYPERELVSALTNLDIGVQESQLAALAPGEYYWYQ
FT                   LIGMSVINSKGDLFGKVVEIMPTGSNDVLVVEGEKRHLIPYLPGQFVINIDESQQVITV
FT                   DWDMNF"
FT   gene            complement(492209..492469)
FT                   /gene="rpsP"
FT                   /locus_tag="LPC_2944"
FT   CDS_pept        complement(492209..492469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="LPC_2944"
FT                   /product="30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2944"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56845"
FT                   /db_xref="GOA:A5IHJ5"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHJ5"
FT                   /protein_id="ABQ56845.1"
FT                   /translation="MVVIRLSRAGAKKRPFYHMVVTDSRKRRDGNYIERIGYFNPVARG
FT                   QEVKLHIDMDKMTHWQKVGAQLSDRVSALLKEHSKKSETAA"
FT   gene            complement(492556..493932)
FT                   /gene="ffh"
FT                   /locus_tag="LPC_2943"
FT   CDS_pept        complement(492556..493932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="LPC_2943"
FT                   /product="signal recognition particle protein Ffh"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2943"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56844"
FT                   /protein_id="ABQ56844.1"
FT                   /translation="MFENLTERLTRTFKNLRGQGRLTEDNIQHALREVRLSLIEADVAL
FT                   PVIKEFIEQVKQKSLGQEVLTSLNPDQAFIKIVHDELIHVMGDERVELDYKTQPPAVFL
FT                   MAGLQGSGKTTSTAKLARYLKETENKKIMMASVDVYRPAAIHQLKVLAEQIDVAFFDSD
FT                   PNEQPIKIAQKALESARKQYVDVLILDTAGRLHVDEDMMSEIKSLHKAVNPIETLFVVD
FT                   SMTGQDAANTAKAFHEALPLTGVILTKTDGDARGGAALSVKQITGKPIKFIGSGEKIEA
FT                   VEPFHPERIASRILGMGDILTLIEEVERKADKQASEKLAKKLKKGKGFDLEDFKQQLLQ
FT                   MNNMGGISGMMSKLPGVGQLPKQAMQQVNDKAMAQTIAIINSMTPKERRIPKIIVGSRK
FT                   KRIALGSGTQIQDVNRLLKQFEQMQKMMKKFTKPGGMQKMMRGIGGMAGLKGMFPDDLK
FT                   "
FT   gene            complement(494190..494855)
FT                   /locus_tag="LPC_2942"
FT   CDS_pept        complement(494190..494855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2942"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2942"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56843"
FT                   /protein_id="ABQ56843.1"
FT                   /translation="MPKAFTHLCKKVNLSLYNDTLTVYPKSSALPKPIQIRSELDLLMV
FT                   LLFSQMDCNSAQVDQFFMMRSNELGVYRFIHRDDSDHDLYHQDEFSMDDNHYHAQFDKA
FT                   IDESKLENILGILEKHSLISSEEHVSFIEAYHKANTLPEDMPKLETTLPSPLPVSSPSV
FT                   HTTKKQPVVKQKEVDPPTTFAGLRVGFFLTSTKTTTKPLSRSHDDDEKKIGTNGHGFH"
FT   gene            495128..496636
FT                   /locus_tag="LPC_2941"
FT   CDS_pept        495128..496636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2941"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2941"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56842"
FT                   /protein_id="ABQ56842.1"
FT                   /translation="MIYVLICIMLVCGLVVYQLMPKLLSYSTSLISKKQDTSELTHDGI
FT                   TNVLTQLGHPKFEGVCYGFTLNWALAVAQGKESFFYRQLHHLRTHQFGLPKTLQQIKEK
FT                   KERNQSLSNDEMVIDTLPQLGKKICVAQDPLQYKEKYRKLVWQPDINSILKAINADSSV
FT                   AKHIFYKTHSFLNQDEATEYLELLKRTGIREDVAVIISTADHAMGFKLAGNVWRFININ
FT                   DLYQQDKNKPYFEFSSRNLVKELYRVCAENLQGSRLTVNTDFVSVNPEEKLSRALQNVF
FT                   PVFPVRTKTSYPERLAFFSMAATQGDMNSVKKCIHSGWSIFSRQRLSDDSPILTAIYLG
FT                   RRDVVRAMLSTSRHRVNQKRKSDSSTLLHIACRYGGSGIVEDLLNIRGIKIDPQDNKGR
FT                   TPLMYACKKSVVTEDKKLFNLLFAKGASLSIKDNDGLTALDHALKNEHTLAIQMIEERL
FT                   EKEACAKENSTSRRFKFSETKGTLFQRGVKTISYQSQQPGFGMK"
FT   gene            496973..498376
FT                   /gene="gadC"
FT                   /locus_tag="LPC_2940"
FT   CDS_pept        496973..498376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gadC"
FT                   /locus_tag="LPC_2940"
FT                   /product="Glutamate/gamma-aminobutyrate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2940"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56841"
FT                   /protein_id="ABQ56841.1"
FT                   /translation="MSNKKHSLTIFSLTMITVGSVDSIRNLPATALFGSQLIFYFILGA
FT                   LFFLIPTALVSAELASGWARQGGVYIWVKEAFGKKSGFLAIWLQWIENVIWYPTILSFV
FT                   AGTIGYLINPSLTTNPYFLWAVIVSCFWGATIVNLRGMKSSAMFSNICSLAGLLLPMSL
FT                   IIGLGAVWIAQGNPLQISFDMPSIVPHLSDKGMWVSLTAIILSFCGIEIATVHANDVKD
FT                   PQHAFPKALVYSVGIILSTLILGSLAIAVVLPQKDINLVAGIMQAFSAFFLKYHMDWMM
FT                   PVVAVMLVLGGLGGVSNWIIAPTKGLLVAAEEGNLPEVFQRTNGKGAPAMMLYTQATIV
FT                   TVLSALFLFMPSVNGSYWLLTALAAQLYMLMYLIMFVAAIKLRISQPYHPRPFKIPGGM
FT                   AGMLFVAGIGIIGVVTTLAVSFIPPEGINVGSATRYELTLIIGLLLMCAPPFITSWLQA
FT                   KEADLEPAV"
FT   gene            498432..498956
FT                   /locus_tag="LPC_2939"
FT   CDS_pept        498432..498956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2939"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2939"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56840"
FT                   /protein_id="ABQ56840.1"
FT                   /translation="MGYIDELLEELSARLPELEWKINGLSSSISIHNLPKGIFSSVIEF
FT                   NGPACIKEIRDDIHALQKHKDESIACFLAERIQKKINVLVILCQMDKKNNKPESKISFD
FT                   LTTLSTRQQWIKTMEENICALEEQHQAMRKTLEQMKSCSNPATILHLQTELGNVEKRLT
FT                   LAKETLNRAIS"
FT   gene            499160..499501
FT                   /locus_tag="LPC_2938"
FT   CDS_pept        499160..499501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2938"
FT                   /product="Carboxymuconolactone decarboxylase family"
FT                   /note="pfam02627"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2938"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56839"
FT                   /protein_id="ABQ56839.1"
FT                   /translation="MSDKFSHITKDITTQLAKFRKEMPELMTGFSSLAQAATKDGALDK
FT                   KTKELIAMALAVAKQCPGCIGFHSQTLVKLQATREELLETLGMAVYMGGGPSLMYAAEA
FT                   LEAFEEFSK"
FT   gene            complement(499715..500158)
FT                   /locus_tag="LPC_2937"
FT   CDS_pept        complement(499715..500158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2937"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2937"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56838"
FT                   /protein_id="ABQ56838.1"
FT                   /translation="MRLLFISLILASGYLQADTINNYMNIANNIPQMEMKADPQAQAWA
FT                   RSARHVLTITSESIAETLIQANEAAKTQGKPIFCLPQGVQLNSFVMNELIQQTYKEISS
FT                   QQSDKDKMTVSQVALLGLSKKYPCEPSPQEKQIQHVASLLSPQ"
FT   gene            complement(500177..500725)
FT                   /gene="lidJ"
FT                   /locus_tag="LPC_2936"
FT   CDS_pept        complement(500177..500725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lidJ"
FT                   /locus_tag="LPC_2936"
FT                   /product="inner (transmembrane) protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2936"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56837"
FT                   /protein_id="ABQ56837.1"
FT                   /translation="MNKQMQWHLFGNTSGLLIICCLLILAFLDQFIFYELPCPICILQR
FT                   ICFVAVGLCFVMNLMLGIRASHYGLMLLASLLGLSISVRQMYIHLTPGDPGYGGLFLGL
FT                   HLYTWSAIIFLVIILLIAGALILDKGFMPDYKVRSKSAKVMIWVFFILILANGISTFLE
FT                   CGPHECPDNPSKYYLLNNN"
FT   gene            complement(501142..501345)
FT                   /locus_tag="LPC_2935"
FT   CDS_pept        complement(501142..501345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2935"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56836"
FT                   /protein_id="ABQ56836.1"
FT                   /translation="MFTKIFIIFVMILIVASLASGLFYLVKDTDKSKRTVKALTVRIAI
FT                   SLSLFVFLFIAFKLGLIQPHGI"
FT   gene            501413..502141
FT                   /locus_tag="LPC_2934"
FT   CDS_pept        501413..502141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2934"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG3346"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2934"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56835"
FT                   /protein_id="ABQ56835.1"
FT                   /translation="MPSLTCFNFRFTSNWPMLILTAVCFFLFISLGFWQIHRADEKTEM
FT                   ITAQQALAKKEPIIWQPGQKLPEQYQRISIEGAFLPKLFLLDNQHYQHQFGYDVVSPML
FT                   LDDGSIVMVDRGWVSGDITRRTFPNVQTPNGKFKLFGMVYFPSKKQWILGPSFEEKENK
FT                   VTLLELIDEEILKQLLQKKVYPFIIRLDKNEPFGFVREWEIVSMPPQRHFAYAIQWFAM
FT                   ALVILIIFVIFNLKKNEKTI"
FT   gene            502125..502670
FT                   /locus_tag="LPC_2933"
FT   CDS_pept        502125..502670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2933"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2933"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56834"
FT                   /protein_id="ABQ56834.1"
FT                   /translation="MKKPYKYMTLLLLVVIFAAPGITAYLFYKNPSWLGTSKVNKGILL
FT                   SPPIALKPLDSSAKWRIIYWNPNGCDKTCLKQLNMLGRVRLSFGRKLYQVDEWLLLSNK
FT                   DSLIAEELKPILKEQDIHVAALSLTEMSKLSTLYPEAKIFIANPDNYLILSYQPGCNPG
FT                   DIYKDLKLLLNTTEIKSG"
FT   gene            502675..503682
FT                   /locus_tag="LPC_2932"
FT   CDS_pept        502675..503682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2932"
FT                   /product="cytochrome c oxidase assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2932"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56833"
FT                   /protein_id="ABQ56833.1"
FT                   /translation="MSNSSIRLAATLAVFLAFFVVMLGAYTRLTDAGLGCPDWPGCYGR
FT                   MVLPGADKGLQEAQSQYPDLPIESKKAWTEMAHRYAAGTLALLIFFIAFQVWFKRRQDQ
FT                   DLPWHLPLALFMLVVFQAALGMWTVTLKLLPVVVMGHLLGGMLIVACLCRFRLQIAQLK
FT                   GQNLPEWRPWLRLGIVIILLQIALGGWVSANYAGISCIGFPLCNGTWFPELHFAKGFNL
FT                   FSTIGANYQGGVLESEVRASIQFIHRIGAILTATYLLALSLIIVFKTHSIYLRATAVIM
FT                   AMLVLLQFTLGIMNVIHLLPLKVAVAHNGVAALLLAVAFCSLHFTQDREVSHAY"
FT   gene            503672..504556
FT                   /locus_tag="LPC_2931"
FT   CDS_pept        503672..504556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2931"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2931"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56832"
FT                   /db_xref="GOA:A5IHI2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHI2"
FT                   /protein_id="ABQ56832.1"
FT                   /translation="MRTEYAARLPVDWRDYVELCKPRVVLLMLLTVIVGMYLAAPGWVS
FT                   LRLIAFTLLGIGLCAGSAAAINHLVDRHIDSIMARTKKRPVAYGRVSVKQALWFAVIIG
FT                   LMGLSLLILFVNQLTALLTFVTLIGYAGVYTGYLKRATSQNIVIGGLAGAAPPLLGWTA
FT                   VTDQLDPQALLLVLIIFTWTPPHFWALAIYRYKEYQDAEIPMLPVTHGIQFTKLNIYLY
FT                   TVLLLVVSLLPFVVSMSGWIYLLGALVLGIRFLVWAHKLYFTDKPVVAMQTFRFSILYL
FT                   MLLFVFLLVDHYF"
FT   gene            504566..505207
FT                   /locus_tag="LPC_2930"
FT   CDS_pept        504566..505207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2930"
FT                   /product="hypothetical, SCO1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2930"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56831"
FT                   /protein_id="ABQ56831.1"
FT                   /translation="MNIKIKGGAVTITVLALVSLLAGIYISQNFHFKKKINVADFHGTY
FT                   LENPRTVNNFSLTGTDQKAFNNSSLQGRWTLVFFGFTNCGYLCPTTMAELGKMYRILEK
FT                   KGVKNLPQVVMISIDPQRDSLDKLGSYVTSFHKSFYGARGEEDSIKSMTHEMGIAYAKI
FT                   NNKESSEPENYDIQHSGAVMLFNPQGELNAFFTTPHHADLLAKDYVLLVS"
FT   gene            505573..506481
FT                   /gene="rimK"
FT                   /locus_tag="LPC_2929"
FT   CDS_pept        505573..506481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimK"
FT                   /locus_tag="LPC_2929"
FT                   /product="glutathione synthase, ribosomal protein S6
FT                   modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2929"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56830"
FT                   /db_xref="GOA:A5IHI0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHI0"
FT                   /protein_id="ABQ56830.1"
FT                   /translation="MKIAILATNPHLYSHKRLKAEAEAAGHEVKIINPLYCYMNVAASN
FT                   PKVHYRGGAPLPHFDAVIPRIGASITYYGTAVLRHMETMGMYTLNESIAISRSRDKFRS
FT                   LQLLARKGIPMPLTSFAQSPDDTEDLIHMVGGAPLVIKLLEGTQGKGVILADSHQSAVS
FT                   IINAFKEMHANILVQEFIEESRGTDIRCFVIGEKVVAAVKRQAKDGEFRANVHQGGKAV
FT                   KVKLSPQERAIAVSAAKTMGLRVAGVDLIRSNHGPLVLEINSSPGLEGIEKATNINLAG
FT                   KIIEYIEKKAKPISSNHRFHG"
FT   gene            complement(506485..506730)
FT                   /locus_tag="LPC_2928"
FT   CDS_pept        complement(506485..506730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2928"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2928"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56829"
FT                   /protein_id="ABQ56829.1"
FT                   /translation="MLNKRFSERLNKELDNIGVPEATAERIEILSKLIKIPKFKAEALL
FT                   NGITIPDEAVLKTLAQELEVNVDWLIGKSDSKSGAH"
FT   gene            507048..508538
FT                   /gene="zwf"
FT                   /locus_tag="LPC_2927"
FT   CDS_pept        507048..508538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="LPC_2927"
FT                   /product="glucose-6-phosphate-1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2927"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56828"
FT                   /protein_id="ABQ56828.1"
FT                   /translation="MLLKAESKYPCDLILFGTLGDLSCRKLLPALYQLELANLLHEKTR
FT                   IIGCAREELDFSAYADLIKNKIQQFLFDEIDEAVWLRFIKKLAYCKLDLNQSDDYQKLT
FT                   DYVNPSERVVISYLAIPPSLYSQTCRSLARLNLTQKPSRVVLEKPIGHDLPSSVATNEQ
FT                   VACFFSEDQIYRIDHYLGKETVLNLLVLRFANSIFSTNWDNRVIDRVEISVAEEIGVEG
FT                   RWEYYDKSGQVRDMLQNHLLQILSLVAMEPPLSLSAESIRSEKLKVLKSLRFINKSNAH
FT                   DHTVRAQYVANNLANGKKIPGYLEEVGANQASTTETFVAIKAYVDNWRWSGVPFYMLTG
FT                   KRLPKKQSEVVIYFKPQPYNIFHPLNEELYPNQLIIRLQPDEGVEVRIMNKIPGLGERM
FT                   MLHDSKLDLNFHHSFKTQRIADAYERLLLEVMLGNQYLFVSREEIEQAWQWIDSIVSAW
FT                   EEDNIPLYTYPACTWGPKEVIRLFNGQAHVWGDHNAVS"
FT   gene            508525..509238
FT                   /gene="pgl"
FT                   /locus_tag="LPC_2926"
FT   CDS_pept        508525..509238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="LPC_2926"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2926"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56827"
FT                   /protein_id="ABQ56827.1"
FT                   /translation="MQFHSFRDAKQLIHDMVEKLRTILSDAIKRRGQAFLVVSGGRTPI
FT                   DLFKELALADLPWEKVVITLADERCVNLFDPHRNELLVREFLLQEKAKKAKFISLFDEK
FT                   EEPLGHLNEVSSQIDSLPTFDAVVLGMGEDGHTASLFPCSDELSAGLDDKANAVLIVKP
FT                   RTASFQRVSLSKRRLLNSSTIFLHLVGQRKRVVLEQAMATNNPEILPICAILNAPDANV
FT                   QVMYAPSDEEKECIL"
FT   gene            509226..511064
FT                   /gene="edd"
FT                   /locus_tag="LPC_2925"
FT   CDS_pept        509226..511064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="edd"
FT                   /locus_tag="LPC_2925"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2925"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56826"
FT                   /protein_id="ABQ56826.1"
FT                   /translation="MHPVINQVTENIQNRSASRRAAYLNQIDKARTKGPQRSILHCGNL
FT                   AHGFAACAKQDKAILRGNAKANIAIISAYNDMLSAHQPYAVFPDLIKEAISAAGGVAQF
FT                   AGGVPAMCDGITQGQPGMELSLLSRDVIALSTAVALSHNMFDGGLLLGICDKIVPGLLM
FT                   AALAFGHLPFIFVPAGPMPSGISNQEKARIRQLYAAGQVDKNALLDVEAASYHTAGTCT
FT                   FYGTANSNQLVIELMGLQLPGSSFVNPNTPLRNELTKAAACQILSLTDLNSDYMPIGQM
FT                   LDVKNIVNGIIGLLASGGSTNHTMHLVAIAAMAGYWVNWDDFAQLSAIIPLIARIYPNG
FT                   QADINHFQRAGGMAYFVKTLLEADLLHPDVNTVVGFGLDKYTQQPQLIDNRVVWVNGPD
FT                   SSSNNDVLTSAADPFKPQGGLQVLSGNLGRAIIKTSSLYDEHYVIEAPAVVCSSQEEFE
FT                   YLFNQGLLNKNCVVVVRFQGPKACGMPELHQLTPKLGVLMDKGFHVALVTDGRMSGASG
FT                   KVPAAIHVTPEAVDGGGIAKIETGDMILIDCERGILQLLVSDEELAGRSPVAIEGYSSV
FT                   LGMGRELFGNLRLHFTGAEQGACSLFKGNEFFYDAS"
FT   gene            511051..512046
FT                   /gene="glk"
FT                   /locus_tag="LPC_2924"
FT   CDS_pept        511051..512046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="LPC_2924"
FT                   /product="glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2924"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56825"
FT                   /protein_id="ABQ56825.1"
FT                   /translation="MMPHDLAQYAIVADIGGTFARFSRVNLVNLQMDKIEISPCAEFIS
FT                   LESALLTYKNRHSLQEIKHIAIAIACPVIDDLVSMTNCHWQFSITELKQRLGLEVLEVM
FT                   NDFTAIAMSLPVLSTQDLVQIGNGYLDASKVRVVLGAGTGLGVAYLIPHQHHYSAFAGE
FT                   GGHADWGAKTEQEWFIYRYLKSKYSHVSYERLLSGQGLENLYQALAAYHSKKVEFLSAA
FT                   QIISLALNQECFIAHKAVAQFFSSLGSFAGDLALTYGAFGGVYIAGGIMPRLLSLVHQS
FT                   DFRIQFEDKGRFSDFNALIPTYVIAAAQPGILGASVSLKQILTGASHVLF"
FT   gene            512033..512695
FT                   /gene="eda"
FT                   /locus_tag="LPC_2923"
FT   CDS_pept        512033..512695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eda"
FT                   /locus_tag="LPC_2923"
FT                   /product="multifunctional: 2-keto-3-deoxygluconate
FT                   6-phosphate aldolase/(4-hydroxy-2-oxoglutarate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2923"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56824"
FT                   /protein_id="ABQ56824.1"
FT                   /translation="MSFSEWKTQPGAVFAASPVIPVIVIKELEDVLPLAEALFAGGIHV
FT                   LEVTLRTPVAIKALELLINTFPDELIGAGTVITPGQLHDVAAAGARFAISPGQTRELLI
FT                   AGQKSEIPLIPGVASVSELMEGLGMGYNHFKFFPAAAAGGIPMLQAISGVFPQVKFCPT
FT                   GGINSKNYEEYLCLPNVVCVGGSWIVPEEAIKNHNWSLITELCMAVSSQKRELCSQN"
FT   gene            512809..514230
FT                   /gene="ywtG"
FT                   /locus_tag="LPC_2922"
FT   CDS_pept        512809..514230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywtG"
FT                   /locus_tag="LPC_2922"
FT                   /product="D-xylose (galactose, arabinose)-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2922"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56823"
FT                   /protein_id="ABQ56823.1"
FT                   /translation="MAWIVAIIGSIAGFLFGYDEGIIAGSLGLVKNHFNLNATHIGVMA
FT                   SALPFGALFGSLLIGAFMASKCVKRFGRRSLLSFAGFLFFVGALGAGFAETISVLILSR
FT                   LILGLAIGMASVLTPLYLAETAAMQSRGAVVAIYQLALTVGIVCSYSVNYLLIEQQAWR
FT                   AMFASSAIPALLLTLGILFMPESPRWLCSVGRHDAAANSLRKLRGKQSVEQELKDIEAT
FT                   LANEPKQGNWLLLFQKPLLPVLMLGTILFCLQQLSGINVVIYFAPEIFKNLGLGSTTGQ
FT                   ILATMGIGLVNLLVTIIAILYVDKLGRRKLLLLGFAGTSLSLFALSLFSLNHVAWLSYL
FT                   SVICLMVYIFSFAISVGPIPHIAMAEIFPLHVRGAGMGMSSMSNWSFNTIVIFSFPVLH
FT                   QMFGIEVTFVLYAVICFLGFIYAYIYMPETRNISLEQIETYIMSGKPLRFLGREDEEVN
FT                   AVSTKSESSLLASTN"
FT   gene            complement(514320..515603)
FT                   /locus_tag="LPC_2921"
FT   CDS_pept        complement(514320..515603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2921"
FT                   /product="glucoamylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2921"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56822"
FT                   /protein_id="ABQ56822.1"
FT                   /translation="MIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVASPSQYNPN
FT                   YYYDWIRDSAIAMGLVETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQDILGEPK
FT                   FYINGNPFDGEWGRPQNDGPALRASVLIRFAQQLLDHNEIDYVKSHLYNNTMDPQSMGT
FT                   IKMDLEYIAHHWQDANFDLWEEVYGHHFFTAMAQQKALTDGAILARQLHDRQAAVFYEM
FT                   QANLINSRLQQHLDHQNKIIQATLLPHPGPQKTLELDSSVMLGILTNPQKEGVFAPHHT
FT                   FVRNTAKALHEQFNLMFPINKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEY
FT                   YFTMAHNLSLNSSNKLHIQNYLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSLT
FT                   WSYVSVLRAIHLREQLENRIKTMGWNTY"
FT   gene            complement(515779..516030)
FT                   /gene="yozG"
FT                   /locus_tag="LPC_2920"
FT   CDS_pept        complement(515779..516030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yozG"
FT                   /locus_tag="LPC_2920"
FT                   /product="transcriptional regulator, cro family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2920"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56821"
FT                   /protein_id="ABQ56821.1"
FT                   /translation="MSIIVNLDVMMAKRKCRLRDLAEAIGITEANLSILKNGKAKAIRF
FT                   ATLEAICAYLHCQPGDLLEYQSTEDITLSKTGLNLRKL"
FT   gene            complement(516117..516656)
FT                   /locus_tag="LPC_2919"
FT   CDS_pept        complement(516117..516656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2919"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2919"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56820"
FT                   /protein_id="ABQ56820.1"
FT                   /translation="MKKIKSVSHLLFLLFKTLAYGLPLVTTYFILFHFESMLNWGGWHS
FT                   LLSTPVKDPSHFSLLHRFIILLIEALPLSINVLICHQLAKLFRLYEHGYLFEEENIRLI
FT                   KNISIYLISGELIQLLYQPLITAALTFTNPSGQRIASITLGTANLSTLITAFIILIASW
FT                   IIKEAHKLKTDALLTI"
FT   gene            complement(516784..517779)
FT                   /gene="hemH"
FT                   /locus_tag="LPC_2918"
FT   CDS_pept        complement(516784..517779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="LPC_2918"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2918"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56819"
FT                   /db_xref="GOA:A5IHG9"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHG9"
FT                   /protein_id="ABQ56819.1"
FT                   /translation="MRRGLLLLNLGTPDNADIRAVKLYLREFLTDKRVIDLPTIPRYIL
FT                   VYCLILPFRSPKSAQAYQSIWTEKGSPLLYHSQNLVTKLQSALKDEYKIALGMRYGTPS
FT                   ITTALAELKDCHSLTILPLFPQYSSAATGSAIEKTLSYLANQEIIPSIKIIRDFYQRPE
FT                   YIQAQAKIMKPYIKDNFHVLFSYHGIPERHIHKSGCDTLCPQTCTPIYDKNQACYRAQC
FT                   YQTSLLLAKELQLGTHQYTTAFQSRLGKTPWIKPYTDEIFAELISKGIKNIVVSCPSFV
FT                   ADCLETLEEIGIRAKEQWEKLGGEQFILTPCMNDHPEWIKAIHSIVNEQI"
FT   gene            complement(517890..518123)
FT                   /gene="cspD"
FT                   /locus_tag="LPC_2917"
FT   CDS_pept        complement(517890..518123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="LPC_2917"
FT                   /product="cold shock protein CspD"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2917"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56818"
FT                   /protein_id="ABQ56818.1"
FT                   /translation="MARGEVKWFNNAKGWGFIIPEGGGEDIFVHFSSIHGTGYKTLAPG
FT                   QAVTYDVVNGERGLHASNVVALSENAEQEEIA"
FT   gene            518360..518791
FT                   /locus_tag="LPC_2916"
FT   CDS_pept        518360..518791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2916"
FT                   /product="diadenosine tetraphosphate (Ap4A) hydrolase,
FT                   histidine triad family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2916"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56817"
FT                   /protein_id="ABQ56817.1"
FT                   /translation="MFCIDDRIKSSSFILGEWPLSTVLLKNDASYPWFILVPRKMDIQE
FT                   IYQLEKSERFLLIEEINQLSLLVRDYFKPDKLNIGALGNIVPQLHIHIVIRSKNDPLWP
FT                   QGIWQSSMPSIPYPESELKSLLPTLGDLVRAYDKPQSLC"
FT   gene            complement(519005..519433)
FT                   /locus_tag="LPC_2915"
FT   CDS_pept        complement(519005..519433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2915"
FT                   /product="glyoxylase domain hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2915"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56816"
FT                   /protein_id="ABQ56816.1"
FT                   /translation="MFIIVIYNSSNGESIFKFQQGALMIKKIAFTMYPVQNMDRARQFY
FT                   EKTLGIKVGKISAEGAWVEYDLPQGGCFAITTLAQGVIPSANSGGSVAFEVDNLDELVF
FT                   QLKSKGVQFKIDLFASPVCRMAIAVDSEGNAFTLHQLT"
FT   gene            519460..520803
FT                   /gene="oprM"
FT                   /locus_tag="LPC_2914"
FT   CDS_pept        519460..520803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprM"
FT                   /locus_tag="LPC_2914"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2914"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56815"
FT                   /protein_id="ABQ56815.1"
FT                   /translation="MLKKLMFLLLLGAGLLSCGQSTDQQISNIITPKQFPSSPRDYRPV
FT                   QELPYLAWWKQFQDPELDRLIDTGLKTNMDIHIAMANLQQAQGELQQVKLSWIPNVQIL
FT                   GGYSTNPALGVPGGFYGIWPSYILNIMQLYTQQKRAQYQVQYHQAAIDGLRLTLIGQVA
FT                   AAYFTLIAQLEQLKLLYKLDRDLKSLIALSRKEINIGLKNDIDLAQLQSNERLIAAQIK
FT                   PIKHNIVVSQNALRYLINENPGLIKSKNNFAQLDFTRFKPGSLPASVLSNRPDMKMAEY
FT                   SLKAARAGIFVAYSDFFPVMQLDDFIGEAHLPDSTFEQATDAYVNWTINPNTLGKISVS
FT                   KGVYNAKLAEYVKTIRLILKEVDNAFSANKRMREQFLSYRHAQEDYQHKYKLQNGLLKS
FT                   GLMSYKELLESKVYLDTLALSTNQAKLELAMSLVMLYQDLAGGYACSD"
FT   gene            520943..521980
FT                   /locus_tag="LPC_2913"
FT   CDS_pept        520943..521980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2913"
FT                   /product="multidrug resistance efflux pump PmrA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2913"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56814"
FT                   /protein_id="ABQ56814.1"
FT                   /translation="MKKLMEYGGKIKEYLLRLKPKRWLTLTNVIIFIGFLTAIIYVFSY
FT                   LIPFTDNAFVVNNVRPVAALTSGYITELYVKNGDAVRKGQKLFTVFKKPYEYTVEQLSA
FT                   DLAGAQAKLAVLKATYERDLKLSENEQKIYKKLAQDDQKYLKGYAIKSVSLITLQNSQQ
FT                   ETKAAKDKWQASLKQLEIDQHQITVQENEIKSIQARLKNAKVNLDLTDVYAQGNGVIQN
FT                   LFFTIGTPVNINQPLFSLVDQDNIYIQANFNETDLRDVRKGSKVLIFPRMYLGRKIFHG
FT                   VIDSDYWSANRQLVDDRTQLQNVINENQWILLPQRLPVIIKVTDPDPKYPLRVGASAYV
FT                   YVEVY"
FT   gene            521958..522890
FT                   /locus_tag="LPC_2912"
FT   CDS_pept        521958..522890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2912"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2912"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56813"
FT                   /protein_id="ABQ56813.1"
FT                   /translation="MSMSKFIEWIDKVDPYAVQRIALYKSLFIATVMAYVYWVFRPTNF
FT                   TAFFSPFLLVRFYESPSLTSFKEKEHFLIFIGVVVVLLSTSFYLVYPFRVVFFFFSIIA
FT                   LASVYFYVLKNYLPLRNVTMLIIASGATILSTEPPANWQIVYDIVGSSALSMIAIFICL
FT                   RFFPNQYLSVWKRALAKFIQSLEQDIEGSFSHRGPRFMQEEMTHLGMLRQYRRLIPKKY
FT                   MIYTQRISINIRNIQFSLDNLYYEAKNEAFWHGVKENLYTLRCAIKTNTSCDTPKMSIV
FT                   PESKLQQYVMRCLQQAFSHWNRLCMILQH"
FT   gene            522869..523756
FT                   /locus_tag="LPC_2911"
FT   CDS_pept        522869..523756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2911"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2911"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56812"
FT                   /protein_id="ABQ56812.1"
FT                   /translation="MHDTSALKKKLDYARFIHLVIMFMVAMLIFLFSTFPEKWWVLITV
FT                   LSVSAGIEPGLIIRRAKHRIGGTLLALIILIPLLYLLQLNYRLISILFVLAIVGLSVAT
FT                   LNTRRYDISVFFITLVVFFLMAQTEEATSPRGPFEMVLNRGICTLFGVFIVLAGDYFLF
FT                   QAYRYSHRLYFFHQVMVYDFLNDIVRKIDESNTEKINTLLFVEKLRGQFTEHYLPISIS
FT                   SENLKLDFKTSEHTKKRIDIFQETIWEIRRLVFALCISEFVLHSSTASEQHLQRFKLLM
FT                   NKARTHFIQFEGRY"
FT   gene            523778..524158
FT                   /locus_tag="LPC_2910"
FT   CDS_pept        523778..524158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2910"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56811"
FT                   /protein_id="ABQ56811.1"
FT                   /translation="MPHPDYSVYNEKCPSHNVLEGISDKWSILVISLLSQKIYRFGELK
FT                   REIGGISPKMLTQTLLKLERYGFVQRQSYPVLPMKVEYSLTRLGKELSAILVLLTRWTE
FT                   TNMDKIIKAEKTFCEQKLGCQA"
FT   gene            complement(524160..524591)
FT                   /locus_tag="LPC_2909"
FT   CDS_pept        complement(524160..524591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2909"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2909"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56810"
FT                   /protein_id="ABQ56810.1"
FT                   /translation="MHPDLKDLLDYRNHKIITRYNMDYPTAAMQAEEALHELMKFIWLC
FT                   HKHKADKLLYPDDKNLDFSCVIHAEMADIDKMWHTFLLFTRDYHEFCDTCLNGIFFHHD
FT                   PLIGENIPVSEEDYALELTRYLTYIHDHLGSETLIKWFQ"
FT   gene            complement(524662..524751)
FT                   /locus_tag="LPC_2908"
FT   CDS_pept        complement(524662..524751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2908"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2908"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56809"
FT                   /protein_id="ABQ56809.1"
FT                   /translation="MKEKLIKKIVQKKLLKRNRGWCGPGTCIG"
FT   gene            524853..525464
FT                   /locus_tag="LPC_2907"
FT   CDS_pept        524853..525464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2907"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2907"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56808"
FT                   /protein_id="ABQ56808.1"
FT                   /translation="MNKRNWTAYYNSTKQNTLPRKSLLKAIANFEKEKINLSKSAIDLG
FT                   CGAGIDVMELLRCGWSVIAIDSQLSAIDSMLSSAQELTCANKLKTIVSSFEALDSLPKV
FT                   NLINASFSLPFLKPVYFYKFWNIILKGLKPDGRFSGSFFGFNDFWNTRTDMTFLNREMI
FT                   CHLFSQFKIEYFQEEEKDEMDALGYYKHWHKFFIVAKKIA"
FT   gene            complement(525619..526419)
FT                   /locus_tag="LPC_2906"
FT   CDS_pept        complement(525619..526419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2906"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2906"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56807"
FT                   /protein_id="ABQ56807.1"
FT                   /translation="MGRSEMKIASAKLRELMKAVSEGHYETVNTILDKDPELVNQYVPP
FT                   TYDSPLARVLNKKYIDYKMLDILVKHHVDFDYPINHHKETPIELACKNQDLQLFKYLVQ
FT                   HNAPISEHAPHFLLVNSTNIKYLTEDKIKNTCEIIKLMGGLEAVSSKCNAEGNRFEELA
FT                   RKSQLINRFGGVVRYDYMQLLQSVYPIVDREVDTPTINASTEKLTNLLNKIRDQHISKE
FT                   GYDQQNLKDSISLFFMTGGEIPPSRKVPESRFEEAGIDTPKNTL"
FT   gene            526690..528690
FT                   /locus_tag="LPC_2905"
FT   CDS_pept        526690..528690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2905"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2905"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56806"
FT                   /protein_id="ABQ56806.1"
FT                   /translation="MQNLDEILKKLGEDLKKTSKETANKLSVLSRKVAEDVVKVSDETV
FT                   QKINEVTKKLSVDTTVSTIDTQRILDDFMKNIRFSRFKQIWQAIEETPKSKHILLKSLF
FT                   LKGLLTHNKPLLEEIIRQIELIPYSSDLEMLGAFSQDKAHPLSPELLEFVQEMLANESE
FT                   KVLLTILMNAFQSIPELSLDSKTGTLSMKTKKELLPLLIANADTSIAKSIMSQLTDISF
FT                   DSVLPAFRPSIGDPSYQKTNINLSKYLSLVGDKTDISEFLILTIGLFTSLKIGDKGFLQ
FT                   ELSADYLFVRYDDCLHKIIEKLKEKEVIEQLGEEKIQKIMKAVESLQIFNPTSNDPRRF
FT                   FETRLAQYINGLSHSEKTIEIDSIGEDKEPEDEELRDNTLKACNKILQFFLGDCGRVDT
FT                   PREMEQKICIFANGYKDTSKFTKKEVEFITGVLHHAEAHKGRDRVERDKLTGIKERKFE
FT                   TDSEKVGSDVWNCGGGVMKGCSPVFYDAQRDPMRNMLVDSSTVAPDNKEGKQWFWNNNR
FT                   QYSSYVGSISGHTCNIVGMLAKYMENYKEDPDLPNDINLFLIQVIGVYAKRGFHAMLEV
FT                   IDVLHDPYVQDIFKGYGVQVNLYSYFKENPELAGFLQHAMNDATTYTQALVNKKHVKEA
FT                   LKSNSFFSKKDEESGDKKNDHTPKDGTVYGC"
FT   gene            complement(529509..530285)
FT                   /locus_tag="LPC_2904"
FT   CDS_pept        complement(529509..530285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2904"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2904"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56805"
FT                   /protein_id="ABQ56805.1"
FT                   /translation="MRGKREFLKHEYSPSHWSIDYTRAGTSIAVITVRNKYHYSVILNP
FT                   TDCRGYRIIIRYLNEGDSSLSSAFNRPYTVSEQRGLNDVASLMTQVYEKLGLIVQFSQL
FT                   GNNSQSFDKETGVTLIGSEEEPSMLHLHMWGRGDPDMEYIAGVPLRGPEPGLMFDLIAK
FT                   NKTHPINQHAIKWNEEELQACLAMFKLKLAEYVNSPEFTEEFGDTLKVTIHDKKDLGEA
FT                   KESGFGFFHKMKSASDGITTLEKTLALEDDKINPFV"
FT   gene            530651..530863
FT                   /locus_tag="LPC_2903"
FT   CDS_pept        530651..530863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2903"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2903"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56804"
FT                   /protein_id="ABQ56804.1"
FT                   /translation="MDIHSTYKMLAKMQGNKELSSHKIAETEQAEAETVPQLKLQAEPE
FT                   AKPDMQNILSNMLGISSNKKHSPMD"
FT   gene            531033..531293
FT                   /gene="icmT"
FT                   /locus_tag="LPC_2902"
FT   CDS_pept        531033..531293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmT"
FT                   /locus_tag="LPC_2902"
FT                   /product="IcmT"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2902"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56803"
FT                   /protein_id="ABQ56803.1"
FT                   /translation="MAGGFSATSHWRDSARSARFFVVDARAAFPIFLFLMHIRVWTGVL
FT                   VLVSAIFFGIIEHYGFTVPVFLRWLRSFLAGSVRSARPWWR"
FT   gene            531294..531638
FT                   /gene="icmS"
FT                   /locus_tag="LPC_2901"
FT   CDS_pept        531294..531638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmS"
FT                   /locus_tag="LPC_2901"
FT                   /product="IcmS"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2901"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56802"
FT                   /protein_id="ABQ56802.1"
FT                   /translation="MERDISKCMAKIAASMNAKFYLNDRFVSFDEVFSETGLLPAIAKR
FT                   ADQLCSLCLGYGLGATYDESEGALLGIRVVFDEVTPNVLRLLCMTDVMNELIQGGPSRD
FT                   YTPLDELMYD"
FT   gene            531738..532100
FT                   /gene="icmR"
FT                   /locus_tag="LPC_2900"
FT   CDS_pept        531738..532100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmR"
FT                   /locus_tag="LPC_2900"
FT                   /product="IcmR"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2900"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56801"
FT                   /protein_id="ABQ56801.1"
FT                   /translation="MGNNTDDSARNPFGFYTPPRVKEIGESDVTDATLGSVYSEIISPV
FT                   KDCILTVAKAVSFNPGGKDNTDAVDVLTELNTKVERAALNQPILTAKTERMFGAAESEK
FT                   SSEQPSHEERGFKLSS"
FT   gene            532191..532766
FT                   /gene="icmQ"
FT                   /locus_tag="LPC_2899"
FT   CDS_pept        532191..532766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmQ"
FT                   /locus_tag="LPC_2899"
FT                   /product="IcmQ"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2899"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56800"
FT                   /protein_id="ABQ56800.1"
FT                   /translation="MKDQLSDEQKETILKALNDAIEKGPWDKSNFLRVIGKKLIAIRDR
FT                   FLKRIGAASQAKLKAESHLANRIALRSGQQEIYVSLYSSDGSNLQSWEKIVGSLPRQMI
FT                   SRPIYADEEDIKAILKTKENKQNEAYVAIYISQSDILHLSADKAPVDKLGKPLLTLKDK
FT                   SISLENISRFVHVSGVYRYSNGRLIKNA"
FT   gene            532953..534083
FT                   /gene="icmP"
FT                   /locus_tag="LPC_2898"
FT   CDS_pept        532953..534083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmP"
FT                   /locus_tag="LPC_2898"
FT                   /product="IcmP (DotM)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2898"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56799"
FT                   /protein_id="ABQ56799.1"
FT                   /translation="MAQQQQQSGSDNSMAPVWIVILLFITAYFVWALAHQYIVSFVFTI
FT                   NIWQARLVNLFLNNQLLANQIYLMQTLDPNTVNWDQMVTVMRAVGDYMRYPVICILVVL
FT                   AFVLYNSNVTLKYRKTYDMKSLRAQEQFNWPAIMPIVKEDLVSQDVNKGPWAMALTPME
FT                   FARKYNLLRKDDALLDNPVPGQEMTAGIRRGDAKRVFTMQLGPYWDGFERCSPQAYALS
FT                   AVFMARMNRDRDAANNILKVLDKTFVDGKPDFSVARPVMKKYQNSELVQEVVAKHAYVL
FT                   TVIASLLEAAREDGVVPSSEFLWLKPVDRRLWYMLNCVGRQTPYSEVAGPFAHWKAEKE
FT                   MGRRSLVPMIDEAIRALEIAVKEVRLTPRQMEELEP"
FT   gene            534080..536431
FT                   /gene="icmO"
FT                   /locus_tag="LPC_2897"
FT   CDS_pept        534080..536431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmO"
FT                   /locus_tag="LPC_2897"
FT                   /product="IcmO (DotL)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2897"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56798"
FT                   /protein_id="ABQ56798.1"
FT                   /translation="MMRGIDSRHELDPTLLLRDTRTFTQRLADFFADPTNISIVLISLA
FT                   AVSYYFSEAATFLLIMGSIFFLYSYTRKQKLPFRLPQISRAKDYNDLKPGINKPNIARG
FT                   ITFFGNDRKTGEELWFANDDMRTHALIFGSTGSGKTETLVSLSYNALVQGSGFIYVDGK
FT                   GDNSLYAKVFSMVRSMGREDDLLLINFMTGARDIVGPQEKRLSNTLNPFCQGSSSMLTQ
FT                   LVVSLMGSSGQSSDGDMWKGRAIAFVEALMRLLVYMRDEGAILLDANTIRNYFDLQRLE
FT                   SIVIDKVFPRDDQESVNIETIPKLVTDPLRNYLNTLPGYNKEKKGKQVSQVLEQHGFIT
FT                   MQLVRSFSSLADTYGHIIRTNLAEVDFKDVVLNRRILVVLLPALEKSPDELSNLGKIIV
FT                   SSLKAMMAAGLGEEVEGDYRDVILRKPTNAPTPYMCILDEYGYYAVQGFAVVPAQARSL
FT                   GFSAIFAGQDLPAFQKASKEEAASIGANTNIKICMKLEDPTETWDFFTKTAGEAYVTKV
FT                   DSFQTKETSIANSYMDTKSSSFEKRARVDLLDLKEQTEGEAHIFFKSKIVRARMFYANP
FT                   KPVKQLKINQFLKVEPPPDDYLMKLQKQLASFQSILESGDLSINKAVENEEITLISKAL
FT                   KESTIVEPIERGVAALIAFHGQNEPEPVEDIVEEEVEGALTIFSKLRIDPNAPPILVAD
FT                   KEVFSEPLLPINETRNQMITIECLAGAKDKYAGTVANELIKDFQIATSYPPEERDVIDV
FT                   QELTGIIRDLSAKISAEREKANKKAAEELT"
FT   gene            536835..537404
FT                   /gene="lphA"
FT                   /locus_tag="LPC_2896"
FT   CDS_pept        536835..537404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lphA"
FT                   /locus_tag="LPC_2896"
FT                   /product="LphA (DotK)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2896"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56797"
FT                   /protein_id="ABQ56797.1"
FT                   /translation="MRSLRTNYIYVLFKTTGLLFLLLLSACNRSGYIPENEVPKLPCRV
FT                   DGACDATIIKMMTDLNKKGIKVASVGQNYLISIPASALFADQSPRLNWASYSLLNEIAA
FT                   FLKQFRKIAITVTSYSSKYVSVKRERALTLARSRVVSEYLWSQGVDSRIIFTQGLGSDK
FT                   PITSYTLGGDRSPNARVEITFRRAVA"
FT   gene            537416..537700
FT                   /gene="icmM"
FT                   /locus_tag="LPC_2895"
FT   CDS_pept        537416..537700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmM"
FT                   /locus_tag="LPC_2895"
FT                   /product="IcmM (DotJ)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2895"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56796"
FT                   /protein_id="ABQ56796.1"
FT                   /translation="MSRETWALIKRNKNFNVHIYRRGLTLLILSLGLSCGLSGLIYYVH
FT                   IHEPERDFYATSGITPPIQLKPMSTPNMSSEALLPPDPPDEDSQRIIPQ"
FT   gene            537716..538354
FT                   /gene="icmL"
FT                   /locus_tag="LPC_2894"
FT   CDS_pept        537716..538354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmL"
FT                   /locus_tag="LPC_2894"
FT                   /product="IcmL (DotI)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2894"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56795"
FT                   /protein_id="ABQ56795.1"
FT                   /translation="MAEDALTVVALRNKFYKDSQRKVILALLIAIVVNVVLASLVVYMI
FT                   THPPAPKYFATSINGRITPLFPLDEPNQSDSAVLQWANQAAIAAFTYNFVNYRDELQAS
FT                   SGFFTAEGWDQFLGALEQSNNLDAVKAKKLVVSAVATRAPIILQKGVLNGRYSWRVQMP
FT                   ILVTYQSASEFTQQNNVVTMLITRVSTLNSPRGIGISQFVVGPASGGVS"
FT   gene            538357..539439
FT                   /gene="icmK"
FT                   /locus_tag="LPC_2893"
FT   CDS_pept        538357..539439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmK"
FT                   /locus_tag="LPC_2893"
FT                   /product="IcmK (DotH)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2893"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56794"
FT                   /protein_id="ABQ56794.1"
FT                   /translation="MKKYDQLCKYCLVIGLTFSMSCSIYAADQSDDAQQALQQLRMLQQ
FT                   KLSQNPSPDVQLGAGDGGDNAASDSTQQPNQSGQANAPAANQTANAGGDGQIISQDDAE
FT                   VIDKKAFKDMTRNLYPLNPEQVVKLKQIYETSEYAKASTAGTPPKPTATSQFVNLSPGS
FT                   TPPVIRLSQGFVSSLVFLDSTGAPWPIAAYDLGDPSSFNIQWDKTSNTLMIQATKLYNY
FT                   GNLAVRLRGLNTPVMLTLIPGQKAVDYRVDLRVQGYGPNAKSMPTEEGIPPSANDLLLH
FT                   VLEGVPPPGSRRLVVSGGDARAWLSNEKMYVRTNLTILSPGWLASMTSADGTHAYEMQK
FT                   SPVLLVSWHGKVMQLKVEGL"
FT   gene            539444..542590
FT                   /gene="icmE"
FT                   /locus_tag="LPC_2892"
FT   CDS_pept        539444..542590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmE"
FT                   /locus_tag="LPC_2892"
FT                   /product="IcmE (DotG)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2892"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56793"
FT                   /protein_id="ABQ56793.1"
FT                   /translation="MASKKENLKSLFSNTRTRVIIIFTAALLIIAVVIGFFKIRSATTS
FT                   SIAAAEVSTVPGGIQSIPGVLDPTAQYAKLQEEQNITQAQVAEKTGGSAIPTIIRTQAL
FT                   GEGVGVIGSQSGVGFAALAQEELGGPQRSLWIQELQDGGCSKSVITKVVNQGAQLTDLK
FT                   AACSCVQLKDSGYGLQELEQVCECKELKAAGYNARQLKEAGYSAGRLRNCGFDACELRN
FT                   AGFTAQEMKDGGFSDGELKGAGFSDAEIAKASGLPDGITADDVRKAGCGAAALAKLRQA
FT                   GVSASAIRKISGCTAEQLKAAGYTAKELKDAGFSAADLKRAGFSAAELKDAGFTARDLL
FT                   NAGFTPADLAKAGFSNAQIKAAQAELPPGITPQDVKNAGCDVEALKKEREAGVSAALIR
FT                   QYAGCSAQALKAAGFTDADLASAGFTPAQISAATPLSDAEIKAAGCDPDKLKKLFSAGV
FT                   SAKRIKELNGCSAEALKAAGYDAQSLLAAGFTPQELLAAGFTPKQLEDAGLNPASIIAD
FT                   GRVADCSVESLKKARAAGVSALTIKQTLGCSAAALKAAGYTAKELKDAGFTAAELKAAG
FT                   FSAKDLKDAGFTAKELRDAGFSAQELKDVGFSAKDLKDAGFSAAELKAAGFTAAQLKAA
FT                   GFSAKDLKDAGFSAAELKAAGFSAKELKDAGFSASDLKNAGFSAKELKDAGFSASDLKN
FT                   AGFSASELKNAGYSADELKKAGYTSAELRNAGFSPQESAVAGLQGPDLQQLDSSITGIP
FT                   SIPGATPRPTTSDAASSAEQLQAILQKQNEQLAEQKYQQEIQQRTSDMLSAATQLVQDW
FT                   KKVETQVYTEGTEETKTSGGESSVPGAGTGAGANNQPVEQGASGAQNQAIIKTGDIMFA
FT                   VLDTAVNSDEPGPILATIVTGKLKGSKLIGSFNLPSNADKMVITFNTMSIPGAEKTISI
FT                   SAYAIDPNTARTALSSRTNHHYLMRYGSLFASSFLQGFGNAFQSANTTITIGGTGGGNN
FT                   ITVANGVGRSTLENAVIGLATVGKAWSQQAQQLFNTPTTVEVYSGTGLGILFTQDVTTI
FT                   "
FT   gene            542608..543414
FT                   /gene="icmG"
FT                   /locus_tag="LPC_2891"
FT   CDS_pept        542608..543414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmG"
FT                   /locus_tag="LPC_2891"
FT                   /product="IcmG (DotF)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2891"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56792"
FT                   /protein_id="ABQ56792.1"
FT                   /translation="MAEHDQNNDEYKFAELDSYDMDQAGESDLDSEASFQSGKEGLTKK
FT                   KDIKRNALIAIGAVVFIMVMYKIIGWMFFSDKSSQVTTKPAIPPVTQVATPQPVQTIPT
FT                   TTPIQQVQPTTIIEDDPDLKKKVSAIELTQQSLRSEVNALGEQINAVNNNIKNLNAQIV
FT                   NLNQIIGNMSNQIARQSEVINVLMARTTPKKVVKVSRPTVPVRIIYYIQAVIPGRAWLI
FT                   GSNGSTLTVREGSKIPGYGMVKLIDSLQGRILTSSGQVIKFSQEDS"
FT   gene            543422..543763
FT                   /locus_tag="LPC_2890"
FT   CDS_pept        543422..543763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2890"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56791"
FT                   /protein_id="ABQ56791.1"
FT                   /translation="MADPTCTGGTVACWIVSQANILANIANQLEPVQRLITGGAYLIGC
FT                   AFIFKAIYSLKVYGEARTMMSSNTSMKEPVMYLMVGALLIYFPSLVSSVLPNDFWLLAI
FT                   PLAYSRKFE"
FT   gene            544034..544432
FT                   /gene="icmD"
FT                   /locus_tag="LPC_2889"
FT   CDS_pept        544034..544432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmD"
FT                   /locus_tag="LPC_2889"
FT                   /product="IcmD (DotP)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2889"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56790"
FT                   /protein_id="ABQ56790.1"
FT                   /translation="MNIKVIHKSGYKHWLVSAACLALLTLICQDAAAGVSLGKMASQIT
FT                   GSFTSLTKLITAGSYLAGLGFSIGAIMKFKQHKDNPTQIPIGTPIALIFIAAALLFLPS
FT                   ILGVAGVTMFGSSGGKTAGPTGTIYKTN"
FT   gene            544632..545258
FT                   /gene="icmJ"
FT                   /locus_tag="LPC_2888"
FT   CDS_pept        544632..545258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmJ"
FT                   /locus_tag="LPC_2888"
FT                   /product="IcmJ (DotN)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2888"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56789"
FT                   /protein_id="ABQ56789.1"
FT                   /translation="MADNQQRCELKLIASPGSWRLYSARKIDERFKSYEQKIFQRDRYT
FT                   CQFCGFQARLYQDIVNLDGDYTNNRLSNLVTACCFCAQCFFVESVGVGGYGGGTLIYLP
FT                   ELTQAELNSLCHVLFCAITNDTGYKSSAQNIYRSFKFRSQIVEEKFGEGTSDPAIFGQL
FT                   IIDSGVNSEEIREKLFKNIRLLPSRAKFRKQIEKWAASALEEIAD"
FT   gene            545294..548323
FT                   /gene="icmB"
FT                   /locus_tag="LPC_2887"
FT   CDS_pept        545294..548323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmB"
FT                   /locus_tag="LPC_2887"
FT                   /product="IcmB (DotO)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2887"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56788"
FT                   /protein_id="ABQ56788.1"
FT                   /translation="MANWSESFFEGVDTFFAWLSTSLKQTTESYIDLETADSPTVLVNH
FT                   DGSLLSVLKIEGITGLAGPEEFERLVEGLANSFQAAMGRPGHALQVYFSHDKQNIVKMI
FT                   KDIYDPAEATASRLELNLRDLFEERVNYLSQYCAEERVYFVLYTRPFNLASDQLKAANK
FT                   AKMKMIKDTKAPPFKNTQTIFAAVPEIRDTHDAYVRAILNDLDALNVIAKLLEVHDAIH
FT                   AIRMTGDPDYTADDWRATLPGDKIPVRELNNFEGDPSDLLWPPLSKQVLPRDAEIIDLR
FT                   TVRVGDKIYSSTYIDLFPKDVRPFISLFSRILPSHVPWKISFLLESEGLSTIKLKGLLA
FT                   AILSFSSAQNRLISDSVNLLKYIQLNTDEAIVRLRVVATTWAPEGNIPLLRRRSSELVK
FT                   AIEGWGSTDVSEICGDPFAGFVSSMLATTLNSSAVASVAPLSDVISMLPITRPASPWKT
FT                   GALLFRTPDGKPWPFQPGSTEQTTWIDLVYARPGSGKSVLSNALNLALCLSGGLMRLPR
FT                   IAIIDIGPSSSGLISLLKEALPASKRHLVAYHRLRMTPDYSINPFDTQLGCRYPTALER
FT                   SFLVNFMTLLTTPLGAAKPYDGMADLAGMVVDELYKSMADEFNPTPYAPGIEEFIDSIL
FT                   EEIGFVRDAKSTWWEVTDSLYSAGFVHEAMLAQRYAMPLLADAASICRTPSIEDLYEKI
FT                   TAPTGESLINAFSRMISSAVREYPILSRVTSFDIGDARVVSLDLDEVAKSGGDAADRQT
FT                   AVMYMLARYVLARHYYLTEESLNNVPEQYKEYHKQRVLEIREDHKRIVYDEFHRTAKSS
FT                   AVREQVIIDMREGRKWKVQISLLSQAVDDFDPVMIDFATAIYVMDAGPSQAVEKTSQIF
FT                   GLSETAKIALRTRVHGPRQGGATFLAQFATKTGINVQLLTLTLGPVELWAFSTTAEDAT
FT                   VRNLLYRHLGPSEARRLLAALFPNGTVTKELEARLASMKQKVGLIEDDEREGMINQLVN
FT                   DILDAYSKDPNVKSLPAKVG"
FT   gene            complement(548469..549725)
FT                   /gene="tphA"
FT                   /locus_tag="LPC_2886"
FT   CDS_pept        complement(548469..549725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tphA"
FT                   /locus_tag="LPC_2886"
FT                   /product="proline/betaine transport protein like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2886"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56787"
FT                   /protein_id="ABQ56787.1"
FT                   /translation="MNQNTKHSIIAGLYGNALEWYDFLLYASFAPVFAEIFFPSKIHFV
FT                   SLIATFSLFAIGFIMRPIGGLLLGHYADHVGRRKALILSMSVMTISTALIAVLPDFNSW
FT                   GIIAPLLFSILRLIQGLAVGGELPGSTTYLIEHMFQQSRELAGSLVLSSAFLGIFIGAL
FT                   TASIFSTLFTGDALLNWGWRYAYLLGGILGILGIYLRIKSFESPTFLKDKHTAELPAKV
FT                   VFTRFKQQLFLSVIITSILAMSNYVLIAYVTTFLVKSEYFLLKDALLINLIALALLTVL
FT                   IPLMGFLSDVVGRKPIFLIGLFSLCILIFPFFWLLLSGSWWKALCSELLLAIALAPINA
FT                   TVPTIIAEMFPTSVRASGISISYNIGQALFGGTMPLVAFTLIELSSNKMAPAWYLFLWI
FT                   LIVIPITISIRESYQKELT"
FT   gene            complement(549728..552649)
FT                   /gene="icmF"
FT                   /locus_tag="LPC_2885"
FT   CDS_pept        complement(549728..552649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmF"
FT                   /locus_tag="LPC_2885"
FT                   /product="IcmF"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2885"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56786"
FT                   /protein_id="ABQ56786.1"
FT                   /translation="MDNSLRALCDAIKKILSQLKPQANQLSFIVITGKNAQGKSALLKQ
FT                   SNMEEMPVFSEEHAKLYFNQKGIIVELGENWLTNSKTLLLTTLKQLNKCNRHLKITGLI
FT                   LCVDVNDLLIAEPAQFTEQKKSHLQLIQRLGVNLGYQAELAIIFTKMDTLAGFSEFYQM
FT                   DHVNDLSKPLGFSLDCVNQSSKKIETFSLQFNQLIEALGQQVINKMHPVRSTIKRSLIR
FT                   EFPLQLASLRAPIQSLIQGISPKLFHVHSIFFTSAEQGGVSVDRLNKKIQHEYALVVQD
FT                   TFPQATNFRSYFVEGALKTIQEQCIQVPQTTKFSQKPFIAVAVSLAGLSLLTLIYNHYK
FT                   TAHILDEASKELLAYEALNNQGTSGAQALYHLSQAANKMNHITSNSISLPTVHQLKLNL
FT                   HNNAQNRLQGEFLPSLANELEQVITSPGNTPITRYKALKIYLMLGDSKYFSSQPILDWF
FT                   QQQWQGRAPGTTQKQLALLKQTLSNPPQNIPIKSQIISDARNYLNALPTSYLYYSIAKE
FT                   YFPQEKQKIVIEGFSIPTDEVPTYFTKTGFTKIINELPKITSTLQSENWVLARQDLSQL
FT                   HNMLIQAYCFDYVTWWQTFMKKSQPLRYQDYQQGRQLTKLIQQSNSFYKFANLIQQETK
FT                   PDLTEGISTFNQFIANQFTDLNLTTLSSIKELDFRISELERFIATLSVVNDGGKTAFTI
FT                   TRSRFLNENSSDPVSLLYSQARQLPEPLSSWTKQIAGDIWVILIRDSRQYINNQWQKTV
FT                   YREFQNSIAQRYPFDSSQTAEIDIADFNRFFSTHGLLNTYSEQYIKPFLDTSSPEWKPK
FT                   AVNDFILPISNEVIDELIRANIITNMFFPDHSDESKIDFSLQKISLDPVVSNLVLEIGG
FT                   TKLMDNQTSDSLIRFTWPQNNAKLALDSIEGNHYELAEYGTWAIFKLLEKVNVLVDEQD
FT                   SSSLQILFEVNSNSGRYLLKTNNQINPFTPGILNGFTLNDHIA"
FT   gene            complement(552649..553434)
FT                   /gene="icmH"
FT                   /locus_tag="LPC_2884"
FT   CDS_pept        complement(552649..553434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icmH"
FT                   /locus_tag="LPC_2884"
FT                   /product="IcmH (DotU)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2884"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56785"
FT                   /protein_id="ABQ56785.1"
FT                   /translation="MTTEQYPSSLVNRLAITEPALVPSGYYRSKLFIAPFSTNVLVAAA
FT                   GPILSLLERLCLSPSLPPVEDIRENIQHELRAFHSKLDASKYPLDIISIAQYLLSATID
FT                   EILGKSYLRVYNLTTEFKSFTPLSSDGAQPQQRFFEILNYIKERPNQFLDLIELAYFCL
FT                   IAGFEGEYHLKADGRQCLDNTIEDLYQIIQKYRFNKPHRLFNENPLPKTIKKNYKATWI
FT                   TTIAAVGIVILAFVTSHVLLENKAKTVLFGHTQLAMLEN"
FT   gene            complement(553719..555308)
FT                   /gene="purH"
FT                   /locus_tag="LPC_2883"
FT   CDS_pept        complement(553719..555308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="LPC_2883"
FT                   /product="phosphoribosylamineimidazolecarboxamideformyltra
FT                   nsferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2883"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56784"
FT                   /protein_id="ABQ56784.1"
FT                   /translation="MAKKQIYSSFNPRRALLSVSDKRGIRELGQALHDHGVELIATGNT
FT                   AAILREHKLPVTDVSECTGFPEIMDGRVKTLHPAIHAGLLARGEQDSPVLKQHGIKPID
FT                   LLVVNLYPFEQVINHPDCDFNKAIENIDIGGPAMVRAAAKNHAHTYVIVDPNDYPKLIH
FT                   YLQDQKAPSHWNFALAKKAFAHTAAYDAAIANYLTTLDNDYVPTGFPDILTCQFNKITD
FT                   LRYGENPHQQAIFYADKNSHPGSLGTAALLQGKQLSYNNILDADAALDCVKSFSNEKSV
FT                   CVIVKHTNPCGIALSDTSLDAYLKAFQSDPISAYGGIIAFNGTLDSDTAKAILEKQFVE
FT                   VIIAPDANEEAKKILAAKENIRVLLTGFWQQGTNFRLNMKKVDGGLLVQEHDSLSLESC
FT                   ELQTVTQAKPTDEQLQNLMFAWLAAKHVKSNAIVYANDLATIGIGGGQTSRVMSARIGL
FT                   WQAEQMGFDPQGAVMASDAFIPFPDTIEIAAKAGISAIIQPGGSIRDEKIISCADQHNI
FT                   AMIFTGVRHFKH"
FT   gene            complement(555335..556204)
FT                   /gene="prmA"
FT                   /locus_tag="LPC_2882"
FT   CDS_pept        complement(555335..556204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="LPC_2882"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2882"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56783"
FT                   /db_xref="GOA:A5IHD3"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHD3"
FT                   /protein_id="ABQ56783.1"
FT                   /translation="MWFQLKIEHCPNDKIEEITEELEEYGALSITLTDKNDNPVLEPEP
FT                   GTTPLWPEVIIHALFAQAEEAQYVREQLVAKTPSLHCSLEPLADKNWERAWMDDFRPQR
FT                   FGNRLWVCPTWLPPPEPDAVNLMLDPGLAFGTGTHATTSLCLTWLEQADLKNKSVIDYG
FT                   CGSGILSLAAIKLGAKHVYAVDIDNQALQATQNNAHANHITESQLSISSPEALQNPVHL
FT                   IIANILLAPLISLKERFHQLLPSGAHLVTSGILEEQAPLLIDAYDSAFTHIATEYCEGW
FT                   SLLVFTSK"
FT   gene            complement(556206..557549)
FT                   /gene="accC"
FT                   /locus_tag="LPC_2881"
FT   CDS_pept        complement(556206..557549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="LPC_2881"
FT                   /product="acetyl CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2881"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56782"
FT                   /protein_id="ABQ56782.1"
FT                   /translation="MLSKIVIANRGEIALRILRACKELGIQTVAVHSDVDKDLLHVRLA
FT                   DETVCIGPAPAQKSYLNIPAIISAAEITDAVAIHPGYGFLSENADFADIVEQSGFRFIG
FT                   PRGDSIRLMGDKVSAIAAMKAAGVPCVPGSDGPLGDDDNKNLELARKIGYPIIIKAAGG
FT                   GGGRGMRVVHSESNLLSAIALTRSEAKAAFNNPIVYMEKFLENPRHVEFQVLGDGKGHA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITPELREEIGASVIKACKELQYRGAGTFEFLFQD
FT                   GCFYFIEMNTRIQVEHPVTEMITGIDLIKEQIKIASDIPLTLTQKDIKLRGHAIECRIN
FT                   AEDPRNFMPSPGTIKLLHQPGGPGVRFDSHIYSSYVVPPNYDSMIGKLISYGATRAEAI
FT                   ARMRNALDEIIIDGIKTNIELHQRILHDKSFMEGGTNIHYLEKMLKDS"
FT   gene            complement(557562..558044)
FT                   /gene="accB"
FT                   /locus_tag="LPC_2880"
FT   CDS_pept        complement(557562..558044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="LPC_2880"
FT                   /product="acetyl-CoA carboxylase biotin carboxyl carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2880"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56781"
FT                   /protein_id="ABQ56781.1"
FT                   /translation="MDIRKIRKLIELLEETGISEIEIKEGEESLRLSRHSNIVAETAPQ
FT                   IHYVAPSAVKQTASAPSSNTSTTEPHVVENKQVTSTSSGHKIRSPMVGTMYTAPSPESP
FT                   PFVTVGQSVKAGDTLCIIEAMKMFNEIEADRAGKIVEILVKNGDPVEYDQALFIIE"
FT   gene            complement(558057..558494)
FT                   /gene="aroQ"
FT                   /locus_tag="LPC_2879"
FT   CDS_pept        complement(558057..558494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="LPC_2879"
FT                   /product="3-dehydroquinate dehydratase type II"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2879"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56780"
FT                   /db_xref="GOA:A5IHD0"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHD0"
FT                   /protein_id="ABQ56780.1"
FT                   /translation="MKKILVLHGPNLNLLGSREPSIYGHASLTEINGDLIQEADNAGIR
FT                   LSCFQSNAEAELIQAVHQAGIDKINYIIINPAAFTHTSIALRDALSAVAIPFIEVHLSN
FT                   IFSRETFRHHSYFSDIAVGVISGLGTKGYLLALQAIIKELK"
FT   gene            558696..560486
FT                   /gene="dcoA"
FT                   /locus_tag="LPC_2878"
FT   CDS_pept        558696..560486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcoA"
FT                   /locus_tag="LPC_2878"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2878"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56779"
FT                   /protein_id="ABQ56779.1"
FT                   /translation="MSKTFITDVTLRDAHQCLIATRMRTEDMLPICNKMDDVGFWAMEV
FT                   WGGATFDACLRFLKEDPWSRLRQLRQALPNTQLSMLLRGQNLLGYRNYADDVVRAFVKL
FT                   AVNNGVDVFRVFDALNDARNLKVAIDAIKSHKKHAQGAICYTTSPVHTLDNFLELGKKL
FT                   AEMGCDSIAIKDMAGLLTPTVTVELYAGLKQATGLPVHLHSHSTSGLASICHYEAVLAG
FT                   CNHIDTAISSFSGGASHPPTEALVAALTDTPYDTELDLNILLEIDDYFKAVRKKYSQFE
FT                   SEAQNIDPRVQLYQVPGGMISNLYNQLKEQNALDKMDAVHKEIPRVRKDLGYPPLVTPT
FT                   SQVVGTQAVINVLTGERYKTITNEVKLYCQGKYGTPPGKISSALRKKAIGRTEVIEVRP
FT                   GDLLPNELDQLQNEISDLALSDEDVLLYAMFPEIGRQFLEQRKNNQLIPEPLLTQSSAP
FT                   DNSVMSEFDIILHGENYHVKVAGYGMIEHGQQSCFLWVDGVPEEVVVQHSELHDKIERS
FT                   SVNNKIGPGDITVAIPGSIIAIHVSAGDEVKAGQAVLVIEAMKMETEIKAPANGVVAEI
FT                   LCQKGDKVTPGQVLIRVEVS"
FT   gene            561052..562683
FT                   /gene="proA"
FT                   /locus_tag="LPC_2877"
FT   CDS_pept        561052..562683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="LPC_2877"
FT                   /product="zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2877"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56778"
FT                   /protein_id="ABQ56778.1"
FT                   /translation="MHPNYYLSPLAVAIALGIASPVKAADPIPLQKSSFSEVTQKFQLT
FT                   LPGVMKGAVVSTNSLQFIRQHTDGNKVTHVRMQQQYAGFPVFGGYAILHSKNATPSLAT
FT                   AKSDVKMNGVIYDGLQAELGQPKPSFVKNASMALQQFKDKYANKQVSEDQVTPMIYIDE
FT                   KHQAHWAYKVSVLVIHDDRIPERPTAIIDAETNKPFVQWDDVKTEKVQAKGMGFGGNRK
FT                   IGEYQFGKDLPLLEITRDSSVEMCFMENTDVKVVDMGHKYYSNNKPMQFTCKETPDTQS
FT                   TKTYYTGYSADGYDRDNGAASPTNDALYAGYVIKHMYHDWYGVEALTKSDGSPMQLVMR
FT                   VHYGQGYENAYWDGKQMTFGDGDTMMYPLVSLGVGGHEVSHGFTEQHSGLEYFGQSGGM
FT                   NESFSDMAAQAAEYYSVGKNSWQIGPEIMKEDSGYDALRYMDKPSRDGMSIDVADDYYG
FT                   GLDVHYSSGVYNHLFYILANQPNWNLRMAFDVMVKANMDYWTPYSTFDEGGCGMLSAAK
FT                   DLGYNLDDIKKSLSEVTINYQSCYVD"
FT   gene            complement(562685..563533)
FT                   /locus_tag="LPC_2876"
FT   CDS_pept        complement(562685..563533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2876"
FT                   /product="MhpC, Predicted hydrolases or acyltransferases
FT                   (alpha/beta hydrolase superfamily)"
FT                   /note="COG0596"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2876"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56777"
FT                   /protein_id="ABQ56777.1"
FT                   /translation="MKTKILSIPGLSIACKVWGNPDNPPILALHGWLDNANSFDDIAEH
FT                   LQNDYYFIAVDLPGHGHSSHLPPGCIYHFTDGIFTVVEIINALGLNKLHLLGHSMGACL
FT                   GSLVAGVAPDRFLSLSLIEGLGPFSHPAETACQQLSKYLDYLSQKQSKKAKGYNKFEHA
FT                   ALARSVKGYVSLDIAKSLCERGIQQENGLYYWRHDRRLLAPSPLQMTEAQVLSCLTEIK
FT                   AQTYLIWASKGFSFDSDKMKARIQAVKNIKIEKLDGGHHIHMEKPEVISRLLAEFYQSI
FT                   K"
FT   gene            564002..564757
FT                   /locus_tag="LPC_2875"
FT   CDS_pept        564002..564757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2875"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2875"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56776"
FT                   /protein_id="ABQ56776.1"
FT                   /translation="MQPEVRSVSLITYNIHKGFGVGAVRFLLPEMRDAIAGLNPDFVFL
FT                   QEVQGKHRKREKRIVSWPDSPQCEYIAENIWPHYVYAKNAVYQSGHHGNAILSKYPFES
FT                   FESINLSNMNRASRGILHTQLKLDNNIIHLLCVHLGLFKAERTEQCKALIQRIKDVVPK
FT                   NEPLIMAGDFNDWRHVISKILAENLGIEEAFVALEGQHARSFPAIKPALCVDRVYFRGM
FT                   KVQEVACLQGKPWRMLSDHLPLYARFELL"
FT   gene            complement(564936..565946)
FT                   /gene="alf1"
FT                   /locus_tag="LPC_2874"
FT   CDS_pept        complement(564936..565946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alf1"
FT                   /locus_tag="LPC_2874"
FT                   /product="fructose bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2874"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56775"
FT                   /protein_id="ABQ56775.1"
FT                   /translation="MSYEELSNTMEQMLHEGKGILAADESNSTIGKRFASINTENTEEN
FT                   RRDYRLLLATTPDLEQYINGVILFEETFTQTDEHGTPIPELFANKGIIPGIKVDKGLVD
FT                   LANTEHEKVTQGLDGLTERLLHFKKLGAKFAKWRNVYSISEYTPSLTAIKTGAENLGRY
FT                   AAACQSVGIVPIVEPEVLMDGNHSIEHCAEVCEMVLHELFHTLFIHQVELEHIILKPSM
FT                   VTCGKEVTPFSDPEEVADYTISVFRNNVPASVPTINFLSGGQTPQQATANLNAINQIGH
FT                   QPWLLSFSFGRALQEDCLKEWCGNKANIAKAQEALIKRARLNSMACLGEYQNDME"
FT   gene            complement(566096..566788)
FT                   /gene="poxF"
FT                   /locus_tag="LPC_2873"
FT   CDS_pept        complement(566096..566788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxF"
FT                   /locus_tag="LPC_2873"
FT                   /product="phenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2873"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56774"
FT                   /protein_id="ABQ56774.1"
FT                   /translation="MISPKVKHFIFNCELSPPFEYLPGQFITIHFEHDGKNLKRSYSIA
FT                   NEPKKDNRIEFAAGYFEGGPGTELLYNLKPGDVIHINGPFGRLIFKDETPGRYILVATS
FT                   TGTTPYRAMLNELGQRIEKHPDLQVVILQGVQRSEEILYPDDFQAFAKKYPQASFRPYL
FT                   SRVQKQDLKDNEYSGYVQHAFPELNLNPTRDMVYLCGNPGMIDEAFNYLKEHGFPMQHI
FT                   VREKYISR"
FT   gene            566914..567456
FT                   /gene="dotV"
FT                   /locus_tag="LPC_2872"
FT   CDS_pept        566914..567456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dotV"
FT                   /locus_tag="LPC_2872"
FT                   /product="IcmC (DotV)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2872"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56773"
FT                   /protein_id="ABQ56773.1"
FT                   /translation="MNTIDLITILGNISQSLYPVQKLITGGAYILGVLFFLTAIGKLKK
FT                   IGDHRAQSSSQEKMFTPMMYLLVGALLIYLPSGMDLMANTAFGVGNVLTYSNYNPANIY
FT                   SSMGFLIRTAGVLWFIRGCVLVAHSSQPGTQQGLKGLVFLIAGVFAMNFDNTIAMINSA
FT                   LDYFVKATLSVKAAAGF"
FT   gene            complement(567658..567942)
FT                   /locus_tag="LPC_2871"
FT   CDS_pept        complement(567658..567942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2871"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2871"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56772"
FT                   /protein_id="ABQ56772.1"
FT                   /translation="MSNRKNKTIVIEGVTSQGKTFRPSDWAERMSGSLAVFKNSRIYYS
FT                   PLLQPSVNSEGYKCVLLDPKLKESSPQVYQAIMDFAKANNLKICGEEDL"
FT   gene            568172..568909
FT                   /gene="pssA"
FT                   /locus_tag="LPC_2870"
FT   CDS_pept        568172..568909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="LPC_2870"
FT                   /product="CDP-diacylglycerol-serine-O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2870"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56771"
FT                   /protein_id="ABQ56771.1"
FT                   /translation="MNKENHSGIYLLPNLLTTVSLFAAFYSIVASTKGQYEAAIVAMFI
FT                   GMIADSLDGRIARLTNTQTEFGAQYDSLSDMVTFGVAPSLLLYNLTLHQLGKFGWLVAF
FT                   IYTAAVALRLARFNTQIGKSDKRYFQGLPCPPAAAVMASFAWICFQNEWANLIVSLFTA
FT                   VLALIVSVLMVSNLRYYSFKEVDYKGKVPFLYVLVMILLFVAIAANPAIVLFASSGIYA
FT                   LSGPMLTVISLHKMRKQRRNMSK"
FT   gene            complement(569151..569420)
FT                   /gene="ptsH"
FT                   /locus_tag="LPC_2869"
FT   CDS_pept        complement(569151..569420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="LPC_2869"
FT                   /product="sugar transport PTS system phosphocarrier HPr
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2869"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56770"
FT                   /protein_id="ABQ56770.1"
FT                   /translation="MIKTKIKIINRLGLHARASAKFVSTAAKFQSHIDVTKDTQTVNGK
FT                   SIMGVMMLAANKGSELTLEIDGPDEERMNEALVELINNRFGESE"
FT   gene            complement(569611..569910)
FT                   /locus_tag="LPC_2868"
FT   CDS_pept        complement(569611..569910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2868"
FT                   /product="sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2868"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56769"
FT                   /protein_id="ABQ56769.1"
FT                   /translation="MQINITGHGMDVTPALRAFTEEKFDKLERHFDHIRAINVVFDVEK
FT                   VRQIAEATVLVTKGELHASSESEDMYAAIDTLVDKLNRQLIKHKEKLLAHRDRD"
FT   gene            complement(569937..571331)
FT                   /gene="rpoN"
FT                   /locus_tag="LPC_2867"
FT   CDS_pept        complement(569937..571331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="LPC_2867"
FT                   /product="RNA polymerase signma-54 factor RpoN"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2867"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56768"
FT                   /protein_id="ABQ56768.1"
FT                   /translation="MKPTLQIGIGQHLTLTPQLQQAIRLLQLSTFDLQQEIQLVVESNP
FT                   LLEATPVEEKEDAQINTNQDQDEYSDFQWSQLYNNLNKRNNFEENDYNFDNLHCTTTNL
FT                   QDHLNWQLDLTPMSDIDRVIATTIIDAINDDGFLTIPVAEIHASLNSDDFPLDIEEIEA
FT                   VRHRLQLFDPVGCASVNLAETLVLQLEQLPLEPKLLATAKKVILEDIELLGQHNYRQLM
FT                   KNHQISEKTIHEILQVIHKLNPKPGSLIHQDNIEYVIPDLTVKKIDNQWKVFLNQDILP
FT                   RLSINSQYAALIQRANNSLDNQFLKHNLQEARWFLKSIQSRQETLLKVATCIMEYQHGF
FT                   LEFGEEAMKPLILNDVASALDMHESTVSRVTTQKFINTPRGVFELKYFFSSHVNTDSGG
FT                   ECSSTAIRAVIKKLISAENRKKPLSDSKIAQLIGEQGIKVARRTVAKYREAMGIPPSNE
FT                   RKVISS"
FT   gene            complement(571543..571707)
FT                   /gene="rpmG"
FT                   /locus_tag="LPC_2866"
FT   CDS_pept        complement(571543..571707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="LPC_2866"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2866"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56767"
FT                   /db_xref="GOA:A5IHB7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHB7"
FT                   /protein_id="ABQ56767.1"
FT                   /translation="MAAVTIKVKMESTAGTGYYKTTTKNPRNHPEKMELMMYDPKVRKH
FT                   VLFKEKKVK"
FT   gene            complement(571722..571958)
FT                   /gene="rpmB"
FT                   /locus_tag="LPC_2865"
FT   CDS_pept        complement(571722..571958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="LPC_2865"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2865"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56766"
FT                   /db_xref="GOA:A5IHB6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHB6"
FT                   /protein_id="ABQ56766.1"
FT                   /translation="MSRVCQVTGKRPMVGHKVSHANNKTKRRFLPNIQNHKFWVEEENR
FT                   FVTLRLSTKGMRIIDKLGIKAVLDKIRAKGEKI"
FT   gene            572056..572217
FT                   /locus_tag="LPC_2864"
FT   CDS_pept        572056..572217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2864"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2864"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56765"
FT                   /protein_id="ABQ56765.1"
FT                   /translation="MKYKSGFITKKPKYCNIFTLFSLKTDFSGLLSKQVSGKSRIFNQN
FT                   QYNPEILY"
FT   gene            572227..572904
FT                   /gene="trmB"
FT                   /locus_tag="LPC_2863"
FT   CDS_pept        572227..572904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="LPC_2863"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2863"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56764"
FT                   /db_xref="GOA:A5IHB4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHB4"
FT                   /protein_id="ABQ56764.1"
FT                   /translation="MQRKIKSYVLRAGRISNRQQQGLDLWLEDYELKFDSPSPWNFAKE
FT                   FGRHDADTIVEIGFGMGTSLFTMAMNNPQCNYLGIEVHKAGVGSLVADLHEHQITNVRV
FT                   VVHDAVDVLQTKIPENSLAGVQIFFPDPWHKKRHHKRRLIQSEFIQMLVKKIRPSGFIH
FT                   CATDWEDYAEHILNVLSSESALFNQQKEGGYSPRPDSRPLTKFEQRGERLGHGVWDLVF
FT                   IKK"
FT   gene            572916..574040
FT                   /locus_tag="LPC_2862"
FT   CDS_pept        572916..574040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2862"
FT                   /product="endo-1,4 beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2862"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56763"
FT                   /protein_id="ABQ56763.1"
FT                   /translation="MIKHAILISGLIVSFLASAAEMSFLAQLTEVPGASGYEKNVRHLV
FT                   QKQWQSYMAELKIDGMGNLIGQRKDNQKGPKLLFMAHLDETGFMVESITPDGFLKVIPL
FT                   GGIANSVIYAQRWTVSTPKGPVLAYSGMDSPHLLGDKKMLGSPDINALFLDIGAENKKQ
FT                   AQKEFAIQPGLEVTPVSEFSLLSKNRFLGKALDDRIGLAVISDALRAVKQQPNQLYLAA
FT                   TVQEEVGMRGASTVYKATHPDIAINVEVGIADDYPMLLADRKGRIGLGKGPSLFVYDKS
FT                   MIPNQELINWIMELANKNNIPLQLEVEPGYGEDGSKVQASGMGVPVVNIGIPIRYAHQH
FT                   AGIFDKRDYDNTVKLLRLIAENLNQEVVDKIKKS"
FT   gene            574118..575605
FT                   /locus_tag="LPC_2861"
FT   CDS_pept        574118..575605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2861"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2861"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56762"
FT                   /protein_id="ABQ56762.1"
FT                   /translation="MDFVSEMNKILQMELEQFKEFIQKKLEEDKNYLEKLFWLPNGSQM
FT                   TVLNYLIEQYSEPKLGIDDANRDLLAKIDFVLHEAKDVNVGEPLHQAIVAGKISLALHL
FT                   LGVDENNFTPGESEKTDVLSILSKVKKKIEESFNHVKRCFFDVDKRDGYGRTLLSLALD
FT                   AKRQELLIAILARNPIVHATTLRSSAYVPFQPIHQAVVLDYAEGITLLASMGAQLTNPL
FT                   GSMRDTPVILAARLGKINALAALLELPTQSLSLESENNHLFEDKQTGHTAVEELCERMA
FT                   NENDKAEALRGIAMLICRGAEPPRNEKMRNLLSSNRVAFLKAVSTYLADKPQLVDAFVE
FT                   RCHLRESALHNIVYADHSWGSSIRHLLGVPSEAALIVEELVTRKYSDPSFASENVSSLS
FT                   TTATENLRSERNPLKLYAEFVRRYTQAYDSQMITNRWSTMRWMIAEGNCDWDTVVRYSK
FT                   NHPTSRTRIVLNEMFNPIPRVHEDIESQQNSPRVVLK"
FT   gene            575814..576956
FT                   /gene="hflK"
FT                   /locus_tag="LPC_2860"
FT   CDS_pept        575814..576956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflK"
FT                   /locus_tag="LPC_2860"
FT                   /product="protease subunit HflK"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2860"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56761"
FT                   /protein_id="ABQ56761.1"
FT                   /translation="MGWNEPEKGKDPWSGKNQPPDLDEALKRIQDKLKKTFFGGTGKSN
FT                   NNSSGGSSGGLLAVTVLLIAFILWALSGIFIVDPAEQAVILRFGKYAETVGPGPHWIPR
FT                   FISSKIVMNVDRVLDYSYSAQMLTSDENLVSVSLAVQYRINDLSEYLFNVANPEESLQQ
FT                   ATSSALRQVVGTTTLDQIITEGREVWGGRVQETLTKTLESYKTGILIVNVSPQPARAPE
FT                   SVQDAFDDAIKAQEDEKRFKEQAYAYAAKVVPIAEGKASRIQQEAEAYSKQVVLRAQGE
FT                   VAEFLALLPQYNAAPQVTAKRMYLEAMQKVMNKSSTIIVDSKAGNLLYLPLDKLLGNQY
FT                   VQQSGNLKAIKNGANVSNEEDNLILSGRDLTRPTYSQGRD"
FT   gene            576959..577873
FT                   /gene="hflC"
FT                   /locus_tag="LPC_2859"
FT   CDS_pept        576959..577873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="LPC_2859"
FT                   /product="membrane protease subunit HflC"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2859"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56760"
FT                   /protein_id="ABQ56760.1"
FT                   /translation="MNAFKTTLGVLIFLVLVLLFTSMFTVTQGQQGIILRLGRLVKDPQ
FT                   TDAVKVLNPGLHFKTPFIESVRIFDTRIQTMDIKSTRIVTKEKKDVMVDYYVKWRISDL
FT                   AQYFKSTGGNEFKAETLLEQQLNTLLRAQFGKRTISDAVSGGRDDVMEILRNAAEKQAG
FT                   ELGIKVVDVRIKGIELPSNTSNAIYQRMRADMQKIANRHRADGQAAAEQIQAKADADVT
FT                   VLLAKTNSNAQRIRAVGEAEAAAIYSKAYTQNPDFFALYKSLLAYEASFHSKKDILILD
FT                   QSSSFFDYFKQAMPKNDGTAAKK"
FT   gene            578008..579303
FT                   /gene="purA"
FT                   /locus_tag="LPC_2858"
FT   CDS_pept        578008..579303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="LPC_2858"
FT                   /product="Adenylosuccinate synthetase (IMP--aspartate
FT                   ligase) (AdSS) (AMPSase)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2858"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56759"
FT                   /db_xref="GOA:A5IHA9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHA9"
FT                   /protein_id="ABQ56759.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKIVDLLTQDAQVVVRYQGGHNAGHTLK
FT                   INGVKTVLRLIPSGMLRPNVTCYIANGVVLSPQALLSEIKELEGNGVNVRERLRISLAC
FT                   PLILPYHIALDKARETHMGKSAIGTTGRGIGPAYEDKVARRALRVGDLFHRDRFANKLT
FT                   ELLDYHNFVLTQYFKQPAVDLESLLDESLQWVEELRPMVCDVSACLHEHRKQGENILFE
FT                   GAQGVYLDIDHGTYPYVTSSNTCVGSVINGAGFGPRYIDYVLGITKAYTTRVGGGPFPT
FT                   ELLDDVGKRIAERGQEFGAVTGRPRRCGWFDAVLLKRSIELNSISGLCVTKLDVLDGLE
FT                   VLRIAVAYKDRDGNILSRPPLAADDFNDLLPVYEELPGWQESTADVTLMSDLPANARAY
FT                   LKRIEEILGIPIDMLSTGPERDSTITLRGPFL"
FT   gene            579812..580093
FT                   /locus_tag="LPC_2857"
FT   CDS_pept        579812..580093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2857"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2857"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56758"
FT                   /protein_id="ABQ56758.1"
FT                   /translation="MGSIIGVEKNYFWKRMDDGSKPGYAEIIREKTAVIRPAGGVIGFL
FT                   PNDIHSVMNESDDVAISLHVYGKNLNYTGRHQYDPVNNLMQPFIVNYS"
FT   gene            complement(580293..580751)
FT                   /gene="argR"
FT                   /locus_tag="LPC_2856"
FT   CDS_pept        complement(580293..580751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR"
FT                   /locus_tag="LPC_2856"
FT                   /product="arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2856"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56757"
FT                   /protein_id="ABQ56757.1"
FT                   /translation="MTHDAFLDDLILSIVQTESIAEQSDLQNSLRKRGYEIPQATLSRR
FT                   LKKMKIAKVSGYYKIIDYNQPGLPLVLNVQISDFGLIILQTHPGNANSLAYYIDRKYVS
FT                   FSIKDSSNSGILGTIAGDDTVLLIIKSKSDQQKVLDILMKEFPYLFAS"
FT   gene            580882..581616
FT                   /gene="yqiX"
FT                   /locus_tag="LPC_2855"
FT   CDS_pept        580882..581616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiX"
FT                   /locus_tag="LPC_2855"
FT                   /product="amino acid (glutamine) ABC transporter,
FT                   periplasmic amino acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2855"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56756"
FT                   /protein_id="ABQ56756.1"
FT                   /translation="MRKVFSLLLISSIIVISSCSEQKNQNTLRFSTSAEYPPFEYIENG
FT                   EIKGFDIDLAKLIAKELGKEAVFDNMQFSAVLPAVNSGQDDVAIATITITEERKKNFDF
FT                   SKPYYFEGMAAVFDNSQPVKEISQLTGKKIAVQLGSVMEIWLHQNFPKAEIMALDNNNQ
FT                   AIEALIAGHVDVVLMDGAQGGVYSKKYPGLSYSILAKANEGYGLVLKKGSPLRDEINSA
FT                   LENLKAKGEIQKLESIWIKGSI"
FT   gene            581613..582260
FT                   /gene="yqiY"
FT                   /locus_tag="LPC_2854"
FT   CDS_pept        581613..582260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqiY"
FT                   /locus_tag="LPC_2854"
FT                   /product="amino acid (glutamine) ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2854"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56755"
FT                   /protein_id="ABQ56755.1"
FT                   /translation="MTEIVQNLFFIGKGIVLTMQLLTGGMLIGVLLGTLLSICRHQGVA
FT                   CFVINRFISILRGTPLILQLSFIYFAVPVLLGMRPSILVAGIVAFGLNSSAYFAEILRA
FT                   GIESLPKGQFEAALTLQIPTFYLWKDIILPQVIKNIFPAMINEMIALLKETALISTIGG
FT                   MDLMRQAQTLAAQQFTYFMPLCITGFYYYSLVLLLEALGKKIEKRGHYAASH"
FT   gene            582244..582912
FT                   /locus_tag="LPC_2853"
FT   CDS_pept        582244..582912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2853"
FT                   /product="amino acid (glutamine) ABC transporter, ATP
FT                   binding component"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2853"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56754"
FT                   /protein_id="ABQ56754.1"
FT                   /translation="MLQVINASKKIGNAQVLNEINLSIQANSIVGLVGPSGSGKTTLLR
FT                   CIQQLESIDSGSIQCEGKSGFMFQDFQLFPHMTVLNNLIYAPYLHDKTADHMANAWALL
FT                   AMLGLSDKAHSYPQGLSGGQKQRVALARSLMMKPDLLLCDEPTSGLDMATTNDVIALLN
FT                   TVKTLKITMLIASHDLFFLSNIAERLLVVKQGQLIADFKTQEVSDPILYLQQFYQGEIL
FT                   "
FT   gene            582909..584126
FT                   /gene="argG"
FT                   /locus_tag="LPC_2852"
FT   CDS_pept        582909..584126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="LPC_2852"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2852"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56753"
FT                   /db_xref="GOA:A5IHA3"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHA3"
FT                   /protein_id="ABQ56753.1"
FT                   /translation="MKKVIKKIALAYSGGLDTSIMIPWLKEHYEHAEVIAVICDLGQQE
FT                   DLDTIKNKALKSGASKAYVVDVKNEFAIQYLWPLVKSGALYEDQYILGTISRPLIAQKL
FT                   VEIALTEQVNAVAHGATGKGNDQVRFEYSIKALAPQLEIIAPWRTWDIKSRQEAIVYAK
FT                   AHGIEVPVTPKAPYSRDHNIWYISHEGGVLEDPSQEMPDDVLLMTAPVSQTPDEEEVVV
FT                   LDFKKGVPVALNGQELSPVDLLNSLNQKAGQHGIGVADIVENRLVGMKIRGIYEAPAAA
FT                   VLYKAHKLLESLCLTRSTLHLKQSLQQTYANLVYEGRWFSQTKQALDAFIDVTQQHVTG
FT                   CVKLKLFKGNIIPAGMHSPYSLHHPELATFEEDNVYNQKDAEGFINLFSLSAKIYSQVH
FT                   QEGNYD"
FT   gene            584119..585354
FT                   /gene="argH"
FT                   /locus_tag="LPC_2851"
FT   CDS_pept        584119..585354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="LPC_2851"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2851"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56752"
FT                   /db_xref="GOA:A5IHA2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IHA2"
FT                   /protein_id="ABQ56752.1"
FT                   /translation="MTNKTWGGRFKKSLDSGVNQFNASLSFDHVLFDQDINGSQVHVKQ
FT                   LAKQKILTEVESQAIYSALEEIRSEIKQGQYSFNVRDEEDIHMFIEQLLIQKIGDLGKK
FT                   LHTGRSRNDQVALDLRLYTRDKGCLINELLTRLIDCLDDLTSKHQQDLMPGYTHLQQAQ
FT                   PVTLGAYFNAYQCMFGRDKSRLEDWFKRMNYSPLGAGALAGSTLPLDREWVAESLGFAG
FT                   IIPNTLDAVSDRDFVIELCSVAAMIMMHLSRLCEDLILWSTQEFNFVILDDAFATGSSL
FT                   MPNKKNPDVPELIRGKSGRVYGHLMAILTVMKGLPLAYNKDMQEDKEGLFDTINTIIAC
FT                   LQMITPFLQSLTFNTLLMKTKAQSGYLDATAILESLVMKGMPFRDAHHQVGAWIAEAIE
FT                   KQCSLNELLKGG"
FT   gene            585357..586472
FT                   /gene="argF"
FT                   /locus_tag="LPC_2850"
FT   CDS_pept        585357..586472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="LPC_2850"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2850"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56751"
FT                   /protein_id="ABQ56751.1"
FT                   /translation="MSFSTSTNLTPIEMQDDDLEKIQSQNSPSAINEVKTNTFVINLQQ
FT                   AIFGLETGSEAVDFDSHKNTGFPFPAGEYKPRHFLTGTELAREEIQFVLSQARSLKQNP
FT                   GLYNQALANKSLVMIFEKPSFRTRLSFALAIQSMGGIVVESIANSRKQETPADMARVLN
FT                   GYADFVMVRTHEDSFLQEMAEYSKIPIINGLSALHHPCQTLADLLSLEEQFGALEGLTL
FT                   TYIGDGNNILHSLMLLAPQLGVTVHYCCPKSNQPNEAIIKEAQSKTGKQMIYCFDKPEE
FT                   AVKQADAVYTDVWTSMGFDNPEAGKIFKGFQVNETLMSHAKPDSVFMHCMPMERGKEVS
FT                   ATLPDSASSIIFRQSENRMHVQKALMLFLDQ"
FT   gene            complement(586562..588037)
FT                   /gene="add"
FT                   /locus_tag="LPC_2849"
FT   CDS_pept        complement(586562..588037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="LPC_2849"
FT                   /product="adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2849"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56750"
FT                   /protein_id="ABQ56750.1"
FT                   /translation="MNITRLLAFFTSFFLLCPIYASVDSYFSHIKKDSSALYAFFKTMP
FT                   KGGELHYHLAGGAYPETMLALAANGNYCLDKHSFAVSKDSSHCEGVNVKEVFNNPELYS
FT                   NIIKDWSMKDFIPGKESGHDHFFNGFVKYMPIVFDYRPQLLADIVQRAAQQKEQYMEIM
FT                   IIPDNAHSLTYGDLIKDIPSYDQKRHLLLANKDFQSNIKNTVLESDRILTKASQELGCK
FT                   DNPSSDSCHVKIKFIYYVLREQPVDNVFAQALNAFEAVSKSKGNLIGVNLVQPEDGIIS
FT                   LRDYHKHMSIFEYLHRIYPNVPITLHAGELSPQAVTPENLSNHIRDALLIGHAQRIGHG
FT                   VDIGYENNAEDTLKYMASHHIPVEINLISNLKILNISGRNHPLNYYLTHNVPVVLSTDD
FT                   EGVLRTDLTQQYVEAAKEHGLNYQQLKQINRNTLTYSFLPGKSIWANADKAELIPDCHD
FT                   LGSKSCQKFIEHNEKAKLQWSLEQQLIAFEKNY"
FT   gene            588212..589327
FT                   /locus_tag="LPC_2848"
FT   CDS_pept        588212..589327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2848"
FT                   /product="leucine-, isoleucine-, valine-, threonine-, and
FT                   alanine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2848"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56749"
FT                   /protein_id="ABQ56749.1"
FT                   /translation="MPYFYTRSAPLFFVFVIALIFINFSYAHEFQTDSKNKHKVDVHIG
FT                   IYAPFSSHSAFIGRNILAAMEMGSERIQSSDIHYSFYTLDQLPKNKNAGLVLQKFIDTH
FT                   HINVLVTGGKETGLIAAPIAKKNNLIHFSLTNNTEVADGRNNFIVWSPAYDQAKVLVNE
FT                   LKRQQVHHLGIITANQPSSTALTHSVIKQLQADSHIDVAASEYFEPGNKDFSRLANRIK
FT                   RKNADMYLVMASPEDIKLIQEQMEADKQHVPITSIVERATPEVVKVFEGQWYVDSHEMQ
FT                   PDFINEFKKNYLNYPVTEAGYAFDLFQLLNKSIVMAIKTQGSPTSQEVVHQLHDIANGT
FT                   GVMGTMVLDSKGSLFTKSEVKTVKNGEIHTV"
FT   gene            complement(589399..590736)
FT                   /gene="ctpA"
FT                   /locus_tag="LPC_2847"
FT   CDS_pept        complement(589399..590736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="LPC_2847"
FT                   /product="carboxy-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2847"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56748"
FT                   /protein_id="ABQ56748.1"
FT                   /translation="MVIKKLFSSTLALVYALTLMLPLTAFSAEETNSNYSNTKRIPLED
FT                   VQRFSNAIGEIKKYYVKPVDDKELFDNAIRGMLTGLDPHSSYLNEEEFKELQTSTSGEF
FT                   GGLGIEVTMEEGVVKVITPLVDTPAFKAGIKSGDYIIKLGKESVQGLSLKDAVNLMRGK
FT                   PGTTIELTILRKGVNKPLTFDLIREVIQIKSVKSKMLSEGYGYIRLTQFQALTGKDMIK
FT                   AIEQLKQQAGGKLKGLVLDLRNNPGGLLDSAIQVSDAFLGNDKAGKQEMIVYTEGRLPG
FT                   SKFTALANPGDVLDNAPIVVLINNGSASASEIVAGALKDNKRAIILGTKSFGKGSVQTV
FT                   LPLDGKTGIKLTTALYYTPSGVSIQAKGIIPDIVVEEVDVPKNAVKKDTLAGFTEADLN
FT                   GHLINKDNSENTESKNNQIQTGDLIHEDYQLYAALTVLEGMALANR"
FT   gene            complement(590817..591959)
FT                   /locus_tag="LPC_2846"
FT   CDS_pept        complement(590817..591959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2846"
FT                   /product="Membrane-bound metallopeptidase"
FT                   /note="COG4942"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2846"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56747"
FT                   /protein_id="ABQ56747.1"
FT                   /translation="MRMSSLSNYLSNAPLGLALMVILFFCNGLEAKTAPNSITQAQTKL
FT                   KQLDAKINKLKQVLANAQDKRTVLNQELGSTEKQIGEGIRKLRIIQANMSAKEKSIAEL
FT                   QGKINHLNERLQTQQEMLANHVRARYQMGEYQPLKWLINQDEPFKINRILTYYQYIIRS
FT                   RQQLIDEIARTRQNLNDSKTKLGNELAENKQLQFKLSQNQKQLEQNKRYHSTLIQSIDN
FT                   DIQNNQQSLKDFQKDRDNLSHLMKSLSQQSVIQSGKPFTGMRKKLPLPVQTTRRSLRRM
FT                   NQGVTFFADEGSIVTAVYPGKVVFSDWLKGYGLLLIIDHGQGFMTLYAHNQSLFKRKGQ
FT                   IVQQNEQVASVGHTGGIKQNGLYFEIRQRGKAVNPLDWLS"
FT   gene            complement(591946..593490)
FT                   /gene="gpmI"
FT                   /locus_tag="LPC_2845"
FT   CDS_pept        complement(591946..593490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="LPC_2845"
FT                   /product="phosphoglycerate mutase, 2,3-bisphosphoglycerate
FT                   independent"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2845"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56746"
FT                   /db_xref="GOA:A5IH96"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH96"
FT                   /protein_id="ABQ56746.1"
FT                   /translation="MSHNAPLVLMILDGWGYNENDRYNAIAKANTPQWDEWWQTCPHIL
FT                   LKASGLPVGLPDEQMGNSEVGHMHIGAGRVIQQDFTRINEAINNGKFAKNAVFHEVIDQ
FT                   LKKTEKSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRSVHLHLFLDGRDTPPQSALD
FT                   SLKCLNEELVKHPVATINSICGRYYAMDRDKRWERVEPVYNLLTQGKSEHQFPDAETAI
FT                   HFYYKNKISDEFVPPTLIGKEHSIQDGDAVLFFNFRADRARQLTSTFLDPLFKGFERKT
FT                   LPKLSYFVSMTQYDKNLITTIAFPPVPLNNTLGEVLSSHGLSQLRIAETEKYAHVTFFF
FT                   NGGCESVFTNEERIMVPSPQVATYDLQPEMSAPELTKTLIAAINSRDYHVIICNYANAD
FT                   MVGHTGNFEATVQAIECLDQCMHQVWQALKNNGGKLLITADHGNAEEMFSEATNQAHTA
FT                   HTSEPVPFLYVGGGWHFTHAEGSLIDIAPSLLALLGITPPPEMTGRILLEKNHAHV"
FT   gene            complement(593593..593889)
FT                   /locus_tag="LPC_2844"
FT   CDS_pept        complement(593593..593889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2844"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2844"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56745"
FT                   /protein_id="ABQ56745.1"
FT                   /translation="MSRDTKNLILKAIILFVSLTALVNHAMAFNLLGIGPNPKNLPKDN
FT                   DVRATFNHCKSCDKSTTPPLIITTPVPIIYYPGCRPIQSCDAYGHCEQKEDCY"
FT   gene            complement(593966..595033)
FT                   /locus_tag="LPC_2843"
FT   CDS_pept        complement(593966..595033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2843"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2843"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56744"
FT                   /protein_id="ABQ56744.1"
FT                   /translation="MALTAGDIISLGDLYGIVGKPISHGLTKLEKQTRFKEVFNSFARN
FT                   AIAVSEVEDLNSVIRAEMREVESGIAKGETAEAIYKRIGNEVGRQINCITGGGCNSLTW
FT                   WLNPGRYLKLAMENYDHFTPNNLIAYKSGHHVALQQALKAKRTGKRSDLEIAYAMDAFA
FT                   CHYLSDHFAAGHLRTPREELSAIITPTVLGALLSNYMHNEENKYGIHVTNNLGEQWMVY
FT                   GDYSYFNPFNQTNQQMLLKALQASADEIFEAYYSGVLPEKNQIEDMIPHITKLNDENNM
FT                   DIAPMFYWDKENKQLLRRTNLTNPYDRHWTNSWWGWSTLLLLKTQYGITSTVQLSLSKY
FT                   LSQYVPEELQDNPLV"
FT   gene            595584..596300
FT                   /gene="uppS"
FT                   /locus_tag="LPC_2842"
FT   CDS_pept        595584..596300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uppS"
FT                   /locus_tag="LPC_2842"
FT                   /product="undecaprenyl diphosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2842"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56743"
FT                   /protein_id="ABQ56743.1"
FT                   /translation="MNHKLPQHIAVVMDGNGRWAESRGLPRVEGHKAGLDSVKKIINCC
FT                   LEKKISCLSLFAFSSENWSRPVTEVNFLMELFLEALRKEIDDLNQHGIRLKFTGDREPL
FT                   SQVLQKQMCDAEALTKNNQQLILNVVVNYGGKWDIVTAAKKLIHAVLDGKLACDEINEA
FT                   VFAQFLDTSGMPEPDLFIRTSGELRISNFFLWQLAYTELYFTDVHWPDFNEHEFELALT
FT                   SFAKRARRFGQISQSE"
FT   gene            596448..597110
FT                   /gene="cdsA"
FT                   /locus_tag="LPC_2841"
FT   CDS_pept        596448..597110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="LPC_2841"
FT                   /product="phosphatidate cytidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2841"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56742"
FT                   /protein_id="ABQ56742.1"
FT                   /translation="MIPVDNLTVQACFLIFLLMCFWASGYFYPYWLSVGLLVWLLNGLA
FT                   ILTYPRSQNYWGYPIVVAIASLILLPLFTQSLIQISFLQQGKELLVYLLFLIWASDIGA
FT                   YLAGKQWGKHKLIPKVSPGKSWEGVTGGVILAMIVATLGYYYFIPYSIYIWFGLALSTV
FT                   VISIFGDLFISILKRRCQLKDTGNIIPGHGGILDRLDSLIAALPWFYFGLTYIPLGI"
FT   gene            597143..598495
FT                   /gene="ecfE"
FT                   /locus_tag="LPC_2840"
FT   CDS_pept        597143..598495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecfE"
FT                   /locus_tag="LPC_2840"
FT                   /product="membrane associated zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2840"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56741"
FT                   /protein_id="ABQ56741.1"
FT                   /translation="MLSTLLYFLLALVLLVTIHEYGHFQVARWCGVKVLRFSFGFGKIL
FT                   ARFYDKKGTEYAWSLFPLGGYVKMLDETEGEVSEKEKPFAFNNQSVLVRIAIVVAGPLF
FT                   NFIFAFVALWLVLVIGMHSLAPMIESVKPNSIAARAGLLPKQEILALNGVKINSWRDFQ
FT                   YEIMPLIGSQETVSLTVKSMINGEESTLYLPLDKWQLDDKKPDPIKSLGIVPFIPTIPP
FT                   IVGEVVPDSPAEKAGLKIGDEIISVNGQHFNDWLYLVSYVRERPNSQINLDIKRQGKLL
FT                   KITVHTGSQDNNGKLEGLIGVRSQKVDWPAHWLRLEQQPPISALGTAFKQTIQLTGTTF
FT                   ILMGRLVTGKLGLNSISGPVGIAQGAGDSGRGGLVSYLFFLALVSISLGALNLLPIPML
FT                   DGGHLLYYVLEIIRRKPLSDGVKSVGIYFGLLLLVALMFVALSNDISRLTS"
FT   gene            598666..600978
FT                   /locus_tag="LPC_2839"
FT   CDS_pept        598666..600978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2839"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2839"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56740"
FT                   /protein_id="ABQ56740.1"
FT                   /translation="MKKVSNKLILGVCCSTLLAWSSQSFSSDTFIVKGIRVNGLQRVST
FT                   GTVLNYMPVQVGEEISSSSTAQIIRALYETGFFQSVSLERQGNVLVVNVIERATIGSIT
FT                   VVGNKEIPSDKMKAFLKEMGLVKGRVFQRSSLERLEKELKQAYTARGKYNSRIETKVTP
FT                   LTENRVAISITVSEGRVSRIKEIKIIGNHDFKANELLPELTLSTSNLFTYFTKKDQYSK
FT                   PGMDASLEALRSFYLDRGYLKFNVVSSQVLLSPDKKDVYINIHIEEGPQYHFSGYDVVG
FT                   KTILPKEKIDSLIQVKKGDVFSRKKVTESISAIGLALGDVGYGFPAINAEPRIDENNKT
FT                   VFITFVVQPGRHVYVRRINFHGNTKTGDYVLRNVIRQDEGGLLSLHNIKESERQLRMLG
FT                   YLKNIDVKTTPVPGTNNQVDLDVNVEEAPSAEASASMGYGTNGYQFNASVNQRNFMGSG
FT                   RSMGAAFNASQWGQDYSFNYYNPFYTDTGVGRGGSLYYSRIDPKNLNVSTYSSNRYGGD
FT                   ISYNFPLGEKSSFQLGYGYQDINIKSVGYVLPIINFVALNGNHFQEIRLTSGWSRNSYD
FT                   QMPYPNQGFNQQAIAMVALPATSQSLSYYKSSYQAHLYYPLTRGWIFSVLGNVGYGNTF
FT                   DNFGLPFFENYYAGGPVQPGQVRGYDSYSLGPQDNFGNAMGANFLVNGSVGLILPYPLS
FT                   RDNVRTTIFADAGNVFASGTPPALRGTPAGPMRYSAGVSLEWRSPFGPLSFSLAKALNP
FT                   QPLDQTQLFQFALSSGF"
FT   gene            601092..601592
FT                   /locus_tag="LPC_2838"
FT   CDS_pept        601092..601592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2838"
FT                   /product="outer membrane protein OmpH"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2838"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56739"
FT                   /protein_id="ABQ56739.1"
FT                   /translation="MKRLGAVLVALFLGLFGTTVFADWAKIGVVDLQKIMQTSNQMKEI
FT                   QQKLEKEFKPRRDKLVAMEASLKSDMEKFKRDSAIMSASQKKELEKKIVASQQQFERDG
FT                   QQYQQELSTAHNEAMEGLYNKVRTAITKIAKDEKYDIIVQKDAAPFSSESLDVTDKVIK
FT                   AIN"
FT   gene            601594..602625
FT                   /gene="lpxD"
FT                   /locus_tag="LPC_2837"
FT   CDS_pept        601594..602625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="LPC_2837"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl) glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2837"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56738"
FT                   /protein_id="ABQ56738.1"
FT                   /translation="MADALLTLEELANYLNGVWHGNANHAIFSLSSLARASSKDLAYFD
FT                   NPLLQSVLNSTRAGAVLLKPEHKDWCPVNCIVVPNPSEAMFKAAKSLPHLATNVCGIHP
FT                   TAQIHKSAQIGQYVSVGANSVIGENVQLDDYVTIGSNTTIESSVLIGRGSQLGSGAIIH
FT                   SGTVLGQSVIIDSGCIVGAAPFNCYKEHGVWQQAPNFGGVVIGQRTQIGANTVIHRGSI
FT                   GDTYLGDGVCIDSLVLIAHDVYIGNNTAIAGSAAIGALVQIGSDCIIGGASCLAANIRL
FT                   TNDVVITGMSTVTKSIARPGIYSSGTTVHDHRKWRRNTARFRHLDDYITKLITIEKKLN
FT                   NNN"
FT   gene            602743..603195
FT                   /locus_tag="LPC_2836"
FT   CDS_pept        602743..603195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2836"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2836"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56737"
FT                   /db_xref="GOA:A5IH87"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH87"
FT                   /protein_id="ABQ56737.1"
FT                   /translation="MNESIDINQIFTLLPHRYPFILVDRVIDYKVMEYLIAIKNVTINE
FT                   NFFTGHFPGNPIMPGVLMLEALAQACGILANLSRQPKEGYEFLHYFAGIDNARFKQVVI
FT                   PGDQLRLEVRLAGQKRDFWRMHGEAYIGDKLACSADLLSAAKEIKK"
FT   gene            603192..603962
FT                   /gene="lpxA"
FT                   /locus_tag="LPC_2835"
FT   CDS_pept        603192..603962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="LPC_2835"
FT                   /product="acyl-(acyl carrier
FT                   protein)-UDP-N-acetylglucosamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2835"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56736"
FT                   /protein_id="ABQ56736.1"
FT                   /translation="MIDERAMIHPSAKLASGVSIGPGTVIGADVEIGENTWIGPHVVIE
FT                   GPTVIGKNNKIFQFASVGDEPQDITYKGEPTRLEIGDNNVIREYCMISRGTVKGGGVTR
FT                   IGNSNYLMAYSHIGHDCMVGNHIIMVNYAALSGHVTINDYAIIGPYAAVHQFCQVGAYA
FT                   FIARATYVTKDVLPYVMIAGHTTSACGINTVGLRRRGFSSAAIDCLRRAYKIIFRKGLT
FT                   VQQAVSELELIQNECPEIIPMIDALNQSTRGIVR"
FT   gene            603966..604370
FT                   /gene="crcB"
FT                   /locus_tag="LPC_2834"
FT   CDS_pept        603966..604370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="LPC_2834"
FT                   /product="CrcB protein, camphor resistance"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2834"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56735"
FT                   /db_xref="GOA:A5IH85"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH85"
FT                   /protein_id="ABQ56735.1"
FT                   /translation="MVVAPYLAVAIGGSLGAMSRYLVTIMAQNAWGIKFPYGTLLVNTL
FT                   GSFLAGFFLIVLVGRFSAEESFRLFLFTGFLGAFTTFSSFAAESLFMFEQGYWFKLITN
FT                   ILVNNVGSLSMVFIGTLVAKYVLLGHQGSN"
FT   gene            604392..605672
FT                   /gene="serS"
FT                   /locus_tag="LPC_2833"
FT   CDS_pept        604392..605672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="LPC_2833"
FT                   /product="seryl tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2833"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56734"
FT                   /db_xref="GOA:A5IH84"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH84"
FT                   /protein_id="ABQ56734.1"
FT                   /translation="MLDNQLLRENPQYVATQLLKRGFQFDAVTFSQLEEKRKALQVSTQ
FT                   SLQNERNLRSKAIGEAKSRGENIEPMREEVNKLGAKLEQQKTELDEVLKQIEVISLSLP
FT                   NIPHESVPVGKDELDNQEIRKWGDVPAFSFPVKSHDELGEALGQMDFALAAKITGSRFV
FT                   VMKGHLARLHRALIQFMLDIHIQQHGYQEIYVPYIVNADSLLGTGQLPKFEADLFKLTG
FT                   DNGYYLTSTSEIPVTNTVREMILSAEQLPIRYVCHSPCFRSEAGSYGKDTKGMIRQHQF
FT                   EKVELVWITKPEDSYNALEQLTQHAEVILQRLNLPYRVVALCTGDIGAGSAKTYDLEVW
FT                   LPSQNTYREISSCSNMEAFQARRMKARFRNPDTNEIQLVHTLNGSGLAVGRTLVAIMEN
FT                   YQDEHGNIHIPDALKPYLGGIDIISVK"
FT   gene            605811..606035
FT                   /locus_tag="LPC_2832"
FT   CDS_pept        605811..606035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2832"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56733"
FT                   /protein_id="ABQ56733.1"
FT                   /translation="MKHFDFSLRIWPKIIDINGKEKYFFRDYLLSHPEAAEKYQQLKIK
FT                   LAQEHKYDREQYTDAKSEFINQILKLAQN"
FT   gene            606206..606469
FT                   /locus_tag="LPC_2831"
FT   CDS_pept        606206..606469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2831"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56732"
FT                   /protein_id="ABQ56732.1"
FT                   /translation="MADQPPKSKWHEIKRLSEGDNKVDNNQAPVSTADRIKKLYLDTQV
FT                   GSPIDTVEEADAQRNNLGPKDTKIENSSPENDEPNPDIPTPG"
FT   gene            606664..606828
FT                   /locus_tag="LPC_2830"
FT   CDS_pept        606664..606828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2830"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56731"
FT                   /protein_id="ABQ56731.1"
FT                   /translation="MASLFFIKEVITVSDKPDSPYILSLQADGNLFPSILQSNLAMTLV
FT                   WSCYGQFIE"
FT   gene            606809..607741
FT                   /locus_tag="LPC_2829"
FT   CDS_pept        606809..607741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2829"
FT                   /product="hypothetical protein"
FT                   /note="protein of ancient origin, eukaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2829"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56730"
FT                   /protein_id="ABQ56730.1"
FT                   /translation="MDNLLNEKKLTIFTSNEIQDNLNRVLKNYEQNGIIGLNGYLNQAN
FT                   RISLLNELEIIQKDAEQDIVRYWNNKIIHFYSKDPLKPESVDREYVTEPYFQASSNKAH
FT                   VFYEVIDNMRVVNRIGHGMHLINRYPMMQRAVYDSPVLLDLLKGIGFKKPICHLSVYIP
FT                   KYPNGIGSEVKPHQESTFAFTEPQSVVVLWVALEDALIENACMYGVLGSNHWPLKWVSK
FT                   VDRETKTRHFEQVHQLHIPDFMTEREFYTALEVKAGDALLFHGNFVHCSPMNTSKNSRK
FT                   ALSFQFIETYEVDYPETNWLYPPNKVYLY"
FT   gene            607777..608589
FT                   /locus_tag="LPC_2828"
FT   CDS_pept        607777..608589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2828"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2828"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56729"
FT                   /protein_id="ABQ56729.1"
FT                   /translation="MSMYDKRQFFKTYFSSASEKSILVKLLDKRFHPPFHTANILDLGC
FT                   HDGALMKNIVNAYAKRLPEKLVITGVDPSLQAIKEYAKADFPIPVQTNTFAGTAEDYFD
FT                   VCTDHFDWIFASQCLYWSPDLPKIIKQIHEAGDSALIVIRGCHGIYEIQSQFRHYIGNH
FT                   LEKFYTDKEVEMALRTQKILFQKESLSTSIRLPDKDSIELKWLILFFLQMEEESLGDKI
FT                   FCEVRDWITSRASGSIHHEVHFFWLGNAIFTGDYNRNFPVKSKKNSMG"
FT   gene            complement(608579..609409)
FT                   /gene="ytbE"
FT                   /locus_tag="LPC_2827"
FT   CDS_pept        complement(608579..609409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ytbE"
FT                   /locus_tag="LPC_2827"
FT                   /product="aldo/keto reductase-like diketogulonate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2827"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56728"
FT                   /protein_id="ABQ56728.1"
FT                   /translation="MDLGFPTFIYGTAWKEKRTSELVELALTTGFRGIDTANQRKHYYE
FT                   EGVGYALQQYYKKSGILRDDIFLQSKFTYAHGQDHRKPYDDTASLTIQVQQSFASSLEH
FT                   LNTDYLNSYILHGPYYQYHFSDEDKEVWNKMESLHKDGKVKHLGISNVSYEQLIELISF
FT                   ASVKPKFVQNRCFARLLWDKQIRNYCQAHGIIYQGFSLLTANQYELRHPKLENLSKKYE
FT                   KSIEQIIFRFSQQIGMLPLTGTTNLDHMKEDLAIHQFRLTDDEINFIENITFIP"
FT   gene            complement(609848..610696)
FT                   /locus_tag="LPC_2826"
FT   CDS_pept        complement(609848..610696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2826"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2826"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56727"
FT                   /protein_id="ABQ56727.1"
FT                   /translation="MTDLRTEIESLIHEGLLPDREYVSAKRFINHYATTSKFWDGLALV
FT                   GITPIINGLYAGYYASRAVWATLRTVGNLLILKPGLAFDAIKDVGCHLTLSTCLLLMAP
FT                   IHALTHAVELLTRVISSWFVGQEQRYDLLETGLMAKWANRANGYQMVNELPSSNYFNKA
FT                   RFFSSYNNAWDCLEQMASPITSLAKSGFHSLVEALYGVDSAIECIVNLAICKPLHAKEN
FT                   FYNLQVHFGLALSLAVMAPINALVEGIAFMTRLGTTWVSACLKPEVTETEQENTTAYQF
FT                   N"
FT   gene            complement(611033..611500)
FT                   /locus_tag="LPC_2825"
FT   CDS_pept        complement(611033..611500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2825"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56726"
FT                   /protein_id="ABQ56726.1"
FT                   /translation="MNAENNVLNTLNSLSKEINKLYGYVTIAGDNFGEPAINSGPCGPF
FT                   ANAFYKIWNQKFTEKVNIAFIMMKNSDECWHILIRLPNGLLFDGGFGVHNEDKWNKDTF
FT                   DIEDMLEYDLQLLEKHSGGLNRTYPRCCPDFSIDVITNLIHKHLELVEKNK"
FT   gene            complement(611484..612242)
FT                   /locus_tag="LPC_2824"
FT   CDS_pept        complement(611484..612242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2824"
FT                   /product="methyltransferase, ubiE/COQ5 family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2824"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56725"
FT                   /protein_id="ABQ56725.1"
FT                   /translation="MTKLKNLDTYLSLCTEVYDLSKPNPPEEDYAFYRSYVINVKGPIL
FT                   EPMCGTGRFLLPLLEEGFEIHGFDASEYMLEALNIKAKAKNLKPTVWRGFVENLTRPEK
FT                   YNLIFIPSGSFCLLIDPATVRLALQTFYNHLSDEGILLFEGETLKAVPQLDVWRGSVWH
FT                   KPNGQMIMLSQLATLKDQVCHSIGKYELVHDNSIIHTEVEELRVRIYDPQELTAILKSC
FT                   GFKNVRLIKAFDSAATPDAQDETIVYECRK"
FT   gene            complement(612208..612816)
FT                   /locus_tag="LPC_2823"
FT   CDS_pept        complement(612208..612816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2823"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2823"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56724"
FT                   /protein_id="ABQ56724.1"
FT                   /translation="MTPHIIGISGITGAGKSTLAKALSLDLKATLISWDDFDDISLEPE
FT                   DYIEWYHKGCNYSEFQREDLAKVLAELKAKREIMHPVLRTLLNPAEYIIFDAPLGKLHV
FT                   QTGEYIDTCVHIEVPLDISLCRRILRDFKDKLQTKENLLEEISFYLNHSRPLFFDDELK
FT                   QNATIVIDGLLSTEVQIQIVKNFLIGKQDDKIKKPGYLS"
FT   gene            complement(612813..613280)
FT                   /locus_tag="LPC_2822"
FT   CDS_pept        complement(612813..613280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2822"
FT                   /product="acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2822"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56723"
FT                   /protein_id="ABQ56723.1"
FT                   /translation="MITIDLLKNHPQSIARCATIWHEILGKIWVPEIPVEQVIQRFSEH
FT                   LNADKLPITFIALDTGKPVGMCSLRENDGIRPEISPWLGSLVVDPAYQRQGIGNRLIEA
FT                   TKNKARDLGFNKLHLFAFDPTIPNYYSRLGWAIIGMDKFKGHPVTVMEILL"
FT   gene            complement(613277..613435)
FT                   /locus_tag="LPC_2821"
FT   CDS_pept        complement(613277..613435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2821"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2821"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56722"
FT                   /protein_id="ABQ56722.1"
FT                   /translation="MITGINHITLAIKDLNKSFAFHAKILVLKQMLPTTILRLKSLIPE
FT                   LVNAGKA"
FT   gene            complement(613432..613995)
FT                   /gene="aacA4"
FT                   /locus_tag="LPC_2820"
FT   CDS_pept        complement(613432..613995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aacA4"
FT                   /locus_tag="LPC_2820"
FT                   /product="aminoglycoside N (6')-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2820"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56721"
FT                   /protein_id="ABQ56721.1"
FT                   /translation="MNINFEKANASHIELIFSWLKEPFVQEFWDNTQAHKDDILNFING
FT                   RTEPSSYADGKYVYWIASGNGHPFAMLMTIQETSEDEIDEIKLINLSKTGHSYGIDYMI
FT                   GDKNYFGIGYGARTLIEFIDFFIKEVDPKADTFLIDPASDNPRAKHVYIKAGFEYVADF
FT                   LMSGDVSGAGKLHHLLIKRIGLIK"
FT   gene            614497..615231
FT                   /locus_tag="LPC_2819"
FT   CDS_pept        614497..615231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2819"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2819"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56720"
FT                   /protein_id="ABQ56720.1"
FT                   /translation="MKEYISALSIDRLTSYEILCPSKVDTDIIGAYHWNLLISQAFYPF
FT                   IHSVEVALRNSIHHAATKKFENEFWFDIVVTDGKSRSILEDTKNDLHRRFGQVTASDIV
FT                   AGLTFGFWTNLIKQKTYTDQFNPNRLWPDLIPSVFPHYARGHDDRKNISKRFEEIRLIR
FT                   NRLFHHEPIWKFKNAQTPQECIAELRRKFNDTFKAIGWISKYKRNCLREFGFVESFKNN
FT                   CTLETLESYKVKGAEILQQLAD"
FT   gene            615234..616457
FT                   /locus_tag="LPC_2818"
FT   CDS_pept        615234..616457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2818"
FT                   /product="site specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2818"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56719"
FT                   /protein_id="ABQ56719.1"
FT                   /translation="MKAKINNTLIKKLLPRDKEYEVHDLDLKGFMIRVFPSGTMRYVCQ
FT                   YKRGKKINLGTVGVMTAAQAREKAIEVLSNANKGIEPTAQKGINKPKTLQEFIESDYKP
FT                   WVLSTHKRGQETLAGLIRCYKAFFSKPLGEITPALVEQWRVKRLNEGTSQATLNRNISM
FT                   LKSLMTKAVEWGFLKENALGKLKPYKIDRSPKIRYLSFAEEARLREALIERDNQLRLMR
FT                   KNGNLWREKRGYDLLPELSEDNACDYLMPMVLLSINTGLRRGELFHLTWDMVNLSEGSL
FT                   ILSGEITKNKHSRYIPLNDEAYKILDNLHKKAERKEGLVFPSKNNQPFNHVKRSWGSLL
FT                   KKANITQFRWHDLRHHFASKLVMAGVDLNTVRELLGHSDIAMTLRYAHLAPEHKVNAVR
FT                   KIDWSMQG"
FT   gene            616462..616881
FT                   /locus_tag="LPC_2817"
FT   CDS_pept        616462..616881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2817"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2817"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56718"
FT                   /protein_id="ABQ56718.1"
FT                   /translation="MNSHTSKYAERNRPIRRIERFILKIMIFVVIPISCILGIVYPTSK
FT                   ISNSLPVLFSLAGLIQLEVAGLFEYIDYLGNELEKIYDKSGRVPSNITRAIYEYYNPEP
FT                   TVKAFINNQLYLNKRVGFYLLLIGGLIQLFTIWLE"
FT   gene            complement(616983..617657)
FT                   /locus_tag="LPC_2816"
FT   CDS_pept        complement(616983..617657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2816"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2816"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56717"
FT                   /protein_id="ABQ56717.1"
FT                   /translation="MKNATKVKKDSSAMGQRIKRARMLAGLSRKDLEEKHGISIHTLQS
FT                   WELGRNPLNKAKAASLVGILNQYDVSCSIDWLLEGIGKGPSVIENEFQNYPFLADTVGN
FT                   LLASEQAIQKEIDFFKTNNPNAVVITVSDDAMEPEYKVGDIVGGIKFINQNKKNQCVGH
FT                   NCIVETTEGTFFRRLIKSEDKYLLVCNNNRTSVSDPVMSADSILSIAPVIWHRWKFDAL
FT                   SN"
FT   gene            617842..618723
FT                   /gene="lvrA3"
FT                   /locus_tag="LPC_2815"
FT   CDS_pept        617842..618723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lvrA3"
FT                   /locus_tag="LPC_2815"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2815"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56716"
FT                   /protein_id="ABQ56716.1"
FT                   /translation="MDMLINQDELAAMSGLPHIQQLAYLRGIRPYMDVKTGITGIKRRI
FT                   SYQSISEQLYIEPHQGIKSQSFSRDQVRRAVSGLVRAGMIEVQSDGMQLILKCPLASRH
FT                   YSAQNKAAINPPQKATIKPHVETLVNNEFSEGEAIKADIAEPQKAAIPLKDNNYIYLLS
FT                   RFEQFWNLYPEKKSHERAFEAFRKISPDEHLLRMMLQALENQIKARNVKIAHGEWVPPW
FT                   KYPSNWLVQKCWEDEVKIEVTQEKRNAKRHPNTELTTVDPFWNPEGEDTASTSEDEYEQ
FT                   SNVINLRCYRQQ"
FT   gene            618740..619048
FT                   /gene="lvrB3"
FT                   /locus_tag="LPC_2814"
FT   CDS_pept        618740..619048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lvrB3"
FT                   /locus_tag="LPC_2814"
FT                   /product="Legionella vir region protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2814"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56715"
FT                   /protein_id="ABQ56715.1"
FT                   /translation="MFTRFAVFYGHLWRSQFKSDGFLEFAKKEWMAGLSKFSDDVLNQA
FT                   IVECRDFCEMPPSLPQLIRICRDIKKRNNVYVTPEEVAPASAEVAEANIKQCKAFLF"
FT   gene            619069..619335
FT                   /gene="csrA"
FT                   /locus_tag="LPC_2813"
FT   CDS_pept        619069..619335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csrA"
FT                   /locus_tag="LPC_2813"
FT                   /product="global regulator (carbon storage regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2813"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56714"
FT                   /protein_id="ABQ56714.1"
FT                   /translation="MLVLTRRVGESVVISEDIYCTIVGYQNDEVRLAFDAPKSIPIHRD
FT                   EIQRRIYRDQIKDNKFVDKAANNESIVDRLINKFKSSASPTNS"
FT   gene            619346..620311
FT                   /gene="virB11"
FT                   /locus_tag="LPC_2812"
FT   CDS_pept        619346..620311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="LPC_2812"
FT                   /product="LvhB11"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2812"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56713"
FT                   /protein_id="ABQ56713.1"
FT                   /translation="MTIDEEQLITVKDRAKEKLRRDLGGLIERALNDPKTVEIMLNADG
FT                   RLWQERLGETMRCIGSINEVRAESIIKTVAGFHGKEVTRFKPMLEGELPLDGSRFAGQL
FT                   PPVVSRPTFAIRKKALSVFTLDEYVRAGIMTDEQNEIIQQAVSNHRNILVIGGTGSGKT
FT                   TLVNAIIHEMVKSAPHERIFIIEDTGEIQCSAENCVQYHTTMDVNMTQLIKTTLRMRPD
FT                   RILVGEVRGSEALDLLDAWNTGHEGGAATLHANNCLAGLHRLKSLITRNPAAPAEIEPL
FT                   IGEAVHCVVHIARTPDGRFVKEIISVEGFKNGQYNIKKLV"
FT   gene            620323..620700
FT                   /locus_tag="LPC_2811"
FT   CDS_pept        620323..620700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2811"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56712"
FT                   /protein_id="ABQ56712.1"
FT                   /translation="MNQLSSFNHKKIWMMGAVILFLFLMTHPASASTAGGGLPFDSWLT
FT                   KIQKSITGPFAFSAAIIGLVAAGATLIFGGELNGFMRTLVFFVLVLSFLVAAQNTMTAI
FT                   TGKGAEISKPSVEMTAIESQP"
FT   gene            620751..620996
FT                   /gene="trbD"
FT                   /locus_tag="LPC_2810"
FT   CDS_pept        620751..620996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbD"
FT                   /locus_tag="LPC_2810"
FT                   /product="Conjugal transfer protein trbD"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2810"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56711"
FT                   /protein_id="ABQ56711.1"
FT                   /translation="MGGDRELVMFSGLLSAILVFAAQDWLAAIAGIVMWFLSLKGLRLM
FT                   AKSDPYMRAVYLRQRRYQAYYPARSTPFRENKRGYQ"
FT   gene            620993..623518
FT                   /gene="trbE"
FT                   /locus_tag="LPC_2809"
FT   CDS_pept        620993..623518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbE"
FT                   /locus_tag="LPC_2809"
FT                   /product="Conjugal transfer protein trbE precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2809"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56710"
FT                   /protein_id="ABQ56710.1"
FT                   /translation="MIELIAFLISTTGLVILGTLFWEIRSKSCGHHVKKHRSHTAGLVD
FT                   LLNYAAVVDDGVIVGKNGSFMAAWLYHGEDNANTTDEAREMVSFRINQALSAMGSGWMI
FT                   HVDAMRRTAPGYSARGYSHFPDPISMAVDEERRQLFEQLGTLYEGYFVITLTWYPPVLV
FT                   QKRFVELMFDDSGERLSQKAKTHQLIETFKQSCRNFESRMSSAVHLERLGSDDKGDTVM
FT                   QDNFLRHLQYCVTGINHPVNLPKNPIYLDALIGGQELTPGITPKIGRKFVQCVAIEGFP
FT                   MESYPGILTALSQLPIEYRWNSRFIFMDAHEAVAHFTKFRKKWKQKVRGFFDQIFNTNS
FT                   GIVDEDALSMVNDAQSAIAETNSGMVGQGYYTSVVVLMDEDRAQVEKAALFIEKNINAL
FT                   GFAARVETINTMDAFMGSLPGHGVENIRRPLINTMNLADLLPTSSIWTGENKAPCPLFP
FT                   PLSPPLMHCVTSGNAPFRLNLHVRDLGHGIMFGPTRSGKSTHLGLLALSWRRYKDARIY
FT                   SFDKGLSMYPTCKATGGEHYTIADKDSKLAFAPLQFLESKADRAWAMEWIDTILALNGL
FT                   DTTPAQRNEIGYAIISMHQSGSKTLSEFVMTIQDEHIRETLKQYTIDGLMGHLLDAECD
FT                   GLGLSSFMTFEIEHLMGLGEKFALPVLLYLFRRIETSLDGRPTLILLDEAWLMLAHPVF
FT                   KNKIAEWLDSMAKKNCAVFMATQHLSHAAKSGILDIIVESTATKIFLPNLYARDPETCV
FT                   IYERMGLNPRQIDIIAQAQPKRDYYYVSEKGQRLYQLALGSMALAFVGATDPDSIARMK
FT                   QLELKYSDGWVSQWLTEKGIQLEQYGEAA"
FT   gene            623515..624258
FT                   /gene="trbF"
FT                   /locus_tag="LPC_2808"
FT   CDS_pept        623515..624258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbF"
FT                   /locus_tag="LPC_2808"
FT                   /product="Conjugal transfer protein trbF"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2808"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56709"
FT                   /protein_id="ABQ56709.1"
FT                   /translation="MKKIKQWLNTKRPEKKNEALTENPFLNARRAWNVHTAGLMKSVQV
FT                   WQLVGLSSLLLALAAVGGLISIGSQSKFIPLVFQQDANGNTLSVTRADRVGQANIDDYR
FT                   AAAAHFIENIRMVSSDVELQKKAVFQVYSYLNQNDAALAKVQEFYSNKQQSNPFERATH
FT                   EIVSIEIRSVLQESDETWQVDWVETVRNRDGTLKEKPYVMKAMITMYQDNELNDVSSES
FT                   ILKNPHLIFIRDFNWSYELKHGEQR"
FT   gene            624255..625130
FT                   /gene="trbG"
FT                   /locus_tag="LPC_2807"
FT   CDS_pept        624255..625130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbG"
FT                   /locus_tag="LPC_2807"
FT                   /product="Conjugal transfer protein trbG precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2807"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56708"
FT                   /protein_id="ABQ56708.1"
FT                   /translation="MKKIMLTFCLLMPLTGFALDNNELATRYFSENDPKLSNQEKQALD
FT                   IAERWQKGDKTSKPFPSSDGSVSFVYGSGQIRVVCAPLQVCDIALQAGEQFNDMNVGDP
FT                   RFIVEPSITGSGAAQQIHLLIKPKDVGLDSSLVVTTDRRTYHFRLKSDRTEFMPYVSFI
FT                   YPDEAKAKWQFIQNVQAERRKMDTLPETNEYLGNLNFNYRIQGHARFKPLRVYNNGVKT
FT                   IIEMPKTMAQSEAPVLLVLRSRGLFQKSESVMVNYRLQGCRYIVDSVFDRAILVIGSGS
FT                   SQEKITITRC"
FT   gene            625133..625543
FT                   /locus_tag="LPC_2806"
FT   CDS_pept        625133..625543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2806"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56707"
FT                   /protein_id="ABQ56707.1"
FT                   /translation="MKELSVLLFALLLSSCASQRYGNFTQVSQGRDVYLAQDAASQLTR
FT                   VYPPAQNTFCISQKVRDAFGISLIHEMRKKGYGVIENNCPKQKANFFYVVDEIKATNLY
FT                   RVSLFIGSQTFSRIYAKTGGKIPPVSAWTHKE"
FT   gene            625549..626799
FT                   /gene="trbI"
FT                   /locus_tag="LPC_2805"
FT   CDS_pept        625549..626799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbI"
FT                   /locus_tag="LPC_2805"
FT                   /product="Conjugal transfer protein trbI"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2805"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56706"
FT                   /protein_id="ABQ56706.1"
FT                   /translation="MNQNNDFLSKDYSPQKLQTAGVKRVNNVPLIIVIGILTVFVVLIA
FT                   FVANKRANAQNQSPEIVKIKSQKKNTMSLAYEVVGNHKVPVVAPQTETITIKQEASLPI
FT                   LEQQDLPQKQETLDQNVTDAEIERIRQEKTQEFEEAVKAKTSIMVDNVRLNNRASVRTS
FT                   MSGNDVTFNVDPSTAFKEQLMLVQGMHNKPMPQTLGGEENEMRWHLNSRLESPNSRYEL
FT                   RAGGVIPGVMVSGISSELPGQIIGQVSQNVYDTATGKYLLIPQGTKVFGIYSSDVSFGQ
FT                   NSVLVAWQRLVFPDGKALDIGSMPGADSAGFAGFRDQVDHHYARIYGSALLMSGIVAGI
FT                   TYSQNSNQPNQFGYSQPTAGSVLSQALGQQLGEVTSQLVSKNLNVSPTINVRPGYRFNI
FT                   IVVKDLTFKQLYRQFAY"
FT   gene            626815..627555
FT                   /gene="trbJ"
FT                   /locus_tag="LPC_2804"
FT   CDS_pept        626815..627555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbJ"
FT                   /locus_tag="LPC_2804"
FT                   /product="Conjugal transfer protein trbJ precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2804"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56705"
FT                   /protein_id="ABQ56705.1"
FT                   /translation="MKFRIMLIYLWTLHVFASGAPVFDFANWIENGKIILNQVSQYKTQ
FT                   IDQYNNQLQQYQNMLENTKSLTSFQWDNANSVINNLLESTNTIDYYKQEAGSLQGYLDR
FT                   FQSQEYYQKTPCFNGNGHCSPEELRKIKQSRLSTSVAEKRANDAMLKGIDKQQQSLKDD
FT                   SEKLRVLQSQAQSAVGQKQALQAASQLASNQSHQLLQIRGLLLAQQNAQAVKDAANANK
FT                   EAIQAAGDEQFRAGTYHKSSGKKW"
FT   gene            627582..627794
FT                   /locus_tag="LPC_2803"
FT   CDS_pept        627582..627794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2803"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2803"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56704"
FT                   /protein_id="ABQ56704.1"
FT                   /translation="MKRLSLSIMVFACLLSGCESTETKARKKSEHLASLTCDSPREGHT
FT                   KEELQAIVEACFRGGSYSKSSGKKW"
FT   gene            627799..629196
FT                   /gene="trbL"
FT                   /locus_tag="LPC_2802"
FT   CDS_pept        627799..629196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trbL"
FT                   /locus_tag="LPC_2802"
FT                   /product="Conjugal transfer protein trbL"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2802"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56703"
FT                   /protein_id="ABQ56703.1"
FT                   /translation="MNKKTTTSLLILCLLGFSVCCHAQGHGIDSRDLLDNILYRFSSTA
FT                   SMWSQTILSYARYLFWSLATISMVWTYGLMALRKADIQEFLAETVKFLVVVGFFYWILD
FT                   NGPAIATAIMDSMRLLAAKASGINEHVSPSDIVDVGFDIVSKAIDSSSIWSPAATTVGL
FT                   IVAGLILIILALVSINMLIILITAWILTYGGIILLGFGGGRWTQDIAINYYKTVLGIAL
FT                   QAFAMILIIGIGKSFVDQYYAAMSENIMLKEMFVMMVVAVLLLVLINKIPPVLSGIVSG
FT                   GGSGGGGGLGLGGALGAAGIAGTALAGAAGAAAVQSAGGLSALQAAFKAASHSIGASGA
FT                   GSVSGDSPGSKQGSLAQAMGQASKFAGSFGSHLASGAFDVAREKAASMKDAFSAKAADT
FT                   TGGKIADAIHQRISSNAESPTINQQVSESQNVTSMGAPEGSFSSCNINSDDEISQFVNQ
FT                   KASGDGQ"
FT   gene            629193..631082
FT                   /gene="traG"
FT                   /locus_tag="LPC_2801"
FT   CDS_pept        629193..631082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traG"
FT                   /locus_tag="LPC_2801"
FT                   /product="Conjugal transfer protein traG"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2801"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56702"
FT                   /protein_id="ABQ56702.1"
FT                   /translation="MSLNKPNKAIGPQVRQKHNEKTNKQLVILVALSLFISMQVGTQFV
FT                   AYKLHFSDELGFSLNHVYFPWQSLWWSLKYHHYYPDYFNAAFGLMAMSGSLFLMLIVFV
FT                   AKHLKKENISEYLHGSARWANRDDLKNAGLFGNEEGVYVGAIEDEKGDIHYLRHNGPEH
FT                   ILTYAPTRSGKGVGLVIPTLLSWKQSCVITDLKGELWALTAGWRQKHANNKVIRFEPAT
FT                   LKGSARWNPLDEIRAGTEYEVGDVQNLATLVIDPDGKGLETHWQKTSQALLVGFILHAI
FT                   YKLKNQGEPATFPNIDRMLVDPNTNIADLLIEMTQYPHVDGKTHFVISASARDMIDRPE
FT                   EEAGSVLSTLKSYLALYRDPIVAYNVSASDFCIKDLMHHASPVSLYIVTQPNDKARLQP
FT                   LVRVMLNMVVRLLADKMEFERVDDGRGNYFVRTKKTYKHRLLCMIDEFPSLGKLDILQE
FT                   SLAFVAGYGLKFYLICQDINQLKSRERGYGPDETITSNCHIQNAYPPNRIETAEHLSKL
FT                   TGQTTIVKEHTTTSGKRFSTFLNQISKTKQEVSRPLLTVDECQRMPGPKKDENGLIKEA
FT                   GDMVVYVAGFPAIYGKQPLYFKDPVFIARASVEAPEQSDILRARLREDEEIRL"
FT   gene            631079..631624
FT                   /gene="traF"
FT                   /locus_tag="LPC_2800"
FT   CDS_pept        631079..631624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traF"
FT                   /locus_tag="LPC_2800"
FT                   /product="Plasmid transfer protein traF precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2800"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56701"
FT                   /protein_id="ABQ56701.1"
FT                   /translation="MKKFTSWIAVLMLSIIGMAFLFMLMGFRVNTTDSIPFGLYRITNI
FT                   KNIKNAYVIFCPDDRPVFKQGLDRGYIGSGLCPGGYGYLMKKVVATNGDQISITSDGVF
FT                   VNRQLILFSKPTLIDGRKRPLPQWRTIDYQIKEDELITMTSQSECSFDSRYYGPIRIGQ
FT                   IKGVIKPIWVNATSGEIA"
FT   gene            631621..631785
FT                   /gene="traD"
FT                   /locus_tag="LPC_2799"
FT   CDS_pept        631621..631785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traD"
FT                   /locus_tag="LPC_2799"
FT                   /product="traD protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2799"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56700"
FT                   /protein_id="ABQ56700.1"
FT                   /translation="MNKEAELMDVISEKLDDLMVPGFIAEVTPIEAEIMGAFSEDALSA
FT                   YDAKEAAYD"
FT   gene            631778..633964
FT                   /gene="traC"
FT                   /locus_tag="LPC_2798"
FT   CDS_pept        631778..633964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traC"
FT                   /locus_tag="LPC_2798"
FT                   /product="DNA primase traC (Replication primase)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2798"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56699"
FT                   /protein_id="ABQ56699.1"
FT                   /translation="MTKLSHHQVVANQIIESLKQGTAPWVKPWEPSTGGGQIPFNPVTG
FT                   KRYRGINALYLMLNQSGDNRWLTYKQAQSIDAQVRKGEKGTTVQYWKFTDEKIKNDDAG
FT                   NPVLDEQGNPVKVQVNLERPKVFYATVFHASQIDNMPELVQKEQDWSLIERAENLLLNS
FT                   GAAIFHSEADRAFYRVSTDSIHLPPKEQFKSAAHYYVTALHALGHWSGHPSRLDRDLRH
FT                   PFGSEAYAKEELRAEIASMLLGSELGIGHDPSQHTAYIKSWIRVLEGDPLEIFRASADA
FT                   EKIVNHICSLEQAQDIQHEQSIVNRDEKNNEETLMESEKNIPEKVWLSIPFKQKELAKS
FT                   VVGKLPDGTPGIAWDKTQKCWYAKPGVSIEKIKAWLPENQNSPEDKALSPADEFKEALI
FT                   SLGAVLTGEHPIMDGKTHRIQMEDDKTGEKAGFYVAHLDGIPAGYIKNNRTGAELKWKS
FT                   KGYVLTDEQKAALKAQVLENQKNRELELVERHKSTALRLKQRLSKMSEITEPTPYMKSK
FT                   GIQVHPDVYTDDDKKLTCIPATDIEGTIWTVQYIAEDGTKRFAKDSKKEGCFHVLGGMN
FT                   KLFDAPVIVIAEGYATAATIKEACGLPAVVSAFDSGNLKSVAKVLHEKYPYTPVMIASD
FT                   DDKHLELTQGINPGKEKALEAAGAVNGFIVMPTFAPHEQSLNPKKFSDFNDLANHSMLG
FT                   LDGVKRQLKPKIEKVAKRCNCLRLLQKSNGIHIA"
FT   gene            complement(633966..634424)
FT                   /locus_tag="LPC_2797"
FT   CDS_pept        complement(633966..634424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2797"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2797"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56698"
FT                   /protein_id="ABQ56698.1"
FT                   /translation="MTVQLIKNFDINIDRYPNQYVGCLVLTKDNKILLQQRPHDWPTYP
FT                   DYLCEFGGRIEHNESPEQAVIRDLEEELGGDVKLKELVSFGAITESMSKHKELIHTFFW
FT                   HDKEGTITGCYEGLPRFFNESAHILLQTKITDGLRWLIDESKKLHLIK"
FT   gene            complement(634435..635202)
FT                   /locus_tag="LPC_2796"
FT   CDS_pept        complement(634435..635202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2796"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2796"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56697"
FT                   /protein_id="ABQ56697.1"
FT                   /translation="MDDKKLILDAANRYGFNLEFRTKKVLEEKNFSVLMNQLMKSGDEF
FT                   VEIDIRAAQYTGREWLIECKGSSDSSHLILIKEDSSNDPKSYNTKRHAIQDSNYRIAQF
FT                   KPDENQYFFTFTGDFFNKTGQQLKKISKNDSENNFFKAQYQILSAIKAISLTDTDKDKS
FT                   KDFPIIIPMIVTNAKIWVIDYNKSSEPGVSQHKWVLHKVKIKNNLFIVPKYEIEYDTIS
FT                   ILVLNIDYLDEFLGCYSYNINGEITIGNSELAK"
FT   gene            complement(635310..637175)
FT                   /gene="traI"
FT                   /locus_tag="LPC_2795"
FT   CDS_pept        complement(635310..637175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traI"
FT                   /locus_tag="LPC_2795"
FT                   /product="traI protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2795"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56696"
FT                   /protein_id="ABQ56696.1"
FT                   /translation="MIIRHIPMKSARLSSFSALVKYITDEQNKQERVGKVRISNCNSVD
FT                   PTWAIHEVLATQARNQRAKSDKTYHMLISFAPGENPPNEVLKAIEERIISSIGFKDHQR
FT                   ISAIHHDTDNLHIHVAINKIHPKAFNIIEPYRAYRTFSEVASKLEIEYGLEITNHQTRK
FT                   SRSENLADDMEQHSGIESLINWIKRNCLEQINQANHWNEVHKILSLHGLEIHIKANGLV
FT                   FYNEAGLMVKASSVSRCFSKKNLESRLGEFKPSPFSTERSRQNIYRYEPLNRKVIGSEI
FT                   YARYLYEKEHGKTLLAEKLKHLREAKARLITKAKKRGRTKRAVLKLMKAPRTQKKYLYQ
FT                   QISKTLLKEIEKVRQNYAKERKHLLELHKNKTWADWLQQKAREGDKEALTAMRYHNRKN
FT                   QSNYSLSAASSNFSLADIKQVDSITKEGTEIYKMDKAVIRNTGKEIKISKGGSIATLKK
FT                   AIEMAQQRYGNCIQVNGSPLFKKIILQITIQHNIPLTFADSEMEAQRQKMVLEQERRYE
FT                   QSRRYRFNDGGRTPRSNEAAGAAIGERGTLSSTKPNADSIRQGPPAKSQNSLRDLSQLD
FT                   MVQLARRSKVLLPDNAHDQLERQRLKSDNYVRRKVSGLSRKVEHK"
FT   gene            complement(637172..637525)
FT                   /gene="traJ"
FT                   /locus_tag="LPC_2794"
FT   CDS_pept        complement(637172..637525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traJ"
FT                   /locus_tag="LPC_2794"
FT                   /product="traJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2794"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56695"
FT                   /protein_id="ABQ56695.1"
FT                   /translation="MDDKNKSPSRKHGRHLRVPVLPDEEISIKSHAAQAGLSVAGYLRR
FT                   IGLGYQIHSAIDKDYILQLSKINADMGRLGGLFKLWLTQDRRVAHFDHRKVKALLDRIQ
FT                   TMQAAMFEVVKKL"
FT   gene            637940..638266
FT                   /gene="traK"
FT                   /locus_tag="LPC_2793"
FT   CDS_pept        637940..638266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traK"
FT                   /locus_tag="LPC_2793"
FT                   /product="TraK"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2793"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56694"
FT                   /protein_id="ABQ56694.1"
FT                   /translation="MKKPLSERVIQNQSEKKNGRTNAKIQFIALKEDIREALDKGCSMK
FT                   AVWETLSDEGQISFGYKAFRHYVLKLIKSEQENIRDDKQSKSKTTNEIKGFTFNPIPNP
FT                   EELL"
FT   gene            638266..638991
FT                   /gene="traL"
FT                   /locus_tag="LPC_2792"
FT   CDS_pept        638266..638991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traL"
FT                   /locus_tag="LPC_2792"
FT                   /product="traL protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2792"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56693"
FT                   /protein_id="ABQ56693.1"
FT                   /translation="MAKIHITMQGKGGVGKSFVSATTAQYKLNKAQSPLCIDTDPINAT
FT                   FHGFKSLNVERLNIMEGDEINPRHFDTLIEKIANTQNDVIIDNGASSFVPLSHYLIANQ
FT                   VPTLLKDMGHELIIHTVITGGQALLDTINGFAQLVNQFPEDIRYVVWLNPYWGKIESEG
FT                   KPFEQLRVYKETKDRIAAIINIPDLKEETFGHDLSNMLQQKITFNEAIDSPDRNIMTRQ
FT                   RLKLIRDQLFSQIDNATVI"
FT   gene            638991..639440
FT                   /gene="traM"
FT                   /locus_tag="LPC_2791"
FT   CDS_pept        638991..639440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="traM"
FT                   /locus_tag="LPC_2791"
FT                   /product="traM protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2791"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56692"
FT                   /protein_id="ABQ56692.1"
FT                   /translation="MSDKINEAIQYIAGKHGVVLGRDDPVLILQTMNDRLLEENRKAQQ
FT                   EMLAQLKEEMENISSQWKVDAKEKAEKVLNAALASSKEAMNKILREATNESVHVMKKLI
FT                   SDSLTEANDLTQQTRKANRFTLLASASMMTVSCAFMLFLLINFAR"
FT   gene            639466..641496
FT                   /locus_tag="LPC_2790"
FT   CDS_pept        639466..641496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2790"
FT                   /product="Putative type I restriction enzyme HindVIIP M
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2790"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56691"
FT                   /protein_id="ABQ56691.1"
FT                   /translation="MKNENNKKIQNLSTFSWSIAEILRGDFKQSEYGKVILPFVVLRRL
FT                   DCILEPSKDAVISAYENLPEGIDDHTKDMMLFSAVGGGLKVYNYNTLTFSKIRNQDPGD
FT                   VHKNLLDYITSFNSSVRDIFLEKFLFTDQLKRLKDGGILWQVFDRFCQIDLHPDNVSNM
FT                   EMGYLFEDLIRRFSEISNETAGEHFTPREVIRLIVDLLLINDAEALAGSGIIRTVYDPA
FT                   CGTGGMLALMEEAMKEYNSKIRVELYGQELNPESFGICTSDMLVTGHNPEQIAFGNTLT
FT                   EDAHKDKKFHYMLSNPPYGVDWKKYQDPIKQEAQEKGMDGRFGAGLPRISDGQLLFLQH
FT                   MISKMRDDEVGSRIGIVMNGSPLFTGGAGSGESEIRRWMFENDWVEAIIALPTDLFYNT
FT                   GIQTYVWMLTNKKDKNRRGKVQLIDASSERFWQSMRKSLGSKRREISDHARSEIVKIYY
FT                   EMLNGGGDWSEFSKIFDRQEFGYREIRIERPLRLNFEGSKERLELLQQENTFLKLSEIE
FT                   QQELLTALNHNTLKQQFKNRDAFEKALKTALKNLSFKLTAPLKKAILTTLSEKDETADI
FT                   CCDAKGNPEPDTDLRDHELVPLKEDWREYVEREVKPFVADAWVDENHKDATDGKVGRVG
FT                   YEINFNRYFYKYVPPRPVAEINEELKQLEAEIANLLKEVVA"
FT   gene            641493..642767
FT                   /locus_tag="LPC_2789"
FT   CDS_pept        641493..642767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2789"
FT                   /product="hypothetical protein"
FT                   /note="similarity to MJ0130"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2789"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56690"
FT                   /protein_id="ABQ56690.1"
FT                   /translation="MNHQTFLDKFVNNYRWKSVPTKRNFRNIKQINKGLIEEHRLALTL
FT                   GGVIDRSLDDVEGLQSSDYSTYQIFEKDDLVFKLIDLENIKTSRVGYVPRRGIMSPAYI
FT                   RLTPTSELVIPRYYYWLFYAAYINNIFNGMGGGVRQNLTPTDLLEFPIPLTPKETQIEI
FT                   TNFLDREIDRIDQLIEKKKKLICLMRERESNAVREAIFSLINEGVQIWKLSHVCRVQRG
FT                   KFTHRPRNAPELYDGEVPFIQTGDVARANKFITKHKQTLSELGISVSAKFPSNTLLMAI
FT                   AANVGNLAITTYEVYCPDSIVGFIPTEKVESEYLYYVLRAISDDISSSSTSNAQDNTNV
FT                   ARLGSLKIPLPSIQKQKNLIDKFKIEENLLFKTTSKISNSITKLNEFRCALISEAVTGQ
FT                   LDIKSWKKRGSTDERLDNIEEAMRA"
FT   gene            642764..645745
FT                   /locus_tag="LPC_2788"
FT   CDS_pept        642764..645745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2788"
FT                   /product="Putative type I restriction enzyme R protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2788"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56689"
FT                   /protein_id="ABQ56689.1"
FT                   /translation="MTDTTKRAYSQDTIRRENVLQYHVIDQLVKKLGYVHRSTEDFDRA
FT                   SALDKTLVMQFIKSTQLDEWKRLQEQYSDSAETEFFKQLEKALKSRGTLDVLRQGIKLI
FT                   PGIKFSLCFFKPASGINKELLQLFEANILSVIDELKYSSKHDNRIDIGVFVNGIPLATI
FT                   ECKNQSTGTTFRHAEKQYRTDRSPAGEPLLTFKQGALVHFAMDEDNVSMTTRLANGKTR
FT                   FLPFNRGHNGGAGNPDIADEFRVGYLYADQPEGKAILSRDILLDIVGRFMHLEVKDGKE
FT                   VMIFPRFQQLDAVLRLLRHAKQHGPGHSYLIQHSAGSGKSNTIGWTAHRMITLHDEKDQ
FT                   PIFNTAIIVTDRIVLDRQLQNTVAQFEQTKGVVKKIDGTSRQLKEAIKQGARIIITTIH
FT                   KFSTDHLKEISGQSKRRFAVLIDEAHGSQSGKYADNLSKTLTREEGNNTPSDIEDMIAE
FT                   YQRQRGPQDNISYFAFTATPRNVTLERFGTKGSDGLPYPFHLYSMRQAIEEGFILDVLQ
FT                   NYMTYKQYYKLEKAIEDDPELQGRRAHRRVARFAILHPTAIAQKVEVIVEHFCRHVMQE
FT                   INGKAKAMVVTQSREHALKYYFGIKKYIEEKQYVGVKALVAFSGELEIDGETYTEAELN
FT                   GFAETQLPEKFDKDFQLLIVAEKYQTGFDQPKLCAMYIDRKLDGLQAVQTLSRLNRTTP
FT                   GKINTYVLDFQNTIEDIQNAFRPFYEVTSLEEISDPNQVYELEGRIKSFSIIDEDEVNR
FT                   FSEVFYKGALDPHDRIALEKLVKNAVQRFEYEEDEGKREEFRQLLKSYMRFYSFVAQVM
FT                   SLQDTWLEKLFSYVSWLNRLLPNREVPPEIEITDDMIRLQAFRIEKKEQGSASLSPGTT
FT                   SPLSAIKEFGANAYTEDEERSLSEIIESFNQRHGTEFTKEDFLRFEKVNQEILSDDNLK
FT                   DMLKNNPPDVVFGAFSQAFFESAIQLFQRDNQLQNIIMTDAEARNQAIKHFFSRALKKV
FT                   RNGI"
FT   gene            645773..647026
FT                   /locus_tag="LPC_2787"
FT   CDS_pept        645773..647026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2787"
FT                   /product="hypothetical protein"
FT                   /note="similarity to Vibrio vulnificus VVA0689"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2787"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56688"
FT                   /protein_id="ABQ56688.1"
FT                   /translation="MSMESQDKFVAKRGKTYLNREELEAHLASVIRLENIGVLLGAGAS
FT                   ISAGGKTMSDVWKSFKDDYSDSADWLQKKTFFNDGSINVEELLDTLEIAEKEWIRQGKT
FT                   KLTKQLQKAKADLYRSIIKASVLQDKWWNSPHLVDLDDGKLDSHRALLQALCGSRQVGQ
FT                   PAPWIFTTNYDLAMEWAGETLGWKINNGFEGLHNRIFSPHVFDLGYSNLSARGEARFGT
FT                   YGFFLAKLHGSLSWQELDGEYLEYPAATIWSDIQNFLDKKDNHKLPIVFPSAAKYIQTV
FT                   GFVLGELLRRFTEFLSKSQTCLITIGYSFSDSHLNQIVKRALLNPTLQLVICLPELEKF
FT                   DGNNININKSIQSILKLESPQITIIGGKEKAFFDSFVTYLPQPVIYDEYALKIKKLINE
FT                   NKEQNTPAREDIGIGENM"
FT   gene            647023..648783
FT                   /locus_tag="LPC_2786"
FT   CDS_pept        647023..648783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2786"
FT                   /product="hypothetical protein"
FT                   /note="similarity to MJECL08"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2786"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56687"
FT                   /protein_id="ABQ56687.1"
FT                   /translation="MNIKGREPFGYVVAIEGSKVTLNLKDTYKGQFAAHRDGVSAVTEI
FT                   NGLFGIDGGNRLLVLRIISLLFLEPKEAHKYTTQKNRLDTEPLRQVLAVVVGHIKRKNE
FT                   ELNFMPDSLASPALGAEAFPLSDNELLAVVQPNIDKDKSIIIGTDTRGFDSIKVNINNM
FT                   LNRHTAVLGSTGQGKSCFIASMLQQMHKFPKPRIVIFDINGEYENAFVNKNDSVKTTKI
FT                   GGKEGYRIPYMALGRHGLSRLLMPSEKTQRPALTFAIDNLNKVKCFKNSSGVGLNDSDS
FT                   PIFFDDCRTGDAKSAWDGIEKLRNGQADFVSKWPKMSALSALVAESYSLKPDRNNSVTR
FT                   DAFLYSNVSPLITRIKRLVDDPLFTSIVDINEKDFIGNDNQGSWEQEGSKVVNDIFGCE
FT                   GSDWSIHIINLRDVAHDLMPLVLGALLELFAFELFNRGQEKSYPTLLVLEEAHHYLRQF
FT                   VGDDEGRHQNLAYERLAKEGRKFGLSLLISTQRPSEMSSTVLSQCGTWVVFRLTSEQDL
FT                   RSVSAASEWVDKLELNRIAGLPRQQALIFGSSFSVPIRIQTHNASPTPKSSDPDFNKWF
FT                   TDKNDSSGVE"
FT   gene            648787..652206
FT                   /locus_tag="LPC_2785"
FT   CDS_pept        648787..652206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2785"
FT                   /product="putative RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2785"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56686"
FT                   /protein_id="ABQ56686.1"
FT                   /translation="MQLIDGMGRFSPTDLTLFMISPFASWMNRFSLEFPDKAPEKDPKD
FT                   ELMEVLQNKGFQHEKAREELFKSQELFVQKIEADTIELKQHLTLEAMKNGTDVIVQGYL
FT                   ENQQFFGYADFLVKAPGESKFGDYHYEVWDAKLSHKAKPEFIIQLCCYAEMLEAIQGRR
FT                   PDNIIIVLGNGKNEAFKVDDYFYYYLSLKESFLLSQEQFDYRNIPDPADSKEWGCWSSY
FT                   AEKLLIERDHLFQIANITKSQIKKLNKAGIQTMQQLIDIKLNRIPGINSDVLERLKAQA
FT                   TIQKESIGKERPQYKIIAPAPNEKSGLALLPPHSPLDVFFDIEGYPLEEGGLEYLWGCT
FT                   YFDEKGNRCFKDYWAHNEVQEKEAFKQFIEWVYARWQRDPMMHIYHYANYEIAACRKLM
FT                   GRYGICEYELDQLLRNEVFVDLYKIVKGSLLLGEPRYSIKNVEHLYRDKRETEVGTGGD
FT                   SVVFYEQWRDLHSRDEQGETWETSHILKNIRDYNIDDCNSTQELVAWLREQQKTNCILY
FT                   LGKTEIVEPEPKEEITQCIELRDRLLTKARQRLSDYPEYAALTENLAWMLEFHRRELKP
FT                   LFWRLFDRLGLSEEELFDDLDCLAFCKRTERAPFKPTSRAKNLAYEYQFDPMQEFKGAA
FT                   DYFYLLGLKDENGKNVKVKFCSEESNLENGVIVLQAREEPPSLITLIPDEYINPDPIPQ
FT                   AIYQLVSDYDSDRVGKCAILDFLRRSKPCIKNHCGGAIAPSHEPNIKLQQIIQAVKNLD
FT                   NSYLTIQGPPGAGKTHTAKHIIADLIKTGAKIGITSNSHKAINHLLLKTKEYCFEQSIN
FT                   GIFACTRDTDSNLQAINISILKNSDLVNNIVASCVIGTTAWGFARDDMVDQLDYLFIDE
FT                   AGQVSVANLVAMSRSAKNLVIMGDQMQLGQPSQGTHPGESGLSILDYLLHQTPTIADDM
FT                   GVFLGTTYRMHSAVNHFISKFIYDNNLEPHPDNDVRVVKVPDGYQGKLNKEAGIIFVPV
FT                   EHEGNAYASDEEVSEINLLAQELIGRTFIEKLGETRKIGWNDILFVAPYNYQVNKLRQA
FT                   LGDQARVGSVDKFQGQEAPIVFLSMCTSDANESPRGIDFLFDKHRINVAISRAQSLAIV
FT                   VGNPQLCTITVNRVKQLKLVNLFNALVNQSES"
FT   gene            complement(652210..652533)
FT                   /locus_tag="LPC_2784"
FT   CDS_pept        complement(652210..652533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2784"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2784"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56685"
FT                   /protein_id="ABQ56685.1"
FT                   /translation="MTFYYEEKLIENDPLKRIVEKSNISVLPWNQASFMNKHEKQTMSG
FT                   RSAFGLYNGVSIVSKFNNKNYIFVLATEHRDHDLARYLLLEKNYELKKLMHGCITSLEG
FT                   WCG"
FT   repeat_region   complement(652704..653930)
FT                   /note="TP3"
FT   gene            654017..655219
FT                   /locus_tag="LPC_2782"
FT   CDS_pept        654017..655219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2782"
FT                   /product="proline/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2782"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56684"
FT                   /protein_id="ABQ56684.1"
FT                   /translation="MTNLARISVFISTAIEVFDLSIFAFLIPVLSSVFFSSHSQTSAIN
FT                   FTILAYVVSYVVKPFSGMVFGYLSDSYGRKQVLSVTTLLMTVSTAVIGLLPTSLPGIDL
FT                   WIALFSCRIIQGLSISGEFSNGLIFAVEQGKDRPAFSGSMAFMGGILGLLLANLSVFIL
FT                   LNHLPYEQMIQYGWRIPFLISAIIWLALYQIRRFINEPFAQKMNDTKHFSSLVKKYRKE
FT                   LVICFVAASLSASAFYMTFVYMPTLLSSVIQNQTHHKSVWVTLIALSVYFICLPLFGSL
FT                   ADRVGITKQITAASALYLLFSYVCFDYISHFNYVVIFCSLILLALIQSLYNSALPAFMV
FT                   SLFPAIHRGKALAISYNTSLSIFGGLMPYVILSHKSFMNPGIVISICAILTLVVLRFVR
FT                   E"
FT   gene            655222..655566
FT                   /locus_tag="LPC_2781"
FT   CDS_pept        655222..655566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2781"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2781"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56683"
FT                   /protein_id="ABQ56683.1"
FT                   /translation="MVVYEVNLSIDNEIYRDYKDWLDEHILEMLKFPGFLNATVMHQSM
FT                   DGDSSDNQKHLTVQYQLESAEDLQNYFEEHAPKMRGDGMNRFKGRFTATRRTFEVEAVI
FT                   TAVNEYVNRV"
FT   gene            655647..655844
FT                   /locus_tag="LPC_2780"
FT   CDS_pept        655647..655844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2780"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56682"
FT                   /protein_id="ABQ56682.1"
FT                   /translation="MEKRVFKEAEAANYICMSRSFLSQDRVNGTLANRTPGPKYIKIGR
FT                   SIRYLKDDLDAWLEQHRKCG"
FT   gene            complement(655907..656674)
FT                   /locus_tag="LPC_2779"
FT   CDS_pept        complement(655907..656674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2779"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2779"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56681"
FT                   /protein_id="ABQ56681.1"
FT                   /translation="MQIECVLLKKNISGIMCKILKSIYISLMLIVSPQIKATSDTCHPK
FT                   INPRLPQYITGYGSLIDEQSKKTTDSKAYENIPVLIKGFKRSWCAHGNLPGFNATFLSL
FT                   NENKKGTFNGVIYRVSDPKEIELYDTRETVYCRKELSAKQIKIYTKNIPEKKQVWIYYP
FT                   KSTQSDHPSREYPIVQSYVDIFIRGCIKVEEKFNIKDFAKECILTTDNWPEQHWVNDRI
FT                   YPRRPSTYEPYARKIDGLLKELLPKQFKNIRIE"
FT   gene            complement(656737..656813)
FT                   /locus_tag="LPC_2778"
FT   tRNA            complement(656737..656813)
FT                   /locus_tag="LPC_2778"
FT                   /product="tRNA-Pro"
FT   gene            657116..657742
FT                   /gene="lvgA"
FT                   /locus_tag="LPC_2777"
FT   CDS_pept        657116..657742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lvgA"
FT                   /locus_tag="LPC_2777"
FT                   /product="hypothetical virulence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2777"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56680"
FT                   /protein_id="ABQ56680.1"
FT                   /translation="MADGDIEIKAGFVDTDLDDRKLTMIDDLNNPLAIVERVYLIWWHW
FT                   ADFHLHVISPHIDTITPAIVIEPELISGSNEHEFVYSIHDSGSKLSTSKSQDMFSAGMS
FT                   MCKLFYTIEKMVHILVDRLKSGGVSMEEEVQIAFAGHEIAQRKAFESIINLPYNVVVTN
FT                   FDPGIWGEKYLQNVKRLADKGYGYPPESPRENYKHPVSSATTARK"
FT   gene            complement(657772..658149)
FT                   /locus_tag="LPC_2776"
FT   CDS_pept        complement(657772..658149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2776"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2776"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56679"
FT                   /protein_id="ABQ56679.1"
FT                   /translation="MFFIKYLGALIYDLIILFILFFAYTSVLLLFTHGQAIPPATRWYQ
FT                   FSLLSITLVYYYGSIRCGGQTVGMKAWRFKLTTDSNKTLSRQQIIARFFYFIPATLIAP
FT                   FCLKGNYVLLHQWTQTRFKKV"
FT   gene            complement(658299..659438)
FT                   /locus_tag="LPC_2775"
FT   CDS_pept        complement(658299..659438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2775"
FT                   /product="Predicted signal transduction protein containing
FT                   EAL and modified HD-GYP domains"
FT                   /note="COG3434"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2775"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56678"
FT                   /protein_id="ABQ56678.1"
FT                   /translation="MIAKRPIYNQQLKCVAFEILSCRNVILNEELTRQFYELIYHTDTQ
FT                   LPLFVPFSLKKLLEQFETPINNPIILKLPADEIESVYSLTELQDSLFSIALLINTPQQL
FT                   AWLNFAEYIGLTEQLMNKSDVTKVVQYSKAKNRKIIAYDLNQHVNFEKCRAMTMDYYCG
FT                   DFLLNYIAEEHTEIAANKLNVLQLIQELQKEDCDLNTITHIIQEDPLLSYQLLKLVNSV
FT                   GFSSGPSIESIDQAVARLGTINLKKWVMLFSMKNISDKPVEILESGLIRAHMAEELAKK
FT                   SSNIFSQSAYTAGLLSILDCLLNKPMPALVEQITLAEEIKNALTNKSGPLGNLLSLVIA
FT                   YEEGHWEEVTQLNINGIDLSQLYIDSLALVSQGTKIMSN"
FT   gene            659759..660133
FT                   /gene="sdhC"
FT                   /locus_tag="LPC_2774"
FT   CDS_pept        659759..660133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="LPC_2774"
FT                   /product="succinate dehydrogenase cytochrome b556 subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2774"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56677"
FT                   /protein_id="ABQ56677.1"
FT                   /translation="MNKKRPINLDLSSLKFPPMAIASILHRVSGVLIFLLFPFVLFILG
FT                   CSLQSEESFAQTKIILANPYYKLLLWAFGASMIYHVIAGIRHLIMDMGFGESLRAGRMS
FT                   AVSIIALAVILAIFLGIWIW"
FT   gene            660127..660474
FT                   /gene="sdhD"
FT                   /locus_tag="LPC_2773"
FT   CDS_pept        660127..660474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="LPC_2773"
FT                   /product="succinate dehydrogenase hydrophobic membrane
FT                   anchor protein subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2773"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56676"
FT                   /protein_id="ABQ56676.1"
FT                   /translation="MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNF
FT                   SQWHLLFANKIFQIATTIGLMALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLLGQ
FT                   FIWGLMIIWGQ"
FT   gene            660476..662245
FT                   /gene="sdhA"
FT                   /locus_tag="LPC_2772"
FT   CDS_pept        660476..662245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="LPC_2772"
FT                   /product="succinate dehydrogenase flavoprotein subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2772"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56675"
FT                   /protein_id="ABQ56675.1"
FT                   /translation="MTVARNRFDAVIIGAGGAGMRAALQMTNSGLKVALLSKVFPTRSH
FT                   TVSAQGGITAALGNADEDDWRWHMYDTVKGADYIGDQDCIEYLCKTGPEAVYELEHMGL
FT                   PFSRMDNGKIYQRQFGGQSKHFGGEQAARTCAAADRTGHALLHTLYQQNLKAKTHVFSE
FT                   WYALDLVKNSQGRIAGVTAMCMETGEIVFFQTRVCILATGGAGRIFQSTTNAFINTGDG
FT                   FGMALRAGIPLQDMEMWQFHPTGIAGAGVLVTEGCRGEGGYLINKDGERFMERYAPRVK
FT                   DLASRDVVARAMALEIRAGKGFDPKGVDHVKLKLDHLGADLIMSRLPGIRELSMKFAGV
FT                   DPIVEPIPVVPTCHYSMGGIPTNMHGQVITKTDGKEHVVEGLYAVGECACVSVHGANRL
FT                   GGNSLLDLVVFGRAAGIHVEELWQSNQLPDMSYVSEDDVVASLVRYERWENSKDGESHA
FT                   VIRDEMQRVMQEDFGVFRTGEVMASGLKRLQALRDRLAHAKLDDKSQIFNTERVEAMEL
FT                   DNLMATAYATALSAIARTESRGAHSREDYPKRDDANWIKHTLYFEEGEVIDYRPVNTSP
FT                   KYVEPFEPKERVY"
FT   gene            662258..662980
FT                   /gene="sdhB"
FT                   /locus_tag="LPC_2771"
FT   CDS_pept        662258..662980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="LPC_2771"
FT                   /product="succinate dehydrogenase iron-sulfur protein
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2771"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56674"
FT                   /protein_id="ABQ56674.1"
FT                   /translation="MADSRNVILSIYRYNPEVDAKPYMKDYEIEIPAKSDPMLLTLLER
FT                   LKAEQDPSITYRRSCREGVCGSDGMNINGTNGLACITHLSQLKTDKIVIRPLPGFPVIR
FT                   DLAVDMTQFYQQYERIEPYLQNDEVAPARERLQSPEERAQLDGLYECILCACCTSSCPS
FT                   YWWNPDKFVGPAGLLQARRFLADSRDKATQHRLDLLQDPFSVFRCRTIMNCTNVCPKGL
FT                   NPTQAIAKIRTQMLTQET"
FT   gene            663038..665848
FT                   /gene="sucA"
FT                   /locus_tag="LPC_2770"
FT   CDS_pept        663038..665848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="LPC_2770"
FT                   /product="2-oxoglutarate dehydrogenase E1 component)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2770"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56673"
FT                   /protein_id="ABQ56673.1"
FT                   /translation="MSSSDLQKEWASSYLSGGSMAYVDSLYEDYLADPDSVSEDWRAVF
FT                   SALPKVNGATKEVSHRDIRDYFLQNADKKLNKIIQIADSQQYQVASLINDFRSLGHLAA
FT                   KLDPLEMTERMPVPRLELAYHNLADVDVNRTFFAGTSFNGPEMTLGEIYNALRETYCRS
FT                   IGIEYMHISDTEVTEWLQHKMESVRGCPEFSKQEKLNILKDLIAADGLERYLGTRYVGQ
FT                   KRFSLEGGDSLIPMMKELIRRSGVNQVKELVIGMAHRGRLNVLVNVLGKEPGLLFQEFE
FT                   GKIKYERTGDVKYHLGFSSDIKTESGAIVHLALAFNPSHLEIIGPVVEGSVRSRLGRRN
FT                   DLAKKDKVVPIVIHGDAAFAGQGVVMETFNFSQARGYCTGGTIHIVINNQIGFTTSNPL
FT                   DARSTLYCTDVAKMVQAPVIHVNGDDPEAVVFATQVAFDFRMKFKRDIVIDLVCYRRHG
FT                   HNEADEPSVTQPKMYKKIKSMPTLREKYGEQLVSANLLTKTELDKLVDSYREALDKGKA
FT                   VVDLVHEDYEGKQSLDWTPYINAKWTDKVDTTISKEELEKISSQLNKLPDGMKLHPVVE
FT                   RLLAERNKMTAGEIPMNWGYAEIMAYASLLHEGYGVRISGQDSGRGTFAHRHAALHDIE
FT                   KGDTFIPLEHISTNPKRYFTVIDSVLSEEAVLAFEYGFASSEPSFLVIWEAQFGDFANG
FT                   AQVVIDQFISSGEQKWGRLCGLVMLLPHGYEGQGPEHSSARLERYMQLCAQHNIQVCTP
FT                   TTPAQIFHLLRRQVIRNFRKPLIVMTPKSLLRHKLAVSPLEALFKGKFHTVIPEIDALD
FT                   AQKVTKVVLCCGKVYYDLLQMRRDKNLNHVAIVRIEQLYPFPKKALMAELEKYQKANEV
FT                   VWCQEEPQNQGVWFSSQHNIRDCLRSDQTLQYAGREFAAAPAVGSPGLHAEQQVALVEQ
FT                   ALLGKK"
FT   gene            665884..667113
FT                   /gene="sucB"
FT                   /locus_tag="LPC_2769"
FT   CDS_pept        665884..667113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="LPC_2769"
FT                   /product="dihydrolipoamide succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2769"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56672"
FT                   /protein_id="ABQ56672.1"
FT                   /translation="MSIEVKVPVLPESVADATVAAWHKKVGDKVSRDENLVDLETDKVV
FT                   LEVPSPVDGVLSDILFNTGDTVGSGDLLAKISQSVSVESQKTEKEEKPVKKEEIKISES
FT                   ESVSTKEDKSTSPVVRRMMAENDLKAGQIQGTGKDGRITKEDVLSYIESNREKSNQTAE
FT                   VQKESSMRALSFGGREEKRVPMTRLRAKIAERLLQAQHNAAMLTTFNEVNLKAVMDMRS
FT                   QYKDSFEKKHGVKLGFMSFFTKAVVESLKRFPAVNASIDGQDIVYHGFYDIGIAVSTER
FT                   GLVVPVIRDADQLSMAEIELAINDAASKARTGKLSMEEMQGGTFTITNGGVFGSLLATP
FT                   IINPPQTGILGMHKIEERPIVEKGQIVIRPMMYVALSYDHRLIDGKDSVQFLVSVKELL
FT                   EDPSRLLLNV"
FT   gene            667176..668339
FT                   /gene="sucC"
FT                   /locus_tag="LPC_2768"
FT   CDS_pept        667176..668339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="LPC_2768"
FT                   /product="succinyl CoA synthetase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2768"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56671"
FT                   /db_xref="GOA:A5IH21"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH21"
FT                   /protein_id="ABQ56671.1"
FT                   /translation="MNLHEYQAKQLFASYGLPVPRGEVAYNVEDALLVASQLSTSRWVV
FT                   KAQVHAGGRGKAGGVKLVSSKDELAAVAKSMLGTRLVTYQTDARGQPVNAILVEETCEI
FT                   DKELYLGAVVDRSTRRVVIMASTEGGVEIEKVAHETPEKIFKVVVDPLVGVMPFQCRET
FT                   AFKLGLKDDQIKQFTHLMMGLGKMFVDCDLSLLEINPLVITKSGQLICLDGKINIDGNA
FT                   LFRQPKLKNMRDVSQEDDRENRASDWELNYIPLDGTIGCMVNGAGLAMATMDVIKLHGG
FT                   EPANFLDVGGGATKERVSEALKIIVSDEKVKGILVNIFGGIVRCDLIADGILAAVKEVD
FT                   VKIPVVVRLEGNNAQLGAEILNKSNLNVIAATSLTDAAKKIVAAVSE"
FT   gene            668414..669289
FT                   /gene="sucD"
FT                   /locus_tag="LPC_2767"
FT   CDS_pept        668414..669289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="LPC_2767"
FT                   /product="succinyl CoA synthetase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2767"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56670"
FT                   /protein_id="ABQ56670.1"
FT                   /translation="MSVLVDKHTKVLCQGFTGKQGTYHTEQALAYGTKMVGGVTPGKGG
FT                   QMHLGLPVFNTMREAVEETQADASVIYVPAPFCKDSIIEAAEAGVKLIVCITEGVPVLD
FT                   MLQVKVYIENNTQARLIGPNCPGIITPGECKIGIMPGYIHLPGKVGIVSRSGTLTYEAV
FT                   KQTTDKGFGQSTCIGIGGDPIPGTSFIDALSLFEKDPKTEAIIMVGEIGGSAEEEAAEF
FT                   IKSHVKKPVVSYIAGVTAPAGKRMGHAGAIISGGKGTAAEKYAALEAAGVKTVRSPADL
FT                   GDAIAEVTGW"
FT   gene            669711..670358
FT                   /gene="pdxH"
FT                   /locus_tag="LPC_2766"
FT   CDS_pept        669711..670358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="LPC_2766"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2766"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56669"
FT                   /db_xref="GOA:A5IH19"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH19"
FT                   /protein_id="ABQ56669.1"
FT                   /translation="MSKFRSLADIRRDYGELQLSEESAENDPISQFKLWFDDVLLNEKN
FT                   DPTAMVLSTVDEKGYPDSRVVLLKGLENGNFIFYTNYQSAKAMQIQKNPYAALNFYWPQ
FT                   MARQVRVRGRVKKISSEQSDAYFSSRPLKSQFSAIVSPQSQEILDRISLEDALNQLIEE
FT                   YGQKPVVRPENWGGYMIIPDEIEFWQGRDNRLHDRIHYYRHGHEWTHRRLAP"
FT   gene            670971..671342
FT                   /gene="letE"
FT                   /locus_tag="LPC_2765"
FT   CDS_pept        670971..671342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="letE"
FT                   /locus_tag="LPC_2765"
FT                   /product="transmission trait enhancer LetE"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2765"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56668"
FT                   /protein_id="ABQ56668.1"
FT                   /translation="MNDTTSLLSHLRLRFNIEHPSYEECYIFGYECALAEVPEEDNPFR
FT                   EGSQEAEQWLEGWWAGIYGEKPLFDLNNIEEDILLDKTTAANDQQYHHKNSFLSLVFEI
FT                   GGAIAASAIVGYQLLELVA"
FT   gene            complement(671413..671802)
FT                   /locus_tag="LPC_2764"
FT   CDS_pept        complement(671413..671802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2764"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2764"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56667"
FT                   /protein_id="ABQ56667.1"
FT                   /translation="MNKLNIAIKEAFESSGSSKEANKVYLEFIKANFIIPIESNSDDSE
FT                   PRVLFLEENNHAFLPVFTDMKYLDAWASEISQHIKLLKLSGVDLLKGLGEKVTVCLDIG
FT                   SELYKEFNPSEIERMRSMVLKLFKD"
FT   gene            complement(672046..672156)
FT                   /locus_tag="LPC_2763"
FT   CDS_pept        complement(672046..672156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2763"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56666"
FT                   /protein_id="ABQ56666.1"
FT                   /translation="MTELKIFFNQEIGVFGYPVDEFKTKLNNPRGFTKKF"
FT   repeat_region   complement(672338..673562)
FT                   /note="TP3"
FT   gene            673688..674971
FT                   /locus_tag="LPC_2761"
FT   CDS_pept        673688..674971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2761"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2761"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56665"
FT                   /protein_id="ABQ56665.1"
FT                   /translation="MGISKVEIYKRKNYLGFAWLVWGLAAAFYFSDYLARVAPGVMHRY
FT                   LQMDFGINEAGFGILTASFYVPYILMQIPVGLTVDRLSIRWLLTIMSLVTAFGCCVFGL
FT                   ADGLLTASIGRMLIGFSAAFAFICSLRLATSWFPPTMLGLLSGLTQALGMLGAAAGEAP
FT                   VSFLVSNVGWRHSMLIIAFLFIALSGLLYQFVQDKPGEHRNEIRSVNRISILDSLKIIL
FT                   SNKQTWLNAMYAGFLFGPTAVIGEAIGPAYLQFGRGLGAHAAAFATGLIFIGWGISGPL
FT                   SGWISDKMGRRKPLMIISAVCGVILSSLFVFIPEMSQTMAYILFFVFGLTNTGVAISYA
FT                   VSTEIHDRSVVGTSIAFTNMTSIFVGALFQPLVGRIIDMVSGPRAYNVETLLLSDFQAG
FT                   LKLLPLCSLVALILAFTVKETYCKPIRH"
FT   gene            complement(675016..675099)
FT                   /locus_tag="LPC_2760"
FT   CDS_pept        complement(675016..675099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2760"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56664"
FT                   /protein_id="ABQ56664.1"
FT                   /translation="MQEDSNLMKNIFIKFHKFDVFTAKIKQ"
FT   gene            675199..676656
FT                   /locus_tag="LPC_2759"
FT   CDS_pept        675199..676656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2759"
FT                   /product="conserved hypothetical protein"
FT                   /note="COG5339"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2759"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56663"
FT                   /protein_id="ABQ56663.1"
FT                   /translation="MKKLTGLVIILAVLILGGYYGMGILTERTVKKTVEVINQSNGLFA
FT                   DIQQYKRGWFCSDALVKWRLHVPERVVKDDDGKLQTTPAQDYQMEMPIKIYHGPIIYAN
FT                   KQLRFGMGFAQTVFPFPEKYNQQFNELFSQDSEKPQLDLSIFVNYLNKSTVELSIPSFK
FT                   LTAKDGNGKFNWMGMDSTTSMSSNLDKVEGEIEFDGAEFSKDDTKLSLGKVISEYDLHK
FT                   TTTGLYLGQASFSLPSLAVVVKDQKMFEISELTLSSSSDIDDNLFSTHFSAALKSLFAN
FT                   GQNYGPGEVEMSLRNLDAEVLAKINEQANAMQRGTDQERQQALMAMLPELPKLFSKGAE
FT                   FEISKLSLKLPQGMIDGNLLITLPKGDNSNPFELIQKTQGNAKLKMPIEVVKQLMQQSI
FT                   MQQMAKQPEMQQALIQQLQSSQGQSNQAEPTPEQIAAMQVDKQINELEQSGLITVDGKD
FT                   YVIEMSLSEGKFTVNGKPFDPSMMKFQ"
FT   gene            676846..677127
FT                   /locus_tag="LPC_2758"
FT   CDS_pept        676846..677127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2758"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2758"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56662"
FT                   /protein_id="ABQ56662.1"
FT                   /translation="MTTISNDAGDTTASLAESVTQSVQKYFSELKGTDPVDLYQFVLEE
FT                   IETPLFRAVMEHCKYNQSRAAIMLGISRGTLRTKLRRYFDDKYVGTRD"
FT   gene            complement(677189..678136)
FT                   /locus_tag="LPC_2756"
FT   CDS_pept        complement(677189..678136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2756"
FT                   /product="Ribose-phosphate pyrophosphokinase (RPPK)
FT                   (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP
FT                   synthetase) (PRPP synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2756"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56661"
FT                   /protein_id="ABQ56661.1"
FT                   /translation="MSTMMIFTGNANPELALKISSHLQIPIGKATVGTFSDGETMVEIL
FT                   ENVRGKDVFVLQSTCAPANNNLMELLIMADALRRSSAGRITAVVPYFGYARQDRRVRSA
FT                   RVPITAKVVADMMASVGICRVLTVDLHADQIQGFFYMPVDNVYSTPVLLEDITKQKLNN
FT                   IMIVSPDVGGVVRARAVAKRLNDAELSIIDKRRSGPNKSEVMHIIGEPANKNCIIVDDI
FT                   VDTAGTLCTAAHELKKNGAKSVRAYITHPVLSGPAVNNIKHSGLDEVVVTDTIPLSAEA
FT                   QNCEKIRVVSLADMLAQAIKRVNVEESVSSMFAE"
FT   gene            complement(678316..678390)
FT                   /locus_tag="LPC_2755"
FT   tRNA            complement(678316..678390)
FT                   /locus_tag="LPC_2755"
FT                   /product="tRNA-Gln"
FT   gene            complement(678406..678525)
FT                   /locus_tag="LPC_2754"
FT   CDS_pept        complement(678406..678525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2754"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56660"
FT                   /protein_id="ABQ56660.1"
FT                   /translation="MYNLILVIYLLSEVDIDKKALQNTQHIAGMNTIYKLMDD"
FT   gene            complement(678518..679117)
FT                   /gene="lolB"
FT                   /locus_tag="LPC_2753"
FT   CDS_pept        complement(678518..679117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lolB"
FT                   /locus_tag="LPC_2753"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2753"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56659"
FT                   /protein_id="ABQ56659.1"
FT                   /translation="MNAIKRLTIILICFLTACAPPRPSEEPPANREIPLEERKAETATV
FT                   SSWEIKGALAAKTKAKGWSATMNWVQQGANSYQIRLMGPLGGGAVLISKKGNTITFQDG
FT                   SKITTSTNADELLLKQTGIRLPVNNLYYWVRGLPAPGGVQSEKHDQFNHLIQLKQNGYT
FT                   IDFTKYTSVKGIDLPSMIRLEGNGVMVKVVIKNWVV"
FT   gene            679201..679692
FT                   /gene="kdtB"
FT                   /locus_tag="LPC_2752"
FT   CDS_pept        679201..679692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtB"
FT                   /locus_tag="LPC_2752"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2752"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56658"
FT                   /db_xref="GOA:A5IH08"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH08"
FT                   /protein_id="ABQ56658.1"
FT                   /translation="MKQKAIYPGTFDPCTKWHIDIITRASTIFPELIVAVASNKNKAAY
FT                   FIWESRNSLLEESVGHLTGVRGVGFDNLLNDFVLEQNAGIILRGLRAVSDFEYEFQLAG
FT                   MNRKLSKKVETLFLTPAEHLMYISSTLVREIAALNGDISQFVPPNVVRELKKRQNERSL
FT                   "
FT   gene            679676..681400
FT                   /locus_tag="LPC_2751"
FT   CDS_pept        679676..681400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2751"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2751"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56657"
FT                   /protein_id="ABQ56657.1"
FT                   /translation="MKDHYKWLSCLFFLICNIYQVNAKTFPQHPPGYAVASAHPLATHA
FT                   GLEILAAGGNAFDAAVAVAAALAVVEPYHSGLGGGGFWLLHQEKEHLNLFIDGREVAPL
FT                   AASKDMYLAPDGQVIPGLSLNGGLSAAIPGQPAALVYIAKNYGRLPLSKTLAPAIKLAE
FT                   EGFPVDPQFRYFSTLDDRLENLKKYPDTAAIFLKNGQPFEIGEKLVQKDLAKTLRLIAK
FT                   YGNAGFYSGETASLLVQGVNAAGGIWSLDDLAQYKIKVRPPLISAYHNMLIITAPLPSA
FT                   GGVALVTMLNILSKFPLSSFPKLKWVHYVVESMRLAYWQRDQFLGDPDFIKVPLDKLIS
FT                   SDNAKQLSRLISPNKAIDSKVLQGSVPTGKHSNTSHISIIDTEGNRVAATMTINYIFGS
FT                   SVVAKGTGVLLNDEMDDFSTKVGEQNVFGLVGSERNAIEPRKRPLSSMAPTFLEMPGRV
FT                   AILGTPGGSRIPTMVLLASLLFYDGYGAISMVSAMRFHHQYLPDVLQFEPDTFPSSIQQ
FT                   GLQAMGYHLMPLKQYYGDMQAITWDKESNVLTAASDPRHIGLAAAISNMAYGYGVNY"
FT   gene            complement(681498..683714)
FT                   /locus_tag="LPC_2750"
FT   CDS_pept        complement(681498..683714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2750"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56656"
FT                   /protein_id="ABQ56656.1"
FT                   /translation="MSINKIEEDRDTSSDLEMKAKMYLVHRMDKARPLTVKDVHILINK
FT                   LSKDLQKNQLTLIDCQLIINLVESRFTLVKQATRYLQFFLNKLDGKSINPILIPLSNIP
FT                   FWQNEPHPFDHYRSTDQLPEKADIVIIGAGLTGASTAYHLIDAVKKRNLTVVLLDKGNP
FT                   ATEASGRNGGNFELLPENSVGIYSGLVSERFRFLKRCYPLVHPSILQIESEYHASLVFQ
FT                   FALKNRNRFKEIVRKERIYCDLAAKGWLYIAHTEEEEQAICDEVTLAAQHGERIYIWSR
FT                   KKIREQFGINSKFIGRFIPDDGTYNPFKYTCCLIKAAIKGGIKLYTFVKVQQIQSMDTE
FT                   YHQLKTNMGLLKARQVIVATNAFTSELLPELSAIKPHQSQIAITDSTPDYCKGRLITSE
FT                   DGPLYLNQPRVRSKNGLVPLLIGAGDDRPMKNPYYRKRSKKVHDLIVQQRDKYFPDLKG
FT                   KPFSTEWVGALAFTPDQLPAIGYLSPGIIIVMCCNGYGGSYTTAAGFAAAEIALTGQNP
FT                   PWLPADVFSPKRLLSDKPLFLEDSDSLWRIGKTLCTTLNNLNQLLAESLSYQSMYQPYF
FT                   TISSLPHGHQEKTCNLDPLRVMHQLAIFRTFAYQELEMLIRYTSPVCLNKGEILFKQGD
FT                   AGHSCFILIQGKINLYYEHAEGFTSMVAELEAGSVFGQMALFLENKRMATCQATENCSM
FT                   LEIMVEPCKSLFIQQQALGIKLLRLLNQGVIDALHKLNKRLKYT"
FT   gene            complement(683924..684655)
FT                   /gene="plsC"
FT                   /locus_tag="LPC_2749"
FT   CDS_pept        complement(683924..684655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="LPC_2749"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2749"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56655"
FT                   /protein_id="ABQ56655.1"
FT                   /translation="MKISRLKTFWIITRLFYYTGVACTRSIFKYLFSTPTRPWVDKVIH
FT                   HWVDQLLNAVKVEYKVINPHNVQPQPGKATILMCNHSSAYDIPLGFKAFPNNSIRMLAK
FT                   RELSKIPLLGKGMAAAEFPFIDRKNRFQAIKDLEFAQQLMESGIILWVAPEGTRSKDGK
FT                   LAPFKKGGFITAIQAKATIIPIGIRGAFDILPARTFNIHLNQKAEIHIGEPIDAAQYTI
FT                   ENKEELIEKTHQSIKKLVGEN"
FT   gene            complement(684724..685044)
FT                   /gene="sugE"
FT                   /locus_tag="LPC_2748"
FT   CDS_pept        complement(684724..685044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="LPC_2748"
FT                   /product="suppressor of GroEL (SugE)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2748"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56654"
FT                   /protein_id="ABQ56654.1"
FT                   /translation="MLLPWLYLIIAGLLEVCWAVGLKYTDGFSKWQPSLFTVTMLIISM
FT                   FLLAKAAQTLPIGTAYAVWVGIGSLGTAIMGILLFQEHLSVFRLLYLVLMLISIFGLKY
FT                   TA"
FT   gene            complement(685187..685501)
FT                   /locus_tag="LPC_2747"
FT   CDS_pept        complement(685187..685501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2747"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2747"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56653"
FT                   /protein_id="ABQ56653.1"
FT                   /translation="MWVHGDISAGNLLVKNGKLCAVIDFGQLSVGDPACDLAITWTLFA
FT                   GDSRKIFREMLALDKGTWFRGQAWALWKALIVAAGIVNTNAMELQKSCRIINELFLTEL
FT                   "
FT   gene            complement(685885..686952)
FT                   /gene="dinP"
FT                   /locus_tag="LPC_2746"
FT   CDS_pept        complement(685885..686952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinP"
FT                   /locus_tag="LPC_2746"
FT                   /product="DNA-damage inducible protein P"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2746"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56652"
FT                   /db_xref="GOA:A5IH02"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IH02"
FT                   /protein_id="ABQ56652.1"
FT                   /translation="MNPIRKIIHIDMDCFYAAIEMRDFPELANKPIAVGGDAKRRGVIA
FT                   TCNYAARQFGIRSAMPTAHALKLCRELILRPVRMDVYQKESQYIRSLLTEYTDLIEPLS
FT                   LDEAYLDVTESTQCQGSATWIAEEIRARIYQTRQLTASAGIAPNKSLAKIASDWHKPNG
FT                   QMVIRPEDVSAFVLDLPVRKLFGVGPKMEEKLGALNIKTCADLQRYSVEYLLQKFGTMG
FT                   QRLYELARGIDNRPVNPERIRKSISVEETYPKDLPNSEACLAVLPELMARLEARIQRAG
FT                   KISGIHNLFVKLKFNDFQQTTIERVMDKLDLIVLRQLIQEGFARRGMPVRLLGIGIKLK
FT                   QENTYQSVQLPLLDL"
FT   gene            687264..687337
FT                   /locus_tag="LPC_2745"
FT   tRNA            687264..687337
FT                   /locus_tag="LPC_2745"
FT                   /product="tRNA-Gly"
FT   gene            complement(687392..688012)
FT                   /locus_tag="LPC_2744"
FT   CDS_pept        complement(687392..688012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2744"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56651"
FT                   /protein_id="ABQ56651.1"
FT                   /translation="MDIKKLKKAASNFLERYPGGFYHPEMIEMGKKHKMDKMVALAQGS
FT                   FAKQNFKNPDEITNSMLKIVTQSSLISIFEKPKFRDFIKRTPPNDKVLIAKGLKELLYG
FT                   NEQEGFEELLFQFQREKLAKWTLMTIFQAYFNPEVDVFIKPTTTKNIIKELNLDIVYNP
FT                   TPSWEFYESYRNIINQMKTKIEKSLAPSNAAFCGFLMMSLDDR"
FT   gene            complement(688087..688911)
FT                   /gene="mutM"
FT                   /locus_tag="LPC_2743"
FT   CDS_pept        complement(688087..688911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="LPC_2743"
FT                   /product="formamidopyrimidine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2743"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56650"
FT                   /protein_id="ABQ56650.1"
FT                   /translation="MPELPEVETTKQGIKPHLEGRMITAVQVRNRKLRLPVPLNLNELC
FT                   QGKHITAITRRGKYILLHMDKGYLLIHLGMSGHLRIVSQTANPQKHDHIDLHINNGLAL
FT                   RFCDPRRFGLFIYIDENPYQHPLLAHLGPEPLSDDFNSEYLLRKAANKSQSIKSFIMDS
FT                   QIVVGIGNIYAAESLFLAKIHPNTSAKKITTEEFNALTGHIKKILESAIEAGGTTLRDF
FT                   YSSDGKPGYFRFALKVYGRKNLPCLVCENKIETVVIAGRHSAFCPHCQPIIT"
FT   gene            complement(688911..689141)
FT                   /locus_tag="LPC_2742"
FT   CDS_pept        complement(688911..689141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2742"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56649"
FT                   /protein_id="ABQ56649.1"
FT                   /translation="MSDKVQKLIENIVPFIVIGVGIAIVVALLFMFFYVAIWGVIIGGI
FT                   LWLGALAKEYFFPSKSSQKEQGRIIEHDDKK"
FT   gene            689322..690509
FT                   /locus_tag="LPC_2741"
FT   CDS_pept        689322..690509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2741"
FT                   /product="stearoyl-CoA-9-desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2741"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56648"
FT                   /protein_id="ABQ56648.1"
FT                   /translation="MVFGFLNLSFWGYVLATFILTQITIASVTIYLHRNQTHRALTLHP
FT                   VISHFFRFWLWLTTGMVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYRE
FT                   ARKDRDMVAKYSHGTPTDWIERNVYSRHSSKGILLMLLLDLFFFGIPGITVWAIQMMWI
FT                   PLFAAGVINGIGHYWGYRNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWW
FT                   EFDIGWMYIRILSFFGLAKVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSNYYKNV
FT                   IRPILKYEKNTSIETKEDKKLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYS
FT                   YKQSLQNVWLKTATTQKELVEALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE"
FT   gene            complement(690550..690948)
FT                   /locus_tag="LPC_2740"
FT   CDS_pept        complement(690550..690948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2740"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56647"
FT                   /protein_id="ABQ56647.1"
FT                   /translation="MFNKFLVTTLSVVTLTLSPYGFAKDDSCEVQVAVSTPPVQFDQSV
FT                   AFNVTNDDGISKSIILQGGSSPKTIGKLICSPLPYTISATQYFTPTGLTNRHAQPVGQC
FT                   VLKAGNVILNGSNNSVAVVFPNDFICHH"
FT   gene            691214..691954
FT                   /gene="phaB"
FT                   /locus_tag="LPC_2739"
FT   CDS_pept        691214..691954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaB"
FT                   /locus_tag="LPC_2739"
FT                   /product="acetyoacetyl CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2739"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56646"
FT                   /protein_id="ABQ56646.1"
FT                   /translation="MDKMIAIVTGGTGGIGSAISQRLADSYQVVACYYKDGRHEEAKKW
FT                   QDEQKQLGYDIDIVYGDIAQYSDCEKITSLVMERYGRIDVLVNNAGITKDCSLRKMTPQ
FT                   QWQQVLDANLTSVFNMTRNVVPVMLERGYGRIVSISSINGRKGQFGQCNYASTKAALFG
FT                   FTKSLALEVASKGITVNTVSPGYIETPMLAALKEDVLNSIISSIPVGRLGYPKEIADAV
FT                   AFLASPDSGFITGANLDVNGGQYM"
FT   gene            692132..692878
FT                   /gene="phaB2"
FT                   /locus_tag="LPC_2738"
FT   CDS_pept        692132..692878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaB2"
FT                   /locus_tag="LPC_2738"
FT                   /product="acetyoacetyl CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2738"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56645"
FT                   /protein_id="ABQ56645.1"
FT                   /translation="MLNNNVVLITGGTGDIGTAVAKQLDSTFKHVIALDLVSYDEGEVW
FT                   LHDLKTQGYKNINFRHMDVTDYEQCAEVIGLIIEEFGGIDVLINNAGITRDAVFTKMTK
FT                   RQWDEVLRVNLDGMFNVTKQVVESMKVQESGRIVNVSSVNAQKGQFSQANYAASKAGVY
FT                   GFTKSLAQELMIKNITVNSISPGYVNTRLMKGIRPDILEGIINLIPAKRLAEPQEIAWA
FT                   IEFLISEKSRYITGANLSVNGGLHMY"
FT   gene            693008..693406
FT                   /locus_tag="LPC_2737"
FT   CDS_pept        693008..693406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2737"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2737"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56644"
FT                   /protein_id="ABQ56644.1"
FT                   /translation="MTRLIKKYKNRRLYDTEISQYITVEQLQKYVVDGIDFKIEDSETG
FT                   KDLTNSVLLQIIVEMEAGPTQFLSSEILRQIISLANHPMHVSFKEMMEQMFHAMDKPLQ
FT                   NNPYQQATDVWNKQMQQMVHQWQKMFKV"
FT   gene            693613..693906
FT                   /locus_tag="LPC_2736"
FT   CDS_pept        693613..693906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2736"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2736"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56643"
FT                   /protein_id="ABQ56643.1"
FT                   /translation="MTQYNFERWSEMAKKIQEPFQAIAELNVKTLQGLSYLKPDELAQV
FT                   KKPEEMLKKQINLAVKNGHKALDYMQKSFQIIEKAMLGFVQEAKKTTAEVKK"
FT   gene            complement(694148..695218)
FT                   /locus_tag="LPC_2735"
FT   CDS_pept        complement(694148..695218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2735"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56642"
FT                   /protein_id="ABQ56642.1"
FT                   /translation="MKHTYNPFRYLIYFAFFITSLSSYSSQTTNIKEQTDTGLAPPAPS
FT                   ITTNSAAIEEQANSSIRKLYHTLNTMPNTSMADRISQISAYFKGTKYILGSLGEGPNAR
FT                   YDQFPRYRVDGFDCDTYVNTVLSLALANSLESFQECLKHTRYKNGKRSYINRNHFTSID
FT                   WNNYNQKRGLLKDITFSIRNEKKQPVALYANALINKPQWYNHKTIDTIRLQKQDKNEQE
FT                   KRLVELKAKGKKLETSLSNVPYIPFTALFSENKPNLHLFSQIPNGAVIEIIRPNWDLRQ
FT                   QIGTELDISHLGFAIWINNELFFRQASSQYGKVVDVSLIDYLDKARSSPTIKGINIQIV
FT                   LPEKPVSNGCQLFDIR"
FT   gene            695288..695893
FT                   /locus_tag="LPC_2734"
FT   CDS_pept        695288..695893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2734"
FT                   /product="spore maturation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2734"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56641"
FT                   /protein_id="ABQ56641.1"
FT                   /translation="MLNLIWLGMILISVVVGVIEGRIDEVVRAVTDSAKLGFELALGLA
FT                   GIMTFWLGIMSVATESGLVSILGKVLKPVLKRLFPDIPVEHPAMGAMVMNIAANMLGLA
FT                   NAATPFGLQAMKELQSLNQNLKVATNSMCTFLAINTSSVQLIPVTAIAFLAANGSTNPS
FT                   SVVFTSLIATTVSTLVAIVAVKQLAKLPRFKIERTDSL"
FT   gene            695890..696423
FT                   /gene="spmB"
FT                   /locus_tag="LPC_2733"
FT   CDS_pept        695890..696423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spmB"
FT                   /locus_tag="LPC_2733"
FT                   /product="spore maturation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2733"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56640"
FT                   /protein_id="ABQ56640.1"
FT                   /translation="MNGFANHLSNWLFLTFIVGIPLYAAIKKVNVFDAFIIGAKQGFDV
FT                   SVKLIPYLVAMMVAIGMLRASGFFSLMSQILSPALAMIGMPSELLPLALIRPFSGSAST
FT                   GVMAELIHKYGGDSFIAKTAATMMGSTETTFYVIAVYFGSVGIRRTRHAIPAGLLADLA
FT                   GIIASVLICRYLFT"
FT   gene            complement(696552..697985)
FT                   /locus_tag="LPC_2732"
FT   CDS_pept        complement(696552..697985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2732"
FT                   /product="peptidase, M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2732"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56639"
FT                   /protein_id="ABQ56639.1"
FT                   /translation="MDKRPNIPKRKSGNSSKLLAFFALVFAFSLPYLLVKNFSHPKRSS
FT                   YADQTDLYPELSDELSRDIPAEASTEIPHEKPDIKSATKPMQTKQDQQDKPINTSHVKK
FT                   DNEWQIVNPHSGDSMATIFHRLGLTAQNLNDVIKNNPHAKMLTRIKPNQKLQFLIKKNK
FT                   LEKLIVPVNTIQTLTVYRAGKIYKTKIDSKKTTTQNRYVTATVQGSLYTTAQRFNIPSK
FT                   LVRQMTTIFNKEIDFSRSLRSGDQFSIIYDAYYIEDKMVGVGDILVVTYTNRGKTYQAI
FT                   RHTNAHGEQDYFTPQGTSFKKAFTRYPIKFSHISSTFALSRYHPILHYRRAHKGIDLAA
FT                   PIGTPIHATGDGVITIIDRHNGYGNMIKIKHDKTYSTVYGHLLKFQKGLSKGSRVKRGQ
FT                   VIGYVGQTGLATGPHCHYELHVNNQPRNPTTISLPTAAPVPAREMAAFKAKASTLLARL
FT                   KLFEQAQLASKGKKKVNVG"
FT   gene            698242..699447
FT                   /gene="tyrS"
FT                   /locus_tag="LPC_2731"
FT   CDS_pept        698242..699447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="LPC_2731"
FT                   /product="tyrosyl tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2731"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56638"
FT                   /protein_id="ABQ56638.1"
FT                   /translation="MIVQDSVCSELMRGCEEILPVPELEKKLQKGIPLKIKAGFDPTAP
FT                   DLHLGHTVLLNKLRQFQQFGHEVIFLIGDFTAMIGDPTGKNVTRMPLSQETVLENAKTY
FT                   QHQVFKILDPDKTTVAFNSQWLNKFDAVDLIRLAATHTVARMLERDDFNKRYTTGQPIA
FT                   IHEFLYPLLQGYDSVALKADVELGGTDQKFNLLMGRELQKHYGFEPQVVMMTPLIEGLD
FT                   GVKKMSKSLDNYIGINETPEQMFGKIMSVSDELMWRYIDLLSFKTGKEIQQLKQSVLEG
FT                   KNPRDVKIDFAKEIVARFHDQTQAEFAHNKFIERFQKGNIPEDLEELSLVIAEPIALVQ
FT                   LLKQIDLTASTSESIRMVKQGAVKVDGDKISDPSLKLPIGKSYIIQVGKRRIAKLSIQQ
FT                   AD"
FT   gene            699631..701105
FT                   /locus_tag="LPC_2730"
FT   rRNA            699631..701105
FT                   /locus_tag="LPC_2730"
FT                   /product="16S ribosomal RNA"
FT   gene            701247..701322
FT                   /locus_tag="LPC_2729"
FT   tRNA            701247..701322
FT                   /locus_tag="LPC_2729"
FT                   /product="tRNA-Ala"
FT   gene            701489..704390
FT                   /locus_tag="LPC_2728"
FT   rRNA            701489..704390
FT                   /locus_tag="LPC_2728"
FT                   /product="23S ribosomal RNA"
FT   gene            704492..704609
FT                   /locus_tag="LPC_2727"
FT   rRNA            704492..704609
FT                   /locus_tag="LPC_2727"
FT                   /product="5S ribosomal RNA"
FT   gene            704959..706482
FT                   /locus_tag="LPC_2726"
FT   CDS_pept        704959..706482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2726"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2726"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56637"
FT                   /protein_id="ABQ56637.1"
FT                   /translation="MLSKYELIKPDIGSSHGNITKVYEIVGGKPLRGQVKVSGSKNAAL
FT                   PVLAASLLCKEPLQLTNLPKILDVTNMIQCMEALGKRFEFINTNTIKIGNREMDTLTIP
FT                   KEAARQIRASIILLGPLVAQYPKVILPLPGGCSIGKRPIDLHISALNALGVDIVELPDC
FT                   LVCSRRYARLQGNTINFSIKTVTGTENAMMAAVLAEGTTIINNAAMEPEIVDLANFLNR
FT                   LGAKIDGAGSDRITISGVDKLNSCGSYSIMADRIEAGTYLVAAAMTRGSISVKGINPDY
FT                   LVAVLSELKCAGAKITCDSDSIQLDMGEEYGESLNITTKPYPGFPTDLQSLFLSLTCVL
FT                   RGNSYLCETLFEDRFQIVQELKKMGANISLKDNTAHIKGVSRLRGSQVNATDLRSGAAL
FT                   VCASLAAEGITQIFAIEHIERGYEDLILKLKALGANIKLIENTHVTSTELSDSHFKEAT
FT                   SSETRIQRASLIETVVTPSITTFGQFKRVPTGEVTELEKQQTPYLHHIM"
FT   gene            complement(706475..707008)
FT                   /gene="yrdA"
FT                   /locus_tag="LPC_2725"
FT   CDS_pept        complement(706475..707008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdA"
FT                   /locus_tag="LPC_2725"
FT                   /product="Carbonic anhydrases/acetyltransferase, isoleucine
FT                   patch superfamily"
FT                   /note="COG0663"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2725"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56636"
FT                   /protein_id="ABQ56636.1"
FT                   /translation="MNYSIRKFEDKYPELGERVYIDPQSTVIGNVTLGDDVSVWPMAVI
FT                   RGDVNYIQIGHSCSIQDGAVLHVTHDGPYTSGGRPLILGQGITVGHKALLHACTIDDYC
FT                   LIGMGSIILDSAHIQKHVMIAAGSIVPPGKILKSGHLYLGSPAQAIRKLTTKEIEQIEY
FT                   SAGHYIRLKDRYLT"
FT   gene            complement(707015..708373)
FT                   /gene="gor"
FT                   /locus_tag="LPC_2724"
FT   CDS_pept        complement(707015..708373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="LPC_2724"
FT                   /product="glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2724"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56635"
FT                   /protein_id="ABQ56635.1"
FT                   /translation="MKTKHFDLIVLGGGSGGIASAVRAAQYGAKVAVIEQSHLGGTCVN
FT                   LGCVPKKIMYNASSIAETLHKSPDYGFFLENNAKLDWKRLVNKRNAYIERLRENYAKRF
FT                   SQHKITLIQGKGIFHDQSSITIDHTIYQAEHIIIATGGEPALPAINGIKHAIDSDGFFS
FT                   LTKLPAKVAVIGSGYIGVELAGILNSLGSETHLLMRGTRPLSRFDHMIGDTLMEIMQKQ
FT                   GICIHQNHKAQAIHLHSDGRKSILCQSGSIIENIDVIISAVGRKPRTGNLNLDKINVNM
FT                   DDKGLILVDAFQNTSVKGIYAIGDVTNAPALTPVAIAAGRRLADRIFGNQPDACLNYDN
FT                   ICSVVFSHPPSGSVGLTEHEAIEKYGKNKIKIYQTRFIPMYDALSIDKTPTAMKLVTLG
FT                   KKEKIIGLHVVGYSADEMLQGFGVAIKMGACKKDFDNTIAIHPTSAEEFVTMV"
FT   gene            complement(708604..709584)
FT                   /gene="add"
FT                   /locus_tag="LPC_2723"
FT   CDS_pept        complement(708604..709584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="LPC_2723"
FT                   /product="adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2723"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56634"
FT                   /protein_id="ABQ56634.1"
FT                   /translation="MNLKKAELHVHLEGTISPDLAKKLAKRNHLTLPDGLIAFDEKSYL
FT                   SKDFLDFLKVYDTLASVIKNPQDYYDITFDYLKSNAQEHAIYIEMMYSPDHAEQSSGIP
FT                   SKEHLAAIQQAIDDAKSQFDIVGRIIITAVRHFGVEACERVAKQASIDKFPCVTGFGLG
FT                   GDEAKFPPQLFAKTYQIAADSGLECTVHAGEFDSAKGMEEAMKTLPIKRIGHGVRVIDS
FT                   PDIMAMVKDQGIALEVCPTSNIFLGLFKDMNSHPFPKLYEAGIKVSINSDDPPFMSTTL
FT                   AQEYKRVQKAYGYSNDTMNNITRMAIEAAFVDEKTRKELLTKLEQ"
FT   gene            709682..709867
FT                   /locus_tag="LPC_2722"
FT   CDS_pept        709682..709867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2722"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56633"
FT                   /protein_id="ABQ56633.1"
FT                   /translation="MNTDDINKAYVSPYDKFLYEFDATHKKSASQLQEIKKHERIFKMR
FT                   DDKDYKIDQSEIWEEF"
FT   gene            709966..710412
FT                   /locus_tag="LPC_2721"
FT   CDS_pept        709966..710412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2721"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56632"
FT                   /protein_id="ABQ56632.1"
FT                   /translation="MKNPYILQLNNPALLNKAMQLKSIGKVAISQNQLTYLKIHDEWIY
FT                   ELFPLLQNEQIRKPDYFGNESIGAHISIIYPEENTTINPKELDQEHRFKIKNIIKANLE
FT                   LKKYYAIIVEAPSLARLRKAYGLPENLYFKGYSTHFHITVGVEY"
FT   gene            complement(710453..711706)
FT                   /locus_tag="LPC_2720"
FT   CDS_pept        complement(710453..711706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2720"
FT                   /product="phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2720"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56631"
FT                   /protein_id="ABQ56631.1"
FT                   /translation="MDYSIYLLFAALILCFLMTWGVGANDLANVMSTTMGSKAVTVRQA
FT                   MLIAIIFEFAGAFLGGEGVTETMRDGIINTSQLSNEPLILIEGMLCVLFACTIWMNLAS
FT                   YLGVPVSITNALVGSMVGFGTIVLGPDAIHWNQVARIAIGWVSSPLISGITAYALFISI
FT                   QQTIFVKSNPLTKAKLYIPIYLFLIGFILSFITVFKGLNHFDIHLNLKQDLAVTLATSI
FT                   IITILGMIFIKRIPEYHKIRRRERFIQVEKYFAVLMAMTACAMAFAHGSNDVALAVGPL
FT                   SIVHSLVMHSNQIFDADNYPSWIILLGCVGVVTGFLMYGRKVIETVGSSITALTPSRAF
FT                   AATLSAATTVVVATSTGIPVSATQTLVGAVLGVGLARGIGALNLIVIRNIFMSWVLTLP
FT                   AASMLTILSYKLLHALLG"
FT   gene            complement(711716..712369)
FT                   /locus_tag="LPC_2719"
FT   CDS_pept        complement(711716..712369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2719"
FT                   /product="hypothetical phosphate transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2719"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56630"
FT                   /protein_id="ABQ56630.1"
FT                   /translation="MFGPSPIKPIEQHIRKAHQCAKQLYPFFEAVLKNDWDTANKIKDK
FT                   IIAIEKEADLIKRDLRLHLPTGLFLPVARTDILELLSAQDRIANKAEDIAALIISRQMS
FT                   IPKKLIPSFMPFLSRCLDASKQACTAINELDELLETGFRGSEVKIVEEMIVKLDEIEHD
FT                   CDERLADIRHKIFELEKELPAIDVIFLYKLVQWIGELADHAQTVGGRLQILIAR"
FT   gene            712578..713342
FT                   /locus_tag="LPC_2718"
FT   CDS_pept        712578..713342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2718"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae; Secretin_N, Bacterial type II/III secretion
FT                   system short domain pfam03958"
FT                   /note="pfam03958"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2718"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56629"
FT                   /protein_id="ABQ56629.1"
FT                   /translation="MIKRWLLVILLISGNAFSQQMITKVIELNYLQADKVIQLIQPLLQ
FT                   TDEKVSGSGQTLIVNVSPQTLTQIRNVLHKIDVPPVVFNITVYQGDPEWLSSQDGNDVV
FT                   YSTQPQYEVQRSQSVKVMSGESAFVATGEQVPVVTSVGVGLLATGVSYEQHNIQNGLLV
FT                   HPVLQGSQVKLTVRRVREQENVESDQQFDNQQIDTTIMAPLNKWVPLGTAEGVQNTDSS
FT                   STSYTAGRPFSQNSTLYIKVSVVKSTPSGTTK"
FT   gene            713635..714198
FT                   /locus_tag="LPC_2717"
FT   CDS_pept        713635..714198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2717"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2717"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56628"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGX8"
FT                   /protein_id="ABQ56628.1"
FT                   /translation="MAIISSLANHLLIAMPSLKDPNFERSVVYLCEHNEQGSVGLIINR
FT                   PLQFPLSIVFEQLQIEPIRVEKNGLPLLFGGPVQPERGFVIHKQMGGWRSSLFLQDEVT
FT                   VTTSNDIIRAIAYDEGPKDVLITLGYAAWTEQQLEREIMSNTWLVCPYKSEILYEVPFE
FT                   ERWEYAGLTLGIKMNQLSSDAGHA"
FT   gene            714182..714610
FT                   /gene="yqgF"
FT                   /locus_tag="LPC_2716"
FT   CDS_pept        714182..714610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgF"
FT                   /locus_tag="LPC_2716"
FT                   /product="putative ribonuclease with RNase H fold;
FT                   smart00732"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2716"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56627"
FT                   /protein_id="ABQ56627.1"
FT                   /translation="MLAMPRGVYLGFDFGYKRIGVAVGQRLTCSASPLSTIEAKAGIPD
FT                   WNTIQKVITQWNPQALIVGLPTCIDDRELYTTSAARCFAKQLHKRFSLPVHLVDERLST
FT                   VEARGYLFEQGGYRQIKKAEVDSIAACVILEQWLQQSE"
FT   gene            714660..715553
FT                   /gene="pyrB"
FT                   /locus_tag="LPC_2715"
FT   CDS_pept        714660..715553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="LPC_2715"
FT                   /product="aspartate carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2715"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56626"
FT                   /db_xref="GOA:A5IGX6"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGX6"
FT                   /protein_id="ABQ56626.1"
FT                   /translation="MKHFLEISQLSSEQIESLLQRALYFKHTKQYPSYSQSIIANLFYE
FT                   NSTRTRISFELAERHLSMSVVNLDLQTSSETKGEAIEDTIRTLAAMGIQYFVIRHKQDG
FT                   LQQNLANKLGDTVHIINAGDGTHAHPSQAILDMVTIVEQKKQLDKLKIAILGNIKHSRV
FT                   ANSFQCICSKLGVGELVLISPEIWQPSQVHFGRVTDNLNEGLEGADVIICLRVQRERLL
FT                   QDDHLDLDFYRNNFALTQKSLSYAKPDAMVMHPGPMNRGVEIDSEVADGKQSCILQQVT
FT                   NGVYARMAILESLIGS"
FT   gene            complement(715609..715935)
FT                   /locus_tag="LPC_2714"
FT   CDS_pept        complement(715609..715935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2714"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56625"
FT                   /protein_id="ABQ56625.1"
FT                   /translation="MADQYTDTALSLLSQCYDASDEINSNITHCFNEKLKKIPNPLNYK
FT                   ISVHATKTKKSDHGKITVFMINNKGIMLYCIGTAGEKLKINACASDVGKPLTPEQELSI
FT                   EGFF"
FT   gene            complement(716219..716605)
FT                   /locus_tag="LPC_2713"
FT   CDS_pept        complement(716219..716605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2713"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56624"
FT                   /protein_id="ABQ56624.1"
FT                   /translation="MRSIRLLFPCILLMIPWQFATANRPTDNALAIIKSCYDESVNLSN
FT                   DFTPCVTKKLKTMPNAEDFQLIMNFKTDEKGTNERIPVFMVDKTGYMYYCIVTTGKTLI
FT                   INACAGEQGKPLTQGQMLSIDLPE"
FT   gene            complement(716709..718220)
FT                   /gene="comM"
FT                   /locus_tag="LPC_2712"
FT   CDS_pept        complement(716709..718220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="LPC_2712"
FT                   /product="competence related protein ComM"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2712"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56623"
FT                   /protein_id="ABQ56623.1"
FT                   /translation="MNLAFTKTRSTIGIVAQPVSVEVHLSNGLPSFTMVGLAETAVKES
FT                   KDRVRSAIINSQFEFPCRKITVNLGPANLPKTGSGFDLPIALGILAASEQIPLTNLANH
FT                   EFIGELALSGELRGVSAIIPAVLAAHKDNQYLIIANANAAEASLTGHPKVFTANNLREV
FT                   CDYLCQGTSLQNLPPKPDLLLNNHELDWSDIKGQHHAKNAMVIAACGGHSILLSGAPGS
FT                   GKTMMAKRFSTLLPELSETQALECAAINSIRGKLPDFREWRLPPFRAPHHTASPVALVG
FT                   GGNPPKPGEISLAHHGVLFLDELPEFNRQVLETLREPLESGHICISRAAAQIEFPAKFQ
FT                   LIAAMNPCPCGQWGNSQANCLCTPDRISRYLAKLSAPLLDRIDMQVTIHALSQEELIKP
FT                   NTHLEKQSPAIREKVTKMHEIQMARQDSLNANLNSKTCEMVCELGSEEQLFLREVMSKL
FT                   KLSARGYHRLLKVSRTIADMSECNKVMLNHLQQALSYKQILHLPK"
FT   gene            complement(718292..718546)
FT                   /locus_tag="LPC_2711"
FT   CDS_pept        complement(718292..718546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2711"
FT                   /product="conserved hypothetical protein"
FT                   /note="pfam04380"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2711"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56622"
FT                   /protein_id="ABQ56622.1"
FT                   /translation="MFDPKQFDELANKLFATLPTSLQNFEKDIQQKFKEVLQSTFSRMD
FT                   LVTREEFDVQCKVLARTREKLEQLQHQLEDFIKRQEIKK"
FT   gene            718691..719029
FT                   /gene="glnK"
FT                   /locus_tag="LPC_2710"
FT   CDS_pept        718691..719029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK"
FT                   /locus_tag="LPC_2710"
FT                   /product="nitrogen regulatory P-II transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2710"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56621"
FT                   /protein_id="ABQ56621.1"
FT                   /translation="MKMITAIIKPFKLDDVHEALMEIGVPGITISETRGFGRQKGHTEL
FT                   YRGAEYVVDFLPKIKIELALPDNMVEAAIEAICKSAYTGKIGDGKIFVYALEQVVRVRT
FT                   GEVGTDAL"
FT   gene            complement(719039..719620)
FT                   /gene="fthC"
FT                   /locus_tag="LPC_2709"
FT   CDS_pept        complement(719039..719620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fthC"
FT                   /locus_tag="LPC_2709"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2709"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56620"
FT                   /protein_id="ABQ56620.1"
FT                   /translation="MSDQYKVALRNTIKQVRSKLSVSYRTASSNQICTRIRSLEQYRQA
FT                   KRIALYFAVNGEVDLTFLWKSAPLQGKYCYFPVLNNDSTLSFLPATPSTPFKTNKYDIL
FT                   EPDVDIELALPVDELDLIIMPLVAFDAHCTRLGMGSGYYDRTLANKSKAHLLGVAYQFQ
FT                   RVDYIEPRPWDVPLDAVITQKAIYWRNPLA"
FT   gene            719867..720052
FT                   /locus_tag="LPC_2708"
FT   CDS_pept        719867..720052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2708"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2708"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56619"
FT                   /protein_id="ABQ56619.1"
FT                   /translation="MSDLFEEDEEEVIEVVDDFDDVEVDTEIIEAPGVSLDARRRLENM
FT                   LEEKRLRDELDDFVDY"
FT   gene            720066..720881
FT                   /locus_tag="LPC_2707"
FT   CDS_pept        720066..720881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2707"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2707"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56618"
FT                   /protein_id="ABQ56618.1"
FT                   /translation="MPTRVIEDKGDMTPSFGIDDRIFLGEGLFETIRVNSSKPSFAYMH
FT                   WERLGNSARQLGIPFEISFDDWFEHLIQKIQKDNLYHGGIKAILSGGPASRGLAERGQV
FT                   SQLIFQTFNYSIQKHPVRLISINWLRDKANPLYQLKSVNYLEAIIAQRQAIAVGADDAL
FT                   FFNTENHVTETTCANLFLIENNILYTPRIEDGILPGITRARLISHCQQHKMSVQEISLT
FT                   KKRIEDADAVFLTNSLQGIRRVLSLDNIIFEVNHPIIDKLIFLLNQDES"
FT   gene            complement(720908..721591)
FT                   /locus_tag="LPC_2706"
FT   CDS_pept        complement(720908..721591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2706"
FT                   /product="conserved hypothetical protein; transmembrane
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2706"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56617"
FT                   /protein_id="ABQ56617.1"
FT                   /translation="MRVLNSCNKVRGIFTLTQKTIKTFCFILAILVLIIFAVVFHNHSL
FT                   EIIDYIDDLGWLAPVLFLLTYCLATLLLLPTMVLTLAGGAVFGPVFGTLLNLLGATSGA
FT                   AFAFLITRHLVYDWFSTKKGEKLNKLIAGVDEKGWVFVAFLRLFPIVPFNLVNYGLGVT
FT                   GISFRLYLLTTFIFLIPAEIIYTYFGYVGMDALTRPGHLYRNGGVFLTGLAIFFLLVIR
FT                   IMKKR"
FT   gene            721746..722468
FT                   /gene="aas"
FT                   /locus_tag="LPC_2705"
FT   CDS_pept        721746..722468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aas"
FT                   /locus_tag="LPC_2705"
FT                   /product="2-acylglycerophosphoethanolamine acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2705"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56616"
FT                   /protein_id="ABQ56616.1"
FT                   /translation="MMTKTNEENLTWKGKQKQRARRWIKIFLEKWFRIEVKGQYQANSH
FT                   SVIIANRASIIDVLLLSVFLPERLTLALHPDMFKKIWVKTLLFFADVIVVDPGSAQATR
FT                   ILIRAIRAGKRCLLFPQGLLRQQEDSLKAFAGPGLILQKVGAEVIPVRIEGAEHSIFSN
FT                   SKNKYLIRIFPKITLHILPAQKLSQSENTGVDREGISLRLFQLISDLSFANSFKPYVLF
FT                   SALIEGVSIGTKNKTKIT"
FT   repeat_region   complement(722461..723485)
FT                   /note="TP2"
FT   gene            723432..724973
FT                   /locus_tag="LPC_2703"
FT   CDS_pept        723432..724973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2703"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2703"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56615"
FT                   /protein_id="ABQ56615.1"
FT                   /translation="MLPFLSLFFRQLYRIHVKIEDNNRIPLTYRQFLTRCFILGRQIKK
FT                   QTAIGETVGVMMPTTIAGMVTFFALQAYRRIPAMLNFSMGFYNLYSACNTARIKSIYTA
FT                   RQFIETAKLEPLVEELQQAGIRIHYLEDFKSTIHLGNKLSGIFKGFFPTLSYRFLGDKI
FT                   SPDTTGIILFTSGSEGKPKGVALSHANILANCWQMTSRVDFTPRDVLFNSLPIFHCFGL
FT                   TAGSVLPLVNGLNCFFYPSPLHYKVIPGLVYQTGATILFGTDTFLTGYARAAGKHDFNS
FT                   VRYIFAGAEKVKPETIRYWSEAFGARIYEGYGATEASPVISLNCPLASVPGSVGMILPF
FT                   MDFKVEPVEGIVQGGRLKLCGPNIMLGYLDEDKPGVIIEPEDGWHDTGDIVTVNADGFI
FT                   TIAGRAKRFAKIAGEMVSLTAVEGIAASIWPELLHAAVVQKSPRKGEQIFLFTEAEYAD
FT                   KVSFIKKVKERGQSELLVPHMIYPACQIPVLPSGKIDYITLEKQFLEQKETMETV"
FT   gene            724974..725393
FT                   /locus_tag="LPC_2702"
FT   CDS_pept        724974..725393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2702"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56614"
FT                   /protein_id="ABQ56614.1"
FT                   /translation="MKLIWIVLALILALVVILYLFPQINFREMPKGLVEGQLPDDKPNW
FT                   VSSLVNESDSHYIAPLKVESMPQLVACIERKIPELKIQKQEASFLVGYRQSPFFHFVDW
FT                   ICIHADGNVISSATMGYSDFGKNRELVEKIRSLCL"
FT   gene            complement(725480..725863)
FT                   /locus_tag="LPC_2701"
FT   CDS_pept        complement(725480..725863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2701"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2701"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56613"
FT                   /protein_id="ABQ56613.1"
FT                   /translation="MRKKNRILLASLFSLGSLNAFAAQDLTVVNTSDDLGYVTIGSYSC
FT                   ELTSSCAIPPDNSIRINSDIVEAACANTPADCEIVFGVDSIKARIATGSFSLNEGIQYI
FT                   AQSRWLNYSAKRLSKTVAEIYKR"
FT   gene            complement(725912..727654)
FT                   /gene="phbC"
FT                   /locus_tag="LPC_2700"
FT   CDS_pept        complement(725912..727654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phbC"
FT                   /locus_tag="LPC_2700"
FT                   /product="poly-beta-hydroxybutyrate polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2700"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56612"
FT                   /protein_id="ABQ56612.1"
FT                   /translation="MTHDTELSELMQAVAKKSLQIMTDFKEKPIPISSLVSQYIDLTEH
FT                   FQNLIAVILKNPEKVWQMQLNYLEDALSLAQAQFNYWLEGKPLPINDQRFNGEDWINNP
FT                   FFNLLSQHYLLANEHMNSLLENMEYGDENLAKRVRFFTRQYLDALSPANFIHTNPQLMA
FT                   ETLQSHGKNLLRGLHNLLSDVEAGSSRLIIKMTDTEAFKIGENLATTPGKVIFRNSMME
FT                   LIQYCPRTTKVKSIPLLIVPPWINKYYILDLSPHNSLIRWLVEQGITVFIISWVNPDET
FT                   YANKSFYDYLNEGPREAISVIQKQLRVKQVNTLGFCIGGTLLASLLAYNKATKDLSIRS
FT                   ATFLAAMIDFSDPGDIAVFIDEQQINKLEEEMKSKGYLAGKFMASSFNSLRANDLIWSF
FT                   FIKNYLRGKSPVPFDILYWNADSTNMPATMHSQYLRWMYLHNDLIKPGKIRLNHTPIDV
FT                   TNIDIPTFFLSTQKDHIAPWKTTYKGFELMKGPKRFVLGGSGHIAGIINPPTQQKYGYR
FT                   TNNSMDLSAEQWFEKSKEHSGSWWPEWLNWLKLHSGRLINSPDINHLPFAPIMDAPGSY
FT                   VLKK"
FT   gene            728095..728556
FT                   /locus_tag="LPC_2699"
FT   CDS_pept        728095..728556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2699"
FT                   /product="rrf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2699"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56611"
FT                   /protein_id="ABQ56611.1"
FT                   /translation="MLRVSKLADYGTVVMVYLAKHSQELCNARDIALHTHLTVPTVSKI
FT                   LKRLTSAGLLTSVRGVSGGYRLQRPAAEISVSQIIFALEEHRGFTECSMQPNDCFLQGV
FT                   CTIQGNWRLISHAIETALDSVSLEALAKPTLPTRDVERVRQLASGVNRG"
FT   gene            728549..729997
FT                   /gene="ycf24"
FT                   /locus_tag="LPC_2698"
FT   CDS_pept        728549..729997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf24"
FT                   /locus_tag="LPC_2698"
FT                   /product="ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2698"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56610"
FT                   /protein_id="ABQ56610.1"
FT                   /translation="MAKSSEQLNSLLDREYQHGFITDIEVETFPPGLDEDVIRRLSAIK
FT                   GEPEFLLEWRLKAFRHWLTMPHPEWSSVHYPPIDYQSVSYYSAPKSKKDAPKSLDEVDP
FT                   ELLKTYEKLGIPLREQEMLAGVAVDAVFDSVSVATTFKAKLAEKGVIFCPLSEAVHQYP
FT                   DLVKKYLGSVVPYRDNFYAALNSAVFSDGSFVYVPKGVRCPMELSTYFRINAASTGQFE
FT                   RTLIIADVDSYVSYLEGCTAPMRDENQLHAAVVELIALDGAQIKYSTVQNWYPGDKEGK
FT                   GGIYNFVTKRGACRGKKSKISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNFQ
FT                   QADTGTKMIHLGKNTRSTIISKGISAGHAHNAYRGLVRIAPTATNARNYTQCDSMLMGS
FT                   QCSAHTFPYIEVKNPTAQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVL
FT                   KELPMEFAVEATKLLGISLEGAVG"
FT   gene            729999..730751
FT                   /locus_tag="LPC_2697"
FT   CDS_pept        729999..730751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2697"
FT                   /product="ATP transporter, ABC binding component,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2697"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56609"
FT                   /protein_id="ABQ56609.1"
FT                   /translation="MLNIKELNVAVNGQSILKGINLEVKPGEVHAIMGPNGSGKSTLSK
FT                   VLAGHPSYEVTRGDISYLGQDLLPMSPEERARAGIFMSFQYPVEIPGVTNINFLKASVN
FT                   AVRKGQGRNTLDAIEFLSFIREKCQLLDMDESFLYRSINEGFSGGEKKRNEILQMAALE
FT                   PRLAILDETDSGLDIDALRIISQGVNAMRSPERSIILVTHYQRLLDYIEPDFIHVLANG
FT                   RIITSGDKSLALELEKKGYSWLEEVEQL"
FT   gene            730748..732034
FT                   /locus_tag="LPC_2696"
FT   CDS_pept        730748..732034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2696"
FT                   /product="ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2696"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56608"
FT                   /protein_id="ABQ56608.1"
FT                   /translation="MSDILDYYQQQAQSGVSQIPWLAQLQSKALTDLKRRGFPTRYDEE
FT                   WKYTLVDSLLQQHFVLPDPTVKPALKTAFDDSPVKNLFLIQNGFISQEQEWIKNLPEGV
FT                   LILPLSLALIHYADLVKPYLGKIVEQEHGFHYLNTAMLQCGVFIYIPAGICLEEPIVLK
FT                   HIQDQTNQAMHLRHLILMEKESQATLIEEYQGEENICYFTNSITEVFLGAGAKLNHYKI
FT                   QKESKSAYHLGHLSVRQSAASQFSSHSLSLGGKLVRSDISVSMQEEQAQCLMNGIYAPG
FT                   DGQHIDHHTVVHHLVPNCRSDQDYKGILKGHSRAVFNGKVIVAKNAQHTDAKQQNKNLL
FT                   LSANAEIDTKPQLEIFADDVLCSHGATVGQLDEEAIFYLATRGISRDEASHYLIQAFAN
FT                   DNLRLIPNRDLADWMGNLLTQQLGYANEY"
FT   gene            732024..733268
FT                   /gene="csdB"
FT                   /locus_tag="LPC_2695"
FT   CDS_pept        732024..733268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csdB"
FT                   /locus_tag="LPC_2695"
FT                   /product="Selenocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2695"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56607"
FT                   /protein_id="ABQ56607.1"
FT                   /translation="MSTNPSLMTSFDVNKIRKDFPVLHQKINEYDLVYFDNAATTQKPK
FT                   AVIDAIAQFYEKDNSNVHRGVHALSVRATEMYEAARAKVKRFINARSPRECIFVRGTTE
FT                   AINLVAQSLVAPRILPDEEILITYMEHHSNIVPWQMVCKKMGCKLQVAPISLNGEVILE
FT                   EFERKLNENTKMVAINYASNSLGTINPVKTMIKMAHEVGAKVLLDGAQATAHLIVDVQD
FT                   LDCDFYAFSGHKMYGPTGIGVLWGKEELLNSMTPYQGGGEMINSVSFEATEYAAIPHKF
FT                   EAGTPNIAGAIGLAAAIDYIWSLDLDAIAEYETQLLNYATKAIEAVKGYNIIGTAANKV
FT                   PIISFVHGKIHAHDIGTILDSEGIAIRSGHHCTMPLMDFYDVAATSRISMSFYNTFKEI
FT                   DYCMEALQRVKEVFA"
FT   gene            733265..733714
FT                   /gene="nifU"
FT                   /locus_tag="LPC_2694"
FT   CDS_pept        733265..733714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="LPC_2694"
FT                   /product="nitrogen fixation protein (Fe-S cluster
FT                   formation) NifU"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2694"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56606"
FT                   /protein_id="ABQ56606.1"
FT                   /translation="MSMELRELYQEIIIDHNRNPRNHHAMEDATTEAKGFNPLCGDKLT
FT                   VYLKLQGDLIRDVSFIGCGCAISQASASLMTDALKGKSIKEAHELFHRVHRMLTQEEED
FT                   SLVSMDKLTVLAGVKAFPARVKCATLAWHTLEAALNKETEVVKTE"
FT   gene            733786..734121
FT                   /locus_tag="LPC_2693"
FT   CDS_pept        733786..734121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2693"
FT                   /product="metal-sulfur cluster biosynthetic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2693"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56605"
FT                   /protein_id="ABQ56605.1"
FT                   /translation="MFGFKKKQSNESIKEGVITALRGVFDPEIPVNIYDLGLIYDIAVN
FT                   DEGHVHIQMTLTTPGCPVAQTFPGTVEQAVNQVEGVSDCTVELVWEPPWSQDRMTEAAR
FT                   LELGIFY"
FT   gene            734124..735077
FT                   /gene="syk3"
FT                   /locus_tag="LPC_2692"
FT   CDS_pept        734124..735077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="syk3"
FT                   /locus_tag="LPC_2692"
FT                   /product="lysyl tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2692"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56604"
FT                   /protein_id="ABQ56604.1"
FT                   /translation="MSDNSWLPSASIQLLRARAELIGKIRQFFTERQYLEVETPVMARH
FT                   GVTDVYLSNIKAIFRGETCYLQTSPEYHMKRLLAAGSGPIFQLARVFRDDELGRWHNPE
FT                   FTLLEWYQLHIDHHVLMDEVDLLLQIILKSQPMIRKTYQQAFEEACGIDPFSTSIEQFT
FT                   KILAQHGLDGVLSPHEQDRDQYLFLLMSHVVEPFLAEESTPVAVYHFPASQAALAQVNE
FT                   GVAERFEVYYQGVELANGFHELTDVEAQKKRFMLDQQHRKQKGLTAMEADAYLLKALEY
FT                   GLPPCSGVALGVDRLLALALKQPNIANVFSFDFSRS"
FT   gene            complement(735199..736062)
FT                   /locus_tag="LPC_2691"
FT   CDS_pept        complement(735199..736062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2691"
FT                   /product="hypothetical SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2691"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56603"
FT                   /protein_id="ABQ56603.1"
FT                   /translation="MELPYHFSTVYVSKPEFIEALSEELGEVSNKIGSLVFSPHQKLDV
FT                   CFALDVWLEPEIVTFQSISEAAKILRQAGKFWYLHPVTEIRRSRLIEEQLRKCPSLMSH
FT                   FPVTSDIPPIGVFSLLDRNTLLFSAKRLKKWPDGQCYFIEDKVNPPNRAYLKLWEALFL
FT                   LNKYPLPGETVLDLGASPGGWTYVMQSLGTQVTSVDKAELDTKIMALPRVSFLKQSAFA
FT                   LDPEQLTESYDWVLSDVACYPDRAYTLIKKWIASKKAKQLIFTIKLQGLTDLNTSNDFN
FT                   PYLIPK"
FT   gene            complement(736309..736953)
FT                   /gene="alaS"
FT                   /locus_tag="LPC_2690"
FT   CDS_pept        complement(736309..736953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="LPC_2690"
FT                   /product="alanyl tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2690"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56602"
FT                   /protein_id="ABQ56602.1"
FT                   /translation="MEKIFWSNPYQHTLDTKIISVNGNEILLEKTIAFSFSGGQESDRA
FT                   FINGLEVLSSRIDGNLIYYTLPDDHNLAPNDVITITIDWPRRHRLMRLHFAAELILELV
FT                   TRTSMLEKVGAHISESKARIDFKANFNISSIFSQLLDEYNAIIRQDLVIHKGYHDVTNQ
FT                   RRFWKIDGFAEVPCGGTHVHSTSEVGFIRLKRSHPGKAIERIEITLMDDSR"
FT   gene            complement(736956..738251)
FT                   /locus_tag="LPC_2689"
FT   CDS_pept        complement(736956..738251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2689"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2689"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56601"
FT                   /protein_id="ABQ56601.1"
FT                   /translation="MNQNSFKPKNNFVSLVMWALPLSFFTFQFLLRLWPGLTMQDIMAQ
FT                   FSIDAASFGLIAAFYYYGYAGMQIPVALLLDKFGARFVVFAFAMLCGIGTLVFIGTNNF
FT                   YLALSGRFLIGVGSAAGFLGVSKVVSEWFSHSQYSRMIGFSFSVGLLGAIYGGKPLAHL
FT                   IQNFSGQQVGLALAVFSILLGCCALLILRSPPNNTHSVTKTMNLSHCSSLFSSWIIWAL
FT                   ALANLLMVGALEGFADVWGVPYLIAKYALNKTDAAFLISFIFMGMIFGGPLLAFLSQKL
FT                   GNYFVIALCGAGLAFLFLILLYTSTLHWWQLGTLFFAIGLLCCYQVIVFAAGSTLVPYE
FT                   GLGVTIAFLNCINMLGGSFFHTLIGKLMNSSWRGQMSANGLKLYEIESYQWALSLIPFC
FT                   ALCGSLLIVLIHIKTRAYAAPGFIKKTSLTGV"
FT   gene            complement(738526..738687)
FT                   /locus_tag="LPC_2688"
FT   CDS_pept        complement(738526..738687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2688"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56600"
FT                   /protein_id="ABQ56600.1"
FT                   /translation="MLIEYRSPGEFKMTQPELKDTIIIIRFNDKLFNQSNRIEMTPNTS
FT                   KWRPPIDK"
FT   gene            738905..740224
FT                   /locus_tag="LPC_2687"
FT   CDS_pept        738905..740224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2687"
FT                   /product="metal ion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2687"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56599"
FT                   /protein_id="ABQ56599.1"
FT                   /translation="MYNILLIFIAFLLVLLNAFFVSAEFGMVKLRATRIQAIKENYGLR
FT                   GRILEQVHQNLDAYLSACQLGITLASLGLGWIGEPAFAELLGPLFVALGISSVHIVTIS
FT                   SFFIAFFLISFLHIVIGELMPKSIAIRQSELISIWTAVPLYWFYWIMYPAIWLLNTCSN
FT                   FFLKLSGMDIKNEYEGFYSSEELKLILSGQHLQSELKEDEREILEHTLDLAELNVTEVM
FT                   RPEDEMIIIDINEPFETIKDKILKYRYSRYPVYDSGTREMIGVIHVKDLFADLLLQKNI
FT                   NTLKPYVRPVLKVSHKLPAMDLLRKFRAGMPHFALVYKHKSSLLGFVTLDNLLHILIGR
FT                   IKDEFHKTHEDWVKNSDGTITTKGDCSLYSLERALDCDITLSPDEEELNTLYGLIITRH
FT                   GKLPNEGEIIQFVEFDALIEKVQDSFITKIKVFPKIKNQE"
FT   gene            complement(740278..741324)
FT                   /locus_tag="LPC_2686"
FT   CDS_pept        complement(740278..741324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2686"
FT                   /product="alcohol dehydrogenase (NADP-dependent,
FT                   zinc-type)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2686"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56598"
FT                   /protein_id="ABQ56598.1"
FT                   /translation="MSETIGYAAHKAGAPLKPFTFERRPVGAHDVAIDILFCGICHSDL
FT                   HQVNNDWAGAFYPMVPGHEIIGRVKEVGHQVRRFKAGDLVGVGCMVDSCRQCTYCHQNE
FT                   EQYCKSGATFTYNSQDNHLGGVTYGGYSKHIVVTEDFVLKIDESLDPAAAAPLLCAGIT
FT                   TYSPLKRAKVGKMSKVGIVGLGGLGHMAVKLARAMGAYVTVFTTSINKIKAGKDLGAHD
FT                   VVLSTDNNVMQTLANQYDFILDTVSAKHDLGQYLNLLKVDGQLTQVGLPSDPLEVTMFP
FT                   VILKRLSINGSLIGGIKETQEVLDFCARHGITADIELIKMHEVNSAYERLLKGDVKYRF
FT                   VIDMSTLD"
FT   gene            complement(741525..741869)
FT                   /locus_tag="LPC_2685"
FT   CDS_pept        complement(741525..741869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2685"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56597"
FT                   /protein_id="ABQ56597.1"
FT                   /translation="MRKHKNKMVRIFLLALGLFSSTTINAWYGSGITIGVARANVHYYG
FT                   DDIRVYDPWGYGYYDRNYYYNGVRNIIVPNVIVPNVVINVPVQRYYVPSCEEMEVCDPY
FT                   GQCWLEQFCR"
FT   gene            742057..742461
FT                   /locus_tag="LPC_2684"
FT   CDS_pept        742057..742461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2684"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56596"
FT                   /protein_id="ABQ56596.1"
FT                   /translation="MHKLIELQGVGPKYAEMLKRVGIESQEDLLRVCSGRRGRFRVAEQ
FT                   TGISHKLILKWTNQADLARVNGINEEYAELLEQAGIDSIPELAHCNPEQLYSSLKEKNE
FT                   QCHLAQHVPGLSQVVTWVEQAKKLPRAVYH"
FT   gene            complement(742497..743099)
FT                   /locus_tag="LPC_2683"
FT   CDS_pept        complement(742497..743099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2683"
FT                   /product="polypeptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2683"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56595"
FT                   /protein_id="ABQ56595.1"
FT                   /translation="MALEIITIEKKENYHMLKTRAENIQFPLNREDKDLIEAMKKKLYA
FT                   LGGVGLAAPQVNSAKQIIAVYIPEEAQLLRDNAKIFPMHILINPNYEPLPHTRIISDFE
FT                   GCYSVSSKAGKVPRYDEIQLKYYDEEGNVHQQIENGFYARVLQHEIDHLNGVLITDRLT
FT                   PDCVQGTIEEMMTIRRAELPVEKRKLFDQIMAKKLKK"
FT   gene            743429..744616
FT                   /locus_tag="LPC_2681"
FT   CDS_pept        743429..744616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2681"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56594"
FT                   /protein_id="ABQ56594.1"
FT                   /translation="MIDVGKIITDLAWPISLLIAWFAGELGYRWAKLPHISIYAIVGFS
FT                   LASTQIGLLPSIQPPSILLLANIGFGLILFESGYRINLRWLSYNPWVAASSITEATLTF
FT                   CLVYILVKSFGLQTSTCLLLASLSMATSPATVVRVINEQRSSGQVTERVLHLSVINCVL
FT                   AVFLFKVIIGLVVFRTSGNLWEAAYASLTVTAISTIWGIIFGVIMPILLKTVKSTCQDN
FT                   TLAFACAVILLVILTHNLKLSPVLATLTFGLVSRHGRMVFSPSQPGFGTLGDLLSVLLF
FT                   VFIAATIEWQRVVTGVWIGLSIITVRFVAKIIGISLFAHISGISLKKGILTGLAMTPIS
FT                   VFVILILEQSRYIGINLVDTLAPLAMVALTLEILGPIMVQRALIKANEISAIKEF"
FT   gene            744618..745739
FT                   /locus_tag="LPC_2680"
FT   CDS_pept        744618..745739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2680"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56593"
FT                   /db_xref="GOA:A5IGU3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGU3"
FT                   /protein_id="ABQ56593.1"
FT                   /translation="MPLQPFKTSNLLTMGVELELQLISLSNFDLTAASPDILELLGRSS
FT                   FPGSFTPEITESMLEIATDVHEEYDQLLKQLFHIRDALVTVGDRLNIGICGGGTHPFQM
FT                   WSDQRIFNKTRFIEVSELYGYLTKQFTIFGQHIHIGCEDGNQALFLLHSLNRYIPHFIA
FT                   LSASSPFVQSKDTLYNSARLNSVFAFPLSGRAPFVLNWDEFSLGYFEKMEHTGIVKSMK
FT                   DFYWDLRPKPEFGTIEMRVCDSPLTVERAAALACYMQALCSYLLENKEPLPHEDDYLVY
FT                   NYNRFQACRFGLDGTLVHPKTYEQILLREDILTTLRRLKPYANQLNSTMALEHIYEITH
FT                   KGSDASFLREKYAEHRTLESVVNESLKQFRRSK"
FT   gene            complement(745804..746205)
FT                   /locus_tag="LPC_2679"
FT   CDS_pept        complement(745804..746205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2679"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56592"
FT                   /protein_id="ABQ56592.1"
FT                   /translation="MINQQIEVFLKSPAFAVVGASSNREKYGNKVLRCYLRNGKKVYPV
FT                   NPHETLIESLPVIHSVNDLPDDVHSISIITPPSITEEVVKEAVKKGIQHIWMQPGAESD
FT                   SAIQYGLDHKLNVISGGPCILVVMGYEEN"
FT   gene            746350..747207
FT                   /locus_tag="LPC_2678"
FT   CDS_pept        746350..747207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2678"
FT                   /product="GTP cyclohydrolase I PLUS perhaps regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2678"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56591"
FT                   /db_xref="GOA:A5IGU1"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGU1"
FT                   /protein_id="ABQ56591.1"
FT                   /translation="MNKELESIYQNIANQSELGQTANYDSYYNPKRLYPIPRAPKRQEI
FT                   NLDPNSTTFYGFDCWNHYEVSWLNSKGKPVVAMAVISYDCHSPCIIESKSLKLYFNSLN
FT                   NSTFPDVETVVQTISKDLSYCIGSEVAVNVYPLSDIPNQTIYAAFDGVCLDKLDIECSV
FT                   YHVMPDFLSTSSELVEEVLYSDLLKSNCLVTNQPDWGSVQIIYKGKKINHEGLLKYLIS
FT                   FRNHNEFHEQCIERIFADIMRFCQPESLTVYGRYTRRGGLDINPIRSTEPCAFDGQNIR
FT                   LIRQ"
FT   gene            747601..748692
FT                   /locus_tag="LPC_2677"
FT   CDS_pept        747601..748692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2677"
FT                   /product="major outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2677"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56590"
FT                   /protein_id="ABQ56590.1"
FT                   /translation="MKKYHQLLMGISLLLFGVCNYAGDTGPVENSDLFRVFIPNLKPGY
FT                   EFSATAFYLQPGADNLGWGVITTVLPIPSPNWQVVTFNPDYQVGFNLGGRYVFANSGSD
FT                   LQLNWSHLRTNDTDNVFVNPSSQWISPFSQTGTPPTPSGQITGVALLKLAHASLDFSYD
FT                   AVSLDVGKFINFGSKLQTRLFTGLSSAWIKEELISTFRGFSLPILSLNNTSTYKGVGPR
FT                   LGFNNSYNISHGFNLVGQLAGSVLYGRMQPAQYQFTGTSQQLIIAGIFVNREGLANPSV
FT                   NQLVPALDAKIGLSYLYSLKQNWDLNFEAGYMGALYFNPLSSYETNTNVIALDTGSLST
FT                   SSAKHTQSNFSVGGPYITVSLRT"
FT   gene            complement(748852..749424)
FT                   /gene="tag"
FT                   /locus_tag="LPC_2676"
FT   CDS_pept        complement(748852..749424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="LPC_2676"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2676"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56589"
FT                   /protein_id="ABQ56589.1"
FT                   /translation="MSQNIILNRCEWVGQNKPHYELYHDTEWGIPVHDDEKHFEMLILE
FT                   GAQAGLNWETILKKRDGYRRAFKQFNPQAVAQMTDDELNALLINPEIIRNRLKIFSTRK
FT                   NAKVFLSIQQEYGSFDSYVWQFVNGAPILNRPENIRAIPATSKESDALSKDLKKRGMSF
FT                   VGSTIIYAYMQAIGMVNDHIVTCFRAK"
FT   gene            749739..750119
FT                   /locus_tag="LPC_2675"
FT   CDS_pept        749739..750119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2675"
FT                   /product="glyoxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2675"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56588"
FT                   /protein_id="ABQ56588.1"
FT                   /translation="MTQAAFGEFCWNELATSDVKKAKDFYGKVFGWQFREIESKEMTYT
FT                   LIQCNDKEMAGIWQIPKDQQSHIPPHWMAYIYVQDVSEALKKAKQHGAQEVKGITQAGE
FT                   MGRFAIIVDPTGAHVALWESFE"
FT   gene            complement(750225..751178)
FT                   /locus_tag="LPC_2674"
FT   CDS_pept        complement(750225..751178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2674"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56587"
FT                   /protein_id="ABQ56587.1"
FT                   /translation="MARNKRLDRFHNAQNSNTCGYDQAFSEIQGGRKRSHWIWYIFPQL
FT                   ENLGKSPSAKLYGIKDFNEACDYLKDPVLFKRYFELIKLIEEKLKNIPLPHLMGGFPDD
FT                   RKFISSLTLFQATSNYLSSKDTDSQNKYHELYETCNRVFKQIAPQGYSPCQQTELLVKH
FT                   QSNSPVKKTTEKSSQPPQVTIFSPKRSKPNTAHPILKDLAQYINKRGNEWSYHYNFLGL
FT                   VAFVYFIQDLILGTDYLNDKARQVKLTAASKLQKILDPQCHERCNLNPSERKALSDGRL
FT                   GEIINKHGGLDKILTEAPRKPPKTGHDQEINISPFS"
FT   gene            complement(751289..752713)
FT                   /gene="sidA"
FT                   /locus_tag="LPC_2673"
FT   CDS_pept        complement(751289..752713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sidA"
FT                   /locus_tag="LPC_2673"
FT                   /product="SidA protein, substrate of the Dot/Icm transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2673"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56586"
FT                   /protein_id="ABQ56586.1"
FT                   /translation="MAKKYRTPIPLSDKMMTLKKNLQDQLTQSQSLGEQIHAGTTAAST
FT                   ITTGVSHVFNVIDSFLSAYRQIPLVGGILQLVATVAKSISIVSDPEKSIAEKIISSILI
FT                   AAIIALSITAITLGGLAAAIIGTVIASTVTIMEGLGFFGKIAEKFQLANSYKMKKEFID
FT                   LVAKRIEPDNDKYNDLLEIRAIELQHELEKSYPNQIEQQQLKEELNFINTVLRKKNITP
FT                   GNNKENDAYKLNQLYAKRAEQLKTLVDKIALINPTGKRAEQNKLLSEIKSLQKEITKTD
FT                   DSIEEIIAPLAKIERDNLKSTINLPLSYSTFAIAAASTLISIAGLLVVAGVIAAPPIMV
FT                   PIMFAVGSVMAIIGLIKWTAEKMAEIEDAQLKAEETAKHEDAVLDEALNVYEQQLNLEL
FT                   VSPANPARQVKNILTVQDKVPALSPTESTVSSLDSRFTLFGSSSREHTKIAEQKTNDTT
FT                   NEQAPTTFDSISKPTR"
FT   gene            complement(752873..754801)
FT                   /locus_tag="LPC_2672"
FT   CDS_pept        complement(752873..754801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2672"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2672"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56585"
FT                   /protein_id="ABQ56585.1"
FT                   /translation="MTRAQTHPHQTTVISNLKIIPLTLGWLLKFALLIIIIAVFTPLSP
FT                   KMPAPGLDASWAVGLNQAVAQGLAFGKDIFFTLGPYSSIYTKFYHPATNFMMVGGSLYL
FT                   ALCYWIAIILLMQGIKWRWSIAFAILLFSMIYARDSLFFSYSLIIGLLIHKEIPGKETS
FT                   LKSNFFTLFALLFTPFGLFPLIKGSLLILSIITILLCSFFLSLYKQRNLVVLCLASPVV
FT                   SILFFWIASGQSVFNLPAYISNTISLASGFTEAMATEGDNKELIFFGITSSCILLSILL
FT                   QKQLSPLSKAFLFCIYFVFLFLSYKTGFTRHFGHAFIAGTSVLLASFLLPYFNSNNKVI
FT                   VPLLALSLYTANYINGHYTKISVRDNFISTYTAAYYGLQNRIQNKNWLKENFSLTMNYL
FT                   KARDDFPRLPGTTDIYSYNQTSLIASGMQWSPRPIFQSYSVFTAKMAEINTNYLLSENK
FT                   PDNIIFKVEPIDNRIPSMEDGMSWPTLINHYQPVRLENDFLFLRKKLVNKPVTSLVPLK
FT                   TEIHTFGEQVKIPDTDKPLFVEIEIQPTLWGRLATTFFKPHQLEANLELKNGTQRQYRL
FT                   ISNMAKSGFLLSPLIENSAEFGLLFSQNNYLAGKKVISFSINSKQVPSSHWQTKYTIHY
FT                   KIFASNN"
FT   gene            complement(754927..755319)
FT                   /locus_tag="LPC_2671"
FT   CDS_pept        complement(754927..755319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2671"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2671"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56584"
FT                   /protein_id="ABQ56584.1"
FT                   /translation="MLTTFLATVIGWYLVIVSLFLLFHNEHAKSAMAEIIAHRGSQLIM
FT                   AIVTLITGLLLVVSHNIWIMGWPVVITLFAWLVLLGGLIRFLCPDTAVRVGQSFVDNPM
FT                   RLKIAAVIFFIIGLFLLFNVYYVYLK"
FT   gene            755456..755833
FT                   /locus_tag="LPC_2670"
FT   CDS_pept        755456..755833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2670"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2670"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56583"
FT                   /protein_id="ABQ56583.1"
FT                   /translation="MMKKINLFKLLMIFVLGTSALQAAGLSTQRIEQLSNARVTVWKTI
FT                   IYPSSKQVLPMHRHDNDRVLVALTDGTLKITNNKGKVHYLKLKKGKSYYLTKDVPNELH
FT                   NDENVTNHSIQVMVIQLNDKA"
FT   gene            756034..757341
FT                   /locus_tag="LPC_2669"
FT   CDS_pept        756034..757341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2669"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /note="COG0457"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2669"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56582"
FT                   /protein_id="ABQ56582.1"
FT                   /translation="MHTQRGLEVTTGSIEAVDSINYFHEQVLSSGQNAIQILDSAKKHT
FT                   DNLLIQTYAAAFYLYAQEDVANEQASDYLQSASRLLTSANEREKLTFEAVTNWSKRDYA
FT                   NAISLLVTLLERYPRDTLALKFVEWLFYCTGQAFNAEYFLKVCDKCAPENQDESHFLAI
FT                   HSFALELCGQYSKAREMAEEAITMNLHTPWAHHTLAHVHLLTSDITGGINRLRDLQKTW
FT                   EDILPLLKGHNTWHLALFYLANRDEEEVKKLYPHISGALPDTVLEQLDTISLLWRMDMA
FT                   GLPQDRLLNQVVDHLSTHPLEFYTGFTNAHFIYCLVKSGYKNEADESLKRMKSYACAPS
FT                   SDALWGDVVLPLCQGIYAFADADYKTALMLMEPVIGECAQLGGSDAQIELFFQTYLLVL
FT                   IHTNQKDKALQFFTEHLKYYNNTPLSDWWFQSANKT"
FT   gene            complement(757397..759604)
FT                   /gene="comA"
FT                   /locus_tag="LPC_2668"
FT   CDS_pept        complement(757397..759604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="LPC_2668"
FT                   /product="DNA uptake/competence protein ComA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2668"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56581"
FT                   /protein_id="ABQ56581.1"
FT                   /translation="MEIYCFLIGVLYAYTYNIYLTIAIPLLFYITPRYPIVLFFIAGCG
FT                   FALIHQWIVSPKGMPDTQVITQAQLEGTIASIPMQRPNKTQFHFAIEKINNNPAQGLIQ
FT                   LNWYNKPPVLRAGQRWQLSVKLKKPRNFRNPGGFNYVRYLAARHIHWTGYIRYGNNKLI
FT                   SNQPPSFSWLTLREKIGDALTKLAPNTETAGIIEALTLNVTHHISSEHWNLFRRTGTVH
FT                   LFGISGEHIALVSCIFFIVIRWIWSMSYRCCLFLPAHTIASIGGLLAALPYAFLAGFEP
FT                   PVQRALIGCVLYTIYAIGKQRFTPWQIWRYALFLVLCIEPHAVFLQGFYFSFLAVACLL
FT                   LTHQRWPLKNYKKTLTLQLSCLIGLMPLTLHWYSYGSINGFLANLFSIPLVSFLIVPLA
FT                   LMTMITSPLHWSWILMKPLAWLVALLLQGLTYVEQIAGINITWSITSVTMMLAMTAGLF
FT                   LRVLLPVKPFKHLAILWIILPLFPPRTAIYPGEALINILDVGQGLAVAIQTQHHVLLYD
FT                   TGDSYFQGSDLGQMAIIPFFRSIGIKTIDKIVISHPDKDHKGGLNSLEKEMQVNQLIVN
FT                   DPYFYKRGSNCHSYPQWQWDGVSFRFLPIKESFTKKNNNSCILQVSNSAGRVLLTGDIE
FT                   KAAEEYLVRNYGSQLASEILVVPHHGSKTSSSYRFLLEVNPLYAIASLGFDNRFKFPHS
FT                   KTLQSMKTLDITFFRTDECGMAAIKLPASGQVHRPSCMQAN"
FT   gene            complement(759682..760131)
FT                   /gene="pilE"
FT                   /locus_tag="LPC_2667"
FT   CDS_pept        complement(759682..760131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilE"
FT                   /locus_tag="LPC_2667"
FT                   /product="type IV pilin"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2667"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56580"
FT                   /protein_id="ABQ56580.1"
FT                   /translation="MLSHVHFMKNSRMKQSAFTLVEVLISMVIMGILVSIAYPSYLQYI
FT                   QKSRRADAHATLTQDQIILERCYSQNFSYAAACGALPAFPQTTPNGYYTINISNLTATT
FT                   YTLTATPVGTQAKDTECASMSINQANVKTAVDSSANAQPECWNPG"
FT   gene            complement(760143..763652)
FT                   /locus_tag="LPC_2666"
FT   CDS_pept        complement(760143..763652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2666"
FT                   /product="type IV fimbrial biogenesis PilY1-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2666"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56579"
FT                   /protein_id="ABQ56579.1"
FT                   /translation="MDALTFWNFTRKGSQKAIKVLPRTLMAILLSASVSLYAVPLAIPQ
FT                   IPLIIASPVHPQVLILLSNSQSMDGNLSGAIMTGSGSLSTGLSSLYNSSSPVNYTVPAG
FT                   FTPPVQGPDANGLAPYTVVQGGNKVDNSASRLNVAKAGIKAIIENYMPTTDFALGTYST
FT                   SNISSYNTWVYYMSPPGSDFVFTNTPVAGNRYVTNPCYNYGSASSTVSSNCSSIGSLYG
FT                   TTLVSSSQYLQIGDSSDDPDINDVLYAGSGFPGIFVSYNGPTPSSPFPPNYTISNYNQG
FT                   NIRISYANTRPSIGNFSSSPTNAGFVPFSQQVMYVQRGFGYYSNQSYATGNMLVNMQTA
FT                   GTNPTTTSVNNAINAFLPHLKPETNSTATTEIKAAAVQSPLAGLLTRSRSFMKTVGTTS
FT                   GNCPQKQYIILISDGLPTQDLQSRYWPPLGSAAATGYGVTATFNADGSLNSTNSQALSD
FT                   AINEIKALKNDGVLTFIIGMGAGVDPAVNPEAAATLRAMAVAGGTENYYPATSPEALVS
FT                   SLNSILSNIQNGSFSTSAAAISSTRIDSSTVEYQANFITRDTPYQDWTGNLTAIELDEN
FT                   TGQPTNIIQWSAQSTLDSLVSGTGWSTNRKIATWDPIAADGVPFRWANINATQQAQLQP
FT                   SDLLGENRLEYLRGNAALEKRNGGTFRDRSHALGDIIDSQVIYVGPPSAPYLTASYISF
FT                   AKANANRQPMLYVGANDGMLHAFNATTGEEFFAFIPNAVFNNLHQLTSPLYNQNHLFFV
FT                   NGSPESADVQFSDGSWHTILVGGENAGGKSIFALDITNPTNLSSEPGVANAVLWEFTDT
FT                   DLGLTYSKPQIGQIRSGSPSSLNFAVFFGNGYNNTNNKSVFYAVDPQTGTLLRKIDLCA
FT                   AVPSACNVNLPQGLSTVALGQKDGLQADPVTVVYAGDLQGNLWAIDVSSADPASWSARV
FT                   LFQARDSAGTPQPITTPPLVTLNPNYPRNPGLFVVFGTGQLLTTSDLVTTQRQTIYGVW
FT                   DKPLSSVPYVRANLQQQTLTLVNSATSGLSTNIITATAATINWSNKVGWFADLPIAGQR
FT                   LITTPELINGAFIATINTPPLNSCGFGFTSMLLELNFLNGGAFQYARFDISGDGGFDIA
FT                   DQYNGAYPVGIGLSNSYANSPTVLGPNKDNNLVILITQSDGTQTTVIAPNITPRKIGWW
FT                   QIQ"
FT   gene            complement(763665..764177)
FT                   /locus_tag="LPC_2665"
FT   CDS_pept        complement(763665..764177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2665"
FT                   /product="Tfp pilus assembly protein PilX"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2665"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56578"
FT                   /protein_id="ABQ56578.1"
FT                   /translation="MNVSSTNQYSKQRGYVLITSLVLMSMLTVLALTQISQNTSQTRIA
FT                   TNATDSEISFEKTEGAINEAINLIINGTYNPQSFLASNNGMYLFDQSATTPLWKTINWS
FT                   SGSAVINSFQGNTGAQASYYLEKLPSVIMPGQSMKKPSNVYRITARSSGASGDTSVLIQ
FT                   STIQIQQ"
FT   gene            complement(764174..765241)
FT                   /locus_tag="LPC_2664"
FT   CDS_pept        complement(764174..765241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2664"
FT                   /product="type IV fimbrial biogenesis PilW related protein,
FT                   transmembrane)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2664"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56577"
FT                   /protein_id="ABQ56577.1"
FT                   /translation="MNINYRLQQGFSLVELMIATLVGLILTYSILQIYLAQTQLYKASN
FT                   SQDLIQSTENAISNLLIPVIRSAGFAGCGSIITAVSSLNAGGPRPLGILNTTPTILMGY
FT                   NGSGASFTITQSNPANSSNASHWSPALDSTLVGNAQQGSDVLVVLGSTSDSYPTGITTI
FT                   DPGSNTFVVQGTSGMSLTSGMFGAVSDCGKTVIFQITGVAGTTITHDAGAGVLQNASSA
FT                   FPVNFQTGSQFIPIQQTAFFVGQGQGGQSALMRASLVGNNWTIQPLVPGVEIMKVQYGI
FT                   GNNGVITRYVSANAVTDWAQVYAIRLGFLIAGQLGSGSLTTRQYNVLDTQITVPADNRL
FT                   RHVFELTINLRNSIS"
FT   gene            complement(765238..765777)
FT                   /locus_tag="LPC_2663"
FT   CDS_pept        complement(765238..765777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2663"
FT                   /product="type IV fimbrial biogenesis protein PilV"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2663"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56576"
FT                   /protein_id="ABQ56576.1"
FT                   /translation="MINRMDTLAKDKGMTLLEVLISVVILAVGMLGIASMLIVSNKANN
FT                   SSYAKLQAVQAVYDIFDRIRANSDAASNGSYNVSNIGSNGYPTSVSAPSVLCNASVCNP
FT                   NQLAQYDTWYWLTRVVSQLPNGSGSITSALSGVAGNTVITVTVQWDDSKAQNELGASSA
FT                   SSGTANFVQFRVQSQI"
FT   gene            complement(765790..766497)
FT                   /locus_tag="LPC_2662"
FT   CDS_pept        complement(765790..766497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2662"
FT                   /product="type IV pre-pilin"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2662"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56575"
FT                   /protein_id="ABQ56575.1"
FT                   /translation="MNKVITESQRFTLRNVANMLLCVDASVLPTQSNIAQKIQTKGIMY
FT                   NDLCKDSFDTEVPLNSNPLSIAGFTLVELLVTLSVFAIILTLIVPSLRTMILNSRLTSN
FT                   IDSLVSSLNYARGVALDRAVNVAVCPLGSPGSTACGANWSSGWIVVTQPVAGAPTLLKS
FT                   HQTSVNDPVITSNVSSVVFDPHGLSTTQSNFTMCDNRGNAFARSAMVLATGFVQSGTTP
FT                   GQAVWSNGALNCP"
FT   gene            complement(766720..767580)
FT                   /locus_tag="LPC_2661"
FT   CDS_pept        complement(766720..767580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2661"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2661"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56574"
FT                   /protein_id="ABQ56574.1"
FT                   /translation="MKIKTVTRYLLLFSIFFLIGFNNVFAQKKAIAITIDDLPFVGEYR
FT                   NFHLNMMMNTMKDEKIPATGFIIAKEVRPDNWEILHKFRDAGFGLGNHTFSHANLNKLK
FT                   AKEYIQEIKEADSLLMPVLTEPKYFRYPYLAMSSGNKKNKILCYLEKHHYQVAPITIDS
FT                   KDFVFNQRLLSVPELGRRTYLDELKPFYLDFIWQQTLKAEEHTQYHHNPDQAQILLIHA
FT                   NLLNAYVLPDIINLYKQNGYTFVSLEDALKTFKENYHCHKTRILAKKPVGEETDLNIES
FT                   FMDWD"
FT   gene            complement(767756..769093)
FT                   /locus_tag="LPC_2660"
FT   CDS_pept        complement(767756..769093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2660"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56573"
FT                   /protein_id="ABQ56573.1"
FT                   /translation="MTFVLKEFDTLKSHFNDTVKIILQREKKDKIEDLPNPRKEELQFL
FT                   TAVLNQLEAKIDELKPRSLASYVHVFYGAMLLVCKDVENNLRVMEKKENSLLFTRLMDG
FT                   MGISDENIPTSEQNIMFYRGLNKFLNFIYESNDSRKGLKKEHFLQVLSLKKIYSLAKLS
FT                   YEQEEAAENNALAKLTADGKTKANANSFHVEKPIDSSIVEQFKSWDEMKGALHQLILDE
FT                   LSDKNVAKISALSQARSAQLKFLQTMAEQLDKIPNQSLEPSEKMAILAGAMYIVRGQIA
FT                   QEYGKDPLSNDKISATVIHTGLSTILHANADCCEDKEVLIAAANKFIRHMVIERPEQSN
FT                   KKITKESIRENNMFSDIAGFQLISVLTLIQNMIKTCRTDAIEACVTKRKEELEALNPKK
FT                   EGYSIASSVTGYVGSWFKKAPSISEEDEEDDLKDQNTAEETSKPTV"
FT   gene            769395..770876
FT                   /locus_tag="LPC_2659"
FT   CDS_pept        769395..770876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2659"
FT                   /product="melitin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2659"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56572"
FT                   /protein_id="ABQ56572.1"
FT                   /translation="MSFQTDKEIQQKFFSYTLFVLVVLLICRLIANYFFPLFDTTESRY
FT                   AEIARKMLETGNWVTLQQDYGVPFWAKPPLSIWLSAFFMQLLGVNEFAVRLPGLLLSVG
FT                   VLWLVWGVAKKQSGSMAALFSLLTLAGSLYFFLDAGTVMTDPALLFCTTLASVSFWHAM
FT                   VYENKIWSYAFFAGLGLGLLAKGPIAVVLVGMVVFFWVLLRNEWLNLWKRLPWFKGTFL
FT                   LLLIAMPWYVLAELRTPGFLNYFILGEHFHRFLTPGWSGDKYGIVHHVPKGTIWLYAIA
FT                   GIFPWNIIAGGWLVKHGKMLPSLCQSEDGWLSYLTLWMITPLLFFTFASNIIYPYVFPS
FT                   LPAFALLFAEILNRLNLELKHLKWVLISSLLCGVLFLAVAFVLGLKPDVVPNTHKPIIT
FT                   AWLNQNPTAGSHLVYWGYKTDFSAEFYSEGQVKSVKNQNDLCKLLSNRLENYLVINSKE
FT                   TQQIPGELLARLTLIDTFRVHRDTLILFHAPVLTC"
FT   gene            771008..771637
FT                   /gene="tdk"
FT                   /locus_tag="LPC_2658"
FT   CDS_pept        771008..771637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="LPC_2658"
FT                   /product="thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2658"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56571"
FT                   /protein_id="ABQ56571.1"
FT                   /translation="MAKLYFYYAAMNAGKSTVLLQSSYNYRERGMQTLLFTPAIDTRFQ
FT                   YGTICSRIGLSEQAYAFNNSDNLYVLTQEFQLQTQKYSCVLIDEAQFLTREQVYQLTEI
FT                   TDQMSIPVLAYGLRTDFRGELFPGSQFLLAWADELIELKTICHCGRKAIMNMRIDENGQ
FT                   AVVEGEQVLIGGNESYVATCRLHYKLGEAGKTFPRNKLFNKDTNTF"
FT   gene            771688..772956
FT                   /locus_tag="LPC_2656"
FT   CDS_pept        771688..772956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2656"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2656"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56570"
FT                   /protein_id="ABQ56570.1"
FT                   /translation="MSHSVAVESRTFVPRGDFMAWVVCLSAGLFFLYEFFQLNIFDVIN
FT                   QSLREDFHIDATQLSWMSSTYLWADILFLLPAGLILDRFSTRKVILTAMFVCVVGTIGF
FT                   AVTESFFLASFFHFLSGIGNAFCFLSCVVLVSHWFPPRRQALVIGSLVTMAFIGGMMAH
FT                   TPFAYLNDLFGWRRALLIDGVVGDFLILWIYMIVQDRPEDSPAHKLTNEGQILSSFMKA
FT                   LSNKQNWLAGLYTSLLNLPIMVLCALWGASYLQVAHHLPDIAASNVVSLIFMGSVVGCP
FT                   LVGWLSDTQGRRKPLMIFGAIATLITTIPLFINVVLTQMSLSILFFALGLFTSTQVISY
FT                   PLVAESNQPENTGAATGIASVIIMGGGGVAQVLFGWLMTHHAGTNVTAYTVSDFQFAMW
FT                   MFPVAAIAGLVAVLMTRETYCKR"
FT   gene            772969..774252
FT                   /locus_tag="LPC_2655"
FT   CDS_pept        772969..774252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2655"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2655"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56569"
FT                   /protein_id="ABQ56569.1"
FT                   /translation="MQVVDEFKAFDVKASLMPWLVCFAATMFFFYEFIQGNMFASIAAN
FT                   IMQDFQIQADKMAYLSSIYYLANVIFLFIAGMVLDRFSIKNTILIAMFLCVISTFILSY
FT                   SDSFYVALFCRFVTGIGSAFCFLGPVRLASHWFPPQRMALVTGAIVTVAMTGGMLAQYP
FT                   LTKLVLHVGWRQAVQDVGILGLAMLVLMFFWIKERPQVAIKKEGKPINVLVAARKAYLN
FT                   AQNLRAALYTSLMNMAIAVFGAMMGTLYLEQRLGISPDQAAMINGMLFFGAIIGSPLMG
FT                   WISDKVGLRVLPMKGGVLASLLILLGVLYLPVSVTMMAVLFFLLGLFTSAQVISYALVA
FT                   ESSPPMMTATAVSVVSILTQGGYLIYQNLFSALLTNYGDVRLINGVPVYLLEAYQHAAI
FT                   ILPIGLLIALLLLFGLKETRCQQVGHTV"
FT   gene            774249..775472
FT                   /gene="deoB"
FT                   /locus_tag="LPC_2654"
FT   CDS_pept        774249..775472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoB"
FT                   /locus_tag="LPC_2654"
FT                   /product="phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2654"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56568"
FT                   /db_xref="GOA:A5IGR8"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGR8"
FT                   /protein_id="ABQ56568.1"
FT                   /translation="MTGRVCVLVMDSFGIGASLDAARYGDVGANTLVHIYEACKRGECD
FT                   IDGVRKGSLMLPNLASKGLYHAAMASSGLPFIDLSALAIPSGYYGYAVEQSLGKDTPSG
FT                   HWEMAGVPVTFEWGYFPDKPYCFPEELISEFIKQCNLPGVLGEKHASGTIIIDELGEEH
FT                   IRTGKPIVYTSADSVFQIAAHEEAFGLQRLYDICKIARNLVDKYQIGRVIARPFAGKPG
FT                   SFKRTGNRKDYATPPPEKTLLDFLKEDGREVIAIGKIADIYAHQGVTQEIKADGNMALF
FT                   DATLSAMKTAPQGSLVFTNFVDFDSSYGHRRDVAGYAHALEQFDARLPELEVLLQPNDM
FT                   VFIAADHGCDPTFPGSDHTREHIPVLMFGPQVNSKFIGRRDCFADIGQSIAEHLQLSSP
FT                   LAHGVSFL"
FT   gene            775676..776224
FT                   /gene="hslV"
FT                   /locus_tag="LPC_2653"
FT   CDS_pept        775676..776224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="LPC_2653"
FT                   /product="heat shock protein, HslVU, proteasome-related
FT                   peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2653"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56567"
FT                   /db_xref="GOA:A5IGR7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGR7"
FT                   /protein_id="ABQ56567.1"
FT                   /translation="MEQFHGTTILSVRRGNQVVIGGDGQVTLGNTVMKGNARKVRRLYK
FT                   DKVIAGFAGGTADAFTLFERFEAKLEMHQGHLIRAAVELAKDWRTDRILRRLEAVLAVA
FT                   DSKASLIITGNGDVIEPEESLIAIGSGGPFAQAAARALMENTQLSAKEIVQKALTIAGD
FT                   ICIYTNNNLTIEELNDEGK"
FT   gene            776208..777551
FT                   /gene="hslU"
FT                   /locus_tag="LPC_2652"
FT   CDS_pept        776208..777551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="LPC_2652"
FT                   /product="ATP dependent Hsl protease, ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2652"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56566"
FT                   /protein_id="ABQ56566.1"
FT                   /translation="MMKANNMVMTPREIVQELDKHIIGQDDAKRAVAIALRNRWRRMKI
FT                   KDPVLRNEIMPKNILMIGPTGVGKTEIARRLANLAKAPFIKVEATKFTEVGYVGRDVDS
FT                   IIRDLTDMAIKQEREFAMKKVEHLAEDAAEERILDVLLPPARGTLTPGEKNTTARQVFR
FT                   KQLREGELNDNEIEIEVAATPVGIEIMAPPGMEEMTSQLQSMFQQVGSYRTKTRKMTVA
FT                   KAMKILREEEAAKLINEEDIKLKAIESVEQNGIVFIDELDKIAKRSDTVSGGDVSREGV
FT                   QRDLLPLVEGTTVSTKYGMVKSDHILFIASGAFHVAKPSDLIAELQGRLPIRVELSALS
FT                   VEDFVRILTEPSASLTLQYSALMETEGLTLTFDETGIRRIAEVAWQVNERTENIGARRL
FT                   YTVMERLLEVVSFEATDKAGETVHVDKAYVDKNLGQLIADEDLARYIL"
FT   gene            777751..779325
FT                   /locus_tag="LPC_2651"
FT   CDS_pept        777751..779325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2651"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56565"
FT                   /protein_id="ABQ56565.1"
FT                   /translation="MKTQRIIHPNIDIRKFPEVNANFSMTDISMGDLHANALLFLNILV
FT                   RQGIIAISPENYAKFAEIYILPELQADYWGTEAPVFSAGNKQERLEEIKKQYNALIAQI
FT                   KIINTKKLIRLIGDELVDRGVIDYFILKLLQALHDQGADFEILLSNHGIEFVEACELFK
FT                   ENGNKLVAKRLGNIQHGNSFHALQEAIAAGSISNEEVLNIYHQVYKKHLKIISYALDPD
FT                   ANEIKVFSHAGIGLNHIRGLTRKFKVPYSEESAVDLARTIDAINKKFAEKASAGEIHTL
FT                   YTHDMMYRGYAGEYLNSTDEVVAATVWGREYGDLIRTSKKFKVTFIHGHDSYDPEKVEH
FT                   VTLNNQLGQFQNNVGDLYLYATNGMRAVPTQCLNPDKKVQSLREKNRPDKPNDYVVKVH
FT                   HTKPSFFKTAHPKMTFPDSYKRIWDSTPGHSNITKIKALLKDYTKEDSILGSFWGLIFT
FT                   LHWGRHHVKSVHQIAQTQYTSVEAILSDLKALKPREGGSLDKRIKFIESQIITQKVNNP
FT                   ELQFKLK"
FT   gene            complement(779495..780733)
FT                   /gene="rbn"
FT                   /locus_tag="LPC_2650"
FT   CDS_pept        complement(779495..780733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbn"
FT                   /locus_tag="LPC_2650"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2650"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56564"
FT                   /db_xref="GOA:A5IGR4"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGR4"
FT                   /protein_id="ABQ56564.1"
FT                   /translation="MNWKEKVKTKFYSCDRFVRFVIQHFIQDDCTYIASALAFTSLLAV
FT                   VPLMSVGLAIFSSFPVFQGLAEPVQNFIFDNFVPATGKIVQSYLQQFTSQVSKLSIWGV
FT                   VFLIFTALLVMFTIERAMNKIWRVSSSRHGVSAFLLYWAIISLAPVLLGLSLAASSYLF
FT                   SMPILADHRAPYTILHYSPFFLSLIGFTFLYVVVPNCPVKIRHAFWGGLVAAILFESAK
FT                   HAFAYYLIRYNTYELLYGAFATVPIFFIWVYWVWIITLLGAEISYAFSVHHQRRGGKSL
FT                   DGFSHALLWLHQLWIAQQHGKGLSFNDLVDASKQPFAVDVDEMINALIYHELIHATADG
FT                   HYMLSRDLSHVTLYDLTQLLPYRLPTHLELQYSKASLSEQWRAAFKRHNEELKKSLDIN
FT                   LEELFKKTGTILK"
FT   gene            781146..800015
FT                   /locus_tag="LPC_2649"
FT   CDS_pept        781146..800015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2649"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56563"
FT                   /protein_id="ABQ56563.1"
FT                   /translation="MLAESVIGIVRAVNGLLEKVNVQGQASLVKSGARLEEGDVLTLLS
FT                   GEAYIQFINGFPEALALEKPVKLDGVSPTLQYGAEDLKEQMVQEAIAKGIDPSVILDVL
FT                   GSAAAGAEAVGSGGDAFIMDPLFGFGHVTAGYPTGPISFAYEADTQQLFWFVPEETGAI
FT                   AESELTQEPESIPQIPQFTTNQAVLTVFEDALPSGIPDSAGQARIASSSLSTLLTSSPD
FT                   VVASFAFNTNLSVLPTLKSGGIDLDYNLSSDKRTLTASIPGGAAVMQFELTADGQLTQT
FT                   LMDSIDHPTADSDDSEWMRLDLSPLIDVTFTRTSDGSVLESRTLPANAVVAGIQDDVPI
FT                   ARAQLTNNEILLDETIGMKAGDADAANDDFNPTTTVDPFNNTYGIPIGLVQNANLLDTS
FT                   TSEMGGDYKNATMTHLLKITDAVSGLQTTDGTPINLFLESNGDISGRAGDIGAPAVFAI
FT                   RMNPNTGAITVAQYGSIKQFDTNSHDEAVDLTGRISAVVRVTDGDGDVSNAEIPIGQRI
FT                   VFEDDGPIAQIAATGVKVTHDETAGVDAGSDDVASPLALFAGVSQKSTDMAGFAQSSGA
FT                   VVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVGRDAGGDAVF
FT                   AIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGDVATQAIGIG
FT                   DAIVFEDDGPVAQIAATGVKVTHDETAGVNAGSDDVASPLALFAGVSQKSTDMAGFAQS
FT                   SGAVVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVGRDAGGD
FT                   AVFAIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGDVATQAI
FT                   GIGDAIVFEDDGPVAQIAATGVKVTHDETAGVDAGSDDVASPLALFAGVSQKSTDMAGF
FT                   AQSSGAVVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVGRDA
FT                   GGDAVFAIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGDVAT
FT                   QAIGIGDAIVFEDDGPVAQIAATGVKVTHDETAGVDAGSDDVASPLALFAGVSQKSTDM
FT                   AGFAQSSGAVVSSAGSLVGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGFVVG
FT                   RDAGGDAVFAIAIDADTGVLSLAQYESIKHPSGGASYDEAVDLSGKINAVVTVTDGDGD
FT                   VATQAIGIGDAIVFEDDGPVAQIAATGVKVTHDETAGVDAGSDDVASPLSVFVGVVNKS
FT                   TDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGL
FT                   VVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDG
FT                   DGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVV
FT                   NKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLE
FT                   SGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTV
FT                   TDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGTKVIHDETTGLDAGSNDVAGPLSVFA
FT                   GVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITL
FT                   TLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAV
FT                   VTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVASPLS
FT                   VFVGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDA
FT                   ITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKI
FT                   NAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAG
FT                   PLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTD
FT                   GDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLG
FT                   GKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSND
FT                   VAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQ
FT                   TTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAV
FT                   NLSGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGTKVIHDETTGLDAG
FT                   SNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAAS
FT                   GLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYD
FT                   EAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGL
FT                   DAGSNDVASPLSVFVGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIAN
FT                   AASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGS
FT                   SYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGAKVIHDET
FT                   TGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLA
FT                   IANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPT
FT                   GGASYDEAVNLSGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQIAATGAKVIH
FT                   DETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQDNEGATIKF
FT                   SLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYESIK
FT                   HPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAATGAK
FT                   VIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNEGAT
FT                   IKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVAQYE
FT                   SIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDDGPVAQIAAT
FT                   GAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSAGSVTGQDNE
FT                   GATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVLSVA
FT                   QYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPVAQI
FT                   AATGTKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSVTGQ
FT                   DNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADTGVL
FT                   SVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDGDGDVATQAIGIGDAIVFEDDGPV
FT                   AQIAATGTKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVVSSTGSV
FT                   TGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISIDADT
FT                   GVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDKVVFEDD
FT                   GPVAQIAATGAKVIHDETTGLDAGSNDVASPLSVFVGVVNKSTDMAGFAQSSGAVVSSA
FT                   GSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAISID
FT                   ADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGIGDAIVF
FT                   EDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSGAVV
FT                   SSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAVLAI
FT                   SIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDGDGDVATQAIGIGDA
FT                   IVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQSSG
FT                   AVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASGKAV
FT                   LAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVATQAIGI
FT                   GDAIVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAGFAQ
FT                   SSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRDASG
FT                   KAVLAISIDADTGVLSVAQYESIKHPTGGASYDEAVNLSGKINAVVTVTDGDGDVATQA
FT                   IGIGDAIVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTDMAG
FT                   FAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVVGRD
FT                   ASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDGDVA
FT                   TQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNKSTD
FT                   MAGFAQSSGAVVSSTGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESGLVV
FT                   GRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTDGDG
FT                   DVATQAIGIGDKVVFEDDGPVAQIAATGAKVIHDETTGLDAGSNDVAGPLSVFAGVVNK
FT                   STDMAGFAQSSGAVVSSAGSVTGQDNEGATIKFSLAIANAASGLQTTDGDAITLTLESG
FT                   LVVGRDASGKAVLAISIDADTGVLSVAQYESIKHPTGGSSYDEAVHLGGKINAVVTVTD
FT                   GDGDVATQAIGIGDKVVFEDDGPVASNITRSGLANEGADTNLMLILDTSGSMAGSGIQT
FT                   LINSTLELLERYEALGNVKVRIVTFNTSATAIGSVWMTVDAAKNALLGLTAGGNTNFDA
FT                   ALITAMNAFNSGTVGGADGRIGGAQNVSYFISDGNPTVNQDWPSIPGTLAQNGIQPSEQ
FT                   AAWEAFLQDTNGASAGGEKIRSYALGMGTGITVSNLEPIGFNGVNGTDIPAVVVTDISQ
FT                   LDSVLASTITASPISGTLISDPNPGVNFGADGGHVQSVTVNGITYTVNANLSSLSTSGS
FT                   ATQGSNTHSYDNSTHVLTVTISTGESLTIDMDNGSYTFTPPANITSSINRIINYVLVDG
FT                   DGDTAAATITFNIDISGFNDPLVVRDDLVLTNQPAVSGQDVISIPTWALLANDTGGSGV
FT                   SSVSSVTQPVAEGTVVLNAGSVAFTEESNSAADGTYNGSTSDPFRYTNTTGSQSATAKV
FT                   DLDRTQAGENRLDGTYRSEILLGRDTSNDTIIGNDGNDILIGLGGNDTLSGGNGDDILA
FT                   GGAGNDTLDGGAGNDTATYIDATAGVTVSLNTSSAQNTVGAGTDTLTNIENLTGSKFND
FT                   TLTGNNSANTIKGLEGNDTISGLGGNDTLDGGSGDDVIIGGLGDDILTGGSGADQFVLV
FT                   KGQGGASAGAAPIDTITDFEVNIDKIVINGNNITGVSVSTPVSNTYTITVNYSDAATEH
FT                   FKVTLSNGAVLNDSGKTHLNGVVISGGTATIDGTIVGAVLYLDLNANNQEDEGERLGIT
FT                   NQYGHVEWVVDLSKFDVNGDGQYVIGEARAVQTGGFDIDTGLSYEINLYGPVGSAVISP
FT                   LTSLLQAQLEAGMDYETANAALVARLGLPEGTQIISFNPITGSGEVLAQNAGVMTAAIQ
FT                   FAEIAAIHYSTDEGHVSFAVFEAISKALLELPEGVVADFGDEGFLQSISNYLGLDALVT
FT                   SDMIDYMATSQKALEASILTLAPGEDALTAISKIQHVTQGIYAQAIEMALIGYLPLDAL
FT                   KNMSAVLKAYADGDITDEQLNSFEDKLSAVIVNWEDNNVTDTSHQATLQTERTVDDSSV
FT                   KSEVNHEMAQEVNAVINDFMDEHNISLYYYDQQAQMPQEAQQPTEDQAEETVMHDDVVQ
FT                   DLLLDDHSLTMLANNPELNGGNGNDILHGTTGNDFIRGGQGNDTMTGGGGVDTFFWLSG
FT                   DDDGGVDTITDFKANPVDKSSDASVLNLSDLLSDADLETNSLDNYLNVSTTEEGDTAIK
FT                   VDPNGNGNFDAPAQTIILEDVDLTAVFATNNSHDIVNQMIANGNLIVEQ"
FT   gene            800194..800793
FT                   /gene="wrbA"
FT                   /locus_tag="LPC_2648"
FT   CDS_pept        800194..800793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="LPC_2648"
FT                   /product="trp repressor binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2648"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56562"
FT                   /protein_id="ABQ56562.1"
FT                   /translation="MSNPYILVLYYSRTRSTAQLAQYIARGVESVSGLEARLRTVPPVS
FT                   TTCEAVDKPVPDAGAIYVSLDDLRHCHGLALGSPTRFGNMAAPMKYFWDGTTSLWLGGD
FT                   LVNKPACVFSSSASMHGGQETTLISMMIPLLHHGMILLGVPYTEPALTSTQSGGTPYGV
FT                   THVAGGDNENPLSQDEISLAKALGERLGRVAMGLKV"
FT   gene            801075..801293
FT                   /locus_tag="LPC_2647"
FT   CDS_pept        801075..801293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2647"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56561"
FT                   /protein_id="ABQ56561.1"
FT                   /translation="MVPADAKLLKQAKSLRKRSTDAENCLWYYLRAHRLKGYKFKRQVP
FT                   IGNYIVNFVCIQRKLIVELDGGQHLSK"
FT   gene            801482..802264
FT                   /gene="exoA"
FT                   /locus_tag="LPC_2646"
FT   CDS_pept        801482..802264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exoA"
FT                   /locus_tag="LPC_2646"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2646"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56560"
FT                   /protein_id="ABQ56560.1"
FT                   /translation="MKVISFNANGIRSSARNGFYDWLVGQDVDFVCIQETKSQVEQLIP
FT                   EELYFPRDYFCDYFDAEKKGYSGVAIYSKYKPVRIVKGLGFDYCDKEGRYIQFDYPKLS
FT                   VISLYLPSGTSGEDRQEVKYAFLEQFARHLMNLKNEGRELIICGDYNIAHKKIDLKNWR
FT                   GNQKNSGFLPEERAWMDELFGSMGFVDAFRVHNQEEEQYTWWSYRARAWEKNVGWRIDY
FT                   QVITPGLTEYVADSRIFREARFSDHAPLMIEYKGDWCV"
FT   gene            802257..803027
FT                   /locus_tag="LPC_2645"
FT   CDS_pept        802257..803027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2645"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56559"
FT                   /protein_id="ABQ56559.1"
FT                   /translation="MFKLASWNVNSLKVRLEQVLQWLESSQVDVLAMQETKLTDDNFPV
FT                   ASFTDKGYHVIFSGQKTYNGVAIISRYPMTDIQTDIPELEDPQRRILAATVKGIRLINL
FT                   YVPNGGELTSDKYQYKLDWLKKVTRFIQHQLSIYSKVAVVGDFNIAPEDRDVHDPVEWE
FT                   GCVLVSPAERQAFMEILELGLHDSFRNFAQEEKAFSWWDYRAAAFRRNRGLRIDHVLLS
FT                   HELNALCRQSKIDKEPRKAERPSDHAPVWVELEL"
FT   gene            803164..803391
FT                   /locus_tag="LPC_2644"
FT   CDS_pept        803164..803391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2644"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56558"
FT                   /db_xref="GOA:A5IGQ8"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGQ8"
FT                   /protein_id="ABQ56558.1"
FT                   /translation="MKASVHPDYQTVKVTCSCGEVFETRSTLCKDLNIEVCSMCHPFYT
FT                   GKQKLVDTGGRVQKFRDRYNMRTGQAKSKE"
FT   gene            803518..804753
FT                   /gene="mao2"
FT                   /locus_tag="LPC_2643"
FT   CDS_pept        803518..804753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mao2"
FT                   /locus_tag="LPC_2643"
FT                   /product="malate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2643"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56557"
FT                   /protein_id="ABQ56557.1"
FT                   /translation="MDNEVIKQRALDYHEFPVPGKLSVHLTKSTNSQDDLSLAYTPGVA
FT                   APVLAIAEAPENAYRFTSKGNLVAVMTNGTAVLGLGNLGPLASKPVMEGKAVLFKRFAD
FT                   LDVFDIEIDAEDPQSFIATAKRIAPTFGGINLEDIKAPECFEIEQALIQQLNIPVFHDD
FT                   QHGTAIVVAAGLLNALELQNKKLSDIKIVCMGAGAAGIASMRLLVALGAPKSNMLLLDT
FT                   KGVIHDGREDLNPYKFAFARNTLCRTLEDALVDADVFIGVARPDLLNAHLLSLMAPNPV
FT                   IFALSNPDPEIKPELAHSVRKDLVMATGRSDYPNQVNNVLCFPYIFRGALDVRATCINQ
FT                   AMQIAAVEAIRQLVHEPVPQVVKDNYPGVVNWDFGPDYIIPKPIDPRLKERVPAAVAKA
FT                   AIASGASQFNNL"
FT   gene            804964..806256
FT                   /locus_tag="LPC_2642"
FT   CDS_pept        804964..806256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2642"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2642"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56556"
FT                   /protein_id="ABQ56556.1"
FT                   /translation="MHTENRTNYALIGWLLCGLGAIFYSYEYLLRIAPSVMEDALRSHF
FT                   NLSASGFGFLSSFYYFAYVPMQLPVGVLLDRYGPKRLLTLACLVCVIGTYMFTGTTIFW
FT                   VAATGRFLVGFGSAFAFVGVLKIATLWLPENRLAMISGMTSALGPIGAMLGDNFLELFI
FT                   VKMGWVKTLNMTAAFGIVLTLVLWVGIRDRKGQHRQSGTVPTLKKGLVDLGIIITSRQI
FT                   WVNGMYGCLVYLPTTVFAELWGIPYLHHAHGLTTQAAGLANSVLFLGFIIGAPIMGYIS
FT                   DRLYRRKFPMLIGASGAAIVMMMILYLPGLNESNIQALMFLLGLLYSAQAIVFAVGREL
FT                   SPGEAAGTAMAVTNMIVMLGAMFLQPLVGHLLDFSLSTHLSDTTGIVVDNMSKLYTVDD
FT                   YQFALSIIPLGILIAAILTFFLKETHAKAPK"
FT   gene            806237..807514
FT                   /locus_tag="LPC_2641"
FT   CDS_pept        806237..807514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2641"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2641"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56555"
FT                   /protein_id="ABQ56555.1"
FT                   /translation="MQKHLNNMTTKKQISYGVLVCFIGAVFYCYEFILRIVPGALQTEL
FT                   STALGHISATTFGQISALYYFAYSPMQMPVGMLMDRYGPRRLLTFACLCCALGSWMFTL
FT                   TWSIVLVGIGRFLVGFGSSFAFVGVLSLALHWLPRRYFSLVAGLITTLGMLGLVYGEIK
FT                   ITEWSEVIGWDHVLMHIAMIGSALCILTFFVVRDGPEGYQPNKYPWPEFFHNVLKVLTS
FT                   HEVWLIGFVGACLYTSLSVFGELWGKTYLEQAHHLTKVEAAKTVSAVFLGWAVGAPLAG
FT                   YISDITRRRLLPLVIGAIVSLICISFVLYCPGLSYLTLNILLFLYGVFSATEIIVFIMA
FT                   KECSGAKLSGTVFAVTNMIISLAGAIFQPLVGKLLDTFGDSGIVAGEHIYTVDDYQVAL
FT                   SILPISLLLVTILAFFIKDKDHSNNS"
FT   gene            complement(807543..808361)
FT                   /gene="dam"
FT                   /locus_tag="LPC_2640"
FT   CDS_pept        complement(807543..808361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dam"
FT                   /locus_tag="LPC_2640"
FT                   /product="DNA adenine methylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2640"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56554"
FT                   /protein_id="ABQ56554.1"
FT                   /translation="MVKIRPFLKWAGSKYNCLNEIISSLPTGQRLIEPFAGSGVVFMNT
FT                   SYSSYLLAESNPDLVNIYRILQLNGESFIDYCQQYFTPEANCKEKYYELRTEFNNLMDS
FT                   NQKSAVFLYLNRHGYNGLCRYNSKGKYNVPFGLYEKPYFPRKEMMLFYKKCLSAQFIHD
FT                   DFRNTFALAEPGDVIYCDPPYVPLTENNQTLPYNQKLFSLEDQIELAELAQETASKGIP
FT                   VIISNHDTEFTRHHYKKAQIKSFYVPRWISCRSQMRLPVKELVAVFNCPS"
FT   gene            complement(808532..809794)
FT                   /gene="tyrP"
FT                   /locus_tag="LPC_2639"
FT   CDS_pept        complement(808532..809794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrP"
FT                   /locus_tag="LPC_2639"
FT                   /product="tryptophan/tyrosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2639"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56553"
FT                   /protein_id="ABQ56553.1"
FT                   /translation="MTFFEEQSIILFYICTVFGLYFVINSKLIGGILLIVGTSIGGGML
FT                   ALPVSTAEVGFANSLFFLFFCWLVMTAGALLILEVNLRLPAGSNMISMAKSTLGLPGQV
FT                   IAWITYLLLLYTLLAAYISGGSDVFSSLLHKAHIDLPNWITSVIFTAMFSLIVYSGIRS
FT                   VDYVNRGLMFGKLGVYILLVIIISPHVSAAGLTGGSAKAFTGTLMILVTSFGFASIVPS
FT                   LRDYFNDDIRSLRRVILFGSLIPLFCYIVWDAVIMGVISREGENGLLSLMNSDHATSGL
FT                   TEALSQSVSSQWISGFFGFFTSICMVTAFLGVSLGLFDFLADGLKLKKSGNQGKYTLAL
FT                   TFIPPLAVVLFNPGIYLHALSYAGVCCVILLLLLPAIMAWKGRQTCSQSPSETHLIPGG
FT                   NPALSLIGFIAIGLLIIAIMY"
FT   gene            complement(809929..811119)
FT                   /locus_tag="LPC_2638"
FT   CDS_pept        complement(809929..811119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2638"
FT                   /product="tryptophan/tyrosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2638"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56552"
FT                   /protein_id="ABQ56552.1"
FT                   /translation="MRSRFIGGILLIVGTSIGGGMLALPVANAATGFWQSSLFLLICWA
FT                   FMTFGAFFILEANLYLSRGKHMVSMAKATLGDYGLLTAWISYLFLLYTLLSAYISGGAD
FT                   VLNSLLSKVNWHLSDWQASSLFTLIFGLVVYGGIHSVDVANRALMFGKLAVYCILVILI
FT                   APHIEFHYFQHGDYRQIGGAIMILITSFGFAIIVPNLRDYFDDDIKTLKKVIFIGSLIP
FT                   LICYIAWDAVIIGSLPSEGTSGLESLMQNPRTTSALASLLTDKVENTTISALFNFFTSI
FT                   CMLTAFLGVSLCLFSFLADGLKLRERGRHGIGLFVLTFLPPLLIVIYYPGAYIYALRYA
FT                   GIFCIILLLLLPALMCYFGRKRYKSPFWVPGGKISQFAVIIISVVLLAHEFIALFK"
FT   gene            complement(811130..811852)
FT                   /locus_tag="LPC_2637"
FT   CDS_pept        complement(811130..811852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2637"
FT                   /product="outer membrane protein, OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2637"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56551"
FT                   /protein_id="ABQ56551.1"
FT                   /translation="MIKSLIKGVDMSRKLAKTRILGYGLMICFLAGCFHPPYNNFQPDR
FT                   RAVKRVGVDTGIGAVAGVIASGTASGTLIGAAAGGTVGLVASIYRDSKRKIIRDLQKQD
FT                   IQYVEYGDTRTLIIPTDKYFMFSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNV
FT                   GSRSHKRKLSQAQAETMMTFLWANGIAAKRLKAEGYGDKNAISDNAIIHGSAQNRRIEI
FT                   QWFTSPAQPPQPQMAYVK"
FT   gene            812053..817260
FT                   /locus_tag="LPC_2635"
FT   CDS_pept        812053..817260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2635"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56550"
FT                   /protein_id="ABQ56550.1"
FT                   /translation="MKIPVQLKNIGGNIPENDIALQVSYFIKSQNDELLPQSDAYIAPA
FT                   SGKIDVSFGNNLARNKDVFFAVALKSNNILAQTSTSATQLKDEVPITMEFDYSPLVLSE
FT                   PDDQIVSPRPLFVYGRLLDKQGKKKLEDVQIIFEATRANDGGLQPIASVRTEADGYFFI
FT                   EYPQGSFIDASARVGLPLRENPIPVRLDEVRIDGDISNKVFPRNVILVAELMEAEEATV
FT                   EKECGCEVLDVHESKRILEEYSFYSVVRTTEPEILGYVLKEEDEITLDEVLTQHPIRIW
FT                   EIIDPIFQLPAFSHLANRARVNLPEVTERSINTEITTRAHGRANTAPNPPQDNELAETL
FT                   KQIKINRGVLNNFLQRETNITKDNIVNLIEMNESYRFKQKMTLGETKPLGRVVLNSENS
FT                   VDWDLEPTLYQAVSVAHGHLLHFKSEWIADGYSLGDLLYSLPLAPGQKKQIVVFDWERR
FT                   ESATNIQSLEYEESLYNSLSRDRDIFEITKGVIEENIKGKSSATTASASAGIGGVVGGL
FT                   LFGVSGGVGHSGSTASQNSLRQTSASDLQKIRDRIVQSANAVRSQRSSVIQTVSQGERF
FT                   EVSSETVANYNHCHAITIQYYEVLRHFKVRQRFAEARECLFVPLLMSQFELNKLLRWRE
FT                   SLQFALLNTNLSKGFDAAERIKNKWIGSNFPGGTFASEKILNASGNFQIKFIIRRPDDK
FT                   MVEVDDYSKPIYGGQNMIIGYQKKTVEDINEANWQSLIPVMGSDTPKVFYDHHLRHAKN
FT                   KDEVCHRLLAEKIATAFVGALTFHVADETGNEISSISFDTTLTSKYRKEGVLNVSVRFM
FT                   GPSQFSRDKVHYIKIRCGTANVLPDYSSIIVTSGFIRYKTPHYEGFLCRFQSIYDDLSP
FT                   SDGVTLYAGPSLDELRDPRKEDIALVNSLIDHLNDNLEWYHKAIWQLMPAERRFLLLDG
FT                   IVLPGSKGLGRSLASLVENELIGIVGNSLVFPVAKGLNLDPNFGASDSLTDYYMVAAGD
FT                   PVNVSIPTKGVYAEAMMGRCNSCEEKDESRFWRWEESPIPDTPTTINPISTESRRAEPG
FT                   NLQPTAFPNPMVNIQNAPNAPDPTGLAGTLSLLGKGDSFRDITGLTQNQTNALEALKAS
FT                   FDATKTFGQEAAKLEIQKMMDKRLDNAIKAINNNPNLDPKQKMELTEKALNAYLGAGAN
FT                   TTQPPKDANADKLQEGINKNLDKVNSSKSGEISVTKPDGTKVNTKFDGGTTSPAIETKI
FT                   GKGGITPMKQENSNACWATVATMMLRWKDSKNYTIEEVLTKAGSQYLNYYKQKTGLPYT
FT                   EKQNFITSLGMRGEPLANYTAQNYRDWLVEYGPLWVTTDTDQSKGFSAHALIITGISSD
FT                   LKSLEVIDPLQGRKFVQSFEEFANAFKELITDSGLLPTTQVVHFLEKIEATEGAPTPAD
FT                   IVKSLNEYNPSSSETLVINMVEFNTGISGITNYKDWKTDGSVIHNKRKNAYRDPFGIKH
FT                   LVLHETAAESGDGFDDSNNETSHMSVKRDATILQFNDLVEFENHGSGMNTTSIGIEFVN
FT                   RGWLSSSTADGGEGIPAKESSLTAAQKETYKEANGYLWAFWGYGFNIYRVPPSIDQLEK
FT                   EVELVKWLTRDFPALLQSISGISIYNLFPSIDDTWLQLVSYAEVKDIWTFKAADIPPEA
FT                   ERTEKNLFVMTTGYEYLEPSYLTDKSGIISHNAFYENHSDGSFLTLYTWLRLEKGKSKT
FT                   DALDIAKKLMKDHFIRVSLTSNTDKKIILLNVKDGNLV"
FT   gene            817654..818499
FT                   /locus_tag="LPC_2634"
FT   CDS_pept        817654..818499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2634"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2634"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56549"
FT                   /protein_id="ABQ56549.1"
FT                   /translation="MSKKAIAISIVIALFFITAIWFAYSFVKQEENQNWLTLYGNIDIR
FT                   DVSLSFRVSGRILSMDVDEGAHVKKGQLLARLDKDTFIANLEMAKAQLKQAIANQKNAS
FT                   RTYKRREQLVDDGAVSKALFDDAVAMKDSSSAEVSVAKANLEKAQISLNDTEIHAPTHG
FT                   TILTRIQEPGAIVNVAEPVYTLAIDNPVWVRTYIDEPFLGRIYPGQDALVYTDSNPEKP
FT                   YKGHIGFISPQAEFTPKIVETTQLRTDLVYRIRVVIDQPDNGLRQGMPVTVKIHLKANS
FT                   "
FT   gene            818502..820244
FT                   /locus_tag="LPC_2633"
FT   CDS_pept        818502..820244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2633"
FT                   /product="ABC transporter ElsE"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2633"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56548"
FT                   /protein_id="ABQ56548.1"
FT                   /translation="MNSSKPLVSINGVSKCFPGNTDPALDNVSATIFEGQITGLVGPDG
FT                   AGKSTLMRLICSLMLPTQGTITVDSLNTRTDSEKIHAITGYMPQKFGLYEDLTIIENLR
FT                   LYAELRNLHGEKREEQFRTLLKFTALEPFQKRLAGNLSGGMKQKLGLACALMGEPKLLL
FT                   LDEPSVGVDPISRRELWTMVQGLLGRGMGVVWSTAYLDEAEKCDQILLLNAGKPIYHGK
FT                   PGDFLQKTKDRTFQICGVSLLNRRQALMNALNTPEVIDGVIQGKNIRIVISDKKIKPSL
FT                   DGITREPGVHFQEVESRFEDAFIDSLKTKISGRSLLAEHIAEKPHSDKPIIEARKLTKR
FT                   FGSFTAVSNNEFTIKRGEIFGLLGPNGAGKSTTFKMMCGLLQPTQGQAFVMGLDLKTSS
FT                   SEARSRIGYMAQKFSLYSHLDALQNMRFFSGLYGLSGERQEAQINSMIEIFDLKKHLKQ
FT                   NSGDLPLGFKQRLALACAVMHEPDVLFLDEPTSGVDPLTRREFWTHINGMVNKGVTVMV
FT                   TTHFMDEAEYCDRIALIYRGKNIATGTPDDLKDKVRNSTLPNPTLEDAFIELIRLDELR
FT                   EPVH"
FT   gene            820262..821383
FT                   /locus_tag="LPC_2632"
FT   CDS_pept        820262..821383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2632"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2632"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56547"
FT                   /protein_id="ABQ56547.1"
FT                   /translation="MNIRYLKALVIKETLQIIRDPSTILIAFVLPLILLFIFGYGVNLD
FT                   TDQVKFGLALESYDSSTVSLSQSFSSSRFLDVSISTNRQAFRYGLVNGTIRGFIDIPQR
FT                   FTADSLSGNPKPALQNIVDGSYPQVAGFAENYALGALQTWISSQAYEHGQMTLKSGINL
FT                   EPRYWYNQELKSRNFLIPGSIVIVMTLIGTLLTSLVIAREWERGTMEAMMATPISIVDI
FT                   ILGKLIPYFVLGMGSMFLCTIIATWYYGVPFQGTLLALTLVSAVFLVAALGQGLLISTL
FT                   ARDQFVASQLALMSAFLPSFILSGFIFEINSMPKWIQLLTHLFAARYFVTSLQTLFLTG
FT                   NIWSLLIRCLFAIALIGFAFFFITAHKTRKRLD"
FT   gene            821383..822507
FT                   /locus_tag="LPC_2631"
FT   CDS_pept        821383..822507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2631"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2631"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56546"
FT                   /protein_id="ABQ56546.1"
FT                   /translation="MAKLSPATRIFALVIKEILTLFKDPKGRIVLIAPPLLQLLIFSFA
FT                   ATMEIKNISIGILNQDSGKHGYEVIQRFIGSPTFSKVFFIQKQSDIKPIIDNQEAMVVM
FT                   TIPQDFSRKIESNSQANIQLILDGRRSNATQIVNGYISSIIENYNQEIQKTHGAIMMPP
FT                   VMVTRSWFNENLLYLWFTVPSLICILSMLISLVVTALSVARERELGTFDQLLVSPLTPY
FT                   EILIGKTIPAIIIGLAEGLLMWVAAVWLFDVPFYGSPLLMVYILFIFIMSTVGVGLFIS
FT                   SMCKTQQQAILGVFIYMVPVVTLSGYASPVENMPEWLQDLTWFNPLKFTLIAVIGIFLK
FT                   GMSALEVFITTWPLLLVGAVTLFIAGWFFKQRME"
FT   gene            822516..823955
FT                   /locus_tag="LPC_2630"
FT   CDS_pept        822516..823955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2630"
FT                   /product="multidrug efflux MFS outer membrane protein (RND
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2630"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56545"
FT                   /protein_id="ABQ56545.1"
FT                   /translation="MDRKLVLLFSISCLFGCTVGPDYQRPDIKIQEKWPTSKVEKKISS
FT                   SAPVHLTWWKAFHDPLLDRYINEAATNNLDIKAAEARIRQARAMQQISLANFYPQINGS
FT                   ASANSLQISKGTLEGIFANSPTYTLIDRNQWIYNLGFDAQWELDLFGKTRRKVEASKAS
FT                   LEEAYESRRTILLSTIAEIARSYIELRGAQQLYGIAQKNVELQRKTLALVRQRYKAGVS
FT                   SEVDVSLAEGQLKNTESVLPNYITQIQVNAYQIAVMLGKDPQTILKDIAKIQSLPKPPQ
FT                   KVPMGLRSDILRQRPDIRATERQLASAVAEIGVAVADFFPQFNLSVSNLAFQSTSVDTL
FT                   FQSSSGFWLMGPQVSLPIFHGGQIRANVESKKAVAQQAAIQYKKIILQALQEAQSALVR
FT                   YSQSLDTNHSLRAAIIANKRAVQFAKKRFQYGEDDYLSLLQSEAALLNAETQEVNSEVS
FT                   SLTALISLYKALGGGWENFEA"
FT   gene            complement(824287..826068)
FT                   /gene="slt"
FT                   /locus_tag="LPC_2629"
FT   CDS_pept        complement(824287..826068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="LPC_2629"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2629"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56544"
FT                   /protein_id="ABQ56544.1"
FT                   /translation="MKKLLIFLCGLLCSFNLFALSGQAYMDRFNRYLAWYEQLPINPSP
FT                   EFLEFVKENTPLANKLRDKWLYELARIKDWEDYNKYYQPTNDINLRCFAQIAKFNLGLY
FT                   KEAIAGSIPIWLSGESRPQACNTLFALLLKQDNFDQKFITQRIALALDKRNVLLARYLL
FT                   KQYKTPHDTEIKNLTSVYENPSNISKLNPGKLNDYFYLYGLKRLVSINMDKAVKLWQEK
FT                   KTNIMLNERQKQDFLAHLALYKAMRNHADAQEWFAKIKPEYYTDVLVDWQIRFALKNKN
FT                   WKQVEKLINNSPNKEMPCWQYWLARSLEEQGKKAEAIKIYEPLAKNRHYYGFLASKRLK
FT                   KRPSFDNEKPTTNTEILKPYQPVIEQVKNFYNSKQLLQASRLLNDFISELPKEEASALV
FT                   YWIATELKWHGKSVYLSNNDTLNNQLALRFPLAYKDTIKVYASKYAIPPELVYAIIRQE
FT                   SGFREDVTSSAGAKGLMQVMPQTASAVSKTSKIPYSDHKQLFLSQKNINIGIAYLQHLT
FT                   KRFSNHPVLVAAAYNAGPRQVVYWLKNHPPKEIDIWIETLPWQETRNYLKNVMAFYIVY
FT                   QYRLNQQPDMNRFLTPL"
FT   gene            complement(826110..826763)
FT                   /gene="rpe"
FT                   /locus_tag="LPC_2628"
FT   CDS_pept        complement(826110..826763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="LPC_2628"
FT                   /product="D-ribulose-5-phosphate-3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2628"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56543"
FT                   /protein_id="ABQ56543.1"
FT                   /translation="MTFQILPSLLSADMTRLGEEVDAVMKAGADFIHFDVMDNHYVPNL
FT                   TFGPAFCDALIKKFPNLPIDVHLMTTPVDTLIEAFAKAGAKRISIHPDATIHLDRSLQL
FT                   INNLGCEAGLVLNPATSIDTLTWCAHNLKFVLVMTVNPGFGGQKLIPEVIPKLSKIRQQ
FT                   HPNLDLCVDGGVTPQNIASLAHAGANQFVAGSAIFNSSNYSETIKHMREQLASI"
FT   gene            complement(826979..827443)
FT                   /locus_tag="LPC_2627"
FT   CDS_pept        complement(826979..827443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2627"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2627"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56542"
FT                   /protein_id="ABQ56542.1"
FT                   /translation="MKALIAKTYLLADKIFDFLAPIFILLTRLYLAQVFFLSGLTKISN
FT                   WQATLSLFQNEYMVPVMSPTLAAYLGTACELGFPVLITLGLGSRLVLFGLFLFNLFAVF
FT                   SYQFLWTPDGAVGLTDHMQWGIMILMLLCTGPGKLSIDYLIRRFYLKLDN"
FT   gene            complement(827440..828003)
FT                   /locus_tag="LPC_2626"
FT   CDS_pept        complement(827440..828003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2626"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56541"
FT                   /protein_id="ABQ56541.1"
FT                   /translation="MHRYINNCESTQYDINQYGDSLPQFIANFEPAKELPYLQQLCAIE
FT                   WHWHTLKLLSPVNPFDFEAFSSIDEISFQSLCFHLTPNLKILCSEYPIYQIWAMNYFQQ
FT                   DKQIQISGCPEKVVIYQHNDLPCIMLISEEEYIFLELLSSGNQTPWQKVVTELSKWISE
FT                   EKIGDTLTKALRYQWINHFSLEAI"
FT   gene            complement(828211..829080)
FT                   /locus_tag="LPC_2625"
FT   CDS_pept        complement(828211..829080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2625"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56540"
FT                   /protein_id="ABQ56540.1"
FT                   /translation="MYSNHSTDQAAPYSGCSGIGLRLEHIDDILKEQPTVDYFEVLADN
FT                   YMKQSGAQFKQLLKIAEFYPMSLHSVGLSIATSSEPDYQYLQQIKNLAHCLNSKLISDH
FT                   LCWTHANQFFTHELIPFPYTEETLSFIIEKTNCIQEYLNQPIMYENVSRYVTYRQNTLS
FT                   EAEFLNELSTATGCGILLDINNLYVNWYNHGDDPDKYLHSINTKNVWQMHLGGFSKQEG
FT                   YLLDSHSDKVYQDVWQLYEKAQNLFINTPTVIEWDNDLPDFSLLYDEMCKAKAIIKRVA
FT                   ERSMNHYA"
FT   gene            complement(829086..829340)
FT                   /locus_tag="LPC_2624"
FT   CDS_pept        complement(829086..829340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2624"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2624"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56539"
FT                   /protein_id="ABQ56539.1"
FT                   /translation="MNNISKITMAAVMAAGLSMATIPANADTPNDMEKCQGVAKAGKND
FT                   CGTAQHACAGQSKTDGSTTDWIYLPKGTCEKLVNGTVKS"
FT   gene            829678..830703
FT                   /locus_tag="LPC_2623"
FT   CDS_pept        829678..830703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2623"
FT                   /product="conserved hypothetical protein; RssA, Predicted
FT                   esterase of the alpha-beta hydrolase superfamily"
FT                   /note="COG1752"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2623"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56538"
FT                   /protein_id="ABQ56538.1"
FT                   /translation="MAKDTKIINLALQGGGAHGALAWGIIDRLLEDGRIHFDAISATSA
FT                   GAMNAAVLAYGFATGGKEGAREALHQFWKMVSDAGQIYNPLKKTPLEELLGIGIENSMS
FT                   FFMFDLMTKILSPYQFNPLNFNPLKEILEQIVDFEKIKSCKSIKIFISATNVRTGKINV
FT                   FDNKKISADAVMASACLPFMFQAVNIGEDYFWDGGYMGNPAIFPLIYNSECRDILILHI
FT                   NPIYREHVPDTAAEILNRVNEISFNSSLMREMRAIAFVTKLIDSGWIKDEYKNNLRKLY
FT                   LHAIRADVSMESSSVASKLNPEWSFISHLYEEGRKKGEEWLKSNFKHLGKMTSIDLDEY
FT                   L"
FT   gene            830819..833035
FT                   /gene="ndh"
FT                   /locus_tag="LPC_2622"
FT   CDS_pept        830819..833035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="LPC_2622"
FT                   /product="NADH dehydrogenase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2622"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56537"
FT                   /protein_id="ABQ56537.1"
FT                   /translation="MQQEDRAPITQKNRSFSRNTARCFDTFMDTVDFLGRIGWPVIDLA
FT                   FRIWIAQQLLVSAILLTNHWDTAVYLAKNEYPVPWLSPEWEALLGILAQFVGGISLLLG
FT                   LFTRCGAAVIIGFAVMTQVYYQPIDLNLLWIALMLGYVLRGPGPLSLDNLFEHGFSRSP
FT                   LPFAMLIVTFVDRTREFFSSLYLFSLRMWLMISLLLINQHIQLISSDALPLLMPWLPLN
FT                   SASIVFNNVSLFMAIFLGLGLATRVVAIFGLIVVLLSFTPGVTGFYLYWMVVMAILFIS
FT                   GPGILSLDHLIFHALKKHYPQLSGKPAFSLDGLPRVVIIGAGFGGIACAKALRHMPVKI
FT                   TLIDRHNYHLFQPFLYQIATGSLSPADIAISIRSIFLEQFNAEILLGNVTDINKEERLV
FT                   IADNFTIPYDYLVIATGATHSYFGKDSWAPYAPGLKTINDGTSVRSRIIKSFELAEIAE
FT                   SDEERKQFLNFVIVGAGPTGVELAGAIAELARFGIVKEFRHFDPASANIILVQAAPRIL
FT                   PTFSEQISQKAQRYLESMGVKVLVNSMVEQIDSDGVIINKERIYSKSVFWAAGVAASPA
FT                   SKWLQLEADPAGRVKVNDDLTVAGYSNIFAIGDTAASNAWNGKPVPGIAPAAKQGGAYV
FT                   AKVISKRIYNNNSRYKPFKYIHYGSLATVGRKAAVAEFDRFKISGELAWWFWGGVHVFF
FT                   LVGSRNRLSVILNWLWSYYTFRANNLLITDDSLNKKNKSGTSEV"
FT   gene            833077..833841
FT                   /gene="adc"
FT                   /locus_tag="LPC_2621"
FT   CDS_pept        833077..833841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adc"
FT                   /locus_tag="LPC_2621"
FT                   /product="acetoacetate decarboxylase ADC"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2621"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56536"
FT                   /protein_id="ABQ56536.1"
FT                   /translation="MDKYLSANSLEGVIDNEFSMPAPRWLNTYPAGPYRFINREFFIIA
FT                   YETDPDLLQAILPPDMELLEPVVKFEFIRMPDSTGFGDYTESGQVVPVRYKGEEGGFTI
FT                   SMFLDCHAPIAGGREIWGFPKKLAKPKLFVEEDTLIGILKYGSIDIAIATMGYKHRPLD
FT                   TEKVLESVKKPVFLLKNIPNVDGTPLVNQLTKTYLTDITVKGAWTGPGSLELHPHALAP
FT                   ISNLYIKKIVSVSHFITDLTLPYGEVVADYLA"
FT   gene            833879..834151
FT                   /locus_tag="LPC_2620"
FT   CDS_pept        833879..834151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2620"
FT                   /product="signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2620"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56535"
FT                   /protein_id="ABQ56535.1"
FT                   /translation="MNKRPIQNTAVIAAALGAALASIYTYTDWLSSDEITVKRERCYNV
FT                   ARAGKNDCATSQHSCAAQSTADRDPEAFIMLPKGLCERIVGGRSG"
FT   gene            834144..835457
FT                   /locus_tag="LPC_2619"
FT   CDS_pept        834144..835457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2619"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2619"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56534"
FT                   /protein_id="ABQ56534.1"
FT                   /translation="MDSYSKLPLRIRKEIEAQQYTGELLVAGVQLGVIVLLSIINIFSS
FT                   AGYSPGAPVQSSSLGLWLFAILILLRLWFVYTNQLNPIFLGFFIVAEMALLLFIIWTYY
FT                   LQFETTPTINLKNPHINYVYVLIALRALRFEPLWVILSGLTAALGWGIIAWQTLSSSGM
FT                   NVITWDYVTFASTRSVYLGAVFDVILSVLLVTTIIALVLTRAKHTLFQAVEQTSAAKDL
FT                   SRFFDTSVVEKITTSEKSLQAGYGELRQAAIMFIDMRGFTKASVKLSPSELIGLLAEYQ
FT                   RLLVPIIQKNNGSIDKFMGDGILASFGAVTPSNTYAADALRTVDEIVASVDVWSENRRK
FT                   KEQIVVGVGIGLASGEVVVGVIGYENRLEYTVIGEAANLAAKLEKHNKEEKTQALTTRD
FT                   TFLEAVKQGYEDKITKKELNARNVGGVGEPLDLVVLAK"
FT   gene            complement(835477..836292)
FT                   /locus_tag="LPC_2618"
FT   CDS_pept        complement(835477..836292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2618"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56533"
FT                   /protein_id="ABQ56533.1"
FT                   /translation="MPTIKQMQEFFLNTVLNQQDIAIFEYFCPDEITNEFRFDIYRNTI
FT                   FQNLRHSLEMTFPAIWKLVGKECADGLALHFIQDKNNLPTTHCLDDWGEKFPLFLKNNP
FT                   TVSHLLYLKDIAEIEWLKHLSYCSRDCLVFDPQKLQKHLNDRVEKLILLFNPSVFLYSS
FT                   SYYLKNIFDLIENPTETGSIDFQQIPSYAVISRQKNQTVIHWITHDLFHFLCHIKAGAS
FT                   LGFAYENTLENNPDFDLLTALQFLLRNELLEDSFIHSNYHLTHANNCPE"
FT   gene            complement(836279..837112)
FT                   /locus_tag="LPC_2617"
FT   CDS_pept        complement(836279..837112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2617"
FT                   /product="Hypothetical UPF0276 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2617"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56532"
FT                   /protein_id="ABQ56532.1"
FT                   /translation="MHKIINGAMTGIGLRAPHYAQILEEKPDIDWLEVHTENFLVKGGP
FT                   LLELLDSISQHYPLSFHGVGLSLGSAEGVCIAHLNRIKTLIDRFQPALLSDHLSWSTIG
FT                   NTYLPDLLPIPYNEESLTIISNNIDRVQNYLKRTLLIENPSSYLEYQTSSYSEPDFLAE
FT                   IIKRTEARLLLDINNIYVSCSNNKRDPYQYIQRIPHEAVQEIHLAGHSIAYQDNTNFLL
FT                   IDTHNNYVCPEVWDLYRYAIHYTGLVPTLLEWDTEIPSLDTLLNEARKSACYAYN"
FT   gene            837410..837676
FT                   /locus_tag="LPC_2616"
FT   CDS_pept        837410..837676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2616"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2616"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56531"
FT                   /protein_id="ABQ56531.1"
FT                   /translation="MSQNWPTRDKDLQTARVIMEEYANERDSDSLGLFEIVVDQNEKRM
FT                   NFRLSGWVVILAKHFTSLYGVSQGDYVTRQVISRCITQGQTLH"
FT   gene            complement(837920..838672)
FT                   /locus_tag="LPC_2615"
FT   CDS_pept        complement(837920..838672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2615"
FT                   /product="arginine ABC transporter, periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2615"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56530"
FT                   /protein_id="ABQ56530.1"
FT                   /translation="MKFIQGLLLSFFFLVSPLHAQNEPIPLIIGVGGFYPPFIMQGTNN
FT                   ELFGYDIATMTELCKIMKRQCNFRVMRFRQLIPALINKQIDAAISAMSITSERSNLVNF
FT                   SMPYLLSYSRFLTNEVHNTHQPFNLMLLKGKRIGVEQNTVFSQEIRRMGIIDPVIVEFD
FT                   RTEEMLEALSANKIDFVLMDNPAALYWSANSSGRLLVIGSPMLIGYGLGIAVNRENSVL
FT                   LKSLNDALVEYQRSDKYKENYNKYMMNF"
FT   gene            838810..841551
FT                   /gene="glnE"
FT                   /locus_tag="LPC_2614"
FT   CDS_pept        838810..841551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="LPC_2614"
FT                   /product="adenylyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2614"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56529"
FT                   /protein_id="ABQ56529.1"
FT                   /translation="MSPQSDIETLISTKSWLIEKYVAPLHHPLRESAEKLILVSDYACR
FT                   QIRLLVSLLESDSCCSLWSRESYFYAIQQISLELSQAQYMQELRRFRHTHFLRLLLLEI
FT                   ADLASTQEVMQSWSDLADSIILHTLKYIGFTLLSRYGVPRNSEGKEIQLYALAMGKLGG
FT                   RELNYSSDIDLIFAFNEVGSTDGEEQITNQHYFSKMVQTFVHLLQSVTPDGFVFRVDLR
FT                   LRPNGDSGPLVSSFAAMETYYQEQGRDWERYAMVKARVIAESLNEPFPWFERLIIPFVY
FT                   RRYVDFGVIESLRGMKAMIEREVQLNPLLNDIKRGRGGIREIEFIIQNIQLIRGGRLPQ
FT                   LQVQNAMLALAVIKKEKLLPRCDALKQAYLFLRKLENILQSLNDQQTHSLPEDQLKKVQ
FT                   IVYAMGFTDWEQFFNKLQQYQRIVSNFFHSILGKVDDYEDEKRLLNNQLFSLWQGHVES
FT                   NMAVNLLISLGYENAQHCYQMLHAFRHGPRCRRLSQGARIRLDRFMVLLLTELTYCPKT
FT                   DEVLLQVIHLLENIVGRSAYLALLTENPHALRELLFWFVNSPFISSLFVSQPFLLEILL
FT                   EQEKDWHPDSLSQMEQTIVEKLEHTNDVEVHEEILRQFKLTNWMVAARAELYGLCDAVR
FT                   IGKFLSDVAQVIVSQVLIIASKQLCGRHPEMAQIQSRFAIIAYGKLGSREMSYASDLDL
FT                   VFLHSAKPSEEALVTRLTQKILHMLTTRTQMGVLYHVDTRLRPSGAAGLLVSHVDAFVE
FT                   YQKSQAWTWEHQALLKARILSGNSKIKKQFSQLKKSVLLLERDSKLLQRDVLTMRSKID
FT                   QFQESDEVKLARGGLLDLEFLVQFLILNLRDPKFSSYTNTLSQLKHLFLSNVLTKSQFT
FT                   TLKKAYQYFHYLMHQKIVQPDVINDDEMQNAVSSVCKDLYRY"
FT   gene            841819..843030
FT                   /locus_tag="LPC_2613"
FT   CDS_pept        841819..843030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2613"
FT                   /product="dipeptidyl aminopeptidase/acylaminoacyl
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2613"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56528"
FT                   /protein_id="ABQ56528.1"
FT                   /translation="MYANYYDMYQKTGIFSDEFFGQFLRTLGKCYVRCADVGECYATLS
FT                   KITDKDGESWYKAWYEMANTLKTKANISWEANHFITAAYAYLRAAEYYRASEFFLRANP
FT                   DDPRVIPCFDQLQFCFERAMHRLHPGSQKIWIPYDDQTLSGYLFFSDQSPKATLIVPGG
FT                   YDSTFEENYALVPAALLHGYHILIFDGPGQGHVLRRQKLYMRADFEHVVSQVVDWLDEQ
FT                   SELGTSSYVLIGRSFGGYLAPRAACSEKRLAALICDPGQMDIAGSLNKMLPPNLMMLLK
FT                   EGKADELNACFYQLFSENPMKEFYFKSRMYTHGLATPFDYLQALSAYTFVDRVQEITCP
FT                   TLVCDNPSDRISNRGNTLYEALRCEKTYVMFDAKLGAGMHCEADANGQFQQVIFDWLDE
FT                   RFTQ"
FT   gene            843098..843670
FT                   /locus_tag="LPC_2612"
FT   CDS_pept        843098..843670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2612"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2612"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56527"
FT                   /protein_id="ABQ56527.1"
FT                   /translation="MRIGIAILVVLVCCTLQGCKKEKSPYQTTSYVESQLFIVSSPDGG
FT                   YIKEWYADEGQLLHKEDKIVTLDGVNSIKAPADSVMTERYYLKDEYVPPNFPIASLSLP
FT                   SQMKILFYVPESHLEKIKLGKKIRILLNEKKYSGKISFISNQAEYTPDAIFSEKNRYKL
FT                   VYKVKADLSQGLRDLLKIGQPVDVNYE"
FT   gene            843663..844589
FT                   /locus_tag="LPC_2611"
FT   CDS_pept        843663..844589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2611"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2611"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56526"
FT                   /protein_id="ABQ56526.1"
FT                   /translation="MSKWSSKQIIIDVSGLAKSFNGINAVVNLNLQIEEGTIFGFLGPN
FT                   GSGKTTSLRLLSGLIIPDKGQGRCLNLDLMTQTKLIQAQIGYMPQNFCLYQNLTVYENL
FT                   DFIARIYQLKNRKERLKEIIELLALSDNQKRITATLSGGWKQRVALAAALLHKPRILLL
FT                   DEPTSGIDPQSRLLIWAHIQSIVSKGVTVLLSTQHMDEAERCHQLVYMSAGEIIARGSV
FT                   IEIIQSTGLHSWVVKGESFSRLKDILVNNPAIQMIEKGNEMRISSIVDDIHQVLDPFVL
FT                   NNYEIKKTDTTLEDAFIYKIMKEGNPK"
FT   gene            844604..845722
FT                   /locus_tag="LPC_2610"
FT   CDS_pept        844604..845722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2610"
FT                   /product="transmembrane protein, ABC-type multidrug
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2610"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56525"
FT                   /protein_id="ABQ56525.1"
FT                   /translation="MQRLWAIIRKEFLLMKRDPATIVIMAILPLILVCIAGYAINTYPQ
FT                   KVPTVLINLDNTDVTRELVREIQNTGYFSFVASTNDSESAHHLLKTGKAILVLTIPVNF
FT                   TKAIRRNQNPALLLEDGSIDAIASGRAIIALAGLKSSFIEKMGQKGINIPLQRPDFQII
FT                   NHRLYDPDRVTQFYVVPGMIGLVLMLTMLLITVVVAFRDVQGGTIEYLLASPTRPSEVL
FT                   LGEIFSYILIGYLQLSLGLILSYYLFHVPFIGAPLLLYLCTLPYIVAELSLGLTIATFC
FT                   TSQFEAVQVINVFIAFSILLTGFTFPIFGMPEWAQYLGLFLPLTHFFKIMFGIMLKGNN
FT                   FGEIWANLWPLLAYCLTMISLATWRFKRHFVR"
FT   gene            complement(845792..847111)
FT                   /locus_tag="LPC_2609"
FT   CDS_pept        complement(845792..847111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2609"
FT                   /product="2-methylthioadenine synthetase; MiaB"
FT                   /note="COG0621"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2609"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56524"
FT                   /db_xref="GOA:A5IGM4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGM4"
FT                   /protein_id="ABQ56524.1"
FT                   /translation="MNHKVGFVSLGCPKALVDSERIITQLKAQGYELVPTYEDAGVVVI
FT                   NTCGFIDSAVQESLDTIKEAMAENGRVIVTGCLGAKADVIKNACPDVLHISGAHAYEEV
FT                   VNAVHQHLPPPADPFTQLIPPQGIKLTPRHYAYLKISEGCNQKCTFCIIPTMRGKLQSY
FT                   PMAQILTEAKKLKQAGVKELLVISQDTSAYGVDTRYQQVEWQGKTVNTRFYDLCEQLGE
FT                   LGIWVRLHYVYPYPHVDDIVPLMRDGLILPYLDIPLQHANSRILKAMKRPASSENTLLR
FT                   IASWREICPDITLRSTFIVGFPGETEEEFSELLAFLKEAQLDRVGCFKYSPVEGAKAND
FT                   LDNPVSEDIKEERYHRFMQVQAEISRNKLKNKIGSTQTVLIDEITEDQIIARSKSDAPE
FT                   IDGLVYLPKISGITVGSFAEAMITDSDDYDLYGDLEYSLA"
FT   gene            complement(847201..848961)
FT                   /locus_tag="LPC_2608"
FT   CDS_pept        complement(847201..848961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2608"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2608"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56523"
FT                   /protein_id="ABQ56523.1"
FT                   /translation="MKKWLLFSLLFLTSLCVHAEPLPASEVFKVSVKKIDPNTFAIQWN
FT                   ILPKYFLYSDRIQLNSDNDDIAQLGTLRFPTPLTKTDKQGRTFKVYRNQLNLPVGVLGI
FT                   TPGETIVNLRFQGCADDGFCYPPEVKQIKLAIDDKLALSQVDLETFHAPEATPLEKPEQ
FT                   DIADIFANHNWIMILLIFYGFGLLLSFTPCILPMVPVLSGIIVGHGKTATTKKAFFLSL
FT                   SYVLSMSVTYAVVGAVVALLGANLQISMQSPWAISLFSLIFVLLALSMFGFYEFKLPDA
FT                   WQSKIVGSSREQRGGHYLGAAIMGCLSTLILSPCVTAPLIGVLTYIAQTGNVLLGSVTL
FT                   FTLSLGMGTPLLLIGTSAGKWLPETGSWMNAVKAFFGILLLAVAIYLMARILPAGLVMG
FT                   LWACLLIFSGIYSGALTKSNTNQEKLCQGIGIILLTYGLLILIGASMGSSNPLQPLANL
FT                   QAAPTVSNAFESAKAQSVKSVELAIKQAFGKPVMLDFYADWCASCKVMENTTFKDPRVQ
FT                   KALSHFIVIKVDVTANNKNDRALMQHFRVVAPPTFIFFNAEGVQLNNLKRVGELNADEF
FT                   MQTIKSIDEN"
FT   gene            849147..849437
FT                   /gene="htpA"
FT                   /locus_tag="LPC_2607"
FT   CDS_pept        849147..849437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpA"
FT                   /locus_tag="LPC_2607"
FT                   /product="Hsp10, 10 kDa chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2607"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56522"
FT                   /db_xref="GOA:A5IGM2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGM2"
FT                   /protein_id="ABQ56522.1"
FT                   /translation="MKIRPLHDRVVVRRMEEERTTAGGIVIPDSATEKPMRGEIIAVGA
FT                   GKVLENGDVRALAVKVGDVVLFGKYSGTEVKVDGKELVVMREDDIMGVIEK"
FT   gene            849465..851111
FT                   /gene="htpB"
FT                   /locus_tag="LPC_2606"
FT   CDS_pept        849465..851111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpB"
FT                   /locus_tag="LPC_2606"
FT                   /product="Hsp60, 60K heat shock protein HtpB"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2606"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56521"
FT                   /db_xref="GOA:A5IGM1"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGM1"
FT                   /protein_id="ABQ56521.1"
FT                   /translation="MAKELRFGDDARLQMLAGVNALADAVQVTMGPRGRNVVLEKSYGA
FT                   PTVTKDGVSVAKEIEFEHRFMNMGAQMVKEVASKTSDTAGDGTTTATVLARSILVEGHK
FT                   AVAAGMNPMDLKRGIDKAVLAVTKKLQAMSKPCKDSKAIAQVGTISANSDEAIGAIIAE
FT                   AMEKVGKEGVITVEDGNGLENELSVVEGMQFDRGYISPYFINNQQNMSCELEHPFILLV
FT                   DKKVSSIREMLSVLEGVAKSGRPLLIIAEDVEGEALATLVVNNMRGIVKVCAVKAPGFG
FT                   DRRKAMLQDIAILTKGQVISEEIGKSLEGATLEDLGSAKRIVVTKENTTVIDGEGKATE
FT                   INARIAQIRAQMEETTSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDAL
FT                   HATRAAVEEGIVAGGGVALIRAQKALDSLKGDNDDQNMGINILRRAIESPMRQIVTNAG
FT                   YEASVVVNKVAEHKDNYGFNAATGEYGDMVEMGILDPTKVTRMALQNAASVASLMLTTE
FT                   CMVADLPKKEEGVGAGDMGGMGGMGGMGGMM"
FT   gene            851234..851674
FT                   /locus_tag="LPC_2605"
FT   CDS_pept        851234..851674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2605"
FT                   /product="DNA binding stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2605"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56520"
FT                   /protein_id="ABQ56520.1"
FT                   /translation="MSKVIKKLEVALADTYALYLKTQNYHWHVTGPQFKSLHELFEIQY
FT                   KELAEAVDQIAERIRIMGHKAPATFAEFNQLKTIKDGDSGLSANEMVSELAKDNMMIVK
FT                   DLNQAIKIAQENEDEGTVTILSDRVAAHEKAHWMLSASKEKK"
FT   gene            851931..854048
FT                   /locus_tag="LPC_2604"
FT   CDS_pept        851931..854048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2604"
FT                   /product="spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2604"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56519"
FT                   /protein_id="ABQ56519.1"
FT                   /translation="MFRFLFPVSLFISSILLFSIQPMVAKAILPIYGGTPGVWTVCVLF
FT                   FQFILLIAYGYVWLLSQIKKPAVWRLIHMVLVVLSFTALPLLFHPAARDGQPEWVILHN
FT                   LLIQLGLPLLVIGASAPLLQFAYSQTKSKGASDPYYLYISSNLGSLSALLFYPWVIERF
FT                   IGLTRQFYLWNFGFAIYLLLLVTVLFFTKYQPLILTEKKEVDFLPWREIAYWIFLSFVP
FT                   CSLMLGVTLYITTDVAATPLFWVLPLALYLLSFVFTFTATPLISQKWISRNCLFFLVFT
FT                   ILGFIFGVSQIRVWQLVLFNLLSFFILALLCHGQLFARRPKPHKLTLFYFCLSIGGVLA
FT                   GIFNGILAPNWFNYVYEYPLAILLSLFALQLPKTNRGWWVPLVVLGLLSLHYFIPTVPW
FT                   FKSTTTFHILAILALGIIVIWHRNKINLVLSMLILFVFLYFPPLQDKQILLKERNFYGV
FT                   KQVFKKDDVHALISQSTLHGMQVMNGEKASYGRSSYYGAIAPIVDILKKEFHPLSATIM
FT                   GLGAGTLLCQFRATDSIKVIEIDQQVIDLAKNNKLFTYIRDCSPSAEIIKQDGRLALVN
FT                   MPDASQDLLILDAFNSDAIPVHLMTLEAFTLYKKKIVEDGVILVNLSNRHLQMLPVINA
FT                   IGRSLNMITLFLAHKGDKKLGQFNSEWAMLTSNQSLAFQVMKGTNWKFVADDDQFLWTD
FT                   DYSNIIPLLKW"
FT   gene            complement(854188..856068)
FT                   /gene="parE"
FT                   /locus_tag="LPC_2603"
FT   CDS_pept        complement(854188..856068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="LPC_2603"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2603"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56518"
FT                   /protein_id="ABQ56518.1"
FT                   /translation="MSENYTAEAIEVLSGLEPVQRRPGMYTDTTRPNHLAQEVIDNSVD
FT                   EVLAGFASRIIVTLHEDGSIEVEDDGRGMPVDLHPQLGLSGVEVIMTRLHAGGKFSDKN
FT                   YSFSGGLHGVGVSVVNALSERLDVTIKRNGIIYQMTFANGDKLCELNETGVTKKRETGT
FT                   VIRFWPNGKYFDTTKISVKHLTHVLRAKAVLCSGLSMTFINKITNEEMNWCYEQGLTDY
FT                   LQQTLPEDYLPEEPFAGAFKSDEATVDWALAWSDSANGNLNESYVNLIPTIQGGTHVNG
FT                   LRSGLFEAMSEFCELRNLLPRGVKLTADDLWESCQYVLSIKMKEPQFAGQTKERLSSRQ
FT                   TSGLVSNVIKDAFAIWLNQHRNQGEAIAALAIERAQKRLKQAKQVARKRVSQGPALPGK
FT                   LADCLQTDLSQAELFLVEGDSAGGSAKQARNKDYQAILPLRGKILNSWEVDSSQVLASQ
FT                   EIHDISVAIGVDPGSSDLEGLRYGKICILADADSDGAHIATLICALFLRHFKPLVKAGH
FT                   VFVAMPPLYRIDAGKLIHYALDDEEKNRIIQHLSQTTKSKVNVQRFKGLGEMNPIQLRE
FT                   TTMDPNTRRLVQLTLDDEEQTEAIMDMMLNKKRAADRKLWLETKGNLAEI"
FT   gene            856202..858010
FT                   /gene="dppF"
FT                   /locus_tag="LPC_2602"
FT   CDS_pept        856202..858010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF"
FT                   /locus_tag="LPC_2602"
FT                   /product="ABC type dipeptide/oligopeptide/nickel transport,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2602"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56517"
FT                   /protein_id="ABQ56517.1"
FT                   /translation="MQNTAKINQLSVAFKSLDKTVLALDKLSFSLNPGETLVLLGESGC
FT                   GKSLTSLAMMRLLPRAGVYGIDSQINIHGEDILNLPEKMMRELRGRRLAMIFQEPMTAL
FT                   NPVLTIGEQIAEVLKRHRSLTKEQIKERVILLLNEVEMPQPQMRIYQYPHQLSGGQKQR
FT                   VVIAMALACEPDILIADEPTTALDVTIQAQILALLKKIQKKHQMSLLLITHDLGVAKTM
FT                   ADRICVMYAGQVVEQASVKDFFSKVSHPYVQQLLTSLPSFAKRNEKLSIIAGTVPSLES
FT                   MPSGCRFHTRCIYAFERCHHEEPQLQEVEQRILRCHLYPDIKELPLLDKNKISWVPSVE
FT                   KEEIVFSVDDLSVHFIHKKGFLSRKKTIFKAVDGLSFTLSRGKTLALVGESGCGKTTAS
FT                   RALLRLLPAAGGKIRYKDSDVLSMTGSGLRRYRKKVQIIFQDPFSSMNPRMTVGEIIAE
FT                   GMHAQGMKPSYIRKQQKSLIEQVNLPITSLHRYPHQFSGGQRQRICIARALATEPDILI
FT                   CDEPTSALDVSVQAQILNLLKELQQQRGISYLFITHNMGVVSYIADDVLVMKDGLAVEY
FT                   GACEKVLQQPEHPYTRQLLNAVLDIE"
FT   gene            858099..862382
FT                   /locus_tag="LPC_2601"
FT   CDS_pept        858099..862382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2601"
FT                   /product="LigA, interaptin"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2601"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56516"
FT                   /protein_id="ABQ56516.1"
FT                   /translation="MKITRNQLNFKGVKEFGGCLTRNDEQIEFINKEIKLLKELIEFNI
FT                   LKGIDENKSQSLFDAVIEAVEKAGLDVEHELLIQFIQSTSEIIDSKSTDLPELVSLLTV
FT                   LIKSSNKYDKSELTRYCRLIDKLEKTDEKTLEQWIKILTILGRNVESVNGDLLFNVQSR
FT                   LEIHSVLLKDISSLFDYPPYPALDAFSEKLREYSRELKLYIDSFDRDPAGSRAPKVNQE
FT                   GILIKSREQILNEQFDTSQIQEVIAKIESLVDGSGLSCKGQYELAQQVVFINAIGRDFP
FT                   LKIANETYTDLTQLGRNKLQELSDFLIMEMRRLDISKEDKLRTQLKLLAVMREQYFRST
FT                   GIFFDTTQMISLLLSLHHQEQNVLMGVSRNENLSAPPAAILAAMQWVLADGGTVDLCFA
FT                   NHGLIAQDYLEKGDRDFFTCLGIPSSVVEANSESGTYQVGGINYSTLSDLTSYRSHAVI
FT                   EDEELSMDRCGYPVSSYLILNHIDFSNLDDRTFSHFSSLYDYYKGKGRVVRITEIEETV
FT                   GEVVGQISRFDMDVGYRVFPARKNLQEELNTQSLAERRREEAVKQYFIQSVSNIQQAVL
FT                   NQLEEWQAFLHLIYPKSEWRQLDNELFAQRNELIDSLKKQWTKCLEDSDPKKMYPNPYV
FT                   RRDVFQRLQTRELEKAIQAYEKSVSSIWNLNRDQLKAKTENRFSSDSVNALRCKYLEEV
FT                   DLSEQIKWSKLSARLKKKEATQEKKRSHRHLESAVEVTGAMLSYHDGDLEPYRLAFVHS
FT                   QLKLWARDISKEINNSSLPASVKQGLIERANNADNFLALELLLIDYESRWLDKEKLSEK
FT                   FRMQPIISDMLRVYKQAGFEEHKELKILKETYLDSTATQIIHHLDKTLAWAKPENRGPW
FT                   YWIERSAVKKAANEILVLANGVKQARDSLSKQIAIKKLYRDLCKHQAQLEDVWIFSFDH
FT                   KNTRDLINQTLNTMDSLTVLGRDEGGLDINFIQECKEEAQYYLLGEKFSSVLEDFEKNN
FT                   SQILTAHSEWQEVKRQLQQKQNESRKVYTLNEMYYVLCKKINELSISYSLLREPLVQLR
FT                   GMIRTLWNSFQEKHQDIIDESKYFDFKARKIKEELEGIEGYSVFNVKVKKGYTGFNEYV
FT                   ELIIEGEGTSALFEGFMQYKSRLTELKEAYRQLEFSLKQNRLELLNLNRIHAKHLPFLK
FT                   DRIKGNPEVELFPEQCRSKVKEILTLKEWINGQIPENLSQFPENMQNHFLDRNTLKSMD
FT                   RNTMTMEQIDKIKDEQLKAELTELYNKMHKVGEEQSTSWFSTVTRRIVGLIPGMFRQEE
FT                   TEDDWRYQFNELQGRSDSILQSLLTKKIMTKYDALVNEMVLIQSNLAQQMDSGNKKIQF
FT                   LSDKILEEERKTNVIIKRFDNLNDFYDFEAKLKRFKTAPPIVPVNEVQIESKNRILSCG
FT                   EGAFSNLEEEFQTDSVMQPPMVFNI"
FT   gene            complement(862740..864449)
FT                   /gene="proS"
FT                   /locus_tag="LPC_2600"
FT   CDS_pept        complement(862740..864449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="LPC_2600"
FT                   /product="prolyl-tRNA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2600"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56515"
FT                   /db_xref="GOA:A5IGL5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGL5"
FT                   /protein_id="ABQ56515.1"
FT                   /translation="MRASQWFLVTQKETPNDAEIASHQLMLRSGMIRKLGSGLYTWMPL
FT                   GLRVLRKVENIVREEMNKTHAMELLMPSVQPAELWQETGRWETFGGQLLTMKDSNQREY
FT                   CFGPTHEEVITDIMRNELQSYKQLPVNFYQIQTKFRDEIRPRFGVMRAREFIMKDAYSF
FT                   HLSIESLQETYKDMYQAYCRIFDRMGLKYRAVEADTGAIGGSASHEFQVLAESGEDLIF
FT                   YSDASDYAANIEQATSLKPPKANQACNETITLVDTPNQKTIDEVASFLGIASNQTIKTL
FT                   IVKGKEHPMVALVLRGDDELNEVKATKHPLVHSPLSFIDEELILKTLKTPLGSIGPIQL
FT                   NIPVIVDHHALAMPSFVCGANQADKHFINAAWERDAKYDDAYDLRNVKEGDPSPDGRGM
FT                   LHCCRGIEVGHVFQLGDKYAKAMNASVINEQGQLQTMIMGCYGLGITRVVAAAIEQHHD
FT                   EHGIIWPQALAPFQVNIIPLNGARSQTVKEQAESLYQQLKSHGIDVLLDDRNERAGVLF
FT                   ADNDLIGIPHRLVVSERNLEQGCIEYKSRTSSETQLINLDKVVNFIIELINK"
FT   gene            864623..867460
FT                   /locus_tag="LPC_2599"
FT   CDS_pept        864623..867460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56514"
FT                   /protein_id="ABQ56514.1"
FT                   /translation="MPNLPGLYFLQAYPREEIWRLFVDGRFWSKENGWRGYESREPGCL
FT                   NAALESLCSIALQVEKSGEEFELSVDLIKRIHKKCGKKVEELQEKNPGELRTDEPVSFG
FT                   IPAGRASIKGIEEFLSLVFLTEGEAEFGPGKAGPFGPRFDKNYFKNLNPEQIPDLAKQI
FT                   YFDMCKYGHSNTNHFYLAVMKNVDVYLEKITQSYNQEIKTAETLDEKLKIIVKHIRMYE
FT                   VLHPFRDANGRTFVNNLLNILLMQQGLPPATFYEPNVFDLYSAEELVVVVKEAIFNTVE
FT                   IIEQSKRKTPITLYGYHSSLEEQTKFRDMLDSPAYEKIKHMDFSDLNPEKLHRKTQKCL
FT                   SSLNEQYPLHRGAIYLSDPGEIKLLLSNRNESQINQQIEQGAPPIYVGKTPAHLAVISG
FT                   NMAMIDELIAKKADLSLQDYDGKTALHYAAECGNMQIMGKILKVVLSQEDAIKVLNIKD
FT                   NHGKTAFHYAAEFGTPELISALTTTEVIQINEPDNSGSSAITLAYKNHKLKIFDELLNS
FT                   GADISDELLDAIWARKDKETLGKIIAKNEKILLNKEAFRIAISLGSVSLVKKFLRAGVD
FT                   IDIPLTKDKATPLMLSINSGNPKLVSYLLKKGANTRLTDTSGNSVLHYVFYSKAENREA
FT                   LANIITEKDKKLINQPNTNGNPPLYNAVVVNDLKMATILLEMGARVDFEDRLGNNILHS
FT                   AMRRCDLPIILDIVKKDSTLLHNRNSERRNPFHQALHEMHTFPSSKETEEIHFMNLSDL
FT                   LLKEGVDLNKKDIKGKTILDIALSKQYFHLCVKLMKAGAHTNISSPSKFLKNSDANSIL
FT                   ERPFKFKNDLKKELDDNPLIAMAQINDLYVQIKNNRIRTPTGYAPKEGVSFFKGKSSDA
FT                   KAHDEVLSVLKELYDSKLTEMLGNLPGEGLEEIKRSQKFFDGELKLLIKNQDISRKVDK
FT                   KSIQEAVGTSLKLKW"
FT   gene            complement(867467..869125)
FT                   /locus_tag="LPC_2598"
FT   CDS_pept        complement(867467..869125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56513"
FT                   /protein_id="ABQ56513.2"
FT                   /translation="MRDKIITGNKVIFSQSVAKDQTKNLSSFLSNRFYSVNQSHNHSII
FT                   IGSSLSHQENDIEHDTILDTSGMLVTTDTNGLVNGARVAITDGLGGGNGDQEEDDEIYR
FT                   VSHSSCENFLNCNQNMDTTLSLITQPKASDKKQTAPKTLQHTEASMAAFIYQNHPGKGY
FT                   IGQFANIGDGLIIILDKRFKIKHMVSACHIYRGFGTWTPPSLQALATTANKDALLVRQT
FT                   LKLAEGDIIISMTDGVWGELKTSLIAQTNDRRDIGVDKEYFKTLFDELTDSPYPSSFDI
FT                   ARIITSSAMSRSLERRKTLIKLINEIEQQHFHEKSVKTINEVLEYFLKTGHVETAQTLK
FT                   AILFEDGLSDGITYFENIEIPLEMVMHDLKSRTVGDCSTINVTRIPYHLDELIRGFINY
FT                   PEKHQILAPLFKARVKSEADLEEAFHRLSLEMVQAEIECPISEAHFERAFKKETLDKTQ
FT                   AVLTHYFRISTGLDSKKNYQERLNDLSAYLSKESSLEKNDIKLLLSMLDSEIKPKTGVF
FT                   QTLFGENQNKLYKAFHKKIELQFLDGEIENKNELK"
FT   gene            complement(869266..871572)
FT                   /gene="sul1"
FT                   /locus_tag="LPC_2597"
FT   CDS_pept        complement(869266..871572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sul1"
FT                   /locus_tag="LPC_2597"
FT                   /product="sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56512"
FT                   /protein_id="ABQ56512.1"
FT                   /translation="MIDRNIVNLRLFRIYSKRYLKFDFVAAIVVFLVAIPLCLGIALAS
FT                   GAPLFSGILSGIIGGIVVGIFSGSQVSVSGPAAGMAAVVLAAISQLGDFNTFLLALTLA
FT                   GVLQLIIGALRAGFVADYVPSNVVQGLLCSIGILLIIKQLPLAFTLSSDFDELKTHLLE
FT                   TTEGFTVSPLLALSQHINEGALIITTLSLAILIYFDITKNKILKEIPAPILVVLAGILL
FT                   NELFIWANSSLAQNSPQLVNIPDTNGFFQFFSHLEYPDWSAWANPKVYLYALVICIVAS
FT                   LETLLNLKASERLDKKRRHSPTNQELVAQGLGNITSGLVGGIPVTSVIVRTSINIHAGS
FT                   KTKFSAVLHGFFILFAVMLIPGALNKIPLSSLAAILIYTGYKLNKPAIYINIFSQGSDR
FT                   FIPFIVTVISIIAFNLLAGILIGLAISLFYILKSNSQARIDIIKEIYPNGSTYRLILPQ
FT                   QMTFLNKAALVAELDTLPRRSQLIIDARHSQYIDKEILDLFNELKEELAGSKQISLNFT
FT                   GFQEHYKIHNYIDFITVTTYDVQTNLTPAQVLNILLEGNQRFLSDNRIHRSNQIDIKYT
FT                   AKTQHPIAVVLACIDSRVPVETIFDMSFGDLFCVRIAGNVINDDILASIEYACNVVGAK
FT                   LIMVLGHTRCGAIQSACDGIEKGHITQLLSKIKPAVNAEKETTTERNGKNQIFVNHVTE
FT                   LNVANTLQNIYKKSDILRTMIDSNEIGMVGAIYDVSSGKVSCKTYTEELSTLDGDENKL
FT                   LAQKFETILLEAKAS"
FT   gene            complement(871763..872614)
FT                   /locus_tag="LPC_2596"
FT   CDS_pept        complement(871763..872614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2596"
FT                   /product="hypothetical protein"
FT                   /note="similar to ydaO, E. coli"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56511"
FT                   /db_xref="GOA:A5IGL1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGL1"
FT                   /protein_id="ABQ56511.1"
FT                   /translation="MSSNPSSVEKKLLHYTGKAIADFNMIRHGDRVMVCLSGGKDSFTL
FT                   LTILNQLRIKSGNKFEIFAFTLDQAQPGWNDACLRQWLAEKSIPHEILTRDTYSIVKEK
FT                   IPEGKTYCSLCSRLRRGIIYRYAEENGFNKIALGHHRDDLIRTLMMSILYNGDIRSMPP
FT                   KLLSDNKKHIVIRPLCYVQEKDIITFASEQAFPIIPCNLCGSQENLMRKKVASLIDQLA
FT                   IENPKVPSNMLHALQSLKPSQLMDQNFWNFKNLEDGLETAQSVQCEEVFNAQEFEFEDE
FT                   KI"
FT   gene            complement(872632..873999)
FT                   /gene="tolC"
FT                   /locus_tag="LPC_2595"
FT   CDS_pept        complement(872632..873999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolC"
FT                   /locus_tag="LPC_2595"
FT                   /product="outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56510"
FT                   /protein_id="ABQ56510.1"
FT                   /translation="MRKSLFCWILTLGVSTHAFATDLMDIYQQALENDTIFKEAYDTYM
FT                   SSTEAIPQARAALYPQVGLGSQAGRNYQDAVAGAFSANQYYGSYLWQVKASQALFNYQA
FT                   WAQVAQAKASVKAAQASFNDAAQNLILRTAKAYFDVLFAKDTLDFAEAKKRANKRQYDQ
FT                   ATQRFQVGLDAITSVYEAKAAYDQSIATVIAARNNQINQSENLRKLTNHVYETLAPLKD
FT                   SKIPLVKPEPNDVNQWIDTGLKQNYKLYAAKYNLEVAKENVKAISAGNWPVFSLQSNAS
FT                   QVHNNASGNNVFIPSKQTQANIAIAMNFPVFQGGLVQAQTRQAQYNFQSTSEKLEQTYR
FT                   DVIVNSRIAFNTITDGISKVKADRQTVISVQNSLQSTEAQFEVGTRTMVDVVNAQQRLF
FT                   EAQEQLARDQYDLINSILTLKYLAGTLNVNDLEQINSWLATTRVNGFSPVDNKTSK"
FT   gene            complement(874011..874661)
FT                   /gene="pcm"
FT                   /locus_tag="LPC_2594"
FT   CDS_pept        complement(874011..874661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="LPC_2594"
FT                   /product="protein-L-isoaspartate-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56509"
FT                   /protein_id="ABQ56509.1"
FT                   /translation="MNHSARINMIKQQLRTGDVLNESILDLYDEILRHEFVPEPFSHFA
FT                   YSDMQIPLAHGQRMLTPLEEGTILQSLDLKGHETVLEVGTGTGFMTALLSKLCKKVISI
FT                   DYYSEFTTNAKRKLEEHNCNNVELITGDACRGWLESAPYDVIVFTGAMEKLTDTHKLQI
FT                   LPGGKLFAILGKSPVMKAYLFQLDHNAIWTESMLFETDIPPLVDQLKPKEFVF"
FT   gene            874842..876026
FT                   /gene="kbl"
FT                   /locus_tag="LPC_2593"
FT   CDS_pept        874842..876026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="LPC_2593"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56508"
FT                   /protein_id="ABQ56508.1"
FT                   /translation="MLERFINYLQNELETLKADGLYKSERVISSQQQADVKVNEREVIN
FT                   LCANNYLGLANDPELIAEGQAALAKYGYGMASVRFICGTQTPHKQLEQKISHFLNKEDT
FT                   ILYSSCFDANTGLFETLLTEEDAIISDALNHASIIDGVRLCKAARYRYANNDMKALEEQ
FT                   LIAAKNARFRLIATDGVFSMDGILANLPAICELADKYDAMVMVDDSHAVGFMGKTGRGT
FT                   PEHFGVSDRIDIVTGTLGKALGGASGGYTASNQVVIDWLRQRSRPYLFSNTLAPVIAHT
FT                   SCVVLDKLSTNNSLAEKLKRNSHYFREGMTQLGFELIPGEHPIIPVMLGDASLAGRIAN
FT                   RLLELGVYVVGFSYPVVPKGLARIRTQMSAALELHHLDKALKAFETVGKEFSVI"
FT   gene            876115..877137
FT                   /gene="tdh"
FT                   /locus_tag="LPC_2592"
FT   CDS_pept        876115..877137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="LPC_2592"
FT                   /product="threonine(-3-)dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56507"
FT                   /db_xref="GOA:A5IGK7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGK7"
FT                   /protein_id="ABQ56507.1"
FT                   /translation="MKSLVKAKKEPGIWMQDVPVPEYGVNDVLIKIKRTAICGTDIHIY
FT                   SWDEWAQATIPVPMTVGHEFYGEIVEVGKEVQGLKVGQRVSGEGHITCGFCRNCRAGKR
FT                   HLCRNTLGVGVNRPGCFAEYLALPATNVIALPDNITEEQAAILDPFGNAAHCALAFDVV
FT                   GEDVLITGAGPIGIMAAAIVRHIGARHVVITDVNDHRLELARQMGVSRAVNVKYQKLSD
FT                   VANELGMLEGFDVGLEMSGNPMALNDMMKAMNHGGHVALLGIPPQETPIDWNQVIFKGL
FT                   VIKGIYGREMFETWYKMIAMLQSGLNISPVITHNFPVDEYQHAFQIMASGQSGKVILNW
FT                   "
FT   gene            877180..878853
FT                   /locus_tag="LPC_2591"
FT   CDS_pept        877180..878853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56506"
FT                   /protein_id="ABQ56506.1"
FT                   /translation="MAQYIFTMNRVSKIVENQRFILKDISLSFFPGAKIGVLGLNGSGK
FT                   STLLRIMAGVDTQYEGEARPQPGIKIGYLAQEPELDLSKTVREVVEEGVAEIKEKLSRF
FT                   DAISMRFAEPMSDDEMNALLMEQGELQNEIEACGGWDLERKLDVAADALRLPEWDAIIG
FT                   KLSGGERRRVALCRLLLSSPDMLLLDEPTNHLDAESVAWLEHYLEEFSGTVVAITHDRY
FT                   FLDNAAEWILELDRGEGIPYKGNYSSWLEQKEARLSMEKKQEDALQRAIKAELEWVRTS
FT                   PKGRHAKNKARLARFEEMNSKEFQKRNETNEIYIPPGERLGDLVLEGEKICKSYGDRIL
FT                   IDNFDFKLPKGGILGIIGPNGAGKSTFLKMLTGQEEPDKGVIRIGETVKLAYVDQMRDN
FT                   LNPNNSVWQEISDGHDIMQIGNFQMPSRAYVGRFNFKGTDQQKKISQLSGGERNRVHLA
FT                   KLLKSGGNVLLLDEPSNDLDVETLRALEEAILNFPGCAIVISHDRWFLDRICTHLMAFE
FT                   GDSQITFFEGNYTEYETDRKRRLGDEANRPSRIKYRKLSD"
FT   gene            878895..879506
FT                   /gene="enhA"
FT                   /locus_tag="LPC_2590"
FT   CDS_pept        878895..879506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="enhA"
FT                   /locus_tag="LPC_2590"
FT                   /product="enhanced entry protein EnhA"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56505"
FT                   /protein_id="ABQ56505.1"
FT                   /translation="MKKIYWAVILMCLGLTSCVEFDESTLITDDAGYVHRTVHYLRDKR
FT                   GRNYFPMQIKAPGERLFVFDPKASAWAAYDEEGHRVMTGAGSGGIDVCEENPNQSCRTI
FT                   TGTFRIYNKRGIDCRSGEYPVDTKGGAKMPYCMYFYRGFTIHAAYEVPEHPSSHGCVRV
FT                   FPSAAKWLNEEFLRVGTKVIVLAYPDQNGVKTMSSLEKVN"
FT   gene            879616..880053
FT                   /locus_tag="LPC_2589"
FT   CDS_pept        879616..880053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2589"
FT                   /product="predicted transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56504"
FT                   /protein_id="ABQ56504.1"
FT                   /translation="MDYITSFTPYLSAIGGLLIGLSAVLFLWLNGRIAGISGMVHGLFP
FT                   PEKPFPVWRIAFLLGLAAAGLIYFISPVIQFPLRTHYPVFLLLIGGFLVGFGTRMGQGC
FT                   TSGHGVCGLARFSKRSFIATLLFILSAMITVYLIRHVGGLY"
FT   gene            880053..880478
FT                   /locus_tag="LPC_2588"
FT   CDS_pept        880053..880478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2588"
FT                   /product="predicted transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56503"
FT                   /protein_id="ABQ56503.1"
FT                   /translation="MYNIMSFLCGLLFGAGLTISNMINPNKVLNFLDINGFWDPSLLIV
FT                   MAVAVTVTFLGYKLINKFDKPILCNQFYLPEKKNIEKKLILGSIIFGIGWGVAGYCPGP
FT                   SITALTTFNSDPVYFVIGLIAGSWTYYWLFKKRTIQK"
FT   gene            complement(880518..881690)
FT                   /locus_tag="LPC_2587"
FT   CDS_pept        complement(880518..881690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2587"
FT                   /product="(outer) membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56502"
FT                   /protein_id="ABQ56502.1"
FT                   /translation="MRLIFTGVLCLLTLNAQANVIQYFAGISYNNPADLFKVKNGILLV
FT                   GGTGSYADLQFKGSALNFNTFQYDSGVNHSRTYIVWPYGRVAKRLNDKTVVAVDLTEPF
FT                   NSNLDWGNDAFTRYAATQNYLTDVDLSPKISYAISKKLQIGGGINFNVLLKNEVNWAFP
FT                   TGQSTYANLINRSSSFGVGYNLGINYAVNDTNFLGITYYSRIRQNTSGTSYLGLAANPD
FT                   FQFGFYMPATTVASYVHIFNPKWLINLQVFQSEWNANQKVRLYNTAAPPPFTNFIFDMH
FT                   FDASYAYLAAIRKQVSDKLGIALAGMIDDGPEEDGLRTIVFPSDTQYFLGLIGDYRFTE
FT                   HASMELILGHVYSNPSIQNKAKVNNVPVPFTTGRVTINANVLDLKVKIEG"
FT   gene            complement(881747..882721)
FT                   /locus_tag="LPC_2586"
FT   CDS_pept        complement(881747..882721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2586"
FT                   /product="IcmL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56501"
FT                   /protein_id="ABQ56501.1"
FT                   /translation="MKKTVLWGALFTLITTQANSEATQQAISTQNSASTGTNVVSESTN
FT                   QVPATNQNTQQNQLNQPVQSNGQQPTQTIQNNQQNQPSQTGEQQSNQNTQNNQQNQPAQ
FT                   QQTTQQPAQQQVPSQQTAPVINCDYKISAETKAIEQSLVLTWSEKAIIQSFDFDPATVD
FT                   AQLQKLQACFTDQGWLSFNSALQKSGNLDAIKSQKLHVSSQIDGQPQVTEAIENQWKII
FT                   IPLQVVYQNDKEKVTQLLNVNVTVGRKITGDLGINQMIAVPRTATNTSQTNSPSNTNPA
FT                   DSNTSTSQTPGDTTNNATQTNTQTQTGTPTNSPPSGSTTNTQN"
FT   gene            complement(882734..883693)
FT                   /gene="hutG"
FT                   /locus_tag="LPC_2585"
FT   CDS_pept        complement(882734..883693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutG"
FT                   /locus_tag="LPC_2585"
FT                   /product="formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2585"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56500"
FT                   /protein_id="ABQ56500.1"
FT                   /translation="MFDDLSNYRPANPALWQGRKDTANQERFFQKITFIDNQNELMTKD
FT                   KKTIFLGFASDAGIKRNLGRTGAKLGPDQIKTQLAKLPCHNNKHYVDLGNVVCENDELE
FT                   LSQSQFAQIVHFCHENGHQICAFGGGHEIAWAHYQGLSSLYPKLGVINFDAHFDLRPYK
FT                   KGELGNSGTPFSQIATYCEEKKMPFHYCCIGVQKFGNTPSLFEKAKKLNVSYLSAEDLY
FT                   EQSQAWQIAFLDDFILNLDHIYLTICLDVLAECYAPGVSAPQALGLSPWQIMPLLKYLI
FT                   QSGKVVSLDIAELSPPLDSELKTARLAALIIAELLDTN"
FT   gene            complement(883686..883775)
FT                   /locus_tag="LPC_2584"
FT   CDS_pept        complement(883686..883775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56499"
FT                   /protein_id="ABQ56499.1"
FT                   /translation="MSTQKRLQRGNNTKETGYARGLLKGELDV"
FT   gene            883983..884792
FT                   /gene="yueD"
FT                   /locus_tag="LPC_2583"
FT   CDS_pept        883983..884792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yueD"
FT                   /locus_tag="LPC_2583"
FT                   /product="sepiapterin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56498"
FT                   /protein_id="ABQ56498.1"
FT                   /translation="MSGIISPIVFYIDEEIVYLITGGGSGIGRALAFALAKRNKQVFIV
FT                   GRREKLLQETASLSANIHYLCADVSTPQGRELIKASLSTTPQIDGLINNAGTLEPTLLL
FT                   KDISFAEWHQALNTNIDAALFLPQLLYDKLSGGRVLNVGSAAAYFPIKGWGAYCVSKAA
FT                   LAMLTRCWQIECDSLAFASVMPGIIDTHMQAIARNGINLDPEQVNFYRRLKDHNRLISP
FT                   ETVAEFFIWLLLDIDNETYVSKEWDIYDTTHHSAWLKPPHQVLHWEF"
FT   gene            884792..886003
FT                   /gene="hutI"
FT                   /locus_tag="LPC_2582"
FT   CDS_pept        884792..886003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hutI"
FT                   /locus_tag="LPC_2582"
FT                   /product="imidazolonepropionase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2582"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56497"
FT                   /db_xref="GOA:A5IGJ7"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5IGJ7"
FT                   /protein_id="ABQ56497.1"
FT                   /translation="MFACDELLLNASTIDATGLQLSNQAIVIKKGRIEWCGSEDQLPAH
FT                   FQESAKSRKDCHGQLITPGLIDCHTHLVYAGHRAAEFRLKLQGVSYADIAKSGGGILST
FT                   VQMTRDASEEELIDQSLPRLLALKNEGVTTVEIKSGYGLDLQNELKMLKVARQLGEMAG
FT                   VRVKTTFLGAHAVGPEFKGNSQAYVDFLCNEMLPAAKNMDLVDTVDVFCESIAFSIRQA
FT                   EQIFQAAKDLNLPIKCHAEQLSNMGASSLAARYGALSCDHLEFLDENGALNMVKANTVA
FT                   VLLPGAFYFLKEKQKPPVDLLRQVGVGMAIATDSNPGSSPTTSLLLMMSMACQFFSMSI
FT                   PEVLSAVTYQASRALGMEKDIGSIEAGKIADLVLWSIKDSAALCYYFAYPLPHQTMVAG
FT                   EWVS"
FT   gene            886030..886725
FT                   /gene="yjeA"
FT                   /locus_tag="LPC_2581"
FT   CDS_pept        886030..886725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yjeA"
FT                   /locus_tag="LPC_2581"
FT                   /product="endo-1,4-beta-xylanase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56496"
FT                   /protein_id="ABQ56496.1"
FT                   /translation="MPIQMNLINKIGLMFGLLFYSFLASAITTEVIKKETAEYLLDIKY
FT                   PQGFQSNGVNQAVKEFITNQQKSFMNELSEDADTPADAPGKTGLNITYAIPYQSTNALS
FT                   VRFNISIYHRGAAHPSNAVKVLNFIKNQPVQLSDLFVPGSDYLQPIADLAKKEITAKKI
FT                   SDENWIKEGTKPTQENYSIWHFTKKGIAIVFNTYQVAAYVYGEQTVDIPLSLISAMVKP
FT                   EISKAVWGN"
FT   gene            886725..888725
FT                   /locus_tag="LPC_2580"
FT   CDS_pept        886725..888725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2580"
FT                   /product="oligopeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56495"
FT                   /protein_id="ABQ56495.1"
FT                   /translation="MSDTPFIAANKKVAELTFRVIILAIILTVLLAMSNAYLALKLGIL
FT                   TSASIPAAIISMGILRFFKNSTILENNAVQTAASAGEAVAGGIVYTIPALIIIGFWNHF
FT                   DYVTNFFIAVCGGILGVLFSIPLRRILVNDQTLKFPEGRAIAEVLKSSADKVGIKDIFL
FT                   GGLVGGLLELLQIGFKVIASSWNYWFVVKRSLFGLGAGFSATMIGAGYLVGHDMAISIF
FT                   LGAVISWLIALPIASQFYPDFLNQYPAEQAATLLWNSEMRYLGIGAMLFAGIWTFIKLA
FT                   KPLTRSVKTSFRTYISKSKFREQYPRTEKDIPMPFILMGIGLMAGILFLFFQIIFPLGQ
FT                   VGLDNDFSPTIVFIGVIYVLVVGFLFSVITAYFSGMVGVTASPGSSVVISGMLFAAWLL
FT                   VSAINHLLPLPLTSHQIQAAEAITIIIGAVVTGIAAIANDNTQDLKVGQLVGATPWKQE
FT                   VMLLLGVVISALVIPPVMQILFNVYGIAGVMPHAGMDVTQSLPAPTAALMAAITEAVFR
FT                   NSLPWNMMLAGSCIILLAIFLNRILNIKRFLNLSILGIAIGMYLPLSSSVPLFIGGMIA
FT                   LFVQNRLGRLKVNPEESTNRKQKGTLIACGLVAGSAIMDVLLAIPFSIFHSPDALQLVG
FT                   SSWKQYGVYLGVFSTLLLAWWISHRVCRSKI"
FT   gene            complement(888867..889964)
FT                   /locus_tag="LPC_2579"
FT   CDS_pept        complement(888867..889964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2579"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56494"
FT                   /protein_id="ABQ56494.1"
FT                   /translation="MYWRFANSMSITNRLLLIFIGSTVLILSIITGLIYPPMKELLHHS
FT                   HLNNEHYNYLLTRICIKNFFVGLWFSTLIIILASYLLAKKSMRPIKIFTKELASINASS
FT                   LEKRLPYTGNPKELEELALTCNDMLFRIESAFSHIKQFSASIAHELRNPIHYLRTATEI
FT                   TLTKPQTIETYQHVLQTHLEEYQSLTQLIDNLLFLTRCEHGQLQLNVRTLSANHLISSI
FT                   IEYYYSIAQEKGIEIQMFGEAQIEVDEHLFKRVISNLIDNSLTYTNKGGRILIIIEKRT
FT                   DNSIQIRIKDNGIGISKEHLPLLYHGFYRVDYSTNKENAGLGLGLAIAKSIMEHHKGQL
FT                   AIDSKMGLGTTVILTLPGKSFLKIE"
FT   gene            complement(889945..890616)
FT                   /locus_tag="LPC_2578"
FT   CDS_pept        complement(889945..890616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2578"
FT                   /product="two component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56493"
FT                   /protein_id="ABQ56493.1"
FT                   /translation="MRLLIVEDHKRTADFICKGFNEYQFQADAVYDGAEAIYRISEINY
FT                   DAVVLDVMLPIMDGWAVLEKIRELKPDLPVLMLSACDDVDSRVKGLEMGAYDYLVKPFS
FT                   FNELLARVKSLLRRKPKESPILLKINDLTINLQKHTAIRGDKKLPLTAKEFMLLTFMLK
FT                   RSGEVLSRTVIAEQVWDINFDTNTNIIDVAIKRLREKVDNDHPTKLIHTVRGVGYVLEI
FT                   R"
FT   gene            890765..891760
FT                   /locus_tag="LPC_2577"
FT   CDS_pept        890765..891760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56492"
FT                   /protein_id="ABQ56492.1"
FT                   /translation="MSKNESGTAKPIIKSTLMFFNSKLTDLNDKRLQLNRGKGLAKYLA
FT                   KSQKNTRDLAPLDAALGVMSFSLYMLRFSANVGLLAHLILVESQEKTNHKIRRDIYYSL
FT                   LNDSLWCVVNLTQFFWLSYRNSISAGLQGMQLETLAQLIDILVMIIRYQQDKKEYDLKY
FT                   NQAMGMERSRLAIEWQNKELNGLRSLLTSLSVVIAFGLFSFSAVAVPLSPVISSIILIS
FT                   SLLRVLIDIEKDRQLIHQLKLNETSREQIKNEQLAMTNARMKDLNKIILNSVFLPIGFF
FT                   LLITTPIPLTIIACVSMLLVHWLITNLINMRYSPNISVSPTIQTAELSLC"
FT   gene            891775..891867
FT                   /locus_tag="LPC_2576"
FT   CDS_pept        891775..891867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56491"
FT                   /protein_id="ABQ56491.1"
FT                   /translation="MLAKNFKGVALTQNQVSYLILFYEIHWSAY"
FT   gene            complement(891861..892322)
FT                   /locus_tag="LPC_2575"
FT   CDS_pept        complement(891861..892322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2575"
FT                   /product="hypothetical protein conserved within
FT                   Legionellae"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2575"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56490"
FT                   /protein_id="ABQ56490.1"
FT                   /translation="MKKILYVIPGILLITNSFALDIPGNITNSNKDLLPSPFPVYVIEG
FT                   SAVVNHPYPGAKKVLLPTDNGYVDYPGCYIACYSHNTGVYAISPTISVMGQIRVKGQYD
FT                   ARICQPDGYKNQDISAAYQFKQLCAEKIPACQNNSCWAGGDTGGWFGIQ"
FT   gene            complement(892411..893658)
FT                   /locus_tag="LPC_2574"
FT   CDS_pept        complement(892411..893658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2574"
FT                   /product="proton/sodium-glutamate symport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56489"
FT                   /protein_id="ABQ56489.1"
FT                   /translation="MVTQFNTLKSYIFPIILLLSILLGGLTGYVFNQNVAWLKPFGDIF
FT                   LNLIFTTIVPLIFFSVSSAIARTGSIGKLGKIFYSMTVIFLFTGIVAAVYALFVVLLFP
FT                   PAQNMPVLLESSKQLSPTNLPDRLIEIFTVPEFSKLFSHEHILALVLFSILVGLAVAHS
FT                   KDKGTIFNSFLKAGEDVFMSVFRLIMYYAPIGFFAYFAVIVSEIGPQLMENYLRIAILY
FT                   YTASVFYFFFALTAYAYLAGKSQGVRLFWGNIFLPAATSIATCSSAASIPANLMATKSM
FT                   RIPAEIYETSIPLGSIIHKDGSVMGGVFKIAFLFGIFHLPFTSLPVLMMALGVSLLVGT
FT                   VMGAIPSGGMLGELLILSVYGFPPSVLIAVAAISIIIDPIATMVNVTSNSVCSMMIARL
FT                   VEGKNWFLRSSDENNL"
FT   gene            complement(893780..896545)
FT                   /gene="valS"
FT                   /locus_tag="LPC_2573"
FT   CDS_pept        complement(893780..896545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="LPC_2573"
FT                   /product="valyl tRNA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56488"
FT                   /protein_id="ABQ56488.1"
FT                   /translation="MDKTYSPEAIEKALYKKWESHHYFQPRGEGKRFCIMLPPPNVTGS
FT                   LHMGHGFQHTIMDALTRYHRMLGDKTLWQPGTDHAGISTQLVVERQLEAQGISRKDLTR
FT                   EQFLDKVWQWKEESGNTITQQMRRLGASVDWSRERFTMDEGLSAAVQKVFVQLYEEGLI
FT                   YRGTRLVNWDPKLGTAVSDLEVLSEEEDGFLWHIRYPVVDSEEFLIVATTRPETLLGDC
FT                   AVAVHPDDSRFRHLIGKQVHLPLCDRTIPVIADDYVDKEFGSGCVKITPAHDFNDHEVG
FT                   KRHQLPQINILTKKGTINKNAPLKYQGMDRFVAREQIIKDLEQEGLLAKTEPHKLKVPR
FT                   GEKSNVIIEPLLTDQWYVKTKPLAEPAIAAVKKGDIRFIPETWDKTYFQWMDNIEDWCI
FT                   SRQLWWGHRIPAWYDNHGNIYVGYSENDVRFKHKIDQSTPLKQDEDVLDTWFSSALWPF
FT                   STLGWPERTPELEQFYPTSVLVTGFDIIFFWVARMIMMGLKFTGKIPFKEVFITGLIRD
FT                   SEGHKMSKSKGNVLDPLDIVDGIDLDSLIAKRTSNLMLNSVRDRITKATRKEFPEGISA
FT                   YGTDALRFTYCSLASTGRNVRFDLGRVEGYRNFCNKLWNAARYVLLNTDEEQIDFGDGA
FT                   FQYSPADQWILSRLQNTVSKVHHYFETYRFDLLANTLYEFVWHEYCDWYLELSKPILQD
FT                   EQALSAMKRGTRRTLIHVLDQILKLLHPLMPFITEEIWQKTTKFTSENGISIMLSTYPK
FT                   VNEEFINPAIEEELDWLKSAIQSLRTIRSEMSISPAKLIPLYIRNITPELKERIAKYEK
FT                   ILKTLSKIDKINYLAPDEKVPVSATAVLGEIELLIPMADLIDKEAELSRLNKELAKLNK
FT                   DIELAQGKLNNPKFTDKAPEEIIAKEKDKLAQAQLAKDKLLQHKNRIESL"
FT   gene            complement(896801..899707)
FT                   /locus_tag="LPC_2572"
FT   CDS_pept        complement(896801..899707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2572"
FT                   /product="multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56487"
FT                   /protein_id="ABQ56487.1"
FT                   /translation="MTGYPGADAELIAGFITTPLESAVASAEGIDYMTSSSQQGLSTIT
FT                   LNIKLNFDPQIAFTDVMSKVQQTLNQLPKESQQPVILKKSDSSTALMYISLDSKDMTPQ
FT                   QITDYATRVVQPQLQTVDGVAKADILGGQTYSMRIFMDPIKMAALNVTPADVSSVLASN
FT                   NFLTAAGSTKSEYVAINVTAKTDLNNVGEFERLIVKSDKGSIIRLRDIAKVELGSQNYD
FT                   SSVTFNSKKAVFISITPTPTANPLTVINDARKLFPSIVREFPPSLTGTIVYDATAFIRA
FT                   SIHEVMETIIEAAVIVIIVIFLFLGSVRSVLIPVVTIPLSLVGVCTLMLILGYSINLLT
FT                   LLAFVLAIGLVVDDAIVVVENVHRHLEEGKTPFESAIIGAREIATPVIAMTITLAAVYA
FT                   PIGFMSGLTGALFKEFAFTLASAVIISGVIALTLSPMMCSKILSEEATSGKFAIFLDEF
FT                   FNKLKRVYQNALHSILDTREIMLLLAGVVILMLPYLYSNTAAETAPDEDQGFFFVLATA
FT                   PQYATLNYIEAFTKPFDAIYKSFPETENYFTVNTSQPISGMVLKPWDQRKKSQFALKQP
FT                   LQNKLSKIAGLNALAIVPPPLPGGGGGPAVQFVVKTTNDFQSLMDVSNQLTEKARNSGL
FT                   FIYIDNSLKFNQPQVEFSINRAKASEMGLDMRALGSTLTSALSNNYINYFNLEGRSYQV
FT                   IPQLARKFRLTIEQIGQIYVKTLNGTMVPLSTVITPTEKTQPNAATHFQQLNSATIQAV
FT                   MMPGKTLGQGLEFLQKAAQEVLPKGFTYDYGGQSRQFMQEGSALIFAFLFAIIVIFLVL
FT                   AAQYESFRDPLIVLISVPMSICGALIPLNLGAATINIYTQVGLITLIGLISKHGILIVD
FT                   FANHLQREKNLDKRAAVEEAAGIRLRPILMTTAAMVFGVIPLLIASGAGAASRFDIGLV
FT                   ISTGLLIGTCFTLFVVPTLYTYLAEDHRHKPNEPAEIQ"
FT   gene            complement(899965..901227)
FT                   /gene="acrA"
FT                   /locus_tag="LPC_2571"
FT   CDS_pept        complement(899965..901227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="LPC_2571"
FT                   /product="RND efflux membrane fusion protein, acriflavin
FT                   resistance protein E"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56486"
FT                   /protein_id="ABQ56486.1"
FT                   /translation="MNKRLTIMGIILLVVFGGIIAFNLIKAYMIKQFFASYAPPAVTVS
FT                   SAVAQAVDWKPTIDAVGNFVAINGVDVNSEASGNVVQIHFESGQYVEKDEPLITIDDSI
FT                   DQALLKFNQSELTLKELSYKRQTDLFKRGATPSSSVDEAKANLQQAQAKVEQIQAQIKQ
FT                   KHIGAPFSGRLGIRQVNLGQYVTPGQTSIVSLQSLDPLYLEFYLPEQYYKRIHLNQPVT
FT                   FRVEEFPNILFEGVIHAVNSKVDLTTHNVQVQALLPNCPADAIQDPTKSPLIKVRKQVR
FT                   GDKLIVSCSTELNKQNKIRNFVFIPGMFASIEVDQPAEPDTIIVPSTAISYSLYGNAVY
FT                   IIEKSKEGKKNKDGTDQLVVNRVFVTTGEQQGNYTVIKKGIKVGQLVVSTGDLKLQNGT
FT                   PVVINNSVKLDTDSDPNQLGQ"
FT   gene            901468..901872
FT                   /locus_tag="LPC_2570"
FT   CDS_pept        901468..901872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56485"
FT                   /protein_id="ABQ56485.1"
FT                   /translation="MKLKSLLFVVCFSLFSNVFAANLHLHPKADNADKKSIQKSVTYPG
FT                   YCQIEIINQSFTDVRVFGTFDDGTTIDFNIYRYESPHYISLFYNFYCHSGMYITITSPY
FT                   YTIYSGWTNVNSTIRVVPYLKEAKAELSTR"
FT   gene            901938..902375
FT                   /locus_tag="LPC_2569"
FT   CDS_pept        901938..902375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56484"
FT                   /protein_id="ABQ56484.1"
FT                   /translation="MKYLIPCVVLFPLLSSCTVIQEDFYQPEYLGPAPRVEVTPSYPQG
FT                   HYHRHYNQRYHSNNRYYSAPRGQVHYEHAKTQGHAAVVTPPPSQARVEVQKNVHGHNAN
FT                   NGQVHGHAHDNGNVHSHPDSSNVHGHDTSNPEEQKKIHGHS"
FT   gene            902500..902811
FT                   /locus_tag="LPC_2568"
FT   CDS_pept        902500..902811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LPC_2568"
FT                   /product="hypothetical periplasmic or secreted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LPC_2568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ56483"
FT