(data stored in ACNUC7421 zone)

EMBL: CP000680

ID   CP000680; SV 1; circular; genomic DNA; STD; PRO; 5072807 BP.
XX
AC   CP000680; AAUL01000000-AAUL01000028;
XX
PR   Project:PRJNA17457;
XX
DT   21-APR-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Pseudomonas mendocina ymp, complete genome.
XX
KW   .
XX
OS   Pseudomonas mendocina ymp
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-5072807
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Kiss H., Brettin T., Detter J.C., Bruce D., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Hersman L., Dubois J., Maurice P., Richardson P.;
RT   "Complete sequence of Pseudomonas mendocina ymp";
RL   Unpublished.
XX
RN   [2]
RP   1-5072807
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Kiss H., Brettin T., Detter J.C., Bruce D., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Hersman L., Dubois J., Maurice P., Richardson P.;
RT   ;
RL   Submitted (17-APR-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 52c81fde5e2e78d902952e1d72f9e64d.
DR   BioSample; SAMN02598392.
DR   EnsemblGenomes-Gn; EBG00001087221.
DR   EnsemblGenomes-Gn; EBG00001087222.
DR   EnsemblGenomes-Gn; EBG00001087223.
DR   EnsemblGenomes-Gn; EBG00001087224.
DR   EnsemblGenomes-Gn; EBG00001087225.
DR   EnsemblGenomes-Gn; EBG00001087226.
DR   EnsemblGenomes-Gn; EBG00001087227.
DR   EnsemblGenomes-Gn; EBG00001087228.
DR   EnsemblGenomes-Gn; EBG00001087229.
DR   EnsemblGenomes-Gn; EBG00001087230.
DR   EnsemblGenomes-Gn; EBG00001087231.
DR   EnsemblGenomes-Gn; EBG00001087232.
DR   EnsemblGenomes-Gn; EBG00001087233.
DR   EnsemblGenomes-Gn; EBG00001087234.
DR   EnsemblGenomes-Gn; EBG00001087235.
DR   EnsemblGenomes-Gn; EBG00001087236.
DR   EnsemblGenomes-Gn; EBG00001087237.
DR   EnsemblGenomes-Gn; EBG00001087238.
DR   EnsemblGenomes-Gn; EBG00001087239.
DR   EnsemblGenomes-Gn; EBG00001087240.
DR   EnsemblGenomes-Gn; EBG00001087241.
DR   EnsemblGenomes-Gn; EBG00001087242.
DR   EnsemblGenomes-Gn; EBG00001087243.
DR   EnsemblGenomes-Gn; EBG00001087244.
DR   EnsemblGenomes-Gn; EBG00001087245.
DR   EnsemblGenomes-Gn; EBG00001087246.
DR   EnsemblGenomes-Gn; EBG00001087247.
DR   EnsemblGenomes-Gn; EBG00001087248.
DR   EnsemblGenomes-Gn; EBG00001087249.
DR   EnsemblGenomes-Gn; EBG00001087250.
DR   EnsemblGenomes-Gn; EBG00001087251.
DR   EnsemblGenomes-Gn; EBG00001087252.
DR   EnsemblGenomes-Gn; EBG00001087253.
DR   EnsemblGenomes-Gn; EBG00001087254.
DR   EnsemblGenomes-Gn; EBG00001087255.
DR   EnsemblGenomes-Gn; EBG00001087256.
DR   EnsemblGenomes-Gn; EBG00001087257.
DR   EnsemblGenomes-Gn; EBG00001087258.
DR   EnsemblGenomes-Gn; EBG00001087259.
DR   EnsemblGenomes-Gn; EBG00001087260.
DR   EnsemblGenomes-Gn; EBG00001087261.
DR   EnsemblGenomes-Gn; EBG00001087262.
DR   EnsemblGenomes-Gn; EBG00001087263.
DR   EnsemblGenomes-Gn; EBG00001087264.
DR   EnsemblGenomes-Gn; EBG00001087265.
DR   EnsemblGenomes-Gn; EBG00001087266.
DR   EnsemblGenomes-Gn; EBG00001087267.
DR   EnsemblGenomes-Gn; EBG00001087268.
DR   EnsemblGenomes-Gn; EBG00001087269.
DR   EnsemblGenomes-Gn; EBG00001087270.
DR   EnsemblGenomes-Gn; EBG00001087271.
DR   EnsemblGenomes-Gn; EBG00001087272.
DR   EnsemblGenomes-Gn; EBG00001087273.
DR   EnsemblGenomes-Gn; EBG00001087274.
DR   EnsemblGenomes-Gn; EBG00001087275.
DR   EnsemblGenomes-Gn; EBG00001087276.
DR   EnsemblGenomes-Gn; EBG00001087277.
DR   EnsemblGenomes-Gn; EBG00001087278.
DR   EnsemblGenomes-Gn; EBG00001087279.
DR   EnsemblGenomes-Gn; EBG00001087280.
DR   EnsemblGenomes-Gn; EBG00001087281.
DR   EnsemblGenomes-Gn; EBG00001087282.
DR   EnsemblGenomes-Gn; EBG00001087283.
DR   EnsemblGenomes-Gn; EBG00001087284.
DR   EnsemblGenomes-Gn; EBG00001087285.
DR   EnsemblGenomes-Gn; EBG00001087286.
DR   EnsemblGenomes-Gn; EBG00001087287.
DR   EnsemblGenomes-Gn; EBG00001087288.
DR   EnsemblGenomes-Gn; EBG00001087289.
DR   EnsemblGenomes-Gn; EBG00001087290.
DR   EnsemblGenomes-Gn; EBG00001087291.
DR   EnsemblGenomes-Gn; EBG00001087292.
DR   EnsemblGenomes-Gn; EBG00001087293.
DR   EnsemblGenomes-Gn; EBG00001087294.
DR   EnsemblGenomes-Gn; EBG00001087295.
DR   EnsemblGenomes-Gn; EBG00001087296.
DR   EnsemblGenomes-Gn; EBG00001087297.
DR   EnsemblGenomes-Gn; EBG00001087298.
DR   EnsemblGenomes-Gn; EBG00001087299.
DR   EnsemblGenomes-Gn; EBG00001087300.
DR   EnsemblGenomes-Gn; EBG00001087301.
DR   EnsemblGenomes-Gn; EBG00001087302.
DR   EnsemblGenomes-Gn; EBG00001087303.
DR   EnsemblGenomes-Gn; EBG00001087304.
DR   EnsemblGenomes-Gn; EBG00001087305.
DR   EnsemblGenomes-Gn; EBG00001087306.
DR   EnsemblGenomes-Gn; EBG00001087307.
DR   EnsemblGenomes-Gn; EBG00001087308.
DR   EnsemblGenomes-Gn; EBG00001087309.
DR   EnsemblGenomes-Gn; EBG00001087310.
DR   EnsemblGenomes-Gn; EBG00001087311.
DR   EnsemblGenomes-Gn; EBG00001087312.
DR   EnsemblGenomes-Gn; EBG00001087313.
DR   EnsemblGenomes-Gn; EBG00001087314.
DR   EnsemblGenomes-Gn; EBG00001087315.
DR   EnsemblGenomes-Gn; EBG00001087316.
DR   EnsemblGenomes-Gn; EBG00001087317.
DR   EnsemblGenomes-Gn; EBG00001087318.
DR   EnsemblGenomes-Gn; EBG00001087319.
DR   EnsemblGenomes-Gn; EBG00001087320.
DR   EnsemblGenomes-Gn; EBG00001087321.
DR   EnsemblGenomes-Gn; EBG00001087322.
DR   EnsemblGenomes-Gn; EBG00001087323.
DR   EnsemblGenomes-Gn; EBG00001087324.
DR   EnsemblGenomes-Gn; EBG00001087325.
DR   EnsemblGenomes-Gn; EBG00001087326.
DR   EnsemblGenomes-Gn; EBG00001087327.
DR   EnsemblGenomes-Gn; EBG00001087328.
DR   EnsemblGenomes-Gn; EBG00001087329.
DR   EnsemblGenomes-Gn; EBG00001087330.
DR   EnsemblGenomes-Gn; EBG00001087331.
DR   EnsemblGenomes-Gn; EBG00001087332.
DR   EnsemblGenomes-Gn; EBG00001087333.
DR   EnsemblGenomes-Gn; EBG00001087334.
DR   EnsemblGenomes-Gn; EBG00001087335.
DR   EnsemblGenomes-Gn; EBG00001087336.
DR   EnsemblGenomes-Gn; EBG00001087337.
DR   EnsemblGenomes-Gn; EBG00001087338.
DR   EnsemblGenomes-Gn; EBG00001087339.
DR   EnsemblGenomes-Gn; Pmen_R0001.
DR   EnsemblGenomes-Gn; Pmen_R0002.
DR   EnsemblGenomes-Gn; Pmen_R0003.
DR   EnsemblGenomes-Gn; Pmen_R0004.
DR   EnsemblGenomes-Gn; Pmen_R0005.
DR   EnsemblGenomes-Gn; Pmen_R0006.
DR   EnsemblGenomes-Gn; Pmen_R0008.
DR   EnsemblGenomes-Gn; Pmen_R0009.
DR   EnsemblGenomes-Gn; Pmen_R0010.
DR   EnsemblGenomes-Gn; Pmen_R0011.
DR   EnsemblGenomes-Gn; Pmen_R0012.
DR   EnsemblGenomes-Gn; Pmen_R0013.
DR   EnsemblGenomes-Gn; Pmen_R0014.
DR   EnsemblGenomes-Gn; Pmen_R0015.
DR   EnsemblGenomes-Gn; Pmen_R0016.
DR   EnsemblGenomes-Gn; Pmen_R0017.
DR   EnsemblGenomes-Gn; Pmen_R0018.
DR   EnsemblGenomes-Gn; Pmen_R0019.
DR   EnsemblGenomes-Gn; Pmen_R0020.
DR   EnsemblGenomes-Gn; Pmen_R0021.
DR   EnsemblGenomes-Gn; Pmen_R0022.
DR   EnsemblGenomes-Gn; Pmen_R0023.
DR   EnsemblGenomes-Gn; Pmen_R0024.
DR   EnsemblGenomes-Gn; Pmen_R0025.
DR   EnsemblGenomes-Gn; Pmen_R0026.
DR   EnsemblGenomes-Gn; Pmen_R0027.
DR   EnsemblGenomes-Gn; Pmen_R0028.
DR   EnsemblGenomes-Gn; Pmen_R0029.
DR   EnsemblGenomes-Gn; Pmen_R0030.
DR   EnsemblGenomes-Gn; Pmen_R0031.
DR   EnsemblGenomes-Gn; Pmen_R0032.
DR   EnsemblGenomes-Gn; Pmen_R0033.
DR   EnsemblGenomes-Gn; Pmen_R0034.
DR   EnsemblGenomes-Gn; Pmen_R0035.
DR   EnsemblGenomes-Gn; Pmen_R0036.
DR   EnsemblGenomes-Gn; Pmen_R0037.
DR   EnsemblGenomes-Gn; Pmen_R0038.
DR   EnsemblGenomes-Gn; Pmen_R0039.
DR   EnsemblGenomes-Gn; Pmen_R0040.
DR   EnsemblGenomes-Gn; Pmen_R0041.
DR   EnsemblGenomes-Gn; Pmen_R0042.
DR   EnsemblGenomes-Gn; Pmen_R0043.
DR   EnsemblGenomes-Gn; Pmen_R0044.
DR   EnsemblGenomes-Gn; Pmen_R0045.
DR   EnsemblGenomes-Gn; Pmen_R0046.
DR   EnsemblGenomes-Gn; Pmen_R0048.
DR   EnsemblGenomes-Gn; Pmen_R0049.
DR   EnsemblGenomes-Gn; Pmen_R0050.
DR   EnsemblGenomes-Gn; Pmen_R0051.
DR   EnsemblGenomes-Gn; Pmen_R0052.
DR   EnsemblGenomes-Gn; Pmen_R0053.
DR   EnsemblGenomes-Gn; Pmen_R0054.
DR   EnsemblGenomes-Gn; Pmen_R0055.
DR   EnsemblGenomes-Gn; Pmen_R0056.
DR   EnsemblGenomes-Gn; Pmen_R0057.
DR   EnsemblGenomes-Gn; Pmen_R0058.
DR   EnsemblGenomes-Gn; Pmen_R0059.
DR   EnsemblGenomes-Gn; Pmen_R0060.
DR   EnsemblGenomes-Gn; Pmen_R0061.
DR   EnsemblGenomes-Gn; Pmen_R0062.
DR   EnsemblGenomes-Gn; Pmen_R0063.
DR   EnsemblGenomes-Gn; Pmen_R0064.
DR   EnsemblGenomes-Gn; Pmen_R0065.
DR   EnsemblGenomes-Gn; Pmen_R0066.
DR   EnsemblGenomes-Gn; Pmen_R0067.
DR   EnsemblGenomes-Gn; Pmen_R0068.
DR   EnsemblGenomes-Gn; Pmen_R0069.
DR   EnsemblGenomes-Gn; Pmen_R0070.
DR   EnsemblGenomes-Gn; Pmen_R0071.
DR   EnsemblGenomes-Gn; Pmen_R0072.
DR   EnsemblGenomes-Gn; Pmen_R0073.
DR   EnsemblGenomes-Gn; Pmen_R0074.
DR   EnsemblGenomes-Gn; Pmen_R0075.
DR   EnsemblGenomes-Gn; Pmen_R0076.
DR   EnsemblGenomes-Gn; Pmen_R0077.
DR   EnsemblGenomes-Gn; Pmen_R0078.
DR   EnsemblGenomes-Gn; Pmen_R0079.
DR   EnsemblGenomes-Gn; Pmen_R0080.
DR   EnsemblGenomes-Gn; Pmen_R0081.
DR   EnsemblGenomes-Gn; Pmen_R0082.
DR   EnsemblGenomes-Tr; EBT00001689171.
DR   EnsemblGenomes-Tr; EBT00001689172.
DR   EnsemblGenomes-Tr; EBT00001689173.
DR   EnsemblGenomes-Tr; EBT00001689174.
DR   EnsemblGenomes-Tr; EBT00001689175.
DR   EnsemblGenomes-Tr; EBT00001689176.
DR   EnsemblGenomes-Tr; EBT00001689177.
DR   EnsemblGenomes-Tr; EBT00001689178.
DR   EnsemblGenomes-Tr; EBT00001689179.
DR   EnsemblGenomes-Tr; EBT00001689180.
DR   EnsemblGenomes-Tr; EBT00001689181.
DR   EnsemblGenomes-Tr; EBT00001689182.
DR   EnsemblGenomes-Tr; EBT00001689183.
DR   EnsemblGenomes-Tr; EBT00001689184.
DR   EnsemblGenomes-Tr; EBT00001689185.
DR   EnsemblGenomes-Tr; EBT00001689186.
DR   EnsemblGenomes-Tr; EBT00001689187.
DR   EnsemblGenomes-Tr; EBT00001689188.
DR   EnsemblGenomes-Tr; EBT00001689189.
DR   EnsemblGenomes-Tr; EBT00001689190.
DR   EnsemblGenomes-Tr; EBT00001689191.
DR   EnsemblGenomes-Tr; EBT00001689192.
DR   EnsemblGenomes-Tr; EBT00001689193.
DR   EnsemblGenomes-Tr; EBT00001689194.
DR   EnsemblGenomes-Tr; EBT00001689195.
DR   EnsemblGenomes-Tr; EBT00001689196.
DR   EnsemblGenomes-Tr; EBT00001689197.
DR   EnsemblGenomes-Tr; EBT00001689198.
DR   EnsemblGenomes-Tr; EBT00001689199.
DR   EnsemblGenomes-Tr; EBT00001689200.
DR   EnsemblGenomes-Tr; EBT00001689201.
DR   EnsemblGenomes-Tr; EBT00001689202.
DR   EnsemblGenomes-Tr; EBT00001689203.
DR   EnsemblGenomes-Tr; EBT00001689204.
DR   EnsemblGenomes-Tr; EBT00001689205.
DR   EnsemblGenomes-Tr; EBT00001689206.
DR   EnsemblGenomes-Tr; EBT00001689207.
DR   EnsemblGenomes-Tr; EBT00001689208.
DR   EnsemblGenomes-Tr; EBT00001689209.
DR   EnsemblGenomes-Tr; EBT00001689210.
DR   EnsemblGenomes-Tr; EBT00001689211.
DR   EnsemblGenomes-Tr; EBT00001689212.
DR   EnsemblGenomes-Tr; EBT00001689213.
DR   EnsemblGenomes-Tr; EBT00001689214.
DR   EnsemblGenomes-Tr; EBT00001689215.
DR   EnsemblGenomes-Tr; EBT00001689216.
DR   EnsemblGenomes-Tr; EBT00001689217.
DR   EnsemblGenomes-Tr; EBT00001689218.
DR   EnsemblGenomes-Tr; EBT00001689219.
DR   EnsemblGenomes-Tr; EBT00001689220.
DR   EnsemblGenomes-Tr; EBT00001689221.
DR   EnsemblGenomes-Tr; EBT00001689222.
DR   EnsemblGenomes-Tr; EBT00001689223.
DR   EnsemblGenomes-Tr; EBT00001689224.
DR   EnsemblGenomes-Tr; EBT00001689225.
DR   EnsemblGenomes-Tr; EBT00001689226.
DR   EnsemblGenomes-Tr; EBT00001689227.
DR   EnsemblGenomes-Tr; EBT00001689228.
DR   EnsemblGenomes-Tr; EBT00001689229.
DR   EnsemblGenomes-Tr; EBT00001689230.
DR   EnsemblGenomes-Tr; EBT00001689231.
DR   EnsemblGenomes-Tr; EBT00001689232.
DR   EnsemblGenomes-Tr; EBT00001689233.
DR   EnsemblGenomes-Tr; EBT00001689234.
DR   EnsemblGenomes-Tr; EBT00001689235.
DR   EnsemblGenomes-Tr; EBT00001689236.
DR   EnsemblGenomes-Tr; EBT00001689237.
DR   EnsemblGenomes-Tr; EBT00001689238.
DR   EnsemblGenomes-Tr; EBT00001689239.
DR   EnsemblGenomes-Tr; EBT00001689240.
DR   EnsemblGenomes-Tr; EBT00001689241.
DR   EnsemblGenomes-Tr; EBT00001689242.
DR   EnsemblGenomes-Tr; EBT00001689243.
DR   EnsemblGenomes-Tr; EBT00001689244.
DR   EnsemblGenomes-Tr; EBT00001689245.
DR   EnsemblGenomes-Tr; EBT00001689246.
DR   EnsemblGenomes-Tr; EBT00001689247.
DR   EnsemblGenomes-Tr; EBT00001689248.
DR   EnsemblGenomes-Tr; EBT00001689250.
DR   EnsemblGenomes-Tr; EBT00001689252.
DR   EnsemblGenomes-Tr; EBT00001689253.
DR   EnsemblGenomes-Tr; EBT00001689255.
DR   EnsemblGenomes-Tr; EBT00001689256.
DR   EnsemblGenomes-Tr; EBT00001689258.
DR   EnsemblGenomes-Tr; EBT00001689259.
DR   EnsemblGenomes-Tr; EBT00001689261.
DR   EnsemblGenomes-Tr; EBT00001689262.
DR   EnsemblGenomes-Tr; EBT00001689264.
DR   EnsemblGenomes-Tr; EBT00001689265.
DR   EnsemblGenomes-Tr; EBT00001689267.
DR   EnsemblGenomes-Tr; EBT00001689268.
DR   EnsemblGenomes-Tr; EBT00001689270.
DR   EnsemblGenomes-Tr; EBT00001689271.
DR   EnsemblGenomes-Tr; EBT00001689273.
DR   EnsemblGenomes-Tr; EBT00001689274.
DR   EnsemblGenomes-Tr; EBT00001689275.
DR   EnsemblGenomes-Tr; EBT00001689277.
DR   EnsemblGenomes-Tr; EBT00001689279.
DR   EnsemblGenomes-Tr; EBT00001689280.
DR   EnsemblGenomes-Tr; EBT00001689281.
DR   EnsemblGenomes-Tr; EBT00001689283.
DR   EnsemblGenomes-Tr; EBT00001689285.
DR   EnsemblGenomes-Tr; EBT00001689286.
DR   EnsemblGenomes-Tr; EBT00001689288.
DR   EnsemblGenomes-Tr; EBT00001689289.
DR   EnsemblGenomes-Tr; EBT00001689291.
DR   EnsemblGenomes-Tr; EBT00001689292.
DR   EnsemblGenomes-Tr; EBT00001689294.
DR   EnsemblGenomes-Tr; EBT00001689295.
DR   EnsemblGenomes-Tr; EBT00001689297.
DR   EnsemblGenomes-Tr; EBT00001689300.
DR   EnsemblGenomes-Tr; EBT00001689301.
DR   EnsemblGenomes-Tr; EBT00001689303.
DR   EnsemblGenomes-Tr; EBT00001689304.
DR   EnsemblGenomes-Tr; EBT00001689306.
DR   EnsemblGenomes-Tr; EBT00001689307.
DR   EnsemblGenomes-Tr; EBT00001689308.
DR   EnsemblGenomes-Tr; EBT00001689310.
DR   EnsemblGenomes-Tr; EBT00001689311.
DR   EnsemblGenomes-Tr; Pmen_R0001-1.
DR   EnsemblGenomes-Tr; Pmen_R0002-1.
DR   EnsemblGenomes-Tr; Pmen_R0003-1.
DR   EnsemblGenomes-Tr; Pmen_R0004-1.
DR   EnsemblGenomes-Tr; Pmen_R0005-1.
DR   EnsemblGenomes-Tr; Pmen_R0006-1.
DR   EnsemblGenomes-Tr; Pmen_R0008-1.
DR   EnsemblGenomes-Tr; Pmen_R0009-1.
DR   EnsemblGenomes-Tr; Pmen_R0010-1.
DR   EnsemblGenomes-Tr; Pmen_R0011-1.
DR   EnsemblGenomes-Tr; Pmen_R0012-1.
DR   EnsemblGenomes-Tr; Pmen_R0013-1.
DR   EnsemblGenomes-Tr; Pmen_R0014-1.
DR   EnsemblGenomes-Tr; Pmen_R0015-1.
DR   EnsemblGenomes-Tr; Pmen_R0016-1.
DR   EnsemblGenomes-Tr; Pmen_R0017-1.
DR   EnsemblGenomes-Tr; Pmen_R0018-1.
DR   EnsemblGenomes-Tr; Pmen_R0019-1.
DR   EnsemblGenomes-Tr; Pmen_R0020-1.
DR   EnsemblGenomes-Tr; Pmen_R0021-1.
DR   EnsemblGenomes-Tr; Pmen_R0022-1.
DR   EnsemblGenomes-Tr; Pmen_R0023-1.
DR   EnsemblGenomes-Tr; Pmen_R0024-1.
DR   EnsemblGenomes-Tr; Pmen_R0025-1.
DR   EnsemblGenomes-Tr; Pmen_R0026-1.
DR   EnsemblGenomes-Tr; Pmen_R0027-1.
DR   EnsemblGenomes-Tr; Pmen_R0028-1.
DR   EnsemblGenomes-Tr; Pmen_R0029-1.
DR   EnsemblGenomes-Tr; Pmen_R0030-1.
DR   EnsemblGenomes-Tr; Pmen_R0031-1.
DR   EnsemblGenomes-Tr; Pmen_R0032-1.
DR   EnsemblGenomes-Tr; Pmen_R0033-1.
DR   EnsemblGenomes-Tr; Pmen_R0034-1.
DR   EnsemblGenomes-Tr; Pmen_R0035-1.
DR   EnsemblGenomes-Tr; Pmen_R0036-1.
DR   EnsemblGenomes-Tr; Pmen_R0037-1.
DR   EnsemblGenomes-Tr; Pmen_R0038-1.
DR   EnsemblGenomes-Tr; Pmen_R0039-1.
DR   EnsemblGenomes-Tr; Pmen_R0040-1.
DR   EnsemblGenomes-Tr; Pmen_R0041-1.
DR   EnsemblGenomes-Tr; Pmen_R0042-1.
DR   EnsemblGenomes-Tr; Pmen_R0043-1.
DR   EnsemblGenomes-Tr; Pmen_R0044-1.
DR   EnsemblGenomes-Tr; Pmen_R0045-1.
DR   EnsemblGenomes-Tr; Pmen_R0046-1.
DR   EnsemblGenomes-Tr; Pmen_R0048-1.
DR   EnsemblGenomes-Tr; Pmen_R0049-1.
DR   EnsemblGenomes-Tr; Pmen_R0050-1.
DR   EnsemblGenomes-Tr; Pmen_R0051-1.
DR   EnsemblGenomes-Tr; Pmen_R0052-1.
DR   EnsemblGenomes-Tr; Pmen_R0053-1.
DR   EnsemblGenomes-Tr; Pmen_R0054-1.
DR   EnsemblGenomes-Tr; Pmen_R0055-1.
DR   EnsemblGenomes-Tr; Pmen_R0056-1.
DR   EnsemblGenomes-Tr; Pmen_R0057-1.
DR   EnsemblGenomes-Tr; Pmen_R0058-1.
DR   EnsemblGenomes-Tr; Pmen_R0059-1.
DR   EnsemblGenomes-Tr; Pmen_R0060-1.
DR   EnsemblGenomes-Tr; Pmen_R0061-1.
DR   EnsemblGenomes-Tr; Pmen_R0062-1.
DR   EnsemblGenomes-Tr; Pmen_R0063-1.
DR   EnsemblGenomes-Tr; Pmen_R0064-1.
DR   EnsemblGenomes-Tr; Pmen_R0065-1.
DR   EnsemblGenomes-Tr; Pmen_R0066-1.
DR   EnsemblGenomes-Tr; Pmen_R0067-1.
DR   EnsemblGenomes-Tr; Pmen_R0068-1.
DR   EnsemblGenomes-Tr; Pmen_R0069-1.
DR   EnsemblGenomes-Tr; Pmen_R0070-1.
DR   EnsemblGenomes-Tr; Pmen_R0071-1.
DR   EnsemblGenomes-Tr; Pmen_R0072-1.
DR   EnsemblGenomes-Tr; Pmen_R0073-1.
DR   EnsemblGenomes-Tr; Pmen_R0074-1.
DR   EnsemblGenomes-Tr; Pmen_R0075-1.
DR   EnsemblGenomes-Tr; Pmen_R0076-1.
DR   EnsemblGenomes-Tr; Pmen_R0077-1.
DR   EnsemblGenomes-Tr; Pmen_R0078-1.
DR   EnsemblGenomes-Tr; Pmen_R0079-1.
DR   EnsemblGenomes-Tr; Pmen_R0080-1.
DR   EnsemblGenomes-Tr; Pmen_R0081-1.
DR   EnsemblGenomes-Tr; Pmen_R0082-1.
DR   EuropePMC; PMC3194850; 21856827.
DR   EuropePMC; PMC3807495; 23995634.
DR   EuropePMC; PMC4332470; 25705691.
DR   EuropePMC; PMC4888284; 27257541.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00625; P11.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01059; mir-598.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01668; P10.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01670; P17.
DR   RFAM; RF01671; P18.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01683; P6.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02144; rsmX.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000680.
DR   SILVA-SSU; CP000680.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002766
CC   Source DNA and bacteria available from Larry Hersman
CC   (hersman@lanl.gov)
CC   Contacts: Larry Hersman (hersman@lanl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5072807
FT                   /organism="Pseudomonas mendocina ymp"
FT                   /strain="ymp"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:399739"
FT   gene            82..1566
FT                   /locus_tag="Pmen_0001"
FT   CDS_pept        82..1566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82776"
FT                   /db_xref="GOA:A4XN60"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN60"
FT                   /protein_id="ABP82776.1"
FT                   /translation="MELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNRFV
FT                   LDWVNEKYLSRLLELLGERAGGLVPALSLLIGSKRAATARVAPTAPLPAAARAAQVQAA
FT                   ATASKPVPPPAQEEPSRASFDSMAGAAPQPPTPAVAPRAERTVQVEGGLKHTSYLNRTF
FT                   TFDNFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHAVGNHLLAKNPN
FT                   AKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQFFAKKERSQEEFFHTF
FT                   NALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETRVAILMKKADQA
FT                   KVELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDITIELIRESLKDLLALQDK
FT                   LVSIDNIQRTTAEYYKIKISDLLSKRRSRSIARPRQVAMALSKELTNHSLPEIGVAFGG
FT                   RDHTTVLHACRKIAELRESDADIREDYKNLLRTLTT"
FT   gene            1601..2704
FT                   /locus_tag="Pmen_0002"
FT   CDS_pept        1601..2704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82777"
FT                   /db_xref="GOA:A4XN61"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN61"
FT                   /protein_id="ABP82777.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVEGQQLSLT
FT                   GTDLEVELVGRVTLEDAAEPGEITVPARKLMDICKSLPSDALIDIRVDDQKLLVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLTFNLPQAKLRRLIERTSFAMAQQDVRYYLNGMLLEVQ
FT                   SGMLRAVATDGHRLAMCSMEAAIQQDGKHQVIVPRKGILELARLLTEQDAEVAIVLGQH
FT                   HIRANTGEFTFTSKLVDGKFPDYERVLPRGGDKLVLADRQGLREAFSRTAILSNEKYRG
FT                   IRLTLAAGLLKIQANNPEQEEAEEEIVVDYAGGGLEIGFNVSYLLDVLGVMGTEQVRLI
FT                   LSDSNSSALLQEADNDDSAYVVMPMRL"
FT   gene            2712..3815
FT                   /locus_tag="Pmen_0003"
FT   CDS_pept        2712..3815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82778"
FT                   /db_xref="GOA:A4XN62"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XN62"
FT                   /protein_id="ABP82778.1"
FT                   /translation="MSLSRIMVTAVRNLHPVTLSPSPRINILHGANGSGKTSVLEAIHL
FT                   LGLARSFRSTRLQPVIHYEQPACTVFGQVQLAEGGSSNLGISRDRQGELQIRIDGQNAR
FT                   SAAQLADLLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEHRFLGAWQRLQKALRQRN
FT                   SWLRHGTLDGASQAAWDRELCSASQEIDTYRRAYIQALKPVFERTLAELLQLEGLTLSY
FT                   YRGWDKDRELSEVLASSLLRDQQLGHTQAGPQRADLRLRLAGHNAAEILSRGQQKLVVC
FT                   ALRIAQGHLVNEAKRGQCIYLVDDLPSELDEQHRQALCRLLEDLHCQVFITCVDHELLR
FT                   EGWHTDTPVAMFHVEHGRITQTQDHRE"
FT   gene            3820..6240
FT                   /locus_tag="Pmen_0004"
FT   CDS_pept        3820..6240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase,
FT                   subunit B domain protein; ATP-binding region, ATPase domain
FT                   protein domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase, type IIA, subunit B, region 2 domain
FT                   protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82779"
FT                   /db_xref="GOA:A4XN63"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN63"
FT                   /protein_id="ABP82779.1"
FT                   /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGYCSEIVITIHPDESISVRDNGRGIPVDIHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNTYKVSGGLHGVGVSVVNALSEELRLTIRRAGKVWEQIYHHGVPQAPLATVGDTD
FT                   GTGTEIHFKASAETFSNIHFSWDILAKRLRELSFLNSGVGILLRDERSGKEELFKYEGG
FT                   LKAFVEYLNTNKNVVNQVFHFNIQREEDGVGVEVALQWNDSFNENILCFTNNIPQRDGG
FT                   THLAGFRSALTRHLNNYIEQEGLAKKFKVATTGDDAREGLTAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMGKYFADFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKTQAILPLKGKILNVEKA
FT                   RFDKMLSSAEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFF
FT                   RQLPELIERGYVYIAQPPLYKVKKGKQEQYIKDDEAMDEYMTQSALEDASLHVNENAPG
FT                   LSGGALEKLVGEYRGVMKTLDRLSRVYPKEITEHFVYLPRIGLEQLADHAGMQAWLEQF
FT                   SARLKTMEKSGQTYTASLREDRERHVWLPEVEVKAHGLSSYTTFNRDFFASNDYKTVTA
FT                   LGDQLNNLLEDSAYVQRGERKKPVATFKEALDWLMAESTKRHSIQRYKGLGEMNPDQLW
FT                   ETTMDPEVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNALAVSNLDF"
FT   gene            complement(6506..7438)
FT                   /locus_tag="Pmen_0005"
FT   CDS_pept        complement(6506..7438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0005"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82780"
FT                   /db_xref="GOA:A4XN64"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN64"
FT                   /protein_id="ABP82780.1"
FT                   /translation="MDRNTLLLFAGIGALLLLASLVGFVLKRRSGDQPNPVIDNLNARI
FT                   NAWWVMVLVIGIAFLFGNIGVVVLFYFVSFYALREFMTLTPTRRSDYPALVAAFYFALP
FT                   MQYLLIALDWYGLFAIFIPVYLFLLLPILASLGGDTTRYLERAAKAQWGLMIAVYCISS
FT                   VPALLTLDIPGYEGRNLLLIAWLIIVVQLSDVLQYVCGKLFGKHKIAPSLSPSKTVEGF
FT                   VGGVALATLIGGLLCWITPFAFWQAALFALLVCLLGFAGGLVMSAIKRDRGVKDWGHMI
FT                   EGHGGMLDRLDSVCFAAPVFFHMVRYWWA"
FT   sig_peptide     complement(7346..7438)
FT                   /locus_tag="Pmen_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.410 at
FT                   residue 31"
FT   gene            complement(7440..8063)
FT                   /locus_tag="Pmen_0006"
FT   CDS_pept        complement(7440..8063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0006"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82781"
FT                   /db_xref="GOA:A4XN65"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN65"
FT                   /protein_id="ABP82781.1"
FT                   /translation="MLAALTAFAITSAARLLTGARALWLGSTAQATQRLYYANHSSHGD
FT                   FVLLWASLPPELRKRTRPVAGADYWQKPGVRSFLINNVFNGVLVDRERKEAGVNPLQAM
FT                   LDALDGGDSLIIFPEGTRNLGDEPLLPFKSGLYHLAQARPEVELVPVWIANLNRVMPKG
FT                   RALPLPLLCTLSFGAALERIEGEGKEAFLERARNALLALAPEEA"
FT   sig_peptide     complement(7968..8063)
FT                   /locus_tag="Pmen_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.722) with cleavage site probability 0.294 at
FT                   residue 32"
FT   gene            complement(8073..8507)
FT                   /locus_tag="Pmen_0007"
FT   CDS_pept        complement(8073..8507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82782"
FT                   /db_xref="GOA:A4XN66"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN66"
FT                   /protein_id="ABP82782.1"
FT                   /translation="MQADLLLVAALLRRGRSLDHFSSALSLVAVIFGLAPWLGAPPSLM
FT                   LALLCAALLILGLAEKYWALRVALDAELFQRLAEAGEQLDGQTHALDQARQKLGLQNAQ
FT                   LAGRDWSLRAQGALGLLRKQALCLLLQSVIVVLGFFIVFA"
FT   gene            complement(8497..9834)
FT                   /locus_tag="Pmen_0008"
FT   CDS_pept        complement(8497..9834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0008"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; Dual
FT                   specificity protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82783"
FT                   /db_xref="GOA:A4XN67"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN67"
FT                   /protein_id="ABP82783.1"
FT                   /translation="MDNTREQGLWKRGVLWLLLLGPLFFASYGFANWLTGQRDDVGSLV
FT                   FAWEPQIPLWPWTIVPYWSIDLLYGLSFLLPACRREMDRHALRLLAAQVICVACFLLWP
FT                   LRFTFERPPLDGAFGLMFDVLMGFDKPFNQAPSLHITLLVIIWAMFANHTRGPFWRGLL
FT                   HGWMALIGISVLTTWQHHFIDLPTGALAGFFCLWLLPLQGATPLTQMRLTSDPRRWRLA
FT                   LRYGLGATLSAVLAVKLGGAWLWLFWPTVALAMVALNYLLFDAAGFQKQANGRLSPAAT
FT                   ALLAPYLLGAWINSRLWTYRQPMPSQVVEGIHLGRLPATGELGSYAAMVDLCAELPLLR
FT                   TPSAYCSLPSLDLVTPDALTCQRAAEAIERLRHEGPLLVCCALGYSRSATAVAAWLLHS
FT                   GRCQSVDAAVALIRQARPQVVLGPQHLAALQGMLVASPALEVAHAG"
FT   sig_peptide     complement(9739..9834)
FT                   /locus_tag="Pmen_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.984 at
FT                   residue 32"
FT   gene            complement(9834..11588)
FT                   /locus_tag="Pmen_0009"
FT   CDS_pept        complement(9834..11588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0009"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82784"
FT                   /db_xref="GOA:A4XN68"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR022744"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN68"
FT                   /protein_id="ABP82784.1"
FT                   /translation="MRPVQLHTFTTHDGVELSYCHWPATVPADGSRQAVVLFHRGHEHG
FT                   GRMAHLVDELELPHCDFFAWDARGHGLSPGARGDSPSFATSVRDVQTFIEHIGSAHGIA
FT                   EEDLSVVAQSVGAVIVSTWAHDYAPKVRCLVLASPAFKVKLYVPFARPGLKLLHAWRGN
FT                   FFVNSYVKARFLSHDPERIASFENDSLIARPISVTMLLGLYEAAERVVADAQAIQVPTQ
FT                   LLISGADFVVHRKPQEDFFERLGSLRKEKHLLPGFFHDTLGERDRAHALSRARRFILRN
FT                   FEEPVTRPSLLDADRLGATCAEAEALAAPLPRNSLRDLYWRATRAGMRLGSTLSAGVKL
FT                   GFDTGFDSGSTLDYVYRNQPTGKGALGRLIDANYLDSIGWRGIRQRKLHAEELLRLAMT
FT                   RLRETGRAVRIVDIAAGHGRYILESLEGQQQRPDSILLRDYSDINVRDGNALIEQKGLA
FT                   DIARFVKGDAFDREDLAALEPKPTLAVVSGLYELFGSNQMVGDSLAGLAAAVEEGGYLV
FT                   YTGQPWHPQLELIARALTSHRDGQAWVMRRRSQAEMDQLVEAAGFRKVAQRIDQWGIFS
FT                   VSLAQRVK"
FT   gene            complement(11614..12219)
FT                   /locus_tag="Pmen_0010"
FT   CDS_pept        complement(11614..12219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0010"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82785"
FT                   /db_xref="GOA:A4XN69"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN69"
FT                   /protein_id="ABP82785.1"
FT                   /translation="MPSIYQLKPAFQNLLRPGVERLYARGVTANQVTLAAALISVLLGV
FT                   LLAAFSHVVWLFALIPLWMLLRMALNAVDGMLAREFGQQSKLGAYLNELCDVVADSALY
FT                   LPFALLPGVSPLLVVTVVLLAVISEYAGVLGPMIGASRRYDGPMGKSDRAFCFGVLGAG
FT                   VATGLLPALWINLLLALILVLLLYTLYNRVRQGLAEAA"
FT   gene            complement(12430..13197)
FT                   /locus_tag="Pmen_0011"
FT   CDS_pept        complement(12430..13197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0011"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82786"
FT                   /db_xref="GOA:A4XN70"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN70"
FT                   /protein_id="ABP82786.1"
FT                   /translation="MAILQALRITLFYLLLSSSSFFWCLISLVVAPFLPFRQRYRFVVQ
FT                   AWCSCAVWLARVIVGIRYEVRGLENIPERPCVILANHQSTWETFFLSSYFEPLSQVVKR
FT                   ELLRVPFFGWGMALLKPIAIDRSNPKAALKQLAKQGEERLKQGAWVLVFPEGTRIPPGQ
FT                   IGKFSRGGTSLAVNAGLPVLPIAHNAGEFWPKAGWGKRPGTIQVIIGQPMYAEGEGPRA
FT                   IAELNERAFQWVCRQQTELRGEEPQLSRLSEPV"
FT   gene            complement(13211..13741)
FT                   /locus_tag="Pmen_0012"
FT   CDS_pept        complement(13211..13741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0012"
FT                   /product="D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Polynucleotide kinase 3 phosphatase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82787"
FT                   /db_xref="GOA:A4XN71"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN71"
FT                   /protein_id="ABP82787.1"
FT                   /translation="MKLLILDRDGVINEDSDAYIKTLDEWIPIASSITAIARLSQAGWT
FT                   VAVATNQSGIARGYYDLATLESMHARLRELVGEQGGEVGLIVYCPHGPDDGCECRKPKA
FT                   GMLRQIAAHYGTDLAGIWFVGDSSGDLQAALAVDCQPVLVKTGKGERTLAKPLPPGTLV
FT                   FDDLAAVADQLLS"
FT   gene            complement(13811..15865)
FT                   /locus_tag="Pmen_0013"
FT   CDS_pept        complement(13811..15865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0013"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82788"
FT                   /db_xref="GOA:A4XN72"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XN72"
FT                   /protein_id="ABP82788.1"
FT                   /translation="MSAKDFLVELGTEELPPKALKSLGDAFLAGIEKGLKAAGLNYAAS
FT                   RVYAAPRRLAVLVEQLEEQQADRSMNLDGPPIQAAFDADGNPTQAALGFARKCGVDIAE
FT                   IDRSGAKLRFAQHIPGQPAVNLLPTIVQDSLNDLPIPKRMRWAARRDEFVRPTQWLVML
FT                   FGDAVVDCEILAQKAGRVSRGHRFHANREVRISSPANYAEDLRSAYVLADFAERREIIS
FT                   RRVDELAAAEQGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALISTMQDNQK
FT                   YFCLLDAGGKLLPRFITVANIESKDPAQIVSGNEKVVRPRLTDAEFFFKQDKKQKLEGF
FT                   NQRLANVVFQAQLGSVFDKAQRVSALAGFIAREVGGDEARAARAGLLSKCDLATEMVGE
FT                   FPEMQGIAGYYYALNDGEPQDVALALNEQYMPRGAGAELPSTLTGAAVAVADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGVLRILIEKGLDLDLAAAVDFAVAQYAGKVKSDGLAA
FT                   QVLEFIFDRLRARYEDEGIEVAVYQAVRAVNPTSPLDFDQRVQAVQAFRKLPQAEALAA
FT                   ANKRVSNLLSKAEGGVAAQVEAHYFDNPSEFALHAAIQQADQAVQPLAAARQYNEALAK
FT                   LASLREPVDAFFEAVLVNAEDARVRANRYALLARLRGLFLGVADISVLG"
FT   gene            complement(15862..16809)
FT                   /locus_tag="Pmen_0014"
FT   CDS_pept        complement(15862..16809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0014"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82789"
FT                   /db_xref="GOA:A4XN73"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XN73"
FT                   /protein_id="ABP82789.1"
FT                   /translation="MSQNKPAVRTFQDLILALQNYWAEQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAVGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPNPENFQELYLGSL
FT                   KAIGLDPEVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTG
FT                   EITYGLERLAMYLQGVDSVYDLIWTDGPFGTVTYGDVFHQNEVEQSTYNFEHANVEKLF
FT                   ELFDFYESEANRLIELELPLPTYEMVLKASHTFNLLDARRAISVTARQQYILRVRTLAR
FT                   AVAQSYLQARAKLGFPMATPELRDEVLAKLEAQA"
FT   gene            17057..17623
FT                   /locus_tag="Pmen_0015"
FT   CDS_pept        17057..17623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0015"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82790"
FT                   /db_xref="GOA:A4XN74"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN74"
FT                   /protein_id="ABP82790.1"
FT                   /translation="MPRCFWCTDDPLYQAYHDEEWGVPQRDARQLFEMLLLEGAQAGLS
FT                   WITVLKKRERYRQVLHGFDPERLARLSDEEIEALMQEPGIIRNRLKLKAVRQNAQAWLK
FT                   LEDPVSWLWSFVGGAPKINHFSDRSQMLAVTPEAEAMSKALRKAGFNFVGPTICYAFMQ
FT                   ATGMVMDHTTDCDRYPELSGSAATA"
FT   gene            17672..18604
FT                   /locus_tag="Pmen_0016"
FT   CDS_pept        17672..18604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0016"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82791"
FT                   /db_xref="GOA:A4XN75"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN75"
FT                   /protein_id="ABP82791.1"
FT                   /translation="MAGTMPAFHATLESFVEAFKGRLVVGFLRLFALLPWRAVQAVGNA
FT                   IGWLMWKLPNGSRDVVRINLSKCFPELNQAELDRLVGQSLKDIGKTLTESACAWIWPAQ
FT                   KSLKLIREVEGLEVLQQALASGKGVVGITSHLGNWEVLNHFYCNQCKPIIFYRPPKLKA
FT                   VDELLQQQRVQMGNRVAPSTKEGILSVIKEVRKGGAVGIPADPEPSRSAGVFVPFLGTT
FT                   ALTSKFVPGMLTGGKAVGVFLHALRLPDGSGYKVILEAAPEGMYSENVEEGVAAMSEVV
FT                   SRYVRNYPSQYMWSMKRFKKRPDGEAKWY"
FT   gene            18721..18987
FT                   /locus_tag="Pmen_0017"
FT   CDS_pept        18721..18987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0017"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82792"
FT                   /db_xref="GOA:A4XN76"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN76"
FT                   /protein_id="ABP82792.1"
FT                   /translation="MSNQRHQVRTPMKCRIKISHPSFGELVAQTRDLSDSGVYVKHPDM
FT                   TSLTVGAEVTGQVQDLPFPAPVLKMEVVRVDSEGAGLRFLDED"
FT   gene            19365..19931
FT                   /locus_tag="Pmen_0018"
FT   CDS_pept        19365..19931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0018"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82793"
FT                   /db_xref="GOA:A4XN77"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN77"
FT                   /protein_id="ABP82793.1"
FT                   /translation="MQCLDSEGLPRKGQSPGSLGLNKFFMSLCLAGALLLGICTQASAT
FT                   FRIHTIPATAPAAEPKPASEVIDRALAALGTPYRWGGSSLRHGFDCSGLVQYAFKTQED
FT                   LELPRTSRALSRLDAPSVKSSDLQPGDLLFFRIRSRSVDHVAIYIGEGRFVHAPRRGTK
FT                   VRIDRLNDAYWQRHFQLAKRVVSQA"
FT   gene            20108..20545
FT                   /locus_tag="Pmen_0019"
FT   CDS_pept        20108..20545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0019"
FT                   /product="Tir chaperone family protein"
FT                   /note="PFAM: Tir chaperone family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82794"
FT                   /db_xref="GOA:A4XN78"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN78"
FT                   /protein_id="ABP82794.1"
FT                   /translation="MPSAAYCRLVDDLCQLALLPNPKALYERTALTVGKVNFSLVERSG
FT                   DPYSEVLIYTDLGPLPSQRRDAVLLRLLDINFHLFVGAGSPSCSYNSETQRLMLGVSLL
FT                   LQAATGQRLLALLGQLADMAHNWRDDHFLERPSPRHAQVRL"
FT   gene            20545..22776
FT                   /locus_tag="Pmen_0020"
FT   CDS_pept        20545..22776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82795"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN79"
FT                   /protein_id="ABP82795.1"
FT                   /translation="MDRIHQPSSASAHGVGHSPSPSVTGARPASPVSQPSVTVASEAPL
FT                   QGRQAERAARPQSALERYESTFPTLRELRQKAQREAARQADTDRPAYHPLEAAKRRMLI
FT                   EGELLRAHPSLSLQQASEILNMGHVEQLASPIPYGDSLEKLATALDQLFAPGLQDELPS
FT                   LVQLGAILDQGLGEISRHLEGQLDLYRQVLQHTLLDDTERAQVKAGQQALQAMAERWTE
FT                   DIKGKVLGKAQALAESRLQDQQRAQQQSPDQMEVQTRQWQNIRDYLKSAQDAFDTQGEF
FT                   GTALQHVRLDSQVEAMNASNQGLFSAMRSFMANGVPPGIASTLLYVMARAYVSPQLAGA
FT                   EFVARALGSGMAIGAVHETLDNFAKPAAREVLASLGMTELREVDPSEVIPDPPRAVIVE
FT                   GRYQERDAGQMAEAQAEVEQARKAFLNAQQDYKTGTLKGDAITLTSLPGAQAARELVNL
FT                   LSSQNAASTGAMALAAFLGNAGMYGLQAMGQRQKTFSHEGHDLPTHVPKPAPQEALGRR
FT                   LGNVLKDGLSTINPLDASVRQKYDSKGWSAALGMMGYNSVEGSIRQLDTSTTGGMASSV
FT                   ILTGLQTFLMQQVFYANKPAGDEAEAGGTGRFDNALNNIRDPDRETLPHGSRPGTTERR
FT                   IENTYDRLRGVIQGPPQAATEITEAVTSTVVSGLGQLGRQVAEQASRQQQRLASEVSTR
FT                   VFNTLAGGLEHVGRQVAEQAMRQRDRFRAAEPPGDIEMGLQAPRDRDNV"
FT   gene            complement(22972..23322)
FT                   /locus_tag="Pmen_0021"
FT   CDS_pept        complement(22972..23322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82796"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN80"
FT                   /protein_id="ABP82796.1"
FT                   /translation="MKQVSQKLAFYEHVAAERSAVWPVASGVTFVSRREHQDWGIALHV
FT                   ESLAMSPEQLRNALERRFVESDRYSDYFLFLNVQQDFVVWHASPDVEGVGDSLDDICRE
FT                   QLQLAGLGHLQS"
FT   gene            complement(23325..23528)
FT                   /locus_tag="Pmen_0022"
FT   CDS_pept        complement(23325..23528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82797"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN81"
FT                   /protein_id="ABP82797.1"
FT                   /translation="MTIRSLTVLLALSLLAGCASKIGCSGYACERPDSTNRALVIWWPE
FT                   DMRQGLNDRDPARDYTVVPLKD"
FT   sig_peptide     complement(23442..23528)
FT                   /locus_tag="Pmen_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.485 at
FT                   residue 29"
FT   gene            complement(23528..25618)
FT                   /locus_tag="Pmen_0023"
FT   CDS_pept        complement(23528..25618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0023"
FT                   /product="type III secretion outer membrane pore, YscC/HrcC
FT                   family"
FT                   /note="TIGRFAM: type III secretion outer membrane pore,
FT                   YscC/HrcC family; PFAM: type II and III secretion system
FT                   protein; NolW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82798"
FT                   /db_xref="GOA:A4XN82"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN82"
FT                   /protein_id="ABP82798.1"
FT                   /translation="MRNTLISLSWLLWLVSIPAHAVPPESWKQTAYAYDARQTDLNSAL
FT                   ADFAREFGLSLDMPPMDGIVDGRIRASNPQEFLERLGREYQFQWFVYNETLYISPTREQ
FT                   TSARIEVSPDAVDDLENALTAIGLLDPRFGWGTLPEEGLVLVRGPAQYVQFIREYSQKV
FT                   EEPEKAEKQDVIVFTLKYANAADRSIRYRDQELRVAGVASILRELLETRSRGEPISGVG
FT                   IFQPSGTTQGLAPTRPMGLPYAGMSGLDGGLLEQGLDNVLGLAQSSSRKRSESRSRSQI
FT                   RVSADVRNNAVLIYDLPERKAIYQGLIQQLDVPRNLIEIDAVILDIDRNELAELSSRWA
FT                   FNSGSVSGGANLFEPGTTSTLFIQDAGRFAAELRALEGTGAASIMGNPSILTLENQPAV
FT                   IDFSRTEYLTALAERVANIQPITAGTSLQVIPRSLNQGSRSQVQLIVDIEDGQIIESNI
FT                   SEEQPSVRRGNVSTQAVIAEHGSLVIGGFHSLEANDRINKIPLLGDIPVIGKLLFQSRN
FT                   REFNRRERLFILTPRLIGDQVNPARYVQHGNPHNLDRQLREIDERRRGTERPSRGDIEH
FT                   AFTQLLDGIHPSGFDSAPLPLRAETLCNSDHGLTLDAERSQWFARDGWGVAVVVARNDT
FT                   AQPIRIDESRCGGRWAMGVSAWPRAWLQPGEESEVFIALRQPQSLQKTGQGRTSLLHRS
FT                   TP"
FT   sig_peptide     complement(25553..25618)
FT                   /locus_tag="Pmen_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(25620..26045)
FT                   /locus_tag="Pmen_0024"
FT   CDS_pept        complement(25620..26045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82799"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN83"
FT                   /protein_id="ABP82799.1"
FT                   /translation="MEFSEFSDVIAQWCEASALPLDCWIDDANARLAEMGGGVRCSLEV
FT                   LNPFEASDQQRLQAVLSQGGAGLACACDGAFAIDPDTHALVLVNWHRAPCSVDQLLASL
FT                   ERLANQRAALISLLHVSIREAALIAPQPSFNALHPGV"
FT   gene            complement(26032..26256)
FT                   /locus_tag="Pmen_0025"
FT   CDS_pept        complement(26032..26256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82800"
FT                   /db_xref="InterPro:IPR009371"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN84"
FT                   /protein_id="ABP82800.1"
FT                   /translation="MSSLEALRNRLDRAQESAVRNKDDALLQAAESADINDMHAYNEAA
FT                   RKAQLVSTVVSEELRAQHGLTKAIIDGIQ"
FT   gene            complement(26417..27004)
FT                   /locus_tag="Pmen_0026"
FT   CDS_pept        complement(26417..27004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0026"
FT                   /product="type III secretion apparatus protein, HrpE/YscL
FT                   family"
FT                   /note="TIGRFAM: type III secretion apparatus protein,
FT                   HrpE/YscL family; PFAM: HrpE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82801"
FT                   /db_xref="InterPro:IPR009335"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN85"
FT                   /protein_id="ABP82801.1"
FT                   /translation="MLTKRRFTLGSAVLEEPILRRQLLAESLRADELLAQARLQAEQLL
FT                   QQAHEQRQHYLDEAVARFWSEANALLQAIQEERASYQRDALSAVDSLLNIALSRLLDET
FT                   DLPQRISALLRNLVVGLPSKAEANLACHPEAASTVRAWLQTMGFDALWQVQEDPGMAPE
FT                   SLRLSNTLGTFHIDWPSLRRGLIPSLPEARHA"
FT   gene            complement(26994..27527)
FT                   /locus_tag="Pmen_0027"
FT   CDS_pept        complement(26994..27527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82802"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN86"
FT                   /protein_id="ABP82802.1"
FT                   /translation="MSDAAERWVRWWCEAWHFAHPGWRRSSPVLAAAADCSHSRHAALA
FT                   QSLGIGATQPPPPHEGVLQWLALNERQRQHALALAQHICSAKAPCQALPADADWCRSLG
FT                   KALRPGLWLTAEATDPRLLLGAWAGPACWERLRLQWAPGSLEELPPDLPARRLATLWAA
FT                   VLWRTSQMERTRAD"
FT   gene            complement(27524..28342)
FT                   /locus_tag="Pmen_0028"
FT   CDS_pept        complement(27524..28342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0028"
FT                   /product="type III secretion apparatus lipoprotein,
FT                   YscJ/HrcJ family"
FT                   /note="TIGRFAM: type III secretion apparatus lipoprotein,
FT                   YscJ/HrcJ family; PFAM: secretory protein YscJ/FliF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82803"
FT                   /db_xref="GOA:A4XN87"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN87"
FT                   /protein_id="ABP82803.1"
FT                   /translation="MKWTLSIVALCLLLLSGCSDRTDLFSGLSELDANEVIASLGEHRI
FT                   SARKRAEKAGVVVTVDTAEINRAVRVLEAAGLPRRARTSLGEIFKKEGVISTPLEERAR
FT                   YIYALSQELESTLSQIDGVIVARVHVVLPERIAPGEPVQPASAAVFIKHAASLEPDAVQ
FT                   RRIQQMVVSSIPGLASTGVESSEKFSIVFVPAAELQDADTLVPFGPFLIESQKLGFWQL
FT                   MSWLIPLGGLLLLAVLTLLVRQDWRSVLLRRVRPRQPASHNVSTLPSRVA"
FT   sig_peptide     complement(28274..28342)
FT                   /locus_tag="Pmen_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.841) with cleavage site probability 0.468 at
FT                   residue 23"
FT   gene            complement(28353..28721)
FT                   /locus_tag="Pmen_0029"
FT   CDS_pept        complement(28353..28721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0029"
FT                   /product="type III secretion apparatus protein, YscI/HrpB
FT                   family"
FT                   /note="TIGRFAM: type III secretion apparatus protein,
FT                   YscI/HrpB family"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82804"
FT                   /db_xref="GOA:A4XN88"
FT                   /db_xref="InterPro:IPR012670"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN88"
FT                   /protein_id="ABP82804.1"
FT                   /translation="MSISKIDGLTSPDLKLDQGLVSEPSQADVDLFSSLMRDNGNTADQ
FT                   PSHLAAVIAETVNARMTSVDDLSRQAMRHMKEAVTGNDVSAITDMSRALSQYSLQMAVT
FT                   TKVVSKTGQALEKLTNMQ"
FT   gene            complement(28765..29664)
FT                   /locus_tag="Pmen_0030"
FT   CDS_pept        complement(28765..29664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0030"
FT                   /product="HrpZ family protein"
FT                   /note="PFAM: HrpZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82805"
FT                   /db_xref="InterPro:IPR006961"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN89"
FT                   /protein_id="ABP82805.1"
FT                   /translation="MNMISNMPGLVAGNFSNFSIGSQSNSERPQNMDQVVDKLADMLKG
FT                   SDLSSSPLGQMVKDKLDDSGGLMGILKKGGMENAVKDALKDIISEKLGDNFGAAQSFGL
FT                   GNGSGTGGAGGAGGGQQPDLLERVLSGLAKSSLDDLLGKQGEGTKFSNKDMPMLEEIAK
FT                   FMDDPRSGIKPPDSGSWANELKEDNYLNKEETAAFRAALDQVGGALDQKASGQPSGMPG
FT                   GLGMPGNAGQNMLGGEGGLGGSGTGSAAGNPLQQLNDLIQGLQGLASQLSLQNLASSAM
FT                   DTANALVGAMLPNNSRTA"
FT   gene            complement(29716..30009)
FT                   /locus_tag="Pmen_0031"
FT   CDS_pept        complement(29716..30009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82806"
FT                   /db_xref="GOA:A4XN90"
FT                   /db_xref="InterPro:IPR018581"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN90"
FT                   /protein_id="ABP82806.1"
FT                   /translation="MAMDPINGGMQLFNQATSSLNMNNNIADAAGDSKSSKAMEDAMAR
FT                   SDASSARMIDLQSRHAEKMKVENTLQAMQSAEDDAANKKISSTAQNAKGISY"
FT   gene            complement(30305..31210)
FT                   /locus_tag="Pmen_0032"
FT   CDS_pept        complement(30305..31210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0032"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82807"
FT                   /db_xref="GOA:A4XN91"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN91"
FT                   /protein_id="ABP82807.1"
FT                   /translation="MSEFDWPDAFWMNDGGLPNLEVVASSISELNIDVLLTGETGSGKD
FT                   TLAQYLHKLSGRKGPFVAMNCAAIPESLFESELFGVTSGAYTGADHSRMGYVEAAQGGT
FT                   LYLDEIDSMPAFLQAKLLRVLETRQIERLGSTTPVPLDICVVASAQRSLDALVEQGEFR
FT                   RDLYFRLNVLTLRLPALRQKREWIIPMFERFAFEASQDMDTALPVIDPAIEHVLLNHDW
FT                   PGNLRELKSAAKRHVLGINLLGIEAEQPIECDLKCQLRLIEKVLIQESLQRHEHCIEAV
FT                   LHELDIPRRTLYHRMKELDV"
FT   gene            complement(31594..32523)
FT                   /locus_tag="Pmen_0033"
FT   CDS_pept        complement(31594..32523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0033"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82808"
FT                   /db_xref="GOA:A4XN92"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN92"
FT                   /protein_id="ABP82808.1"
FT                   /translation="MSRGVAAEKSARRHGGTDVPELGITLSAGHFRMDLLLCGETGTGK
FT                   DVLARHIHDLSGRTGAFVGINCAAIPEALAESQLFGVASGAFTGANRSRQGYIEASNDG
FT                   TLYLDEIDSMPLQLQAKLLRVLETRGVERLGTTKFIPLNLRIIASTQRPLEELVEQGLF
FT                   RRDLLFRLNAMTLSLPPLRQRRELILPLFKRFTRSLGAKQANGAQALDSQLIQLLLSHP
FT                   WPGNIRELKSAAKRYVIGLPPIDAGVLADLEDGDFPHDRGLKKRMRAVEKMLIQDALKR
FT                   HKNGLEAVAEELGISRRTLYQRIKELDV"
FT   gene            complement(32882..33268)
FT                   /locus_tag="Pmen_0034"
FT   CDS_pept        complement(32882..33268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82809"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN93"
FT                   /protein_id="ABP82809.1"
FT                   /translation="MPTTHMRPAEHGRSLREEEWLKNDQAIDQGRYSSIALTGSFEHQH
FT                   LAQSDGQLAAAAQEYPRRCKGVRCKIAEPSLTSAKPAKCNHGFCKKAGRVLFCFNPAIA
FT                   FRHRHIPLVVFYLSNQTITAHLLG"
FT   gene            complement(33299..35920)
FT                   /pseudo
FT                   /locus_tag="Pmen_0035"
FT   gene            complement(33458..35032)
FT                   /locus_tag="Pmen_0036"
FT   CDS_pept        complement(33458..35032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0036"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82810"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN94"
FT                   /protein_id="ABP82810.1"
FT                   /translation="MIAVPAPLPDDPILLKHLLLLASEQAAAKDARIEQLQEQVALLRH
FT                   KLFSPKSERSPEDADSPQLAMFNEVEELIEAAAAPSEAEAEAEAEAEAEAEEIVAPVKR
FT                   RGKRKPLPANLPRVEVIHDLPEHELTCACGACKQVIGEETSEQLEIIPMQVRVIRHIRK
FT                   TYACKACEAAPLTADKPAQLIEKSLASPSVLAMLLTTKYADGIPLYRFEKMLSRHGVDI
FT                   PRQTLARWVIQSGEQLQPLLNLLRDKLLEYPVLHCDETRLQVLHEPGRDPTAQSWMWVQ
FT                   SGGPPDKPVILFDYTASRAQEVPLRLLDGYRGYLMTDDYAGYNAVAAQEGIERLGCWAH
FT                   ARRKFVEAQKVQPKGKTGRADMALNLINKLYGIERDLKDACDTERLVARQQRSQPLLDQ
FT                   LKTWLDKTQPQVVGQTALGRAVNYLASNWRKLVRYVEGGHLPIDNNRAENAIRPFVIGR
FT                   KNWLFSDTPKGATASAQIYSLIETAKANGQEPYAWLRHILERLPAANSVEDYEALLPWN
FT                   CSPVSAS"
FT   gene            complement(35052..35411)
FT                   /locus_tag="Pmen_0037"
FT   CDS_pept        complement(35052..35411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0037"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82811"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN95"
FT                   /protein_id="ABP82811.1"
FT                   /translation="MMRPDAKVQKVYLYPKPVDFRKSINGLAALVELDIKVEVFNPVLF
FT                   VFLNRTRSQVKILYWERNGFCLWLKRLEAERFKTKPDAGDEAIELTVDELNWLLDGIDL
FT                   WRNRPHQILTPRFVT"
FT   gene            36171..37328
FT                   /locus_tag="Pmen_0038"
FT   CDS_pept        36171..37328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0038"
FT                   /product="type III secretion outer membrane protein PopN"
FT                   /note="TIGRFAM: type III secretion effector delivery
FT                   regulator, TyeA family; type III secretion regulator
FT                   YopN/LcrE/InvE/MxiC"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82812"
FT                   /db_xref="GOA:A4XN96"
FT                   /db_xref="InterPro:IPR010812"
FT                   /db_xref="InterPro:IPR013351"
FT                   /db_xref="InterPro:IPR015144"
FT                   /db_xref="InterPro:IPR038347"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN96"
FT                   /protein_id="ABP82812.1"
FT                   /translation="MIRPIPNASSILHIPSVARAASPATPLAQVRSGAATTTGTSAQQA
FT                   SKFAAALVQNSRELGRRDLFAKINALQSQASKQHELAHLLLATHERGMEESARALRKTL
FT                   KNGQLLRMERGKLLKQIVDSMAGDAAKAHALLQAAARQAKGEKSLNEQQALNQQLQLLR
FT                   QQHGRNPRPLFNTGNNTRILARGGEDPQRRDKLRSLYSVAVTEQLNVVGLIEALLNSTQ
FT                   DDGQKDGREGFEAVLREIRQVVARDMAELDGSASPQKLRTMMYAMSTAQYVATLFGGCE
FT                   HLLGRMRNKNPAMQVETSAFLKNLLGLIGKGMALNDTLQLTQQIGGRQLKHQLAFLNGL
FT                   RPMLHQLPIMLWRDIKSRQNALGNLLSLMAALTSEEQKRLKEGIA"
FT   sig_peptide     36171..36233
FT                   /locus_tag="Pmen_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.626) with cleavage site probability 0.547 at
FT                   residue 21"
FT   gene            37328..39412
FT                   /locus_tag="Pmen_0039"
FT   CDS_pept        37328..39412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0039"
FT                   /product="type III secretion protein, HrcV family"
FT                   /note="TIGRFAM: type III secretion protein, HrcV family;
FT                   PFAM: type III secretion FHIPEP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82813"
FT                   /db_xref="GOA:A4XN97"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN97"
FT                   /protein_id="ABP82813.1"
FT                   /translation="MGAVIDFLNGIALAAMRRSEIVGAFVVIAIIFMMITPMPTELMDV
FT                   LIAINICISCLMIMLAMHLPRPLAFSTFPAVLLLTTMFRLALSISTTRLILLEQDAGHI
FT                   VEAFGEFVVGGNLAVGVVIFLILTIVNFLVITKGSERVAEVGARFTLDAMPGKQMSIDS
FT                   DLRANLISVSEARNRRAELNKESQLFGAMDGAMKFVNGDAIASLIIIAINMIGGMAIGV
FT                   AQMGMSAGDALQVYTILTIGDGLVSQIPALMISVTAGIVITRVPNEQRQQTNIGREIAE
FT                   QLTSQPKAWIIASVAMLGFAALPGMPTLTFIIIAIICGCGGLLQLQRARTSSAAEDDPE
FT                   VIPPEMNGQEDLRTFSPSRQFVLQFHPSQDAHQVAALLSEIRQRRNRLVVQYGLTLPSF
FT                   IIEQSPLLPPDEFRFSVYEVPLFKATLTQSQLAVPARSLPPGAVCGSNERQEEDWVWMP
FT                   ADDPMLQNDELEIVSAATLIVERMERAMQACGPQFIGLQETKAILGWLESEQPELAQEM
FT                   QRVLPLARFSAILQRLAAECVPLRSVRLIAETLIEHAQHERDVTVLTDYVRIALKSQIY
FT                   HQYSSAEGLLVWLLTPESEGILRDGLRQTQTETFFALNHETSQLLLQQLHMAFPMRAPE
FT                   QAVLLVPQDLRSPLRTLLQEEFHHVPVLSFAEISSAARIKVMGRFDLEESVALDNDYAA
FT                   "
FT   gene            39429..40343
FT                   /locus_tag="Pmen_0040"
FT   CDS_pept        39429..40343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0040"
FT                   /product="type III secretion apparatus protein, YscD/HrpQ
FT                   family"
FT                   /note="TIGRFAM: type III secretion apparatus protein,
FT                   YscD/HrpQ family"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82814"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN98"
FT                   /protein_id="ABP82814.1"
FT                   /translation="MYELRVLTGLHKGAALPLIGEQWLIGAEEGRDLALHDPGVETLHC
FT                   RLQRAGDSWQLLAEEGAVLDGEGHSHASMEVLLDCPLVLGSVWVYLAAAESPWPTLPAL
FT                   VGHPGEDGDSKASAEVGERGRVRLLNRGTGIALGVLLGVMGSAWSLSWPVGSASGPAAV
FT                   PTSEPAAVSDGRTLLQKDEAVRVLKQMLSERLLTAVSVEPNEQGVALMGSLQGEGMLVY
FT                   ERMLQRFEKDYETDFVLQDQVSSGAAGLPFVIVQIIAGPRGHLVMEDGRRLHVGDKLDG
FT                   LRLVRIDNERILFDGVRRYEVAW"
FT   gene            40340..41698
FT                   /locus_tag="Pmen_0041"
FT   CDS_pept        40340..41698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0041"
FT                   /product="ATPase, FliI/YscN family"
FT                   /note="TIGRFAM: ATPase, FliI/YscN family; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82815"
FT                   /db_xref="GOA:A4XN99"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN99"
FT                   /protein_id="ABP82815.1"
FT                   /translation="MNAPATELQEWVRFQAARLGTLSAVQVSGRVSAVSGILLECQVPA
FT                   AKVGELCEVSKADGSNMLAEIVGFTPDCTLLSALGTPDGIQVGATIRPLGIAHRIGVDD
FT                   SLLGSVLDGFGRPLLGQAQGAFAGPHDARQTLPVIADALPPTQRPRITTALPTGIRSID
FT                   SAMLLGEGQRVGLFAGAGCGKTTLMAELARNMACDVIVFGLIGERGRELREFLDHELDD
FT                   TLRKRSVLVCATSDRSSMERARAAFTATAIAEAYRARGLKVLLLIDSLTRFARAQREIG
FT                   IAAGEPLGRGGLPPSVYTLLPQLVERAGMSESGSITALYTVLIEQDSMNDPVADEVRSL
FT                   LDGHIVMSRKLAEKGHYPAIDVPASISRVLSNVAPREHQRANNRLRRLMAAYRQVEMLL
FT                   RLGEYQPGTDPVTDCAVQLHEPINAFLRQDLREPSPLPVTLEALMQLTAALPE"
FT   gene            41701..42147
FT                   /locus_tag="Pmen_0042"
FT   CDS_pept        41701..42147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82816"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNA0"
FT                   /protein_id="ABP82816.1"
FT                   /translation="MEDELEADPQRLALEQAIQVLRPLRQHRQASAERQQRQMQQTLAS
FT                   SRERLAETRERLGSERQAQLARREALAQQHVDRCLSLDEVELWHNQERAMLDRLAHMRQ
FT                   DIHRQGLAIEQQQHQLQVMQAQAKAAQRAVEKLSCLAEAINDEN"
FT   gene            42137..42673
FT                   /locus_tag="Pmen_0043"
FT   CDS_pept        42137..42673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82817"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNA1"
FT                   /protein_id="ABP82817.1"
FT                   /translation="MKTEHAARPQLMQTLQQGAAPQGNLAALKETGWSRRSDFESSLSS
FT                   WSNSAVPTLADGQLFAQLIQPVHSGGDQSGFGGSGVASFQARPDGMAGELVDELTQRLP
FT                   SLPSGPINVTLLMPNLGRVQVRAGKRDQQLEVELGFERQDVLERLRAQERTCESALGEA
FT                   LGQPVRLWMREEASV"
FT   gene            42670..43386
FT                   /locus_tag="Pmen_0044"
FT   CDS_pept        42670..43386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82818"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNA2"
FT                   /protein_id="ABP82818.1"
FT                   /translation="MTPLALGAISSVLAQASRALGAGVTLNFRARGHDGELKLLPMLPN
FT                   APSRAGTWLHTNVGPLCLGDAGAVLSLLGELPVTCEGDDQPWYWQLISQRLSQGVAGAL
FT                   GAISPLDGDAPAGALLHAQLHVRLGDERVQAQLAAPPETWLNWLQAPEWQRIRTALHEA
FT                   LVLHIPLQLGQLELSAEQLASLQPGDIVLPAQASFTCDGSGHLALASRYWAAQVSSRGE
FT                   KLFLNLRHEESSQHEH"
FT   sig_peptide     42670..42735
FT                   /locus_tag="Pmen_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.878 at
FT                   residue 22"
FT   gene            43376..43777
FT                   /locus_tag="Pmen_0045"
FT   CDS_pept        43376..43777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0045"
FT                   /product="surface presentation of antigens (SPOA) protein"
FT                   /note="PFAM: surface presentation of antigens (SPOA)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82819"
FT                   /db_xref="GOA:A4XNA3"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNA3"
FT                   /protein_id="ABP82819.1"
FT                   /translation="MSTEHLSQESLQEMAEMDADALPEGFEERPGEMHLEGQEFAPQDE
FT                   HASAVEPQQMAALGSIAHLPLQLTLRCGQLTLSVDQLRQLGSGSVLEIHGVAPGHATLC
FT                   HGERVVGEGELVDVDGRLGLQITRMATLS"
FT   gene            43774..44427
FT                   /locus_tag="Pmen_0046"
FT   CDS_pept        43774..44427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0046"
FT                   /product="Yop virulence translocation R"
FT                   /note="TIGRFAM: Yop virulence translocation R; PFAM: type
FT                   III secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82820"
FT                   /db_xref="GOA:A4XNA4"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNA4"
FT                   /protein_id="ABP82820.1"
FT                   /translation="MILDGMNPIMLALFLGALSLIPFLLIVCTAFLKIAMTLMITRNAI
FT                   GVQQVPPNMAIYGIALAATMFVMAPVAYEIQNRLSDNPLDLSSTDSLQASAGNVVEPLQ
FT                   DFMVNNTDPDIATHLLENTQRMWPREMSEKASKSDLLLAIPAFVLSELQAAFQIGFLIY
FT                   IPFIVIDLIISNLLLALGMQMVSPMTISLPLKLLLFVLVDGWTRLLNSLFYSYM"
FT   gene            44435..44698
FT                   /locus_tag="Pmen_0047"
FT   CDS_pept        44435..44698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0047"
FT                   /product="type III secretion protein, HrpO family"
FT                   /note="TIGRFAM: type III secretion protein, HrpO family;
FT                   PFAM: export protein FliQ, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82821"
FT                   /db_xref="GOA:A4XNA5"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNA5"
FT                   /protein_id="ABP82821.1"
FT                   /translation="MEALALFKQGMFLVVILTAPPLAVAVLVGVTTSLVQALMQMQDQT
FT                   LPFGLKLAAVGLTLAMTGRWIGLELIQFTNMAFDLIARSGGN"
FT   sig_peptide     44435..44512
FT                   /locus_tag="Pmen_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.758) with cleavage site probability 0.648 at
FT                   residue 26"
FT   gene            44699..45499
FT                   /locus_tag="Pmen_0048"
FT   CDS_pept        44699..45499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0048"
FT                   /product="type III secretion protein SpaR/YscT/HrcT"
FT                   /note="TIGRFAM: type III secretion protein SpaR/YscT/HrcT;
FT                   PFAM: type III secretion system inner membrane R protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82822"
FT                   /db_xref="GOA:A4XNA6"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNA6"
FT                   /protein_id="ABP82822.1"
FT                   /translation="MPLDAQAAFELMLGLGLGVARLLPCMLLVPAFCFKHLKGILRYGV
FT                   VIAVAMIPAPSIGEALASEGASFGVVMGLLIKEVMLGALLGVLLHMPFWMFASVGALLD
FT                   SQRGALSGGQLNPALGPDVTPMGELLQEVLVMLVILFGGLPLITQVIWDSYLIWPPTVW
FT                   LPILTEDGLGVLLSQLSRTLQHMLLYAAPFIALLLLIEAAMAIISLYAQQLNVFILAMP
FT                   AKSIAGLAFLLIYLPTLLELGGGEVQQFQLLKQLLGSLVQVPVP"
FT   gene            45496..46575
FT                   /locus_tag="Pmen_0049"
FT   CDS_pept        45496..46575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0049"
FT                   /product="type III secretion protein, YscU/HrpY family"
FT                   /note="TIGRFAM: type III secretion protein, YscU/HrpY
FT                   family; PFAM: type III secretion exporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82823"
FT                   /db_xref="GOA:A4XNA7"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNA7"
FT                   /protein_id="ABP82823.1"
FT                   /translation="MSEKTEKATPKQLRDAREKGQIAQSQDVSKLLILLMVSEITWSLA
FT                   TESVQRLQHLMALAINATGQPFLRIVGQLVDEAVTVLLGFLIFSVGVAMVMRLAGGWAQ
FT                   FGFLFAPKALKIDFNKLNPFPQLKQMFSAQNLTNLLMSILKAAVIGITLYVLLWPELGT
FT                   LILLANSDLDTYWQSLMEVFRYILRCTLGLLLVLAAVDFGLQKYFHAKKLRMSKDDVKK
FT                   EYKQSEGDPMVKGQRRQLAHELLNQPPSTAARPVEEADMLVVNPTHYAVALYYRPGKTP
FT                   LPMIHCKGEDEDALALIARAKKARIPVVQSVWLARTLYKVNAGRHIPRPTLEAVAHIYQ
FT                   LVKQLDEVTDEIIQADSGL"
FT   gene            46762..47412
FT                   /locus_tag="Pmen_0050"
FT   CDS_pept        46762..47412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0050"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82824"
FT                   /db_xref="GOA:A4XNA8"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNA8"
FT                   /protein_id="ABP82824.1"
FT                   /translation="MTLIPASVSRPVLAGLIAFHILIIIASNYLVQLPITLFGWHTTWG
FT                   AFSFPFIFLATDLTVRLIGKHAARVVIARVMLPALVASYVVSVLFHEGVFGGLAVLGDF
FT                   NLFVFRIAVASFLAYAFGQLLDIQVFDRLRQMRQWWIAPTASTIFGNLLDTFLFFSVAF
FT                   WRSDDPFMAANWVEIATVDYVIKLAISLMLFVPLYGMLLSAIVRALPQRPATA"
FT   gene            complement(47452..47766)
FT                   /locus_tag="Pmen_0051"
FT   CDS_pept        complement(47452..47766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0051"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_4; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82825"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNA9"
FT                   /protein_id="ABP82825.1"
FT                   /translation="MSTEALEKMLAKGMDNALLRFGLGKAHLDAGNAAQAAEHLQRCVE
FT                   FDPGYSAAWKLLGKALQAEGDIEAARRAWQQGLNAAQSKGDKQAEKEMSVFLRKLDKVR
FT                   "
FT   gene            complement(47855..49228)
FT                   /locus_tag="Pmen_0052"
FT   CDS_pept        complement(47855..49228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0052"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82826"
FT                   /db_xref="GOA:A4XNB0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNB0"
FT                   /protein_id="ABP82826.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGKGSFPTVLRQAGADDADMLVAVTNSDEVNMIACQVAYTLFHTPTKIARVRESAY
FT                   LTREALFDNEAIPVDVLISPEQVVTNYIKRLIEYPGALQVIDFADGKAQLVAVKAYYGG
FT                   PLVGQQLRQLRQHMPNVDTRVAAIFRRNRPIMPQGDTVIEADDEVFFIAAKAHIRAVMS
FT                   EMRRLEDSYKRVVIAGGGNIGERLAEAIESRYQVKIIEMNPARCRYLSENLDSAIVLQG
FT                   SASDRDLLVEENINDADIFLALTNDDEANIMSSLLAKRLGARKVMTIINNPAYVDLVQG
FT                   GEIDIAISPQLATIGTLLTHVRRGDIESVHSLRRGAAEALEVIAHGDAKSSKVIGRMIE
FT                   EIALPPSTTIGAIIRDEEVLIAHDDTVIESGDHVILFLVDKKYIRDVERLFQAGLTFF"
FT   gene            complement(49240..50553)
FT                   /locus_tag="Pmen_0053"
FT   CDS_pept        complement(49240..50553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0053"
FT                   /product="16S rRNA m(5)C-967 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82827"
FT                   /db_xref="GOA:A4XNB1"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNB1"
FT                   /protein_id="ABP82827.1"
FT                   /translation="MNPRLAAARALTAVLSGKASLGSSLPPQLDKVEHHDRALAQDLAF
FT                   GAARWQPRLQLLADKLLEKPFKAADKDVEALLLIGLYQLLHSRIPEHAAIGETVGCAGA
FT                   LKKPWAKGLLNAVLRRAQREHEALFAELDRDPVLHTAHPRWLQKQLKSFWPEYWQAICA
FT                   ANNAHPPLILRVNRRHGSRDAYLEELRGAGFAAEPCTFSRDGVRLLQPCDVTALPGFRE
FT                   GRVSVQDEAAQLAADLLELAPGQRVLDACAAPGGKTCHLLEAEPALAEVIAVDLEEKRL
FT                   TRVRENLQRLGLEARLIAADGRATKVWWDGTPFQRILLDAPCSATGVIRRHPDIKLTRK
FT                   SEDIPALAQLQGELLDALWPTLAPGGILLYATCSVLPTENSDTIAAFLARTPDAQEVAI
FT                   GGDFGLQAAHGRQLLPQLDGHDGFYYAKLIKSAVPSHS"
FT   sig_peptide     complement(50488..50553)
FT                   /locus_tag="Pmen_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.860) with cleavage site probability 0.407 at
FT                   residue 22"
FT   gene            complement(50550..51494)
FT                   /locus_tag="Pmen_0054"
FT   CDS_pept        complement(50550..51494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0054"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82828"
FT                   /db_xref="GOA:A4XNB2"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNB2"
FT                   /protein_id="ABP82828.1"
FT                   /translation="MPDSLRIVFAGTPEFAAEHLKALLASQHEVIAVYTQPDRPAGRGQ
FT                   KLMPSPVKQLAVEHGIPVHQPASLRNEEAQAELAALKPDLMVVVAYGLILPQVVLDTPR
FT                   LGCINSHASLLPRWRGAAPIQRAVQAGDLESGVTVMQMEAGLDTGPMLLKVSTPISAED
FT                   TGGSLHDRLARLGPQAVLQAIDGLAAGTLIGELQDDAQANYAHKLNKDEARLDFSRPAV
FT                   ELERLIRAFHPWPICHTTLNGDALKVHAAELGEGSGAPGTILAADKNGLTVACGEGALR
FT                   LTRLQLPGGKPLAFSDLYNSRREQFAPGLVLGQ"
FT   gene            complement(51547..52053)
FT                   /locus_tag="Pmen_0055"
FT   CDS_pept        complement(51547..52053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0055"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82829"
FT                   /db_xref="GOA:A4XNB3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNB3"
FT                   /protein_id="ABP82829.1"
FT                   /translation="MAILNILEFPDPRLRTIAKPVDVVDDSIRQLVDDMFETMYDAPGI
FT                   GLAATQVNVHKRVVVMDLSEDKSEPRVFINPEFESLTDEMDQYQEGCLSVPGFYENVDR
FT                   PQKVKIKALDRDGQPFELIAEGLLAVCIQHECDHLNGKLFVDYLSNLKRDRIKKKLEKQ
FT                   HRQRA"
FT   gene            52207..53244
FT                   /locus_tag="Pmen_0056"
FT   CDS_pept        52207..53244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0056"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82830"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNB4"
FT                   /protein_id="ABP82830.1"
FT                   /translation="MRKSLLALLFAAGGLALTSLAQAEVQLKDGHPDRYTVVKGDTLWD
FT                   ISGKFLRQPWKWPEIWHANPQVANPHLIYPGDTLNLVYVDGQPRLMLNRGESRGTIKLS
FT                   PQVRSTPMAEAIPTIPLEAINSFLLSNRIVDTPEEFNGKPYIVAGNAERVVSGAGDRVY
FT                   ARGQFDEQHPIYGIFRQGKTYVDPETKEFLGINADDIGSGEIVAEEGDVGTLLLKRSTQ
FT                   EVRLGDRLFPTEERAINSTFMPSEPAGEIKGLILDVPRGVSQIGQFDVVTLNKGARDGL
FT                   EIGNVLAVYKTGETVRDRVTGESVKIPDERSGLLMVFRTYDKLSYGLVLQASRQLAVMD
FT                   KVRNP"
FT   sig_peptide     52207..52278
FT                   /locus_tag="Pmen_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.925 at
FT                   residue 24"
FT   gene            53331..54437
FT                   /locus_tag="Pmen_0057"
FT   CDS_pept        53331..54437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0057"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82831"
FT                   /db_xref="GOA:A4XNB5"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNB5"
FT                   /protein_id="ABP82831.1"
FT                   /translation="MPLPSSHSPAELEARLRLHLLPELGPRRFRKLLSAFDSASAALSA
FT                   PASAWRSLGLPAVCAEPRRSAEIRQRAAAAMHWLDQTDQHLLMWDDPRYPALLAELADA
FT                   PPLLFVGGDPLLLEAPQLAMVGSRRASRPGLDNAHAFARSLAAGGFVITSGLALGIDGA
FT                   AHQGALDGGGKTVAVLGTGLECLYPARHKRLAAQIIEQGGALVSELPLDCPPQASNFPR
FT                   RNRIISGLSLGVLVVEASPSSGSLITARLAAEQGREVYAIPGSIHHPGARGCHQLIRDG
FT                   ATLVESIEHILEALRGWQTPSGQQASAAQPGAEQHPLLTLLHAAPHSSEALAHSSGWPL
FT                   AQVLAALTELELDGLVCCEAGRWLARGP"
FT   gene            54504..55061
FT                   /locus_tag="Pmen_0058"
FT   CDS_pept        54504..55061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0058"
FT                   /product="translation factor SUA5"
FT                   /note="PFAM: SUA5/yciO/yrdC, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82832"
FT                   /db_xref="GOA:A4XNB6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNB6"
FT                   /protein_id="ABP82832.1"
FT                   /translation="MASNWQVQQAARVVCEGGVIAYPTEAVWGLGCDPWNEVAVDRLLA
FT                   LKERPVHKGLILVADDIEQFDFLLDDLPAIWQERLAASWPGPNTWLVPHQDRLPAWITG
FT                   VHDSVALRVSDHPLVRALCRLTGPLISTSANPAGRPAARSRLRVEQYFPRQLDKVLGGA
FT                   LGGRKNPSLIRDLRTGDVIRSS"
FT   gene            complement(55173..56150)
FT                   /locus_tag="Pmen_0059"
FT   CDS_pept        complement(55173..56150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0059"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82833"
FT                   /db_xref="GOA:A4XNB7"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNB7"
FT                   /protein_id="ABP82833.1"
FT                   /translation="MAKRIQFSQHGGSEVLEYRDYQPAAPGPREVRVANRAIGLNFIDT
FT                   YFRSGLYAPPALPSSLGTEGAGVVEAVGSEVRNFAVGDRVAYATGPLGAYSELHVLPAD
FT                   KLVRLPEAISFEQAAAVMLKGLTVQYLLRQTYELKGGETILFHAAAGGVGSFACQWARA
FT                   LGVNLIGTVSSAEKAARAKEQGAWATIDYSHENVVQRVLELTDGKKCPVVYDGVGKDTW
FT                   ETSLDCVAPRGLLVSFGNASGAVTGVNLGVLAQKGSLYVTRPTLAGYADTPERLQTMAD
FT                   ELFGMIAGGQLQVEISNRYALKDAAAAQDALSARQTTGSTILLP"
FT   gene            56295..57209
FT                   /locus_tag="Pmen_0060"
FT   CDS_pept        56295..57209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0060"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82834"
FT                   /db_xref="GOA:A4XNB8"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNB8"
FT                   /protein_id="ABP82834.1"
FT                   /translation="MTDRTEAVKAYLLDLQDRICAALEAEDGQALFREDAWQRPAGGGG
FT                   RTRVIENGALIEKGGVNFSHVFGDSLPPSASAHRPELAGRGFQALGVSLVIHPENPYVP
FT                   TSHANVRFFSAEKEGEEPVWWFGGGFDLTPYYANEEDCRYWHQVAFDACAPFGAEVYPR
FT                   FKAWCDRYFHLKHRGEPRGIGGLFFDDLNEWDFDTCFAFMRAIGDAYIQAYLPIVQRRK
FT                   LTPFGEREREFQAFRRGRYVEFNLVFDRGTLFGLQSGGRTESILMSLPPMVRWGYDWKP
FT                   EPGSEEARLTEYFLTDRDWLSGA"
FT   gene            57317..58138
FT                   /locus_tag="Pmen_0061"
FT   CDS_pept        57317..58138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0061"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82835"
FT                   /db_xref="GOA:A4XNB9"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNB9"
FT                   /protein_id="ABP82835.1"
FT                   /translation="MDRYCVFGNPIGHSKSPLIHRLFAEQTGQVLTYEARLAPLDDFIG
FT                   DARAFFAEGLGANVTVPFKEEAFRLADELSERARRAGAVNTLKKLEGGRLLGDNTDGAG
FT                   LTRDLQDNAGFALTGKRILVLGAGGAVRGVLEPFLAQKPAVLVIANRTVAKAEQLVREF
FT                   ADLGPLVAAGFDWLDAPVDLIVNGTSASLGGELPPIAPSLIQPGHTLCYDMMYGKEPTA
FT                   FNRWAFDQGAARCLDGLGMLVEQAAEAFELWRGVRPNTAPVLAELRRQLAG"
FT   gene            complement(58342..59982)
FT                   /locus_tag="Pmen_0062"
FT   CDS_pept        complement(58342..59982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0062"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82836"
FT                   /db_xref="GOA:A4XNC0"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNC0"
FT                   /protein_id="ABP82836.1"
FT                   /translation="MRSGATLGSCELPESNPTCLAPTMPLPDLQTLLPFLRWLPGTSRK
FT                   TLGNDLLVGLTGAVLALPQSLAYALIAGLPAEYGLYAAIVPVIVACLWGSSWHLICGPT
FT                   AAISIVLFTSVSPLAKAGSEQFIALVLLLTFLAGLFQWLLGLLRFGALVNFVSQSVVLG
FT                   FTLGAALVIAIGQIPNLLRVEIVSQATALASLLQIGQHLNDVHWPSLALAAFTLLLCLA
FT                   VRRLWPKAPALLLGLVAGSALVWLLPERLVGGIALVSAFEGGLPPFTPLQFDLNSLLQL
FT                   LPAAVACGMLGLVTSLSIARALAVKSHQFLDANQEVRAQGLSNMLGPWFAGSLSAGSFT
FT                   RSALNLQAGARTPLAGVFSALLVALFALFGAALLAHIPLPVMAAGILLICWGLVDLAAI
FT                   RALRRVSRAEFAVMLLTLLATLLLELQTAIYAGVLASLFFYLKRTSQPRVRLWQDGDDE
FT                   VLRIEGSIFFGACHYIQQLLQRSRGQRLVIDARHINFIDYAGVEMLHQEARRLLAGQRS
FT                   LVLRQARPQVVEEILKLEGAERCPVQFED"
FT   gene            complement(60029..60949)
FT                   /locus_tag="Pmen_0063"
FT   CDS_pept        complement(60029..60949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0063"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82837"
FT                   /db_xref="GOA:A4XNC1"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNC1"
FT                   /protein_id="ABP82837.1"
FT                   /translation="MNRINALLLAGALSASANVWAEDAACATVKLGDPGWSDIAVTNGI
FT                   ASFLLEGLGYQTQSQTLAVPIIYAGLQKGQLDVFLGNWMPAQQSNYDKFVASGEVDQLA
FT                   QNLDGTEYTLAVPTYAFDAGVKTFADLDKHADKFGKKLYGIASGSPANESIKQMIAADE
FT                   FGLGDWQLVESSEQAMLVQVGRAVKREQFVVFLGWTPHPMNVQYDMKYLRGGEKYFGDS
FT                   GQVNTLARKGYAQQCPNAGKLLSNLKFTQEMENSIMDRVLSKQASNAQAIKDWLQANPQ
FT                   VLDAWLDGVTTRDGGDGLAAVKARL"
FT   sig_peptide     complement(60884..60949)
FT                   /locus_tag="Pmen_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(60993..62501)
FT                   /locus_tag="Pmen_0064"
FT   CDS_pept        complement(60993..62501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0064"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82838"
FT                   /db_xref="GOA:A4XNC2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNC2"
FT                   /protein_id="ABP82838.1"
FT                   /translation="MKRPNILFIMADQMAAPILPLHDAASPVQMPNLMKLAERAVVFDS
FT                   AYCNSPLCAPSRFTLVSGRLPSQIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMHF
FT                   CGPDQLHGYEERLTSDIYPADYGWAVNWDEPDVRASWYHNMSSVLQAGPCVRSNQLDFD
FT                   EEVVFKARQYLYDHVRLTPEQPFCLTVSMTHPHDPYTIPREYWERYEGVDIPMPRQHIE
FT                   QAEQDPHSQRLLKVIDLWDKPLPADKIRDARRAYFGACSYIDDNIGKLLKTLEECGLAE
FT                   DTLIVFSGDHGDMLGERGLWYKMHWFEMAARVPLLVHAPQRFAAHRVSQSVSTLDLLPT
FT                   LVELAGGRVEEGLALEGRSLLAHLTGEGGHDEVIGEYMAEGTTSPLMMIRRGPWKFVYS
FT                   EQDPLLLFHLQQDPQERENLAGSADHQGVLAEFLAEARARWDIPAIHAATLASQRRRRL
FT                   VAEALSQGKLTSWDHQPWVDASQQYMRNHIDLDDLERRARYPQV"
FT   gene            62616..63569
FT                   /locus_tag="Pmen_0065"
FT   CDS_pept        62616..63569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0065"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82839"
FT                   /db_xref="GOA:A4XNC3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNC3"
FT                   /protein_id="ABP82839.1"
FT                   /translation="MRKVLDEISLDSLRVFESAARLLSFTAAANEQGSSQPAISQQIKR
FT                   LEQQLAVRLFDRVHRGLVLTEAGELLLRYVQEGLHSLDSGLQAVVARQQHEVLQVATDF
FT                   AFAAYWLMPRLQRFHQLHPEVDVSLVTTERDLGGNLPGEIDVAISFGDGRCKHGESLLL
FT                   FGEEVFPVCSPHLLHGREPVDSAALLARLPLLHLRPEARANWFAWDGVFRALGIAEPPS
FT                   AGALRFDNYTLLIQAAIAGQGVAIGWRYLVDELLAQGLLVRMLDTSIRSAYGYYVVMPE
FT                   RKRRARLVRCFVDWLQDELASLQRQPPQGGWAGVAI"
FT   gene            63685..64587
FT                   /locus_tag="Pmen_0066"
FT   CDS_pept        63685..64587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0066"
FT                   /product="murein-DD-endopeptidase, Serine peptidase, MEROPS
FT                   family S11"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11, D-alanyl-D-alanine
FT                   carboxypeptidase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82840"
FT                   /db_xref="GOA:A4XNC4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNC4"
FT                   /protein_id="ABP82840.1"
FT                   /translation="MKLRYSILGLLLSAGLVVSNLQAAPAQPQQELAAGSALLIDLKTG
FT                   KELYSSNPDLRLPVASVTKLMTAMVVLDAKLPLDEVLPITIRDTKEMQGVYSRVRIGSE
FT                   ISRRDMLHLALMSSENRAAASLAHHYPGGHVAFVAAMNAKAKALGMHNSHFVEPTGMSE
FT                   RNVATARDLALMIKATQQYPLIGQFSTDSEATVTFRKPTYTLGFRNTNALVRKPDWDIG
FT                   MSKTGFTNAAGRCLVMLTSMNQRSVAFVVLGAFGKYTHMADANRLKRWMETGKVTPVPA
FT                   AALSYKQQKLTEWSMQAAQ"
FT   sig_peptide     63685..63756
FT                   /locus_tag="Pmen_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(64684..65592)
FT                   /locus_tag="Pmen_0067"
FT   CDS_pept        complement(64684..65592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0067"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82841"
FT                   /db_xref="GOA:A4XNC5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNC5"
FT                   /protein_id="ABP82841.1"
FT                   /translation="MKISLEEMLAFVCVVDSGSISAAAEQLEQTASGVSRALGRLEEKL
FT                   AVTLLRRTTRRLELTEEGEVFLVQARRILDSVEEAEEQMAVRRQAPAGRLRINTASPFM
FT                   LHVIVPLIGDFRALYPQIELELNSDDRIIDLLERRTDLAIRIGHLPDSSLHARPLCHSR
FT                   RRVLASPDYLARHGQPMRTEELAGHSLIGFTEPDSLNEWPLRHALGERWRITPSLHVSS
FT                   GDTVRELALAGQGLVCLSDFMTDVDRASGRLVEVLAEQRVEVRQPINAVYYRNTALASR
FT                   ITCFLDFLSERLGSPGLTPHD"
FT   gene            65802..66605
FT                   /locus_tag="Pmen_0068"
FT   CDS_pept        65802..66605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0068"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82842"
FT                   /db_xref="GOA:A4XNC6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNC6"
FT                   /protein_id="ABP82842.1"
FT                   /translation="MKFIPAFGLGTFRLKDQVAIDSVRTGLELGYRHIDTAQIYGNEAE
FT                   VGQAIAASSVARDELFVTTKIWTENLGPGRVIASLQESLQRLGLERVDLCLIHWPSPGD
FT                   EIPVAQYLGELLEAKRQGLTAAIGVSNFTIAHLQQAIEAVGADEIATNQVEIHPLLQNR
FT                   KLVDFTRQQGIHLTAYMPLAYGKVLAEPEIQRIAAAHGVSPAQVALAWSLQQGYAVIPS
FT                   STKRENLAANLAAAELRLSTEDMAAIATLERGERVANPGFAPRWD"
FT   gene            complement(66677..67420)
FT                   /locus_tag="Pmen_0069"
FT   CDS_pept        complement(66677..67420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0069"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82843"
FT                   /db_xref="GOA:A4XNC7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNC7"
FT                   /protein_id="ABP82843.1"
FT                   /translation="MRKNLLITGASRGIGRATALLAAAGGWTVGVNYRSDRAAADEVVA
FT                   QIEAMGGTAVALPGDVANEQEVQRLFEAMDRLGPLHGLVVNAGIVAPPLPLLEMSGERL
FT                   RRMFDVNVLGSYLTAREGARRMARSRGGEGGSMVLVSSVAASLGAPFEYVDYAGAKGAM
FT                   DVLTRGLAKELGGEGVRVNAVRPGLIDTEIHASGGQPDRAERLGKATPLGRAGRAEEVA
FT                   EAIVWLLDDKASYTTGALIDIAGGR"
FT   sig_peptide     complement(67352..67420)
FT                   /locus_tag="Pmen_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.466 at
FT                   residue 23"
FT   gene            complement(67576..68385)
FT                   /locus_tag="Pmen_0070"
FT   CDS_pept        complement(67576..68385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0070"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82844"
FT                   /db_xref="GOA:A4XNC8"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNC8"
FT                   /protein_id="ABP82844.1"
FT                   /translation="MSRLQNRFAELKAENRAALVTFVTAGDPDYATSLSILKGLPEAGA
FT                   DVIELGMPFTDPMADGPAIQLANIRALAGKQGMQQTLQMVREFRAGNQSTPLVLMGYYN
FT                   PIFVYGVERFISDAKEAGVDGLIVVDLPPEHNDELCEPAQSAGLDFIRLTTPTTDDDRL
FT                   PTVLAGSSGFVYYVSVAGVTGAGAATLDHVEEAVARLRRHTDLPVCIGFGIRTPEHAAE
FT                   VAKRAEGAVVGSALIDKIAEAKSPQQAIDGVLGLCRELAEGVRGARR"
FT   gene            complement(68382..69617)
FT                   /locus_tag="Pmen_0071"
FT   CDS_pept        complement(68382..69617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0071"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82845"
FT                   /db_xref="GOA:A4XNC9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNC9"
FT                   /protein_id="ABP82845.1"
FT                   /translation="MTAMPGSQNSFRTGPDARGLFGRFGGQFVAETLMPLINSLAAEYE
FT                   KAKSDPAFLEELAYFQRDYIGRASPLYYAERLSQHFGGAKIYLKREDLNHTGAHKINNC
FT                   IGQILLAKRMGKQRIIAETGAGMHGVATATVAARFGMQCVVYMGTTDIDRQQANVFRMK
FT                   LLGAEVIPVTAGTGTLKDAMNEALRDWVTNVHNTFYLIGTAAGPHPYPAMVRDFQSVIG
FT                   NEVREQILAKEGRLPDSLVACIGGGSNAIGLFHPFLDDEGVQIIGVEAAGHGIDTGKHA
FT                   ASMAGGAPGVLHGNRTFLLQDEDGQITDAHSISAGLDYPGVGPEHAWLHEIKRVEYVPI
FT                   SDDEALEAFHHCCRLEGIIPALESAHALAEAFKRAPKLPKDHLMVINLSGRGDKDMQTV
FT                   MHHMQDNQEKHA"
FT   gene            69732..70400
FT                   /locus_tag="Pmen_0072"
FT   CDS_pept        69732..70400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82846"
FT                   /db_xref="GOA:A4XND0"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:A4XND0"
FT                   /protein_id="ABP82846.1"
FT                   /translation="MKDRWLWTFPVVGAFLVAIALVLQIHRWNEEERMLRTTGSVVAVM
FT                   GRGCPLVEFFPLPGERVTFTGEVCSRPGYAKGDIVELFYDPLEPQNAHIDSFLQNWFVS
FT                   LILGGIGLFFTLVGLALLMPEALVDGRRNRLKRKGQAVQAQFVEVRRNPLSTLNNVPAW
FT                   QLVCQWYNPSSGAVHLFYSEDLWFDPQPFIENEFLQVMVDPDDLRRYSVDTSFLPRLAD
FT                   "
FT   gene            70405..71316
FT                   /locus_tag="Pmen_0073"
FT   CDS_pept        70405..71316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0073"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82847"
FT                   /db_xref="GOA:A4XND1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:A4XND1"
FT                   /protein_id="ABP82847.1"
FT                   /translation="MNRDLPPLNALRAFEAAARLQSVSRAGEELHVTHGAISRQIRVLE
FT                   EQLGVSLFDKDGRGVKLTEAGVRLRDAAGDAFERLRGVCAEIRQRQEGAPFVLGCPGSL
FT                   LARWFIPRLDRLNRDLPELRLQLSASEGELDPRRPGVDATLCFATPPWPADVQVHELDT
FT                   ERIGPVLSPRYAGYEALRGAPAAALLGEPLLHTVSRPQAWPQWALAQGLEPARLQQGQG
FT                   FEHLYYLLEAAAAGLGVAIAPQQLVADDLAAGRLLAPWGFVETGAKLALWVPGRGHDLR
FT                   AERLAGWLAAELNGLAALRSPV"
FT   gene            71370..71609
FT                   /locus_tag="Pmen_0074"
FT   CDS_pept        71370..71609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82848"
FT                   /db_xref="UniProtKB/TrEMBL:A4XND2"
FT                   /protein_id="ABP82848.1"
FT                   /translation="MKESRDYLEMAFRSIKCFADDGKLLVHELESLVDIARRDGVVDAN
FT                   EKRILQGIVARLNPAELTADMQTKIAALRAELQF"
FT   gene            71708..71923
FT                   /locus_tag="Pmen_0075"
FT   CDS_pept        71708..71923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0075"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82849"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A4XND3"
FT                   /protein_id="ABP82849.1"
FT                   /translation="MTDHHTYKKIEIVGSSRTSIEDAIENALSECAKSVRNMDWFEVVE
FT                   TRGHIEDGKVGHYQVTLKVGFRLSGS"
FT   gene            complement(71892..72869)
FT                   /locus_tag="Pmen_0076"
FT   CDS_pept        complement(71892..72869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0076"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82850"
FT                   /db_xref="GOA:A4XND4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4XND4"
FT                   /protein_id="ABP82850.1"
FT                   /translation="MRVLITGAAGFIGHQLLDELAIQHPQWTLIAADIRALDSRGLKAN
FT                   VEPVLLDMGRPAQVRACVAGWKPDAIVHLATVIRPPRDMSEAHLHAIEVGGTQCLVDSA
FT                   IANGVRQLIVTSSGAAYGYAPENAEWIDENQPLRGHPHFVYARHKLEIEQLLARSRAQH
FT                   PQLHQLILRPGTILGRRLNNPISDLFKKRAVLGVRGHDSRFVFIWEQDVVGIIRQGLET
FT                   AREGIYNLAGDGALSLAEIAEILGKPYRPVPATLLAAALRLLKPLGLSQYGPEQLDFLR
FT                   YRPVLANQRLKEEFGYQPRYTSREAFLAFLNAQGISYRSGESRP"
FT   gene            73153..73734
FT                   /locus_tag="Pmen_0077"
FT   CDS_pept        73153..73734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82851"
FT                   /db_xref="UniProtKB/TrEMBL:A4XND5"
FT                   /protein_id="ABP82851.1"
FT                   /translation="MFRSMLMLLAALALGGCIESETPLVEERRLLLSGEDFSAYDAPDG
FT                   GRYEKLVTYAARSIDLSFESEGSDWFYLYSGVSLYPRASDALMTSYAETFGASFGLRGS
FT                   GLVEQELPLQTKLAARASLKLLTQDGEPVGNLFYATVGNKSMFTIFTGVYFERAEDFEA
FT                   FVAPKLLALRQYKHDDPLLTWAGRTLGFDE"
FT   sig_peptide     73153..73215
FT                   /locus_tag="Pmen_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.581 at
FT                   residue 21"
FT   gene            complement(73972..75201)
FT                   /locus_tag="Pmen_0078"
FT   CDS_pept        complement(73972..75201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0078"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82852"
FT                   /db_xref="GOA:A4XND6"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A4XND6"
FT                   /protein_id="ABP82852.1"
FT                   /translation="MLNGLWLSFFLLGAIAALARWLIGGDATVFGAMVESLFAMAKLSV
FT                   ELMVVLFGTLTLWLGLLRIAEKAGLVDLLARLLGPLFARLMPEVPRGHPALGLISMNFA
FT                   ANGLGLDNAATPIGLKAMRALQDLNPSATTASNAQILFLVLNTSSLTLLPVSIFMYRVQ
FT                   QGAEDPTLVFLPILLATSASTLAGLLAVALVQRLRLWDPVVLAYLIPTALLLGGFMALL
FT                   AGMSATALAALSSLLGNLTLFGLIMLFLLVGALRRVAVYESFIEGAKDGFDVAKSLLPY
FT                   LVAMLCAIGVLRASGALDFGLDGIRWLVEALGWDTRFVDALPTALMKPFSGGAARAMLI
FT                   ETMENFGVDSFPALIAATVQGSTETTFYVLAVYFGAVGLQRARHAVGCALVADAAGIIA
FT                   AIGVCYWFFG"
FT   sig_peptide     complement(75142..75201)
FT                   /locus_tag="Pmen_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.971 at
FT                   residue 20"
FT   gene            complement(75366..75827)
FT                   /locus_tag="Pmen_0079"
FT   CDS_pept        complement(75366..75827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82853"
FT                   /db_xref="GOA:A4XND7"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:A4XND7"
FT                   /protein_id="ABP82853.1"
FT                   /translation="MQLMHAIAAALLMGGALAAQAADRDAAFHPGELLTSNAEYREAWQ
FT                   DLVKNEERLPDWLINLSGLSTPMQAVEADSDRYLVGQVCEAHNCFSQRAYIAFEWEDDD
FT                   AYALYVQVPEGLPEDRAPSEHASLRWLGEPSEEIQQMLMEQLRNDPNWY"
FT   sig_peptide     complement(75762..75827)
FT                   /locus_tag="Pmen_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            complement(75838..76002)
FT                   /locus_tag="Pmen_0080"
FT   CDS_pept        complement(75838..76002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0080"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82854"
FT                   /db_xref="GOA:A4XND8"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XND8"
FT                   /protein_id="ABP82854.1"
FT                   /translation="MLSWALTFLIIAIIAAVLGFGGIAGTAAGIAKILFVVFLVLFIIS
FT                   FIMGRRPRM"
FT   sig_peptide     complement(75922..76002)
FT                   /locus_tag="Pmen_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.240 at
FT                   residue 27"
FT   gene            complement(76022..76294)
FT                   /locus_tag="Pmen_0081"
FT   CDS_pept        complement(76022..76294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82855"
FT                   /db_xref="UniProtKB/TrEMBL:A4XND9"
FT                   /protein_id="ABP82855.1"
FT                   /translation="MHRSRGWKRKGRTCHSPQCDRRTAMWIVALVLAALLLLLSLILAS
FT                   VLLVGQTLCASRNTTAELDLPEGSPRQPAIPSNPQHPWPAWAATH"
FT   sig_peptide     complement(76142..76294)
FT                   /locus_tag="Pmen_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.305 at
FT                   residue 51"
FT   gene            76571..76972
FT                   /locus_tag="Pmen_0082"
FT   CDS_pept        76571..76972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0082"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82856"
FT                   /db_xref="GOA:A4XNE0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNE0"
FT                   /protein_id="ABP82856.1"
FT                   /translation="MNDYEQEDPIPQGDLALQITALPRETNGFGDIYGGWLVSQMDLAG
FT                   TAMASKVAGGRVATVAIDRMAFLVPVAVGAQLSFYTQALEVGRSSIQMMVEVWSDDPLS
FT                   NEWRKVTEAVFVFVAIDGSGRTRPVPARR"
FT   gene            complement(77048..77680)
FT                   /locus_tag="Pmen_0083"
FT   CDS_pept        complement(77048..77680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0083"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82857"
FT                   /db_xref="GOA:A4XNE1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNE1"
FT                   /protein_id="ABP82857.1"
FT                   /translation="MTAATIRIALIDDHALVREGIRALLEVLPHFQVVGEAGSGAEAFD
FT                   LLQRTPVDILLMDVGLRDINGLELTRQLRERYPAIKVLMLSMYDNQEYVSSSLAVGASG
FT                   YVLKEAPSREIVAAIEAIAAGGSFYSGDIARKLVKPAPSEDELTPREREVLLMLAQGLN
FT                   NKVMARTLQISVRTVETHRLSIRRKLAIDKPADLLKHALAHGWVPYD"
FT   gene            complement(77721..79070)
FT                   /locus_tag="Pmen_0084"
FT   CDS_pept        complement(77721..79070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0084"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, dimerisation and
FT                   phosphoacceptor region; Cache, type 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82858"
FT                   /db_xref="GOA:A4XNE2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR017171"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNE2"
FT                   /protein_id="ABP82858.1"
FT                   /translation="MQLKHKIVALSVLPLLLAVAVVCVLVFFQNQRLGEQQARLIEDSI
FT                   LASKRVELKHYVEMALSIISPLYESGRDDAEIKQQVLGVLARISFGSDGYFFVYESNGR
FT                   NLMHPRQGELVGQDLWNMTDPRGLLVIQALMQSAQSGDGFQLYAWQKPSTGEVTDKLAY
FT                   VVMLERWGWMLGTGIYLEDVDQAIAQVHDEASNGIHATMLAIAGVALVAVLLVFAGGLA
FT                   LNLSEHRLADRKLQLLTQRIVSLQEEERSRVSRELHDGISQLLASIKFQFELASLELAS
FT                   GNEQGLDTLHKGTERLAGAIGEVRRISHDLHPSLLDTLGLPAAIAQLVAEFEQRSGLLI
FT                   DYKNDLGDTLLNDGMAVALFRILQEALTNIERHAQANTVAISLDGRARRVRLRVRDDGV
FT                   GFSSRHFDTLTGGIGLRNIRQRVEHFGGRFALTSQPGHTELMVTLPLPTP"
FT   sig_peptide     complement(78966..79070)
FT                   /locus_tag="Pmen_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.399 at
FT                   residue 35"
FT   gene            complement(79640..80740)
FT                   /locus_tag="Pmen_0085"
FT   CDS_pept        complement(79640..80740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0085"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82859"
FT                   /db_xref="GOA:A4XNE3"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNE3"
FT                   /protein_id="ABP82859.1"
FT                   /translation="MKRRDILAAAGVGLAATALVGCKEEAKSAAAPQEGSSSQTFNWKM
FT                   VTSWPKNFPGVGVGAERFAKLVEEMSNGRLKIKVYAAGELVPALEVFDAVSRGTAEMGH
FT                   GAPYYWKGKVPAAQFFCASPFGPNAQEMNAWLHRGGGQQLWEEVYKPFGVLPMACGNTG
FT                   VQTAGWFNKEINSVDDFKGLKMRTPGLGGEVLTKMGGTVVNMPAGEIFTAMQTGAIDAT
FT                   EWIGPYNDLALGLHKAAKYYYTPGWQEPSVLFELDVNLKAWDTLPADLKAIVRAAARDV
FT                   NGDMLDDYNAKNMEAMEQLKADGVEVRRLPDEVLARLKEVAAEVVDASAAADPAASKVW
FT                   EHQKAYLKRLYEYAESNEKDIYNIRG"
FT   sig_peptide     complement(80675..80740)
FT                   /locus_tag="Pmen_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.440 at
FT                   residue 22"
FT   gene            80925..81467
FT                   /locus_tag="Pmen_0086"
FT   CDS_pept        80925..81467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0086"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82860"
FT                   /db_xref="GOA:A4XNE4"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNE4"
FT                   /protein_id="ABP82860.1"
FT                   /translation="MPNPPPLLGLARFIDACNALFGKACAWLTLFLVIGTAIVVVLRYG
FT                   FGIGATALQEAVLYAHALVFMGAAAWVLQRNGHVRVDIFFQKFSGRRQALVEILGTLLF
FT                   LLPVALFLGWASWDYVSNSWATREASGESGGLKFVYLQKSIILVLVVSLALQGVSNLIK
FT                   ALYVISGRLPAPEVKHG"
FT   gene            81460..82836
FT                   /locus_tag="Pmen_0087"
FT   CDS_pept        81460..82836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0087"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82861"
FT                   /db_xref="GOA:A4XNE5"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNE5"
FT                   /protein_id="ABP82861.1"
FT                   /translation="MAELMAILLFVSICLALMAGYPVAFTLAGVSLLFAGIGVLTGTFD
FT                   AGYLSALPNRLFGIMNNQTMLAVPLFVFMGVMLERSRVAEDLLESMSRLFGTLRGGLAI
FT                   SVCVVGALLAASTGIVGATVVTMGLLALPTMLRRGYDPAISTGTLAATGTLGQIIPPSI
FT                   VLVLLGDVMSSAYQQAQLKMGIFSPKTVSVGDLFVGALLPGLLLVGLYILYIVGTAIFQ
FT                   PKKLPALPQEELGPIEWGKLIKALVPPLILIGAVLGSILAGYATPTEAAALGAVGAMLL
FT                   AASKGKLNFGQLKEVAYGTTEISAMVFMILIGASLFSLVFRGFGGEHMIEEVFAQLPGG
FT                   VLGAFFLVMLVIFLLGFILDFIEITFVVVPIVGPVLLAMGLDPIWLGVMIALNLQTSFL
FT                   TPPFGFALFYLRGVTPASVATSTIYKGVVPFILIQILLLVIAYMFPGLITWLPEQVYGK
FT                   "
FT   sig_peptide     81460..81534
FT                   /locus_tag="Pmen_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.856 at
FT                   residue 25"
FT   gene            82941..83843
FT                   /locus_tag="Pmen_0088"
FT   CDS_pept        82941..83843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0088"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82862"
FT                   /db_xref="GOA:A4XNE6"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNE6"
FT                   /protein_id="ABP82862.1"
FT                   /translation="MSNTQVERVELDQLICWRIRTQRSELLVAQQGAQILAYQRDGQPP
FT                   LIWLSPEAAYQRAQSVRGGVPICWPWFGDLRRNPQAVQAHYQQVEAPAHGLVRGLDWQL
FT                   LGIDEEGEQVTLRFAFDTQREPLAGWPHAALLQFEIRLADDLAMSLQTHNRGEAPLTLS
FT                   QALHTYFAVSDVRQVSVDGLQGCRYVDTLQDWRELRQDAELRFVGETDRIYMDTPARLS
FT                   IVDPGWGRRIHLDCSGSRSAVLWNPWVDKARRLSQFPDDAWQNMLCIETANLLEDVVQV
FT                   KPDEWHRLDLRLSSDSFGH"
FT   gene            84279..85841
FT                   /locus_tag="Pmen_0089"
FT   CDS_pept        84279..85841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0089"
FT                   /product="ImpA domain protein"
FT                   /note="PFAM: ImpA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82863"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017739"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNE7"
FT                   /protein_id="ABP82863.1"
FT                   /translation="MTYSSKLTAHYLNLAKSPINEGNFAGEDVRYSSEYEMLETELGKA
FT                   SSLHETGAIDWQKVREGSENLLTTQSKDLRAATWLTWGLFQRESFAGLQAGLNLLHYLC
FT                   EHHWHELHPRKARTRTAAINWLLPRLEQALAEHVPISEQLPLFRRLAEHLHGLEAALSS
FT                   HLGEDSPLLLPLCRRLDEQIKRASQGQAEPGAVGAAIAQVKQVATQIITGSGPIESEKD
FT                   AHKALRSQQDAARPLCAWWLKNKATDLKPLRLARTLLWLPIESLPERNAEQITALRGLP
FT                   ADKLASYKERFAQGAYADLLADLEASIARAPFWLDGQRLVWECLQELKAEQAMREVEIQ
FT                   LALFLQRVPGLDELRFHDGVPFADAETRAWIGAHVLPHLQAPEVEKKPAASEQGATPPW
FT                   EEALQQVLPGLRKDGLKAAVQQLKQGMSRARGGRERFFWQLTLARLCFAAKKYDLAKTQ
FT                   LESLDQTLQAAGLGEWEPDLALDVLRLLHHCCELLPQNHAVRDSKDEIYRRLCHLDLEV
FT                   VLE"
FT   gene            85896..86402
FT                   /locus_tag="Pmen_0090"
FT   CDS_pept        85896..86402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0090"
FT                   /product="uncharacterized conserved protein UCP028301"
FT                   /note="PFAM: uncharacterised conserved protein UCP028301"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82864"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNE8"
FT                   /protein_id="ABP82864.1"
FT                   /translation="MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLMVLGDFTQRAD
FT                   DRKIEDRKPISIDKNSFDEVLAKQELNLTFAVPNRLQDEQTDDELAVQLRINSMKDFNP
FT                   ANLVEQVPELKKLMELRDALVALKGPLGNAPAFRKAIESVLSDDDSRDRVLGELGLAAK
FT                   DKLDS"
FT   gene            86428..87906
FT                   /locus_tag="Pmen_0091"
FT   CDS_pept        86428..87906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0091"
FT                   /product="protein of unknown function DUF877"
FT                   /note="PFAM: protein of unknown function DUF877"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82865"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNE9"
FT                   /protein_id="ABP82865.1"
FT                   /translation="MSTTSAAVESSHSAAELGILDRIIAETKLTPDDEAYDIAKRGVSA
FT                   FIEELLKPQNENEPVKKAMVDRMIAEIDAKLSRQMDEILHHPDFQALESSWRGLKLLVD
FT                   RTNFRENIKLEILNASKQDLLDDFEDSPEIVQSGLYKHIYTAEYGQFGGQPVGALIANY
FT                   YFDPSAPDVKTLQYVASVACMSHAPFIASAGPKFFGLETFTGLPDLKDLKDHFEGPQFT
FT                   KWQSFREQEDARYVGLTVPRFLLRNPYDPEDNPVKTFVYKENVANSHEHYLWGNTAYAF
FT                   ASRLTDSFAKFRWCPNIIGPQSGGAVEDLPLHHFESMGEIETKIPTEVLVSDRREYELA
FT                   EEGFIALTMRKGSDNAAFFSANSAQKPKFFGISEEGKTAELNYKLGTQLPYMFIVNRLA
FT                   HYLKVLQREQIGAWKERTDLELELNKWIRQYVADQENPSSEVRSRRPLRAAQVIVSDVE
FT                   GEPGWYRVSLNVRPHFKYMGADFTLSLVGKLDKE"
FT   gene            87913..88341
FT                   /locus_tag="Pmen_0092"
FT   CDS_pept        87913..88341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0092"
FT                   /product="GPW/gp25 family protein"
FT                   /note="PFAM: GPW/gp25 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82866"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNF0"
FT                   /protein_id="ABP82866.1"
FT                   /translation="MNGYGSLFERLGGEAGQRAGWSREVAAMASVAAHLAKMLSTRAGS
FT                   VQTLPDYGLPDLNDMRLSLHDSLQQARIAIERFIEAYEPRLTQVRVISLPRTHDPLRQA
FT                   FAIDAMLEMDGVRRQVSFSASLDGSGQVKVNPGASHVR"
FT   gene            88331..89776
FT                   /locus_tag="Pmen_0093"
FT   CDS_pept        88331..89776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82867"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNF1"
FT                   /protein_id="ABP82867.1"
FT                   /translation="MSGKPAARLGDPTACPIPGHGTNPIAAGSPDVLFDSLPAARMGDA
FT                   SACGGAMAGAVIPNVLINGKPAAVVGSVGSHGNTVVAGSGTVLIGASGGGAAFSPVAPL
FT                   SLVAAAASVINVLVPPAQAAEERALDYTIALQRGGNRVLTPLRIPDYEEIGQGTTNNRE
FT                   TIDFQIRNRKQPADSLTLEVYDGETLLHSEADTAALLPTGEHQWQWDGYDRSGVLDTRV
FT                   LKSPNLLVRLTVKKGAEEQVSELRLDNSAAAAPWVDARVDRNAGSVEITLRPSFSDGGV
FT                   SGRNNQLTARTFDELKVLAKAGVEYYWSREGSRAGGIDKPIQTAKGAFQVKVIADVNAK
FT                   PSAKNFPLIASIGDDFGRSTSFAMFKKIYHNLGMWAAANYPANFADEDFAHTAAHEVGH
FT                   LILNEYGDGGLIPAYSWSHKSTSTILTQAPVDNHPIPAAGEIDLMHYHSHSPRNYQDYW
FT                   QRSIASENDVKGLLWLTRVKFDD"
FT   gene            89769..90155
FT                   /locus_tag="Pmen_0094"
FT   CDS_pept        89769..90155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82868"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNF2"
FT                   /protein_id="ABP82868.1"
FT                   /translation="MTKHVLCLLSILLAGCSSQPKSVFIANFENVCGYTVEVSTHDYSN
FT                   AKGSFPAGQRLAADDSIEVLSYIVFNETLEDSVPGTYRLDIAAHGKSVSLDKQRLLAHL
FT                   KRSPIEQKGNAITIWTINDTSLCP"
FT   sig_peptide     89769..89825
FT                   /locus_tag="Pmen_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.470 at
FT                   residue 19"
FT   gene            90186..91976
FT                   /locus_tag="Pmen_0095"
FT   CDS_pept        90186..91976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0095"
FT                   /product="protein of unknown function DUF879"
FT                   /note="PFAM: protein of unknown function DUF879"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82869"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNF3"
FT                   /protein_id="ABP82869.1"
FT                   /translation="MSFNHYYQSELTALRQLGKRFAERSPALAPFLGQAGRDPDVERLL
FT                   EGFAFLTGRLRQKLDDELPELTHSLMHLLWPNYMRPLPAFSMLQFDPLTRPGPALPVKR
FT                   GTPVEAKAIEGVTCRFRTCYPTEVLPLALNGLDYSVKGDGALLSLRLGMSADGHLGEIG
FT                   LNKLRLHLAGERYIGQMLYLALLRNLGGIQLVLLDAAGKPMQDAFGQTLGTLQLKPEQV
FT                   QPVGFAEDEALIPYPLNTFRGYRYLQEYFAFQDKFLFVDLLGLDAIHGLPEDLLKQARG
FT                   LELRFDIHKAGVQRIRPTLENVRLYCTPVVNLFQHDAIPIRLDGKQDQYLLLPAEFDAQ
FT                   HCGVFSVDRVTGWKPGGMGYEEYVPFESFEHDPSFDVPVARPHYSVRQQPSMLGDGLET
FT                   WLSFGLRNLDQHETLSIELTCTNQNLPRQLSLGDICLPSEDTPDFLSFRNISAVTPCYA
FT                   PPLHRDFLWKLISNMSLNYLSLANVEALKVILETYDLPRYYDQHAERVSKRLLGGLKSI
FT                   GHRHVDRLHRGLPVRGVRTELTMNPDGYLGEGDLFLFASVLNEFFALYASLNSYHELHV
FT                   QSTQGELYKWTPRMGQQPLL"
FT   gene            91940..92947
FT                   /locus_tag="Pmen_0096"
FT   CDS_pept        91940..92947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0096"
FT                   /product="protein of unknown function DUF1305"
FT                   /note="PFAM: protein of unknown function DUF1305"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82870"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNF4"
FT                   /protein_id="ABP82870.1"
FT                   /translation="MDATHGAAAPALNRLSRGIREYSLFQAVQLVLERLKVAHPQLDDE
FT                   RLYEYLEFQANPSLGFPGSDIDRVQFFEEHGELRARMRVNLVGLFGGGSPLPAFYSEQA
FT                   LGDSEDGNPTRDFLDLFNNRLQRLLLPIWQKYRYRASFQSGAMDAFSAHLFALIGLGSE
FT                   QIRQAQELNWKRLLPYLGLLSLRAHSAALIESVLRYYFKHAELFIEQCLERQVVVLEEQ
FT                   RNRLGRANSLLGEDTVLGERVRDRGGKFRIHVRQLGWTRFHEFLPIGTGYQPLCALVRF
FT                   TLRDPLDYDIRLELRQDEIRDLRIGEGNPCLLGWTTWLGRENADGLVTLGSKIH"
FT   gene            92959..95559
FT                   /locus_tag="Pmen_0097"
FT   CDS_pept        92959..95559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0097"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82871"
FT                   /db_xref="GOA:A4XNF5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNF5"
FT                   /protein_id="ABP82871.1"
FT                   /translation="MINVDLQQLVQALDAASKRDLEMAAERCVVRGGNKILVEDLLLGL
FT                   LERPESLLARALQDAEIDAGELAQALQPRGEHSESRNPVFSAELVQWLQDALLVANLEL
FT                   GASQIDQAALILALLRNPMRYAGSRYQTLLSKLNAERLRDFALSQQPQAAGGKAAAPGE
FT                   SNLARFTHNFTQQARDGKLDPVLCRDGAIRQMVDILARRRKNNPIVVGEAGVGKTAIVE
FT                   GLALRIATGEVPQVLKGVELLCLDLGLLQAGASVKGEFERRLQGVIDEVKASPKPIILF
FT                   IDEAHTLIGAGGQAGSGDAANLLKPALARGELRTIAATTWSEYKKYFEKDPALARRFQP
FT                   VQLHEPTVDEAVTILRGLAPVYEKSHGIYLRDDAVVAAAELSARYLAGRQLPDKAVDVL
FT                   DTACARVRISLAAAPEALERLRGEIAEGERQGEAMRRDLDAGLSIDGEALDALETRLVA
FT                   ARAELEQVETRWAIQRDLAERLLEQRKQCAAARLAGDAEETDEPRASLEELEAELRALQ
FT                   AELAAAQASERLVSFEVCPRLVAEVISHWTGVPLSQLAREHNTKVITFADDLRQRVRGQ
FT                   EQAIQALDKAMRATAAGLNRPDAPVGVFLLVGPSGVGKTETALALADLLYGGERFLTVI
FT                   NMSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVILLDEVEKADPDVMNVFY
FT                   QIFDKGVANDGEGREINFRNTLILMTSNLASERIASLCAGGERPGAEDLELAIRPQLTQ
FT                   HFKPALLGRMRVVPYYPMDGDLLRQLVGLKLARFGERLARRQLAFSHCDGLVEHLAERC
FT                   THGDSGARLIDHLIDQHLQPLVVDRLLDAMASGETLQQVRATLNGEGTVVCEFA"
FT   gene            95546..97078
FT                   /locus_tag="Pmen_0098"
FT   CDS_pept        95546..97078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0098"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82872"
FT                   /db_xref="GOA:A4XNF6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNF6"
FT                   /protein_id="ABP82872.1"
FT                   /translation="MSSLNPSLMFSQIPQPLRYAEALLQRFAQLARHASADALLGGLVE
FT                   AAAQLSASELSQLYLLDATHTRLTLSAEWQDGQLQRRAEASLPSDYDGEQLLQYCLCQN
FT                   QLLSLTELDSSLHSIGFLPESGQPWRSLLCQPLLDEHRQVNGLLLIASHKPRELQGFAG
FT                   SLGQLGGFAIAQLHLLQRLRAPQSEAATQPTPSCASGYGLIGDSPAMRNVYQLIGKVLH
FT                   NSVSVLLTGETGTGKELVARAIHDCGSRRSKAFVVQNCASLPENLLESELFGYRKGAFS
FT                   GADRDHQGLFDAANGGTLFLDEIGDMPLSLQAKLLRVLQEGEVRPLGSTRTHKVDVRIV
FT                   SATHHNLRSLVEEGRFREDLFYRLSHFPIELPPLRARGEDILRLARHFAVEAACFLQRD
FT                   AYRWSEAALEHLAGYAFPGNVRELKGLIARAVLLCEGGELLPEHFSLEQTPSEGSAPLS
FT                   LRERMDRVERNLLLDCLRKNRGNQTNAANELGLPRRTLLYRMQRLKISPSEV"
FT   gene            97126..97260
FT                   /locus_tag="Pmen_0099"
FT   CDS_pept        97126..97260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82873"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNF7"
FT                   /protein_id="ABP82873.1"
FT                   /translation="MLHRYRTAALLALALVLAGCTGNYKFSDDQYRPLGDPQAEKRGH"
FT   sig_peptide     97126..97203
FT                   /locus_tag="Pmen_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.462 at
FT                   residue 26"
FT   gene            97281..98477
FT                   /locus_tag="Pmen_0100"
FT   CDS_pept        97281..98477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0100"
FT                   /product="putative FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82874"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNF8"
FT                   /protein_id="ABP82874.1"
FT                   /translation="MELVFEMVSAQQFVPGLLTTKTFKQAGGVIGRAEDCDWVIPDRKR
FT                   ILSSRHAEVSYRDGAFYLTDTSSNGIALKDSGASLAKGRPQRIEHGSVYCLGDFEIRAR
FT                   LIQDPAMFEGDIGLPQAAGSIIPDDAFLDLDPLTALEQQERVYAEVDDLTAVLRPSTAQ
FT                   AQQRDYAQIDEENLLVPELVMPTPPAQPKPAPEPERLPPSFWEKFADALGVRLDDLDDD
FT                   AREALALNAAKLLRQSVGSLQQALRTRGELKNELRLALTTVQGAGNNPLKHGLDSGETL
FT                   TALLRGGKPGQLPAEQAISRGFRDLQAHQVALLAASRAAVKGMFEQFAPEQLAMRFERN
FT                   GRKPLLATAGSRWRAYRRLHADLAQNDDWSDRLFTRDFASAYEEQVRLIATLNTDLQG"
FT   gene            98483..98965
FT                   /locus_tag="Pmen_0101"
FT   CDS_pept        98483..98965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82875"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNF9"
FT                   /protein_id="ABP82875.1"
FT                   /translation="MPRLLSLAFIAALLSLAGCAALSPYSSMTKLDLSLAGSDQLNPDL
FT                   HGRPSPIVLRLMELKHPVAFENADFFSLYQRPKEALAPDLVTLEELELRPGETRELKLS
FT                   VGEGSRYVGVLAAYRDLPEANWRYVIAIDEQQRNQARLRLDERGIRNLDAEQERSR"
FT   sig_peptide     98483..98545
FT                   /locus_tag="Pmen_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.788 at
FT                   residue 21"
FT   gene            98962..100293
FT                   /locus_tag="Pmen_0102"
FT   CDS_pept        98962..100293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0102"
FT                   /product="protein of unknown function DUF876"
FT                   /note="PFAM: protein of unknown function DUF876"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82876"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNG0"
FT                   /protein_id="ABP82876.1"
FT                   /translation="MSQHKVIWQEGMLLRPQHFQQNDRYFEHQLKVRTQKLDSYAWGFF
FT                   ELEIDRQFLNMGKLVVSKASGVLPDGSLFDLGAEREPLGLDVPPNTGNTPVYLALPLVT
FT                   GNHIESRRPEQKDVLARYVAFDEEVADCNAGGSSHSQVSTGRPDFRLLLGEQQSDQAYV
FT                   KLKLCEVLDTTPDGVISLDPEFSPTYVNFQASGYLLSCLKEVISMLAHRGDILAERIRA
FT                   TGKVGGAEVGDFMMLQLINRYEPILRHHLGVEQVHPEQIYRELVGLLGELATFSSETKR
FT                   PRLEGRYLHSDQGMSFRKLMDAIRQVLSMVLEQHAIEMLLQQRQYGIQVSPLHDHKLLG
FT                   TSSFVLAASAQCDSEELRQRLPAHLKVGPVERIRQLVNLHLPGIKVKPLPVAPRQIPFH
FT                   SGKTYFALELSSEELAQLERSGGFAFHVSGEFSGLELKFWAIRN"
FT   gene            100296..101177
FT                   /locus_tag="Pmen_0103"
FT   CDS_pept        100296..101177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82877"
FT                   /db_xref="GOA:A4XNG1"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNG1"
FT                   /protein_id="ABP82877.1"
FT                   /translation="MTIKEMEYGQDDKTVILNRKGEARAESPLTDFSAPPKFEQLEERM
FT                   IFAARLRPAESFNISLNPLVAAASALLSEVVRLKHSFESEDLDALNQRLTREIKLFEHR
FT                   ALHDGAESSQVMAARYVLCTVVDEAVVTTPWGNESQWSQMSLLSSFHNETFGGEKFFQL
FT                   LERLSRNPVKHLPMLELMYLCLSLGFEGKYRVLPRGMLELEAVRDSLYRQIRQLRGDVP
FT                   REVSPHWQGLKDTRRRLVRIVPWWLVALFTLMCLVMMYAGFAWVLGEQRDTVLKPYQQL
FT                   DPASGVSMDDVK"
FT   gene            101174..104713
FT                   /locus_tag="Pmen_0104"
FT   CDS_pept        101174..104713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0104"
FT                   /product="ImcF domain protein"
FT                   /note="PFAM: ImcF domain protein; protein of unknown
FT                   function DUF1215"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82878"
FT                   /db_xref="GOA:A4XNG2"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNG2"
FT                   /protein_id="ABP82878.1"
FT                   /translation="MKSFFAKLGAFFRKTWVWSLLLVLVLALLVWFVGPLLAVDDYKFW
FT                   ESATSRLLTISLLFLLWGLAMVFASWRATARKKAEENDAEAQERLRREEQIGEEQNELR
FT                   HRFKDALRTLKRSSLYRGRSEKWRNDLPWYLLLGPQGSGKTSLLDFSGLDFPLNRGDSQ
FT                   RLTKDVSGTRYADWYFADHAVLIDTAGRYLTQPDAQVDGRAWGTLLGLLRQRRARPLNG
FT                   VLVSIPVEQLQGGSEVELETLARQTRQRLHEIHQRLGADVPVYLVLSKADKVLGFDEFF
FT                   DQLSREESEQVLGASFRKEQNASDVAVVRQEFEELLRRLNSQVILRMHQERDTQRRGRI
FT                   LDFPHQLGQIGERLCLFIELAFAGNRYQRASKLRGFYLTSAPQLNEQLDPLTAGIGRNL
FT                   GLAGSALPTFRTGRARFINHLLSRVIFPEADLAGLDQKEVRRIDWGQRAMYATAFAVLA
FT                   LFGVLWASGFSANHGRLEQLREIAQKLTREHQAINPQDDALQTLKALDSSYAATLVFPP
FT                   KGEVSYLQRTGLFQGEAVNPAVYSTYRAELETLLLPRVARQLEAQIRANLGDRERLLGS
FT                   LRAYLMLNLEQRRDAAFLKEWVAADWSLRYAGNSPAQHGLNTHFARLLDESFAPYALNA
FT                   QLVAQARQVLRSESLANVVYRMLREQARSLPDYRLSQKLGPQAGLINGSDYAIPGFYTQ
FT                   AGYSKTFTAQGGNLVREILRDNWVLGEGESLSAGDLGRLMVELEQLYFRDYGNYWGEAI
FT                   AQLSLEPIGSAGRGAALLGGLTAANSPLLQLLVEVRDNTRFKGLAEAADDAGAAAEALE
FT                   GAKGKLGKAAKLASAAAEQAQQALAKNTPDTARKTLERRFEVLHKLLDDNGGAGVELAA
FT                   SLQALDELQRQLASLANAGASDQAAFEMAKARMAGKRDAINQVRSAAARLPQPVGNWLA
FT                   LLAEDSWTLVLNDAYHFLNQRYQSELYAAYDNSLKQRYPFSAHSESDVAVADFREFFKA
FT                   QGIAERFFDQYLRPFVSGSADEYRLRRVDGRGLPLSREFLLQMSRAQVIRRSFFAENPA
FT                   EPQVLFKLEPYSLDSSLSRADFRFGKQQLEYRHGPIVATAFRWPAASEEDRTSLVVEEL
FT                   GGRRVGIEKNTGPWSLFRLLDLMDVDYHSGRDVLILKANLGGLHANYLLHSQRSPNPFD
FT                   IGLLRSFKLPATL"
FT   sig_peptide     101174..101290
FT                   /locus_tag="Pmen_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 39"
FT   gene            104713..105441
FT                   /locus_tag="Pmen_0105"
FT   CDS_pept        104713..105441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0105"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein; Stage
FT                   II sporulation E family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82879"
FT                   /db_xref="GOA:A4XNG3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNG3"
FT                   /protein_id="ABP82879.1"
FT                   /translation="MPAVVNAWRSAARTDTGKVRARNEDAFLALPEQGLWVVADGMGGH
FT                   QNGALASRLIVEQLAELAQGSLEQRLVELRQALHRLNHRLGQELTVTADRPDTVIGSTV
FT                   VALLLDGDRAACVWAGDSRCYLWRGARLYQLSRDHSLVQQLIDEQGLTPQEAARHPAAH
FT                   ALTRAIGASETLQLDILELDVLPGDVFLLCSDGLYQGVSADELGACLNLPSPHLAVERL
FT                   FQRVLDGPARDNLSAVVIRQ"
FT   gene            105438..106409
FT                   /locus_tag="Pmen_0106"
FT   CDS_pept        105438..106409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0106"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82880"
FT                   /db_xref="GOA:A4XNG4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNG4"
FT                   /protein_id="ABP82880.1"
FT                   /translation="MIEAAEASDLTYFALAATAAREPVRETPRQAPGELPEVLGGRYRI
FT                   ERLLGVGGMGAVYRARDLLREQFGDPEPYVALKTLSDDFAEYPDANALLYSEFALTARL
FT                   SHPNVVRLFGFEVDIPSQRAFITLELLRGLTLDQLLCERPEGLPWDELRGIAIPLLEAL
FT                   CYSHQLGVLHGDLKPSNVMLAEDGLRLFDYGLGQPVEGLLPGLPRLCRSRIAAWTPRYA
FT                   ALELLEGAPLSAAADVYALACVLVELASGQHPFRRLSAKQAKSMELDRQLQRPAQVPLH
FT                   CWQALRTALAFDESQRQIDCSELLDAFRRPPASRLRRWLGKA"
FT   gene            106434..108515
FT                   /locus_tag="Pmen_0107"
FT   CDS_pept        106434..108515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0107"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82881"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNG5"
FT                   /protein_id="ABP82881.1"
FT                   /translation="MLNPANETHFSLTIEGVEHDLQVLEFNGREAISQPYRFDVELISE
FT                   RPDLDLTSLLHQRAFLAFSPNGDGIHGLIHRVEQGESGKRLTRYRLAIVPQLAYLAHRT
FT                   NQRIFQHLTVPQIIAQVLEEHGIVEGRYQFQLGPSVYPQREYCVQYDESDLHFVQRLCE
FT                   EEGIHYHFQHSASGHVLTFGDDQTAFAKLGQPTPYIQDSGMTADDPVIKRLALRLETRT
FT                   RSTARRDYDFEQPRLLLEAAYQGEQAGENDGLPDLEDYDYPGRYTDRTRGKHLAKRALE
FT                   RHRADYQQLQGQSDQPRLVTGHLLEISEHPRREWNDLWLLTEVLHEGKQPQVLEESVLN
FT                   LPSPPGRGAGGEGTSGDTDFTQGYRNRFLATPWDVPFRPPLVHPKPRVLGSQSAVVTGP
FT                   AGEEIHCDEYGRVKVQFFWDREGQADEKTSCWLRVSSSWAGDRYGAITIPRIGMEVLVT
FT                   FLEGDPDQPLVTGCLYHAEHLVPYDLPANKTRSVFKTLSSPGGGGYNELRIEDRKGAEQ
FT                   IYIHAQRNWDENIEHDQKIRVGNERHDTVEKNSYTELLAEEHLTVTADRKVEVKPQDHL
FT                   TVATDQHIKLGTAQLTKAGREIHLKAGQKMVIEAGIELTIKAGGSFIKLDPGGITISGP
FT                   LARINAGGSPGKGSGLKIKPPVLPGMADSDKAGSLLEQAVGNALTPKAKPKRTLNFSG"
FT   gene            108566..111730
FT                   /locus_tag="Pmen_0108"
FT   CDS_pept        108566..111730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0108"
FT                   /product="glycoside hydrolase, family 19"
FT                   /note="PFAM: glycoside hydrolase, family 19"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82882"
FT                   /db_xref="GOA:A4XNG6"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNG6"
FT                   /protein_id="ABP82882.1"
FT                   /translation="MADNKPINWAYPFKTAGEDSKEVSDPQIYLDALAKAKDGFYPMGA
FT                   NGLWHGGVHFDDNTAGSLDQSSIRCIADGEVIAYRIDQRYPTTQYGDGRAVVHLPFSTG
FT                   FVLVRHRLVLPSLPAPTAPGGEPGDTTTAATPTDTAASSAASTESATASEGLTFYSLYM
FT                   HLLDWDSYKSATAPEPADFLAPTCYAVKSTTNDPLMGLRVRALNDDGTNKVLALLPKGC
FT                   KVTLGEAHSIKTKYKKLLSIDEGMAIPALPAGTEGWVYEAELTDNTVADKATDTESELT
FT                   LSHQGVRVRREGKGNGTIIGVLPRGATLKVGEKQRSGYCKVLEVMDYRGVPALPNGADG
FT                   KPLGYVFFDALETQKTEPSALDSVHILPKPYSIKAGELVGHIGKYQNQDEGTAKKRLHL
FT                   EVFTSEDVPAFIEKSRAIGEKLPDEQKTLIKVDKGSKIVQPAAADAQVEASVDVRLCSD
FT                   SPKAGCWAKVQKYAICNADKNSELGSYNSTKLTYTLGAAQKTILASRMGLNAADMPDQV
FT                   DFLKVYSNSADGGDPHDYESGSIPSTHPWRKIGAVVGKPFWVKRSALNAQGRRTSTAGS
FT                   LDAWSEFPLYSGLEGEASGYVRILPASSWDALPDERKAIDAEQVRWWYVTVGDMEGNDI
FT                   SGWAPEKDLIVTRHSPWEWPGFSTLQDKVSLDAHLARTLDAAGRATEEETESYAALIEE
FT                   AERGPILSKLYEIIDQPDEKGVRDNKLTPEEFKAALAKPWLAQQLSLLISQHESEWFWN
FT                   ESKWNQLDKLMEHTPEDPNPQWLREKERIKTLSWWKELAGQPGIAADGMAWHFQPIGLV
FT                   ESFKNSSSCCELSTDKFKAIFGERSIFSAWNMPRDSKAFNISIEEFVELINSGFKSYGF
FT                   ESCLHKAHFLAQCYHESDHFNTTIEYADGMDYDLATHPITVCDTYGADSRTCRRHHQIM
FT                   AEGNTTVGDGPKYKGRGLIQITWKSAYQAFSTYSGVDCVSNPEIIGRNMNMAINASLWF
FT                   WTIFKGENLNAKIERYYQELSGNASMSETQKDEEVVRRITAIVNGGDRGLSERKQLFKK
FT                   IREQLK"
FT   gene            111727..112542
FT                   /locus_tag="Pmen_0109"
FT   CDS_pept        111727..112542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82883"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNG7"
FT                   /protein_id="ABP82883.1"
FT                   /translation="MRSNAIYLTLLMMCVEPALGDISYIPISEDIKINTGDFGIGCDME
FT                   ETHISRAGKDIFIATGGINISIPIDIVGEDADVIVGDMSGNGHCDLAVPYGKSDVNESY
FT                   TLFVYDIPHEKFKKSNAGIISNPDFKENKIISSYRDAAQWHEDYFCYSKSLVDFFLCSQ
FT                   KKSIDNSLEWLRLCSEDLCASSTIIYKASSIQASAVVTADRAKLHDITNGNILKERKGY
FT                   LVKGDKVMLIDFLQTYEDAYYKVNYFNNKMITTGWVKGAQLVVNPVTEK"
FT   sig_peptide     111727..111789
FT                   /locus_tag="Pmen_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.873 at
FT                   residue 21"
FT   gene            112621..113043
FT                   /locus_tag="Pmen_0110"
FT   CDS_pept        112621..113043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82884"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNG8"
FT                   /protein_id="ABP82884.1"
FT                   /translation="MMRIFFVLVFSICFPLVVNGSESHMPIFMCKTKNNKNIEVYRDGD
FT                   MVTYSFGRSDYPPELKLTRSMADLEVAIGSVSGNEISNSITFSNGVYAYRVMTTINKVS
FT                   ATQEPRHGVLVKKKTKYLAYIDCVPETVQGSLLDLE"
FT   sig_peptide     112621..112683
FT                   /locus_tag="Pmen_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.982 at
FT                   residue 21"
FT   gene            113171..113710
FT                   /locus_tag="Pmen_0111"
FT   CDS_pept        113171..113710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82885"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNG9"
FT                   /protein_id="ABP82885.1"
FT                   /translation="MQKGGQIYFWPRGGDSFGLNQAMNIRMKKRPLQHTAHQVLLCALS
FT                   CGYLAGCSALELETITYPEALTHYQEGGGIENYRCALVPADEQYQALPDSQPIAVEIDE
FT                   VLLVKIDGSIQALQQTEITETLAAYAHAGMSARLSTLRQLNQTEYNESDDRHVDLTFEA
FT                   GGKTTIYRTFGEACGL"
FT   gene            113794..114204
FT                   /locus_tag="Pmen_0112"
FT   CDS_pept        113794..114204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0112"
FT                   /product="protein of unknown function DUF1311"
FT                   /note="PFAM: protein of unknown function DUF1311"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82886"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNH0"
FT                   /protein_id="ABP82886.1"
FT                   /translation="MFGVNNKYSFFLLFFTFPALSDAIQKSCEVIEDSQQVAQCAEYAK
FT                   GQSDKLLNSAYRAALDRIRHQYRQAPLMADQYISLLRGAQREWIKLRDADCKLEAFEIE
FT                   ETAEAYQVTINNCLARMSNDRADYLKHIAPDI"
FT   sig_peptide     113794..113859
FT                   /locus_tag="Pmen_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.686 at
FT                   residue 22"
FT   gene            114401..115450
FT                   /locus_tag="Pmen_0113"
FT   CDS_pept        114401..115450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82887"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNH1"
FT                   /protein_id="ABP82887.1"
FT                   /translation="MPRLHGNKRDRRHLALTSLLMLASVIAHAEAIRPEGLSALQELRI
FT                   AEGNDDAQRLLITDRADKVVLDTGKVLPRIENEFSPNSYDGYLAELLAERQARATAIDL
FT                   QGERHALLSPTTQAGDYLLLITREEDNGAYNFNLKFRYDGTTKSFALSQILLNENDTQC
FT                   DQSLLSSYAMDSKALGATSIADFDGSRAFGTLRALRLAHQTSASTAEKLMPEAVASNFD
FT                   AALKACQAGNAQELKTLVGYFLSSDEDGACGPGNYIVEKYYFPQRVGWSNDLGFLFEQA
FT                   GHYPEAVELLQHITRRHPDRVVANLNLADAYWALGEREQAREAYGQYHDKMLAAQKQAR
FT                   IPPRVLERK"
FT   sig_peptide     114401..114490
FT                   /locus_tag="Pmen_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            complement(115461..115928)
FT                   /locus_tag="Pmen_0114"
FT   CDS_pept        complement(115461..115928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82888"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNH2"
FT                   /protein_id="ABP82888.1"
FT                   /translation="MKAAALLLLCLLSTAALALEPGERLAPWTLLDQHDVPYTLNDETR
FT                   ILLVARDMAGAKLVSAALEGKPKGYLEERQAVFLADISRMPGVIASLFALPKMRDYNYR
FT                   ILLDRDARIAPRYPAGEGEVLWLQLEDGRLLTQQAFKEAGALEQALAAERP"
FT   sig_peptide     complement(115872..115928)
FT                   /locus_tag="Pmen_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            complement(115947..116483)
FT                   /locus_tag="Pmen_0115"
FT   CDS_pept        complement(115947..116483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0115"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82889"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNH3"
FT                   /protein_id="ABP82889.1"
FT                   /translation="MRHLLLALLLCTGLAHAELPETDWLDLMPPEDRKALEEMPEISHD
FT                   SPEGDSTFYSEGGLRQQDQDLPAVMYSTKTVTELDGKDIRLGGYPVPLESDEKGNSTLF
FT                   FLVPYPGACIHVPPPPPNQLVLVRYPRGIALEDIYAPLWVSGTLKVEKISNDLADAAYA
FT                   MDAGEVRLVTDEDLY"
FT   sig_peptide     complement(116430..116483)
FT                   /locus_tag="Pmen_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 18"
FT   gene            complement(116572..116817)
FT                   /locus_tag="Pmen_0116"
FT   CDS_pept        complement(116572..116817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0116"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82890"
FT                   /db_xref="GOA:A4XNH4"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNH4"
FT                   /protein_id="ABP82890.1"
FT                   /translation="MGIIGTIFIGLIVGLVARFLKPGDDSMGWIMTILLGIGGSIAATY
FT                   GGQALGIYEAGEAAGFIGAVIGAVVLLVIYGAIKKG"
FT   gene            complement(116883..117647)
FT                   /locus_tag="Pmen_0117"
FT   CDS_pept        complement(116883..117647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0117"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82891"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNH5"
FT                   /protein_id="ABP82891.1"
FT                   /translation="MKRLLALLPMLVALTCVGAQEVLRVDFRERPPEMRAVDGIPSGPL
FT                   ISVLETAAQRIGVRLHWRQAPFLRSLDDLRSGRVDLVPRVLLTEQRREYIHFLPSIGNQ
FT                   QLNIRFVVHPGREAGLKRYEDLHRLSVGVKRGTVYFEPFDSDERLARVYASDDAQLAAM
FT                   FRAGRLDTIAVLDMMPMEAQFTALGFEDFSYAHYAHRQVLGNHFGASLKRYRSDRRELY
FT                   NRLAGELERMRDEGEVALIYRRYGVLPPDEAN"
FT   sig_peptide     complement(117588..117647)
FT                   /locus_tag="Pmen_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.821 at
FT                   residue 20"
FT   gene            complement(117703..118788)
FT                   /locus_tag="Pmen_0118"
FT   CDS_pept        complement(117703..118788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0118"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide
FT                   synthase"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; PFAM: ATP-dependent carboxylate-amine
FT                   ligase domain protein, ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82892"
FT                   /db_xref="GOA:A4XNH6"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNH6"
FT                   /protein_id="ABP82892.1"
FT                   /translation="MKIGVIGGGQLGRMMALAGTPLGMNFAFLDPAPDACAQALGEHIR
FT                   ADYGDQDHLRQLADEVDLVTFEFESVPAETVAFLSQFVPVYPSAEALRIARDRWFEKSM
FT                   FRELGIPTPEFADIQSQTDLDAAVASIGLPAVMKTRTLGYDGKGQKVLRKPEDVTGAFA
FT                   ELGSVPCILEGFVPFTGEVSLIAVRARDGETRFYPLVHNTHDSGILALSIASTDHPLQA
FT                   LAEDYVGRVLDKLDYVGVLAFEFFEVDGGLKANEIAPRVHNSGHWTIEGAECSQFENHL
FT                   RAVAGLPLGSTAKLGESAMLNFIGEVPPVDKVIRIADCHLHHYGKAFKVGRKVGHATLR
FT                   SADRATLNTGIAAVQALIAKG"
FT   gene            complement(118788..119279)
FT                   /locus_tag="Pmen_0119"
FT   CDS_pept        complement(118788..119279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0119"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82893"
FT                   /db_xref="GOA:A4XNH7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNH7"
FT                   /protein_id="ABP82893.1"
FT                   /translation="MSALVGVIMGSKSDWSTLSHTAEMLDKLGIPHEVKVVSAHRTPDL
FT                   LFQYAEEAEARGIQVIIAGAGGAAHLPGMCAAKTHLPVLGVPVQSSMLSGVDSLLSIVQ
FT                   MPAGIPVATLAIGKAGAVNAALLAASILGHQHPQFHAALKQFRDEQTNTVLENPDPRAQ
FT                   "
FT   gene            119556..120578
FT                   /locus_tag="Pmen_0120"
FT   CDS_pept        119556..120578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0120"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82894"
FT                   /db_xref="GOA:A4XNH8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNH8"
FT                   /protein_id="ABP82894.1"
FT                   /translation="MNPTMKAAVVHAFGQPLRIEEVKTPLPGPGQILVKIEASGVCHTD
FT                   LHAAEGDWPVKPSLPFIPGHEGVGYVAAVGSGVTRVKEGDRVGVPWLYSACGCCEHCLT
FT                   GWETLCESQQNTGYSINGGYAEYVLADPNYVGILPKNVDFLEIAPILCAGVTVYKGLKE
FT                   TRARPGQWVVISGIGGLGHVAVQYARAMGLHVVAVDVDDAKLELARRLGASLTINARQE
FT                   NPAEVVQREIGGAHGVLVTAVSNAAFGQAIGMARRHGTVALVGLPPGDFPTPIFDVVLK
FT                   AISITGSIVGTRADLQEALDFAGEGLVRATVHSDRLDNINAIFEQMRQGQIEGRMVLQF
FT                   "
FT   gene            120683..121477
FT                   /locus_tag="Pmen_0121"
FT   CDS_pept        120683..121477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82895"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNH9"
FT                   /protein_id="ABP82895.1"
FT                   /translation="MKQYVSLVALSLLSLQAAALELARHPQVFDAGQGVSLTLAPTADG
FT                   KQALVQVKGINHPLDEVVFLTQVRELGNEQRDYGIRLDGRDYNLLNKRRAWSGESFQLN
FT                   LPGTEGFELGYNETKTKALKQSELLALYKRQEKAGLQARLAAFDRKKRVQDYSARLQQM
FT                   DREATQACGTPLATRVDWSAFNDDLLMSVSVPHFCGEVVSQMASLCGRADSYKSEASTI
FT                   KGVECRFGDSMKLREHDGQLSFTTLKDEPNQGDFINAILRNR"
FT   sig_peptide     120683..120742
FT                   /locus_tag="Pmen_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 20"
FT   gene            121557..122549
FT                   /locus_tag="Pmen_0122"
FT   CDS_pept        121557..122549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0122"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82896"
FT                   /db_xref="GOA:A4XNI0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNI0"
FT                   /protein_id="ABP82896.1"
FT                   /translation="MLHAPLTTLHVVSLILQRFADQPELQPQLLAGSGIGAAELECPDA
FT                   RITRVQELQVCANALALRADMGLELGRSLHVSSYGLLGYAALSAATFGDAWRLLLQYPA
FT                   LLGTYFRLELQVEGELAWICAGGYRDAATLEVFNVEMCLASLKLIGDELLGQPLALARA
FT                   EFSYAEPHYVERYAQSFPCPLRFAARRNAFAFPAALLERRLPLADSVTHGDMVERCRRL
FT                   NAEFSSRQAWLERVRQLLAVQLAEPPGLENLAQQMHCSPRTLRRHLQELGTSYQGLLDE
FT                   LRFERAKALLSEEQWPVYRIAEVLGFSETASFRHAFQRWSGVPPSRFRA"
FT   gene            123150..124178
FT                   /locus_tag="Pmen_0123"
FT   CDS_pept        123150..124178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0123"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82897"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNI1"
FT                   /protein_id="ABP82897.1"
FT                   /translation="MLTYYSDDHHLHHGKCELIDGQLMPCFEKPQRADHILQRVKDRQL
FT                   GEIRAPKDFGLAPIERIHSKAYLEFFKGAWARWQEQGGKGDLLPFTWPARTLRRMIPND
FT                   LHGQLGYYSFDGGAPITAGTWQAAYSAAQVALSGQAEIANGAHSAFALCRPPGHHAAGD
FT                   VMGGYCYLNNAAIAAQAFLDQGRKKVAILDVDYHHGNGTQDIFYRRSDVLFASIHGDPA
FT                   EEFPFFLGYADELGEGAGEGYNFNYPLPMGSSWDTWNAALEQACQRIADYGAEVLVVSL
FT                   GVDTYMEDPISQFKLDSPDYLAMGRRIAALGLPTLFIMEGGYAVEAIGVNAVNVLEGFE
FT                   GA"
FT   gene            124242..125336
FT                   /locus_tag="Pmen_0124"
FT   CDS_pept        124242..125336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0124"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82898"
FT                   /db_xref="GOA:A4XNI2"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNI2"
FT                   /protein_id="ABP82898.1"
FT                   /translation="MKAIKQMLGVALCGATLLSGAVQAKELRVYNWADYILPEVPKDFQ
FT                   RESGIRITWDTFETNEALEAKLLTGNSGYDLVIPSNQFLETQIKAGVFAPLDKSKLPNW
FT                   KNLDPVLLGLLEKNDPGNQYGVPYMYGTVLIGYNPDKVKAALGDDAPVNSWDLVFKPEY
FT                   MEKLKSCGVAMLDSPTEIIPIALHYLGLDPNSSNPADYDKVTELLLKVRPYVAYFHSAK
FT                   YMTDIANGDICVAIGYSGSFYQFANRAKEAGNGVVINWRLPKEGAPIWFDTWAIPKSAQ
FT                   NVDEAHAFINHLLDPKVIAPISDFLGYPNPNVPGMQLVGAEIADDADLTPTPELQKSLY
FT                   VVQPLPQKIERVRTRAWTSIKSGK"
FT   sig_peptide     124242..124316
FT                   /locus_tag="Pmen_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(125368..126345)
FT                   /locus_tag="Pmen_0125"
FT   CDS_pept        complement(125368..126345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0125"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82899"
FT                   /db_xref="GOA:A4XNI3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNI3"
FT                   /protein_id="ABP82899.1"
FT                   /translation="MKVTVVMAERCSATSVSAALEFLECANVLQRFLTGDPAATPFEVH
FT                   SASLDGAPVECTGGLRLTPQRALSEVPHSDLVIVPGFMFNILAVLPALEPLSAWLRERH
FT                   AQGSYIASMCTGTFVTAQAGLLDGRRATTHWIFSEQFARRFPRVLLQAERSVTDDGQLL
FT                   CSAGSTTGSDLLLHIIRRFASPQLAIECSKKLLVDSAERLQTPYMSASFNKTHQDAEVL
FT                   RVQIWLEKHSAERIVLDEVAARFALSPRNLIRRFKDATGQTPVQYLQNLRLERAKHLLE
FT                   ASQENFERITQQVGYEDGSSFRRLFKERVGLSPGAYRRRFNRPT"
FT   gene            126485..127327
FT                   /locus_tag="Pmen_0126"
FT   CDS_pept        126485..127327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0126"
FT                   /product="Dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82900"
FT                   /db_xref="GOA:A4XNI4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNI4"
FT                   /protein_id="ABP82900.1"
FT                   /translation="MKHTAYRLFKKPFFGRFMKPWRWPEQVDAARWQRLALTSESGANL
FT                   AALLGEARAGQVRGAVLLCHPMGAAAKGFWLKHGHAELLRAAGYHVMLFDLNGFGESSS
FT                   TTMDYPLDVLAAGQALQARYPDLPVALLGASMGAAMGLCALALAQHPFKAAVLESAFPT
FT                   LLHFWRPYPLPRLGIQLSRLVYPAGERRLRPLHAAQRLVGRPPLLLIYGEEDRHTPLAD
FT                   GQQLHAALTAATHCEFWQVPGADHTLAYVAQPEAYARRVLEFLDGQLGAAAGSASTAA"
FT   gene            complement(127469..128371)
FT                   /locus_tag="Pmen_0127"
FT   CDS_pept        complement(127469..128371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0127"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82901"
FT                   /db_xref="GOA:A4XNI5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNI5"
FT                   /protein_id="ABP82901.1"
FT                   /translation="MNLETKWLEDFIALAATRSFSQAADKRFVTQPAFSRRIRSLEAML
FT                   GLTLVDRSCTPIELTEAGRLFLVTARSLVEQLGEVVRHLHNLEGQQGEVLSIAAAHSLT
FT                   LGFFPEWIARLRREGLPLTTRLVATNVGEAVHSLREGACDLILAYYDPDAALQMDPEIF
FT                   PSLHLGTTSMLPVCAVGEAGAPLFDLDGGQSVPLLAYSAGAFLGRSVNLLLRQRALRST
FT                   TVYETAMADSLKSMALQGMGVAWVPRLSVTAELGRGELAICGGEHWQIPLEIRLYRCAL
FT                   VRKAAVRLLWRKLEGGLAM"
FT   gene            128663..130087
FT                   /locus_tag="Pmen_0128"
FT   CDS_pept        128663..130087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0128"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82902"
FT                   /db_xref="GOA:A4XNI6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNI6"
FT                   /protein_id="ABP82902.1"
FT                   /translation="MSSAASVRVEKDLLGTLEVPADAYYGIQTLRAVQNFRLSGVPLSH
FT                   YPKLVIGLAMVKQASADANRELGHLSAAKHTAISTACARIIQGEFHEQFVVDMIQGGAG
FT                   TSTNMNANEVIANIALEAMGHEKGQYQHLHPNNDVNMAQSTNDAYPTAIRLGLLLGHDS
FT                   LLSALDKLIQSFAAKGLEFGHVLKMGRTQLQDAVPMTLGQEFRAFATTLGEDLQHLKLL
FT                   APTLLTEVNLGGTAIGTGINADPKYQALAVKRLAIISGHPLTPAADLIEATSDMGAFVL
FT                   FSGMLKRTAVKLSKICNDLRLLSSGPRTGINEINLPARQPGSSIMPGKVNPVIPEAVNQ
FT                   VAFEVIGNDLALTMAAEGGQLQLNVMEPLIAYKIFDSIRLLTRAMDMLRELCIDGITAN
FT                   ETRCRELMENSIGLITALNPYIGYENATRIAKVALESGRGVLELVREEQLLDEATLADI
FT                   LRPENMIAPRLVPLQG"
FT   gene            130216..131469
FT                   /locus_tag="Pmen_0129"
FT   CDS_pept        130216..131469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0129"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82903"
FT                   /db_xref="GOA:A4XNI7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNI7"
FT                   /protein_id="ABP82903.1"
FT                   /translation="MSQSNTASLSLLARVPLWQQILVGLVLGVVVGMLSKSLALALAPV
FT                   GALFLNAIKMLIVPLVFVSLVAGITAMSDSAKLGRISVKTIAIYLITTAFAVSIGLAFG
FT                   TLFSPGEGMNMVASGSEEAKQAPSLVQILVGLVPTNPVTAFAEGNILQIIVFAIALGVS
FT                   MNLIGEKAAPVAKLFDSLAEVFYKLTDLVMRFAPIGVFALIAGVVASHGIEVLLPLAGV
FT                   IGVIYLASIAHMLLIYGGLIGGLARLSPLRFFRGIAPALAVAFSTSSSSGTLPVSIECA
FT                   RKNLGVSQGVAGFVLPVGATINMDGTAIYQGVLALFIAQAFGIDLNAGQYLMIILTATL
FT                   ASVGTAGVPGAGLIMLGLVLTSVGLPLEGVALIAGIDRILDMARTTVNVAGDLMTTTLV
FT                   GSSEKELDREIYNSDNAA"
FT   gene            complement(131600..133072)
FT                   /locus_tag="Pmen_0130"
FT   CDS_pept        complement(131600..133072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0130"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82904"
FT                   /db_xref="GOA:A4XNI8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNI8"
FT                   /protein_id="ABP82904.1"
FT                   /translation="MRRSPALPFDLSGIHLQPGQGLARQLYQALRERILDGRLAGGTRL
FT                   PASRELAALLGISRNTVTRALDQLYAEGYVNGRVGDGTYVAELTRHRPAPVPVAAVAPT
FT                   AASPAMQLLHNHHLAMPAAGAPRAFRIGVPAFDLFPFETWSRLQVRFWRKPSLARLGYG
FT                   DPAGDLQLRELIAAYLRNSRGLTCEAPQVLITCGSQQAISLCAQLLIQPGERVAIENPG
FT                   YRAAGHAFAVAGAQLCGVAVDGDGLDVDALQRLNECRLAYVTPAHQYPTGVTLSLPRRL
FT                   ALLEWAKRVNGWIIEDDYDGEYRYSGTPLAPLAALDEQQRVIYIGTFGKLAFPALRLGY
FT                   LVLPPALAESFARRQALEIRHSEVGTQAVMAEFIAAGHFQRHVRRMRQAARSRRDALIE
FT                   AWPQAIPGCSPLPAVEAGLHLSIRVESLARERELIGSARAAGIEMNPLSGYWLPGSDTA
FT                   EDARAGLVLGFAAVPEAQIVEAVQTLRRAWKL"
FT   gene            133170..133802
FT                   /locus_tag="Pmen_0131"
FT   CDS_pept        133170..133802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0131"
FT                   /product="negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82905"
FT                   /db_xref="GOA:A4XNI9"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNI9"
FT                   /protein_id="ABP82905.1"
FT                   /translation="MYCPAAFRQDDLPTLHAQIHASGLAIVTSSGAQGLQASHLPLLLE
FT                   PGEGEFGTLYGHFARANGHWRDLAAGAEALVVFSGADAYVHPGWYAAKAEHGKVVPTWN
FT                   YIAVHAWGQAEVFDEPERLLELVSRLSERHEQGRPQPWAVSDAPRDYIDSMLRAIVGFA
FT                   LPIRRLEGKWKLSQNRSSNDQAGVRAGLATSASPRDQELAAQMNPTD"
FT   gene            133822..134262
FT                   /locus_tag="Pmen_0132"
FT   CDS_pept        133822..134262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0132"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82906"
FT                   /db_xref="GOA:A4XNJ0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNJ0"
FT                   /protein_id="ABP82906.1"
FT                   /translation="MLDIRPITAADHAVWLPLWQAYQRFYQAEIPAETSALTWRRFLDP
FT                   AEPMHAALAWQDGEAVGLVHFIYHRSCWTSGDYCYLQDLFVAEHIRGGGIGRALIEHIY
FT                   AEARAAGASRVHWLTQESNYQGRMLYDRIGDRSGFIQYRKLF"
FT   gene            134262..134933
FT                   /locus_tag="Pmen_0133"
FT   CDS_pept        134262..134933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0133"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82907"
FT                   /db_xref="GOA:A4XNJ1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNJ1"
FT                   /protein_id="ABP82907.1"
FT                   /translation="MTRDLAHWQPRPTPDQRVLQGRFVRLEALDVTRHGEDLWRALQGP
FT                   DPALWDYLPYGPFIERGVFDTWLAGNAQSRDPLFYAVVDLASGRALGLFSYLRITAQDG
FT                   SIEIGHVAFGAPMQRTPGATEAVYLLARHAFDDLGYRRLEWKCDAANARSLRAAERFGF
FT                   IREGLFRQHMVRKGRNRDTAWFSIIDGEWPACREAFARWLAADNFDEAGRQKQRLEALR
FT                   G"
FT   gene            complement(134938..135756)
FT                   /locus_tag="Pmen_0134"
FT   CDS_pept        complement(134938..135756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0134"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82908"
FT                   /db_xref="GOA:A4XNJ2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNJ2"
FT                   /protein_id="ABP82908.1"
FT                   /translation="MSDSLGSNLKLLCSHYRSIAEVCRKLSINRAQFNRYLAGQSRPTA
FT                   HNLKRICDFFGVEPFELSMPAEQFARLIGARSGDTQVHGGSDPLLELFDPLRQQASPMG
FT                   RYCGYYFEYSNCMSVPGHVLLSLVHLREERGNYLFERQERQERQEHTRGGAEDWVRCRY
FT                   LGAAFFLQDRLFLVDYESLTGNEISQTILIPSFKSRITRLNGIKTGVSSGDRRTPACTR
FT                   VVWQYLGNEINRVNAYRQLMLYAPDDARIDDDIRQRLGGAQLRDGLFEME"
FT   gene            135917..137359
FT                   /locus_tag="Pmen_0135"
FT   CDS_pept        135917..137359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0135"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82909"
FT                   /db_xref="GOA:A4XNJ3"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNJ3"
FT                   /protein_id="ABP82909.1"
FT                   /translation="MLDLLNDLIWSKLLIVMLIGLGLYFSIASRFVQFRYFGNMFRIFR
FT                   EAFQRQPGQLSSFQALMLSVAGRVGAGNIAGVSVAIMLGGPGAIFWMWVVALVGMATSY
FT                   FECSLAQLYKRREADGGYRGGPAFYIQHGLGQRWLGILVSILLLVTFGFGFNAVQSFTV
FT                   ASSLHDTFGIPTLVSGIALTVVIGLIIFGGIKRIAQFADVLVPVMAFSYIGMAVLVIGM
FT                   NISEVPATFALIVKSAFGLEPAFAGGIGAAIIMGVKRGLFSNEAGLGSAPNVAAVAEVK
FT                   HPVAQGIVQSLSVFIDTLILCSCTALIILLSGVYQPGMEQAGVVLTQSAVAAVVGEWGR
FT                   VFISLALLLFVFTTLIYNYYLGENALGFFSQKRGPVMIYRVLVVGLVLWGSVQDLGTVF
FT                   AFADVTMGLLAIANLIALALLFKVGLRLMRDYDSQIKAGVDSPVFDAKQFADLDLDPSV
FT                   WGAQASKPVADQAEIGDRVHQR"
FT   gene            137521..138510
FT                   /locus_tag="Pmen_0136"
FT   CDS_pept        137521..138510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0136"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: Asparaginase/glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82910"
FT                   /db_xref="GOA:A4XNJ4"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNJ4"
FT                   /protein_id="ABP82910.1"
FT                   /translation="MATPENLLVLYTGGTIGMQMSADGLAPASGFEARMRAQQASENTG
FT                   ELPNWQFRELLPLIDSANMNPGHWLALRDQIVAAVEQEGHDAVLVLHGTDTLAYSAAAL
FT                   SFLLLGLDVPVLLTGAMQPAGVAGGDAWPNLFGALRALHRGVQPGVHLYFNGQLLHGVR
FT                   CSKLRSDAFDAFQVLPRLRQAERAAIDARIDYRQPRQAANLAVLPLHPALQASHLRALL
FT                   ESGIQGLLLECYGSGTGPAGDAELMAVLHEAHARGVVLAAISQCPQGHVQFGVYAAGSR
FT                   LAEAGLVSCGGMTREAALGKLFALLGAGLTQAEVEHWLARDLCGEMSD"
FT   gene            138539..138982
FT                   /locus_tag="Pmen_0137"
FT   CDS_pept        138539..138982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0137"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82911"
FT                   /db_xref="GOA:A4XNJ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032962"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNJ5"
FT                   /protein_id="ABP82911.1"
FT                   /translation="MSLEIRPVSAADHEAWLPLWQGYQRFYMTDIPAEASAVTWQRFLD
FT                   PAEPMGAALAWQDGEAVGLVHWVIHRSTWTVGDYCYLQDLFVAKGQRSSGVGRQLIQHV
FT                   YDQAREAGCSRVHWLTHESNSQAMLLYERIGERSGFVQYRKLL"
FT   gene            complement(138990..139385)
FT                   /locus_tag="Pmen_0138"
FT   CDS_pept        complement(138990..139385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0138"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82912"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNJ6"
FT                   /protein_id="ABP82912.1"
FT                   /translation="MSMPEYHMFATAPAPVAPFSHACEADGWVFITGQLPIDPGNEAAP
FT                   LPEGIEAQTHKTFDNLLVVLEGLGLGLENVVSARAFLTDFYGDYARFNVVYASYFPEDK
FT                   RPARTCIGTTGLARHALVEIDFIARRP"
FT   sig_peptide     complement(139317..139385)
FT                   /locus_tag="Pmen_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.894 at
FT                   residue 23"
FT   gene            complement(139457..140365)
FT                   /locus_tag="Pmen_0139"
FT   CDS_pept        complement(139457..140365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0139"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82913"
FT                   /db_xref="GOA:A4XNJ7"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNJ7"
FT                   /protein_id="ABP82913.1"
FT                   /translation="MQALLTEILDEVRPLIGQGKVADYIPALAGVVPDQLGIAVYGNDG
FT                   QLHVAGDARTPFSIQSISKVFSLVQAIGHSGEAIWQRLGHEPSGQPFNSLVQLEFERGK
FT                   PRNPFINAGALVICDINQSRYAAPALSMRDFVRRLSGNPEVTVDNHVAESEYQHRARNA
FT                   AAAYLMQSFGNFHNEVEAVLRSYFSCCALRMSCVDLARAFGFLANQGFCQHSGEQILSP
FT                   RQSKQINAIMATSGLYDEAGNFAYRVGLPGKSGVGGGIVAVVPGQFSVCVWSPELNAAG
FT                   NSLTGIKALELLSERIGWSVF"
FT   gene            140508..141437
FT                   /locus_tag="Pmen_0140"
FT   CDS_pept        140508..141437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0140"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82914"
FT                   /db_xref="GOA:A4XNJ8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNJ8"
FT                   /protein_id="ABP82914.1"
FT                   /translation="MSTVLNVLLPIFGLILVGYICRRSNRLGPTAASEMNRFVVWLGLP
FT                   ALLFSLTAKADWAHIWQPGFLLAFTGGTLAVFLLTLAYRWKTTGSLVDASIDGLSAGYA
FT                   NTGYIGIPLCVLVLGEDGMAPALIASLIVVCLLFALAVVCIEVGLQSQKGLGGAIAQVS
FT                   LALLKNPLVVAPVLGALWSFGGLSLAPALDEFLRLLGAATVPCALVSLGLFLAQRQSGP
FT                   AKGAWPLVALKLALQPLVTWFIAFVLLDLPPFWAHAALLLSALPTGTGPFMLAEYYQRQ
FT                   AALVSRAILFSTLGSLLTLSLILLLITP"
FT   gene            complement(141427..142068)
FT                   /locus_tag="Pmen_0141"
FT   CDS_pept        complement(141427..142068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82915"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNJ9"
FT                   /protein_id="ABP82915.1"
FT                   /translation="MNTAAVRQSIAQAQQHEVSSQALARFLQAQLERLHPSIRLPEEDA
FT                   SGALSAFVSAYIEQVPEVLDAAVEVAREAGIEDAVKPVLKIAEHFFLQPPPLIDGHEGL
FT                   EGLLDEAYLAHRLVEEVNDRYITHLGQPLIPLDTTRANLIAHQLIGEPFANQLDEAVHH
FT                   ALAGMLDDASFDQPSVQAYRERLAAPDTVSAWRRWPCLSQQLGLELQLKA"
FT   gene            142477..143601
FT                   /locus_tag="Pmen_0142"
FT   CDS_pept        142477..143601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0142"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="PFAM: cytochrome c oxidase, subunit II; cytochrome
FT                   c, class I; cytochrome C oxidase subunit II, transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82916"
FT                   /db_xref="GOA:A4XNK0"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNK0"
FT                   /protein_id="ABP82916.1"
FT                   /translation="MMRHPRVWMGLLLWLALGSAHAQWTVNMAPGVTEVSRSVFDLHMT
FT                   IFWICVVIGVIVFGAMFWSMIMHRRSTGQEPAHFHESTTVEILWTVVPLAILVLMAIPA
FT                   TKTLIEIYDTSESELDIQVTGYQWKWHYKYLGQDVEFFSNMSTPRSQINNREAKGEHYL
FT                   LEVDEPLVVPVGTKVRFLITAADVIHSWWVPALAVKKDAIPGFINESWTRIEEPGIYRG
FT                   QCTELCGKDHGFMPVVVEAKSKEDFAVWLAERKEAAAAERELTSKEWTMEELMARGEKA
FT                   YLTACAACHQPGGEGLPPMFPALKGSAIAMGPAEGHIDIVYNGKPGTSMAAFGKQLSPV
FT                   DLAAIITYERNAWGNKVGDMVTPKDILDFSKAQE"
FT   sig_peptide     142477..142545
FT                   /locus_tag="Pmen_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            143606..145189
FT                   /locus_tag="Pmen_0143"
FT   CDS_pept        143606..145189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0143"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82917"
FT                   /db_xref="GOA:A4XNK1"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNK1"
FT                   /protein_id="ABP82917.1"
FT                   /translation="MSAVIDHGHTDHHHGPAKGLMRWVLTTNHKDIGTMYLWFSFCMFL
FT                   LGGSMAMVIRAELFQPGLQIVQPEFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPLMIG
FT                   APDMALPRMNNFSFWLLPAAFGLLVSTLFMEGGGPNFGWTFYAPLSTTYGPESTTFFIF
FT                   AVHLMGISSIMGAINVVATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAGCVT
FT                   MMLMDIHFGTSFFNAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIPAFARKPL
FT                   FGYTSMVYATAAIAFLSFIVWAHHMFTVGIPLTGELFFMYATMLIAVPTGVKVFNWAST
FT                   MWQGSMTFEAPMLFSVAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLVPGA
FT                   IFGIFASAYYWLPKWTGHMYDETLAKLHFWMSFIGMNLAFFPMHFVGLAGMPRRIPDYN
FT                   MMFANFNMVSSIGAFLFGATQLLFLFIVIKCIRGGKPAPAKPWDGADGLEWTVPSPAPY
FT                   HTFSTPPEVK"
FT   gene            145200..145748
FT                   /locus_tag="Pmen_0144"
FT   CDS_pept        145200..145748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0144"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82918"
FT                   /db_xref="GOA:A4XNK2"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNK2"
FT                   /protein_id="ABP82918.1"
FT                   /translation="MSEVIATRRLVTRLLVVVVVMFCFGIFVLPPFYDAMCRVFGINGK
FT                   TAGAYQGEQLVDEQRQVRVQFLATNAAGMVWEFGPQADELLVHPGESRDMLFVAYNPSD
FT                   QPMTAQAIPSVSPSKAAAFFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPKDVKHLT
FT                   LGYTLFDITVRKPPVAQAP"
FT   gene            145760..146656
FT                   /locus_tag="Pmen_0145"
FT   CDS_pept        145760..146656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0145"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82919"
FT                   /db_xref="GOA:A4XNK3"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNK3"
FT                   /protein_id="ABP82919.1"
FT                   /translation="MSSHESHENYYVPAQSKWPIVATIGLLVSFYGVGTWFNDLSAGRE
FT                   GSNGPLIFFVGGLILAWMLFGWFGNVIKESRAGLYSAQMDRSFRWGMSWFIFSEVMFFA
FT                   AFFGALFYIRMWSGPWLGGEGSKGIANMLWEGFEYSWPLLQNPDSKLFPPPSAVIDPWH
FT                   LPLVNTILLVSSSFTITFAHHALKKNHRGPLKAWLAATIVLALAFLFFQVEEYIEAYTE
FT                   LGLTLGSGIYGATFFMLTGFHGAHVTLGTIILIVMLVRIMRGHFSADQHFGFEAAAWYW
FT                   HFVDVVWLGLFVFVYVL"
FT   gene            complement(146665..146868)
FT                   /locus_tag="Pmen_0146"
FT   CDS_pept        complement(146665..146868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82920"
FT                   /db_xref="GOA:A4XNK4"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNK4"
FT                   /protein_id="ABP82920.1"
FT                   /translation="MLKAAIVLMLLATIASLFSGLFFLVKDEGHGYRVVGALTVRVGLT
FT                   AITVALVAWGFYSGQLVSHVTW"
FT   sig_peptide     complement(146809..146868)
FT                   /locus_tag="Pmen_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.640 at
FT                   residue 20"
FT   gene            146940..147671
FT                   /locus_tag="Pmen_0147"
FT   CDS_pept        146940..147671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82921"
FT                   /db_xref="GOA:A4XNK5"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNK5"
FT                   /protein_id="ABP82921.1"
FT                   /translation="MNAFRPGWLPSLLVALLLPGLLWLGVWQLQRGEEKRALLASFEAR
FT                   RHAEPISLEQLEPMPDPAYRRVQLRGHFDGEHSLLLDSRIRDGHAGVEVLQPFYDQPSG
FT                   LWVLLNRGWLPWPDRRTTPRFDTPDGVLQLTAWVYVAPSGGLNLRSGAATEGWPRLITQ
FT                   VEAENLWRQLGRGGLPFEARLEDGPASYRVDWPVVAMSPSKHLGYAVQWFALAAALLGL
FT                   FIYLGIHNARESRHEPSHRHA"
FT   gene            147646..148227
FT                   /locus_tag="Pmen_0148"
FT   CDS_pept        147646..148227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82922"
FT                   /db_xref="GOA:A4XNK6"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNK6"
FT                   /protein_id="ABP82922.1"
FT                   /translation="MNPAIAMPEATPRKTRGRLQLLLLLAVAIGPMLLASAMYQWRFWV
FT                   PEARSYHGVLIGDGRTLSDLGVQGEVQPLWQILVTAPGACEADCRELVYLARQIQIGLN
FT                   RETARASHGLALAEPLPAEYDATLKREYPRLGRYQLDPQAYERAVEALPGAQLWLIDPH
FT                   GNLVLRYPAGSRGKAILDDLRYLLKISKIG"
FT   sig_peptide     147646..147759
FT                   /locus_tag="Pmen_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.694 at
FT                   residue 38"
FT   gene            148264..149301
FT                   /locus_tag="Pmen_0149"
FT   CDS_pept        148264..149301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0149"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82923"
FT                   /db_xref="GOA:A4XNK7"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNK7"
FT                   /protein_id="ABP82923.1"
FT                   /translation="MHKPGYRLALFATLLAAVVVLLGAYTRLTHAGLGCPDWPGCYGFL
FT                   GVPMSEHKQAIAEARFPEAPVEVAKGWYEMIHRYFAGALGLVILGMAVQAVRRRGDATQ
FT                   PLKLPLAILALVIVQAAFGMWTVTLKLWPQIVTAHLLGGFATLSLLALLTLRLSGRLAP
FT                   LQLPMRLRALAAACLLLVIGQIALGGWVSSNYAAVACVDLPTCHGEWWPAMDFGKGFHL
FT                   TQHIGPNYLGGQLDSDARTAIHMSHRIGALLVTLALLLLAWRLHAAKLSRLAGLLLLAL
FT                   AVQVGLGISNVIFHLPLLVAVAHNAGGAALLLTLVLVNYRLRAPAPVKVQRTLGSARRL
FT                   QEQGA"
FT   sig_peptide     148264..148359
FT                   /locus_tag="Pmen_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.405 at
FT                   residue 32"
FT   gene            149320..150219
FT                   /locus_tag="Pmen_0150"
FT   CDS_pept        149320..150219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0150"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82924"
FT                   /db_xref="GOA:A4XNK8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNK8"
FT                   /protein_id="ABP82924.1"
FT                   /translation="MATVLRAHSEHATWRDYLELTKPRVVLLMLITSLVGMFLATRAGV
FT                   PWTVLLFGNLGIGLCAGAAAAVNHVVDRRIDSIMARTHKRPVTAGRVSPAAAIAFALLL
FT                   ATAGMGLLLLFTNQLAAWLTLASLLGYAVIYTGFLKRATPQNIVIGGLAGAAPPLLGWV
FT                   AVTGHLSAEPLLLVLIIFAWTPPHFWALAIHRKAEYAKADIPMLPVTHGEHYTKVHILL
FT                   YTLVMFAVTLLPYAIHMSGPLYLVCALLLGARFLHWAWVLYRDSKPHAAINTFKYSIWY
FT                   LFLLFIALLADHYLLLNI"
FT   gene            150372..151004
FT                   /locus_tag="Pmen_0151"
FT   CDS_pept        150372..151004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0151"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; electron transport protein
FT                   SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82925"
FT                   /db_xref="GOA:A4XNK9"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNK9"
FT                   /protein_id="ABP82925.1"
FT                   /translation="MTRTHTTVFVLVAIVALVLGLTVNKVLNSRSQGDPAALLDAGIVL
FT                   LPQNRSLPALTLIDQDGKEVAVDQLKGDWKLLFFGYTFCPDICPATLAQLRQLQTQLPE
FT                   ETRARLKVVMVSVDPHRDTPEQLSKYLNYFDAGFKGLTGEEATLQKFANSVSIPYIPAD
FT                   TSKENYTVDHSGNLVIIGPDGTQRGFIRAPINNAKLAAQLPGLVSGS"
FT   sig_peptide     150372..150449
FT                   /locus_tag="Pmen_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.422 at
FT                   residue 26"
FT   gene            complement(151066..152016)
FT                   /locus_tag="Pmen_0152"
FT   CDS_pept        complement(151066..152016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0152"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="TIGRFAM: homoserine kinase; PFAM: aminoglycoside
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82926"
FT                   /db_xref="GOA:A4XNL0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNL0"
FT                   /protein_id="ABP82926.1"
FT                   /translation="MSVFTPLERHELEVFLAPYGLGRLRDFQGIAAGSENSNFFVSLEQ
FT                   GEYVLTLVERGPVADLPFFIELLDILHDAGLPVPYALRTQQGEALRSLAEKPALLQPRL
FT                   AGKHVREANTHHCQEVGSLLARIHLATRDAPIERRSDRGLDWMLAEGPSLALKLDEQAL
FT                   PLLRDALAEIAELKPRILALPRANLHADLFRDNVLFDGNHLAGVIDFYNACSGPMLYDL
FT                   AITLNDWCSHEDGSLDGARARALLGAYAALRPFTAAEAELWPTMLRVACVRFWLSRLIA
FT                   AESFAGQEVLIHDPAEFQRRLAQRQQVNLPLPFAL"
FT   gene            complement(152032..152316)
FT                   /locus_tag="Pmen_0153"
FT   CDS_pept        complement(152032..152316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82927"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNL1"
FT                   /protein_id="ABP82927.1"
FT                   /translation="MGTAKRLLLVGLLACLPLAAHADDPVSGDPDVTIRQDGDRTIEEY
FT                   RVNGFLYAIKVIPKNGKPYFLVRADGSDGNFIRSDDPDMLIPSWEIFSW"
FT   sig_peptide     complement(152248..152316)
FT                   /locus_tag="Pmen_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            152534..155329
FT                   /locus_tag="Pmen_0154"
FT   CDS_pept        152534..155329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0154"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase I; PFAM: DNA-directed DNA
FT                   polymerase; 5'-3' exonuclease; 3'-5' exonuclease; SMART:
FT                   Helix-hairpin-helix domain protein, class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82928"
FT                   /db_xref="GOA:A4XNL2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNL2"
FT                   /protein_id="ABP82928.1"
FT                   /translation="MSQAPLVLVDGSSYLYRAFHALPPLTTSKGMPTGAVKGVLNMLKS
FT                   LRKQYPDSPFAVVFDAKGGTFRDELFAEYKANRPSMPDELRVQVEPLHASVRALGLPLL
FT                   CVEGVEADDVIGTLARQAAAQQRDVVISTGDKDMAQLVCPHVTLVNTMTGSVYDEGGVK
FT                   EKFGVGPELIIDYLALMGDKVDNIPGVPGVGEKTALGLLVGVGGGLDVLYANLDKVPEL
FT                   PIRGAKSLPAKLEEHREMAYLSYQLATIKTDVPLNIEIDSLHPGEPDQATLVQLYGELE
FT                   FKAWLDELLRQNKALAAKAAVPAGDLFAEPAGPAAEETAETPPMGAGDYELVLEQAQFD
FT                   AWLKKLQQAELIAFDSETTSIDAQQAQLVGLSFAVKAGEAAYVPLAHSYMGVPQQLDRD
FT                   AVLKALKPILEDPAKAKVGQHAKYDINVLANASTPIAVQGVAFDTMLESYVLDSTATRH
FT                   DMDSLALKYLGHSTIRFEDIAGRGAKQLTFDQIALEQAGPYAAEDADVTLRLHQELWGR
FT                   LEAVPSLAKVLREIEIPLVPVLARIERNGALVDAKLLGEQSVELGEKLVELERKAFEIA
FT                   GEEFNLASPKQLGVILYEKLGYPVISKTAKGQPSTAEAVLAELAEQDFELPKVLMQYRS
FT                   LSKLKSTYTDKLPEQINPRTGRIHTSYHQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQ
FT                   AFVAPKGYKMMAADYSQIELRIMAHLAKDEGLLDAFRHDLDVHKATAAEVFGVALEEVT
FT                   SDQRRKAKAINFGLIYGMSAFGLAKQIDVERKEAQAYIDRYFARYPGVLSYMERTRAQA
FT                   AEQGYVETVFGRRLYLPEIHAQNQAMRKGAERAAINAPMQGTAADIIKRAMIAVDDWLQ
FT                   GSGIDARIILQVHDELVLEVREDLLEEVGAQLKALMGGAAQLDVPLLVEVGVGANWDEA
FT                   H"
FT   gene            complement(155776..156426)
FT                   /locus_tag="Pmen_0155"
FT   CDS_pept        complement(155776..156426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0155"
FT                   /product="cell division checkpoint GTPase YihA"
FT                   /note="PFAM: GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82929"
FT                   /db_xref="GOA:A4XNL3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNL3"
FT                   /protein_id="ABP82929.1"
FT                   /translation="MLPKNPIIGLCQQASFLISAAKVDQCPEDSGLEVAFAGRSNAGKS
FT                   SALNTLTHASLARTSKTPGRTQLLNFFRLDDERRLVDLPGYGYAKVPIPLKQHWQKHLE
FT                   AYLGSRESLCGLVLMMDIRHPLTEFDRMMLDWSVASGMPLHILLTKADKLAFGAAKNAL
FT                   LKVRQEIRKQWGEGISIQLFSAPKRMGVEEAQMVLAGWLDLLPQEDEESAEEA"
FT   gene            156671..156961
FT                   /locus_tag="Pmen_0156"
FT   CDS_pept        156671..156961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0156"
FT                   /product="Cytochrome c5-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82930"
FT                   /db_xref="GOA:A4XNL4"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNL4"
FT                   /protein_id="ABP82930.1"
FT                   /translation="MKKMLLAAAVLMLSFNGHAAQDPQAVYDRSCGVCHNGQIPTAPLK
FT                   GDKAAWEPRLAKGMDALVESVTNGLNAMPPRGLCMDCTAEDYQAVIKLMTE"
FT   sig_peptide     156671..156730
FT                   /locus_tag="Pmen_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            157010..157615
FT                   /locus_tag="Pmen_0157"
FT   CDS_pept        157010..157615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0157"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82931"
FT                   /db_xref="GOA:A4XNL5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNL5"
FT                   /protein_id="ABP82931.1"
FT                   /translation="MNKVLVSLLLTLGLTGVAQAAGDAEAGQGKVAVCGACHGADGNSP
FT                   APNFPKLAGQGERYLLKQLHDIKSGARPVVEMTGMLDNLSDQDMADIAAYFASQQMSVG
FT                   AADPKLVERGEALFRGGKLEEGMPACTGCHSPDGAGLAAAGFPKLGGQHAAYVAKQLTD
FT                   FREGDRTNDGDAMIMRAIAAKLSNKDIEAVSSFIQGLH"
FT   sig_peptide     157010..157072
FT                   /locus_tag="Pmen_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            157755..158405
FT                   /locus_tag="Pmen_0158"
FT   CDS_pept        157755..158405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0158"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82932"
FT                   /db_xref="GOA:A4XNL6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNL6"
FT                   /protein_id="ABP82932.1"
FT                   /translation="MPTTKEYPMRNLILGAALAISSLFGITAHAEPVAGQQYVELKSPV
FT                   PVSKPGKVEVVELFWYGCPHCYQFEATLNPWVEKLPDDVNFVRIPALFGGIWNVHGQAF
FT                   ITLEMMKVEHKVHDAVFTAIHQEKKKLGSAEEFADFVATQGVDRDAFLKTFNSFAVKGQ
FT                   MEKAKKLAMAYQITGVPVMIVGGKYRFDLGSAGGPQQTLEVADHLIAKERAAL"
FT   sig_peptide     157755..157847
FT                   /locus_tag="Pmen_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            158425..159297
FT                   /locus_tag="Pmen_0159"
FT   CDS_pept        158425..159297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0159"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82933"
FT                   /db_xref="GOA:A4XNL7"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNL7"
FT                   /protein_id="ABP82933.1"
FT                   /translation="MLRRWRKTRAVGLCDPRVNPHCQPNAEWPSDGLLRLLSFNVQVGI
FT                   NTQRYHHYLTRSWQHLLPHAGRAGNLQRIGDLLADFDLVALQEVDGGSLRSGYVNQVEY
FT                   LAQQGAFPYWYQQLNRNLGRFAQHSNGVLSRLRPTLLEDHPLPGPPGRGAIFLQLGEGE
FT                   HALCVVMMHLALGARTRTRQLAYIRERVGEFRHLVLMGDMNTHAVDLLENSPLRDLGLI
FT                   APQAEATFPSWRPQRCLDHILLSSELELGRVDVLSQPISDHLPVAVEIRLPGAQNAAPM
FT                   PMLKTPSPE"
FT   gene            complement(159403..160971)
FT                   /locus_tag="Pmen_0160"
FT   CDS_pept        complement(159403..160971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0160"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82934"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNL8"
FT                   /protein_id="ABP82934.1"
FT                   /translation="MIAVPAPLPDDPILLKHLLLLASEQAAAKDARIEQLQEQVALLRH
FT                   KLFSPKSERSPEDADSPQLAMFNEVEELIEAAAAPSEAEAEAEAEAEAEEIVAPVKRRG
FT                   KRKPLPANLPRVEVIHDLPEHELTCACGACKQVIGEETSEQLEIIPMQVRVIRHIRKTY
FT                   ACKACEAAPLTADKPAQLIEKSLASPSVLAMLLTTKYADGIPLYRFEKMLSRHGVDIPR
FT                   QTLARWVIQSGEQLQPLLNLLRDKLLEYPVLHCDETRLQVLHEPGRDPTAQSWMWVQSG
FT                   GPPDKPVILFDYTASRAQEVPLRLLDGYRGYLMTDDYAGYNAVAAQEGIERLGCWAHAR
FT                   RKFVEAQKVQPKGKTGRADMALNLINKLYGIERDLKDACDTERLVARQQRSQPLLDQLK
FT                   TWLDKTQPQVVGQTALGRAVNYLASNWRKLVRYVEGGHLPIDNNRAENAIRPFVIGRKN
FT                   WLFSDTPKGATASAQIYSLIETAKANGQEPYAWLRHILERLPAANSVEDYEALLPWNCS
FT                   PVSAS"
FT   gene            complement(160991..161350)
FT                   /locus_tag="Pmen_0161"
FT   CDS_pept        complement(160991..161350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0161"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82935"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN95"
FT                   /protein_id="ABP82935.1"
FT                   /translation="MMRPDAKVQKVYLYPKPVDFRKSINGLAALVELDIKVEVFNPVLF
FT                   VFLNRTRSQVKILYWERNGFCLWLKRLEAERFKTKPDAGDEAIELTVDELNWLLDGIDL
FT                   WRNRPHQILTPRFVT"
FT   gene            161388..163232
FT                   /locus_tag="Pmen_0162"
FT   CDS_pept        161388..163232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0162"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82936"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNM0"
FT                   /protein_id="ABP82936.1"
FT                   /translation="MICGLWAGGVYGADTEQQEKLERRWELRLDLLRRGLVRSSLAAEG
FT                   ADKAVDQCMQEMRDILRRDDMDAALGGLIPRLEKAVLDSEQRRQQRAEEATAALAGLVE
FT                   QLQRLQPPREVRKALKSLGKQLQAAVGQQHQLPALLSQLRNLQGQALTVLQAPAQEQPG
FT                   LLQRLFGSRGDAAEQAQPAEQAAAAAGETQQIAAELLDSPAAPVPAPAAALSTAAPAAA
FT                   LSTAAPARSSLAPRAALDSLPLPPGLVPQPEDEDSPFSLPTSEPGYSAVAPHIASSLRS
FT                   LLDELELPARHRPQGEALRLRLEGGLNWYELVPVLDDLAVLVLAVTDSGQREFAGYLKQ
FT                   LNERLEAFLGTLSEAHEGYSASVESARSFNQELRDQVTDLQNRVQEAADLEALKQALEQ
FT                   RLDGLLQSVSVHQRQRDSREEEVAERLQGLVQRVADMEREAQQFREHIEEQRQKSLLDP
FT                   LTGLPNRAAWSERLELEVARRARYGGELLLAVLDVDHFKRINDGYGHLAGDRVLKIIAG
FT                   ELHKRLRKTDFIARFGGEEFVLLIPATPLEGGMQLLETLRAAIEACPFHFKGEPVTITL
FT                   STGLAEFRDGESAEAVFERADQALYRAKGNGRNRVELG"
FT   gene            complement(163250..164761)
FT                   /locus_tag="Pmen_0163"
FT   CDS_pept        complement(163250..164761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0163"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82937"
FT                   /db_xref="GOA:A4XNM1"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNM1"
FT                   /protein_id="ABP82937.1"
FT                   /translation="MTSTPQRPEDENLGIGSNLLYGLQHVLTMYGGIVAVPLIVGQAAG
FT                   LSPADIGLLIAASLFVGGAATLLQTLGLPFFGCQLPLVQGVSFASVATIVAIVGANGGE
FT                   GGLPVVFGAVIGAALIGLLITPVFSKITKFFPPLVTGIVITTIGLTLMPVAARWAMGGN
FT                   SAAADFGSMGNIGLAAFTLATVLLLSKVGSATISRLSILLAMVIGTLVALAFGMADFSR
FT                   VGEGPVLAFPAPLHFGMPVFEVAAIVSMLIVVMVILVETSADILAVGDIIDTKVDSKRL
FT                   GNGLRADMIASMVAPLFGSFTQSAFAQNVGLVAVTGVKSRYVVATGGLILVTLGLLPIM
FT                   GRVIAAVPTSVLGGAGIVLFGTVAASGIRTLAKVDYRNNMNLVIVATSVGFGMIPIAMP
FT                   SFYHHFPDWFETIFHSGISSAAIMAILLNLLFNHFTAGNSDQQSVFVAGTERSLRYRDI
FT                   AALHEGDHFIGGKLYDAQGNEVPLQDEEEAHGKTQTRRQAALADH"
FT   gene            164992..165582
FT                   /locus_tag="Pmen_0164"
FT   CDS_pept        164992..165582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0164"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82938"
FT                   /db_xref="GOA:A4XNM2"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNM2"
FT                   /protein_id="ABP82938.1"
FT                   /translation="MDIFSIAVLIFLVTDPFGNIAIYIAALKNVAPRRRLWIAARELLF
FT                   ALGLLLLFLTFGDKFLSSLGLSREATAIAGGIILFVIAMRLIFPSPQGLLGDVPDGEPM
FT                   LVPLATPAVAGPSALAVLMTLRNTHTGPLWELYLAVILAWAATAFILLQASFLQRFLGN
FT                   RGLMAVERLMGMLLIMLSVDMLLDNLQSVFGHA"
FT   gene            165579..166361
FT                   /locus_tag="Pmen_0165"
FT   CDS_pept        165579..166361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0165"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82939"
FT                   /db_xref="GOA:A4XNM3"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNM3"
FT                   /protein_id="ABP82939.1"
FT                   /translation="MKSFSLALLLVLLAGCTGGLRIDDSHTATGQNSRVQYVVLHYTSA
FT                   DLQRSLNLLTQTEVSSHYLIGDAPPTVYRLVDENRRAWHVGVSEWQGRTWLNASTIGIE
FT                   LVNQGYYETPAGRYWQPFAPQQIDTLIVLLKDIVQRHQLPLGSIIAHSDVAPQRKVDPG
FT                   PLFPWKRLADEGLVPWPDEARVARQQALFAISLPGIEWFQEQLAQQGYTVPRHGELDEA
FT                   TRNVIAAFQMKYRPANYDGQPDAETAARLLVLNQQAAG"
FT   sig_peptide     165579..165638
FT                   /locus_tag="Pmen_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.834) with cleavage site probability 0.311 at
FT                   residue 20"
FT   gene            complement(166365..166769)
FT                   /locus_tag="Pmen_0166"
FT   CDS_pept        complement(166365..166769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82940"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNM4"
FT                   /protein_id="ABP82940.1"
FT                   /translation="MPSIDPSRADLAEFATRMPSDTPILMLNLLRFNDQAAYPADSAHA
FT                   PCSGRDAYARYSRTALSKVRGVGGEVQLLANAHMALIAPAGEHWDQLVLVRYPSTAAFL
FT                   SMLADPEYQAATVHRSAALADSRLIGTTPA"
FT   gene            complement(166883..167545)
FT                   /locus_tag="Pmen_0167"
FT   CDS_pept        complement(166883..167545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82941"
FT                   /db_xref="InterPro:IPR021747"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNM5"
FT                   /protein_id="ABP82941.1"
FT                   /translation="MRRANPLCLLFAGLLLSGCASQTTSPTQFSGYLADYSQLQPATSA
FT                   TGAPVLRWISPQFKAESYSAVYIEKPTFHPQPVPNEQISAQTLEEVRNYLHQALIREVQ
FT                   GRMKVLSEPTMDSLVLRSAITGVTVTTEGLKAYEVIPVALVVAAATTAAGTRDRDSEIF
FT                   IELEALDARNSEPMVRVVRKGHGLTLENSSTQLTLDDLKPVLDSWARDARDFHPGLR"
FT   sig_peptide     complement(167477..167545)
FT                   /locus_tag="Pmen_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.506 at
FT                   residue 23"
FT   gene            complement(167580..167987)
FT                   /locus_tag="Pmen_0168"
FT   CDS_pept        complement(167580..167987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0168"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82942"
FT                   /db_xref="GOA:A4XNM6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNM6"
FT                   /protein_id="ABP82942.1"
FT                   /translation="MTETGSAIVKTIVLVEDDDVVRQLTAQVLEEFGYRVQALRDGSSA
FT                   LALLQSDQPCDLLMSDIGLPDMDGRALVEAARKLRPTLPVLFASGYNERELLDEVRARD
FT                   TAAATDSIVKPYDLTVLARRLEELANKRSGI"
FT   gene            168101..171607
FT                   /locus_tag="Pmen_0169"
FT   CDS_pept        168101..171607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0169"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   CHASE3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82943"
FT                   /db_xref="GOA:A4XNM7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNM7"
FT                   /protein_id="ABP82943.1"
FT                   /translation="MDVPVSNESAMDEKSFRRILNRNVGLPLGLGLVSALFFAVLIGYL
FT                   LNVIRWVEHTDQVLNRASEVYKLTLDLETGMRGFLLSGREDYLAPYELARGKYRPLVEQ
FT                   MITMVKDNPPQAQRLERLLAMQAQWDAFAQEVIASRRNGRDILEEVGSGRGKNLTDGMR
FT                   GELDAFISSERDLRRHRNAQVSSATTWGAGIYLVVSILFSALLALFGRRELLNLSHTYS
FT                   AALGKQAEYAEEQHQRAWLRGGQTQLSERLLGQPQVNELAERSLAFLAEYLDCVVAALY
FT                   QRDARSGDLRRIAGYGFSEGEALRDEFYRGEGLVGQAAQRRRLVCLDNLPADYIKVTSG
FT                   LGDGQPVSVALVPLQSEDRVNGVLELAFMRVLEPREREFLESISASVGTALEASLYRQR
FT                   LQEVLADTQQLNEELQTQQEELRAANEELEQQARVLKESQAHLETQQAELEQTNEKLSE
FT                   QAQTLADQRDELDQRNTALGRIQAQLEERAEELQRASRYKSEFLANMSHELRTPLNSSL
FT                   ILAKLLAENARGNLDEEQVKFAESIYSAGNDLLNLINDILDIAKVEAGKLEVRPERTPL
FT                   AGMLESLSDVFEPLARERGLSFEIERQAELPQTLFTDRQRAEQILRNLLSNAFKFTDRG
FT                   GVTLRVSRHDEQTLAFAVSDSGIGIAPDQQAVIFEAFRQADGTTNRRYGGTGLGLSISR
FT                   DLAGLLGGSIGVSSVPGEGSTFTLLLPERLLDHGAPARPLPAAPVSPPAVVASVPAAPL
FT                   PAAPRAPAPFADDRERLGERGGRRVLVVEDEVRFARILFDLAHELGYACLVATSADEGL
FT                   ELARQYRPDAILLDMRLPDDSGLGVLQRLKDDAQTRHIPVHVVSVEDHSEAALHLGAVG
FT                   YALKPTSRDQLKEVFGKLEAKLNQQVKRVLLVEDDPLQRNSIARLIGDEDIEISAVALA
FT                   GEALEKLRDTVFDCMIIDLKLPDMLGNELLRRMAEEDICSFPPVIVYTGRNLTREEEAE
FT                   LLRYSRSIIIKGARSPERLLDEVTLFLHKVESSLSSEHQRMLKTARSREKLFEGRRLLL
FT                   VDDDVRNIFALSSALEQKGAAVEVARNGFEALAKLDEHDDIDLVLMDVMMPEMDGYEAT
FT                   RKIRQQPRWNNLPIIAVTAKAMKDDQERCRESGANDYLAKPIDLDRLFSLIRVWMPKLE
FT                   RL"
FT   gene            171607..172416
FT                   /locus_tag="Pmen_0170"
FT   CDS_pept        171607..172416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0170"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /note="PFAM: MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82944"
FT                   /db_xref="GOA:A4XNM8"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNM8"
FT                   /protein_id="ABP82944.1"
FT                   /translation="MPDEIELRLLIEAIYLRYSYDFRDYSKASLKRRVRQAQVQLDCPT
FT                   ISALQERILHEPQVFMQLLQYLTIPVSEMFRDPGYFLALRQQVVPLLHTYPSLKVWVAG
FT                   CSTGEEVYSLAILLREEGLLERTMIYATDINPHSLEKAEQGIFALDNLRTYTQNYQLSG
FT                   GKRAFSDYYSAAYDRVLFDKSLRANVTFADHSLATDSVFAETHLVSCRNVLIYFNRDLQ
FT                   DRALGLFHDSLCHRGFLGLGSKESLDFSAYANQFEALARPERIFRKR"
FT   gene            172413..173024
FT                   /locus_tag="Pmen_0171"
FT   CDS_pept        172413..173024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0171"
FT                   /product="CheB methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82945"
FT                   /db_xref="GOA:A4XNM9"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNM9"
FT                   /protein_id="ABP82945.1"
FT                   /translation="MNEQRIMLRGRPRVPLQALLLGASAGGVEALLQLLVDLPPSYRLP
FT                   VVCLLHQPDRNDSLLADLFARRLQLPVKEAADKEYLRGGVVYVAPAGYHLSIEADRSFS
FT                   LSREEPRHFSRPSIDILFESAADAYGARLAAALLTGANEDGAAGLLAIQRAGGLTLVQD
FT                   PADAQVPTMPEAALALLQPDFLLPLTAMRLLLAELDAPPC"
FT   gene            173018..174205
FT                   /locus_tag="Pmen_0172"
FT   CDS_pept        173018..174205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0172"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82946"
FT                   /db_xref="GOA:A4XNN0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNN0"
FT                   /protein_id="ABP82946.1"
FT                   /translation="MLRKIEAKVLIVDDLPENLLALRSLIQSDDRTLFQASSADEALSL
FT                   MLEHEFALAILDVKMPGMNGFELAELMRGTEKTRHIPIIFVSAVGRDMDYAFKGYESGA
FT                   VDFLHKPLSPFEVRSKVSMFVELYRHRKALSQQLEVLEAARREQEALLTELRETQAELQ
FT                   KAVQMRDSFMSIASHELRTPLNGLILDVQLRKLRLEQGRTDAFTPDKLHEMIARDERQI
FT                   RSLSRLIDDMLDVSRIRTGKLSVIPQPGDLGVLAGNVVEGLAAQFASQGNHIDLQVDGP
FT                   APVMMDEFRIEQVLANLLTNALRYGGGKPVLVRVSSEGEIVRAEVRDQGMGISEADQRR
FT                   VFEQFERVCDAGVAQGLGLGLFISEQIVQAHGGRIELSSRLGEGSCFSVLLPRRV"
FT   gene            174381..174668
FT                   /locus_tag="Pmen_0173"
FT   CDS_pept        174381..174668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82947"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNN1"
FT                   /protein_id="ABP82947.1"
FT                   /translation="MYLVRLSLFCVATLLVNGAYANDFIGSAGASARTADLTVSNAQSR
FT                   ESASAKQRELSQSSGSRRAQDDAQWLRISDETDTANREPRPAVSTPRWVF"
FT   sig_peptide     174381..174446
FT                   /locus_tag="Pmen_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            174687..174872
FT                   /locus_tag="Pmen_0174"
FT   CDS_pept        174687..174872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82948"
FT                   /db_xref="GOA:A4XNN2"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNN2"
FT                   /protein_id="ABP82948.1"
FT                   /translation="MSRSAVILLIMTLLSLASLWLMPGLGEPVSLLLKGAAAVFGLGFL
FT                   LALMLGRRFKFDPVLR"
FT   sig_peptide     174687..174767
FT                   /locus_tag="Pmen_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.827 at
FT                   residue 27"
FT   gene            complement(174898..176694)
FT                   /locus_tag="Pmen_0175"
FT   CDS_pept        complement(174898..176694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0175"
FT                   /product="Alginate biosynthesis sensor protein KinB"
FT                   /EC_number="2.7.3.-"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein domain protein; PAS fold-4 domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82949"
FT                   /db_xref="GOA:A4XNN3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038320"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNN3"
FT                   /protein_id="ABP82949.1"
FT                   /translation="MKLSMKLRTRLFLSISALITVALLGLLLGLFSVTQMSRSQSDLIQ
FT                   RGFTAVQIGQKLRQHLGDELILLIGQTPNPEALENIRQAFRSTLAEGFSAKLGADYVQG
FT                   LEQAAILHRQMEQVAESATPAGQSPHNLAGNIPFTEAFQKLRNHLLDQQDRVVSWVIAA
FT                   EHKAGERSRLIAGLLVMTGLAVLAIGVITANGIARRFGAPIDLLARAADQIGKGQYDVV
FT                   LPVSPVVELAVLSRRFGLMTEALRQYHSSNLTQLLNSEGRLKAVLDSIDDGLVILDALG
FT                   RVEHANPVALSQLSWKQDIQDQPIGPLLPGHAVDEALRQVLAGEPMREPPADLQIDRNG
FT                   EVRLLAWALTPVQVREGGSVGAVMVLRDVTEQRAFERVRSEFILRASHELRTPITGMHM
FT                   AFSLLRERLQVPAGGREQDLMRTVDEEMRRLVQLIDDLLNFSRYQNGLQTLQRVPCDLA
FT                   VMLQQARQRFTDEASERGVTITCELHQPLPRLSLDEGQLHRLLDSLLSNALRHSDSGGT
FT                   VTLQAHRHGEQVIVSVQDQGEGIPYEQQARIFEPFVQIGRRKGGVGLGLALAREIVQLF
FT                   GGQMGVRSRPREGANFYFSLPV"
FT   sig_peptide     complement(176581..176694)
FT                   /locus_tag="Pmen_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.524 at
FT                   residue 38"
FT   gene            complement(176708..178060)
FT                   /locus_tag="Pmen_0176"
FT   CDS_pept        complement(176708..178060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0176"
FT                   /product="Two-component response regulator AlgB"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82950"
FT                   /db_xref="GOA:A4XNN4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNN4"
FT                   /protein_id="ABP82950.1"
FT                   /translation="MAASEQTSGRILLVDDEAAILRTFRYCLEDEGYEVAGASSAAQAE
FT                   ALLQRQVFDLCFLDLRLGEDNGLDLLAQMRIQAPWMRVVIVTAHSAVDTAVDAIQAGAA
FT                   DYLVKPCTPDQLRLAAIKQLEVRALAARLEALEGEVRKAKDGLDSHSPAMMAILETARQ
FT                   VAATDANILILGESGTGKGELARAIHGWSRRAKRTCVTINCPSLTAELMESELFGHARG
FT                   SFTGASESTQGRVSQADGGTLFLDEIGDFPLALQPKLLRFIQDKEYERVGDPVTRRADV
FT                   RIVAATNLDLDEMVREGRFREDLLYRLNVITLKLPPLRERHEDVMSLAERFLAHFVSDY
FT                   GRPACGFSPEAVAALHSYHWPGNIRELRNVIERASIICQQEAVEVAHLGLGGSSDAPNG
FT                   AIRVGAPMSLEELEKAHIAAVLASSNTLDMAARTLGIDTSTLYRKRKQYNL"
FT   gene            178271..179101
FT                   /locus_tag="Pmen_0177"
FT   CDS_pept        178271..179101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0177"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region, bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82951"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNN5"
FT                   /protein_id="ABP82951.1"
FT                   /translation="MPFLRTLLLAGGTALLLSLTPLASHAATDGLTEQIEAARQEGSIW
FT                   TAFALNRHLNPFRLDVAVEKGRATLDGQVESEVQKELAEEVALSVKGVESVDNRIVVDA
FT                   ATAENEPPRLVQRLEDASLAATVKSKLLWNSNTRGLDIQVKSQNGAITLSGHAQTPAAK
FT                   ELAGQLAANTDGVREVFNHLSISTADSSSSEVQTAVEEAREDISDSWITSKVKASFLYS
FT                   RNLDALNISVDTEDGLVRLRGSVLSSAEKRLAVEIARNIRGVRGVDADALRISS"
FT   sig_peptide     178271..178351
FT                   /locus_tag="Pmen_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            179167..179601
FT                   /locus_tag="Pmen_0178"
FT   CDS_pept        179167..179601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82952"
FT                   /db_xref="InterPro:IPR011971"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019052"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNN6"
FT                   /protein_id="ABP82952.1"
FT                   /translation="MSSKTAQLNELIEITRDGKRFYEHAHDEVKDIRLQALFRDMVRAK
FT                   TEVIDALSVKVAANQADPASGGTLLGKLRQLYADTRATLSKDEDAAYVAQLEEAEDRIL
FT                   HAFEDALESADQDVRVLLAVEMPKVRACHDRMRALKQNMQ"
FT   gene            180505..181473
FT                   /locus_tag="Pmen_0179"
FT   CDS_pept        180505..181473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0179"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein, family 1; TC
FT                   3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82953"
FT                   /db_xref="GOA:A4XNN7"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNN7"
FT                   /protein_id="ABP82953.1"
FT                   /translation="MKLKRLMAALTFAAAGVSAVSAVAAVDPALPNYEKTSGVSGNLSS
FT                   VGSDSLANLMTLWAEEFKKNYPNVNIQIQAAGSSTAPPAMTEGTANMGPMSRPMKDSEI
FT                   QAFEEKYGYKPTAVPVAIDALAVFVHKDNPIKSLSIEQVDAIFSSTRLCGGDKDIKTWG
FT                   DLGLTGEWASKPLQLFGRNSVSGTYGYFKEEALCKGDFKSNVNEQPGSASVVQSISSTL
FT                   NAIGYSGIGYKTSSVRAVPLSKKGGEAFEASEENALAGKFPLARFFYVYVNKAPNQPLS
FT                   PLDAEFVKLMLSKQGQEVVMKDGYIPLPSKVAEKALKELGL"
FT   sig_peptide     180505..180579
FT                   /locus_tag="Pmen_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 25"
FT   gene            181639..183924
FT                   /locus_tag="Pmen_0180"
FT   CDS_pept        181639..183924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0180"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82954"
FT                   /db_xref="GOA:A4XNN8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNN8"
FT                   /protein_id="ABP82954.1"
FT                   /translation="MNDLANDTVNRPQNPLGIDFNTPALQRKRRLRALKDRLARWYVSI
FT                   GGLAVLGAITLIFFYLAHVVLPMFQGAEIEARKAQQPAWLGQAGAPLLLAIEEQNQVAM
FT                   RLDDAGVVQFFELRTGEPLQRVQLPLPEGVSVASVAQDQPGSRRAVLGLSNGQVLIVQH
FT                   NYKVSYPDNVRVITPQIDYPYGETPIELDPQGRPLEHVALNLNSGTLMLAGATGSELHL
FT                   ISIGREENLFTGEVSLSEERIGLPQIGEPITQLILDPRQMWLYVFNGDSTADVFDLRKR
FT                   SLNGRYDLLKDASNRVTSAKALLGGISIMIGDAKGGIQQWFMVRDGDGKSTFQPIRSFQ
FT                   LGTSAITQILPEERRKGFMALDESGRLGIFHSTAHRTLLKEQVAEGRGIAALSPRASRV
FT                   LVESDGKLQRFVVDNPHPEVSWSALWGKVWYESYPEPDYVWQSTSANTDFEAKLSLSPL
FT                   AFGTLKAAFYAMLLAAPLAVAAAIYTAYFMAPRMRTKVKPVIELMEALPTVILGFFAGL
FT                   FLAPFLENHLPGIFSLLLLTPVGILAAGYLWTKMPESVRHRVPDGWEAALLIPVVIAVG
FT                   WFSLSISGHLENWFFDGNMRLWLSNDLGIPFDQRNALVVGLAMGFAVIPNIYSIAEDAV
FT                   FSVPKSLTFGSLALGATPWQTLTRVVILTASPGIFSALMIGMGRAVGETMIVLMATGNT
FT                   PIMDINIFEGMRTLAANVAVEMPESEVGGTHYRVLFLAALVLLLFTFVMNTLAELIRQR
FT                   LRTKYSSL"
FT   gene            183940..185616
FT                   /locus_tag="Pmen_0181"
FT   CDS_pept        183940..185616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0181"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82955"
FT                   /db_xref="GOA:A4XNN9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNN9"
FT                   /protein_id="ABP82955.1"
FT                   /translation="MSVKQNNLKSWYKSGAPGVWMSGGAVAIAIIMTLGLLAVIATRGL
FT                   GHFWPADILEADYQVPGQEARVMLGEVVQVEEVPRARLAAAGLPVAEEGGEFMTRELLK
FT                   VGNRELFGADFTWVVGEWLSNPRKPAGITVLERREWGNFYGNLINVKEGGQVVAEGDAA
FT                   WSELQQRLDRVDALHAQLVRLEKKDIGRINHGLERIRLEGRKLQLQGKLDADAQAALDA
FT                   RRDALNADYKVLEEQMVALVQQINRDSVTLSASDGRQTEIALGKVVRAFRPNAMSTLDK
FT                   FGFYAMKLWEFVSDEPREANTEGGIFPAIFGTVLMVMLMAVIVTPFGVIAAVYLREYAH
FT                   QGALTRVIRIAVNNLAGVPSIVYGVFGLGFFVYVLGGNIDRLFFPESAPAPTFGTPGLM
FT                   WASLTLAILTLPVVIVATEEGLARIPRAVREGSLALGATKAETLWKVVIPMASPAMMTG
FT                   LILAVARAAGEVAPLMLVGVVKLAPSLPLNGNYPYLHLDQKIMHLGFHIYDVGFQSPNV
FT                   EAARPLVYATALLLVIVIALLNLTAVYIRNHLREKYKALDH"
FT   sig_peptide     183940..184056
FT                   /locus_tag="Pmen_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.720 at
FT                   residue 39"
FT   gene            185683..186516
FT                   /locus_tag="Pmen_0182"
FT   CDS_pept        185683..186516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0182"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82956"
FT                   /db_xref="GOA:A4XNP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNP0"
FT                   /protein_id="ABP82956.1"
FT                   /translation="MQHETHTHGIDLAALGRDKQSLSLANETTAIQVPGLNLYYGQKQA
FT                   LFDVKMDIPKQRVTAFIGPSGCGKSTLLRTFNRMNDLVDGCRVEGEINIDGRNIYRKGE
FT                   DVAELRRRVGMVFQKPNPFPKSIYENVVYGLRIQGINSKRVLDEAVEWALKSAALWDEV
FT                   KDRLHDSALGLSGGQQQRLVIARTVAVQPEVLLLDEPCSALDPISTLKVEELIYELKSK
FT                   YTIVIVTHNMQQAARVSDYTAFMYMGKLIEFGDTDTLFTNPAKKQTEDYITGRYG"
FT   gene            186678..187406
FT                   /locus_tag="Pmen_0183"
FT   CDS_pept        186678..187406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0183"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82957"
FT                   /db_xref="GOA:A4XNP1"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNP1"
FT                   /protein_id="ABP82957.1"
FT                   /translation="MINKDNLTQHISQQFNAELEEVRSHLLAMGGLVEKQVNDAVTALI
FT                   EADSGLAQQVREIDDQINQMERNIDEECVRILARRQPAASDLRLIISISKSVIDLERIG
FT                   DESTKIAKRAIQLCEEGESPRGYVEVRHIGDQVRRMVQEALDAFARFDADLALSVAQYD
FT                   KTVDREYKTALRELVTYMMEDPRSISRVLNVIWALRSLERIGDHARNIAELVIYLVRGT
FT                   DVRHIGLTRMREEVEGKPEA"
FT   gene            187542..188450
FT                   /locus_tag="Pmen_0184"
FT   CDS_pept        187542..188450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0184"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82958"
FT                   /db_xref="GOA:A4XNP2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNP2"
FT                   /protein_id="ABP82958.1"
FT                   /translation="MSKVSVLVVDDATFIRDLVKKGLRDHFPGVQIDEAVNGRKAQQLL
FT                   GRQDVDLILCDWEMPEMSGLELLTWCREQERLKTTPFIMVTSRGDKENVVQAIQAGVSD
FT                   YIGKPFSNEQLVTKVKKALSRAGKLQALAASAPPKMLSSGGFANDSLAALTGGKAEVVK
FT                   PSAPTPPPATAAAPSAAPAPAAASKAPAGRGQGQLRLPGGSMACVIKALSLKEALLVVK
FT                   RGEPLPQVLESAVLDLEQGEAAETARLNGYLHAVAAFEPKPDSEWLQLTFRFVDRDPQK
FT                   LDYLSRLIARGTAQKHFVPGA"
FT   gene            188598..189494
FT                   /locus_tag="Pmen_0185"
FT   CDS_pept        188598..189494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0185"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82959"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNP3"
FT                   /protein_id="ABP82959.1"
FT                   /translation="MLGRLFFLCSLLAFSGQAAALTIYKYVDKNGVVTYSDQAAPGAQV
FT                   FVFNDRMVERLDNQVKLETKKHEAGETLLIRNDLYAPVEIELKLEQVDNAIGAPDKPIR
FT                   WVLPPRSNIRLATLAPQDASKPLRYKPRLRYALGDPRLQPSIHRYPLPWRGGPFRQTQG
FT                   ANGTYSHFTPKGRYAVDIAMPEGTPIVAARGGVVIKTENQQSGRGNNPAGNFVRILHDD
FT                   GTMGVYLHLMKGSVAVREGQRVATGHLLARSGNTGNSTGPHLHFVVQRNVGLAVESIPF
FT                   NFAQPVNSLPNFAVGGE"
FT   sig_peptide     188598..188660
FT                   /locus_tag="Pmen_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.941 at
FT                   residue 21"
FT   gene            189850..191145
FT                   /locus_tag="Pmen_0186"
FT   CDS_pept        189850..191145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0186"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated protein 2 domain
FT                   protein; flagellar hook-associated 2 domain protein;
FT                   flagellin hook IN repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82960"
FT                   /db_xref="GOA:A4XNP4"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNP4"
FT                   /protein_id="ABP82960.1"
FT                   /translation="MAIDSDYVQSMATQLAKYEIQGQLAKANRNQAAYKAQLSALTTLD
FT                   TALKTFKSAASGLKLAGSSMLVNSASFSQEGYASATVGSKAVAGSYDFFVQQLASKSQL
FT                   ALQGLQDGDLGSGTLTIGQGGDSFEIDLGAVSTLDELAAAINGAGDNTGVKATLVRSNG
FT                   QVNLVLTSEKTGADQAISLSAGGNAAFQGAVAGRQELSVARDAIVRLGGETGIELSSTS
FT                   NTFDNIIDGVSLTFSKAHKAGDTPLTIEIGQDQKATKEKAQTFVSAFNALMTSFDSLTA
FT                   SGGESGGRGPLAGDASVRAIETMLNQLVRTSFGGASLTEFGIVANRNGKLTIDNARFEK
FT                   AVAANPEGFEKLFTDKGNLLDTLDKNLAVYTSSAGGLLTNRKDTLNTQLRRVDQQFDNI
FT                   QKQYDSYYSRYLRQYTGLMQTMAAMEQTYGMF"
FT   gene            191145..191543
FT                   /locus_tag="Pmen_0187"
FT   CDS_pept        191145..191543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0187"
FT                   /product="flagellar protein FliS"
FT                   /note="PFAM: flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82961"
FT                   /db_xref="GOA:A4XNP5"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNP5"
FT                   /protein_id="ABP82961.1"
FT                   /translation="MSAYNLNESYDSYRTVDLEARAAAASPYELVLVLFDGLLDELARA
FT                   RGHIEAKRYQQKGQSLEKCLNILGGLNSALDYENGGELVQGLARLYDYCIYRLSDVSVS
FT                   LSLEGLDEVVGLLGVLREGWEGVNAARK"
FT   gene            191527..191844
FT                   /locus_tag="Pmen_0188"
FT   CDS_pept        191527..191844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82962"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNP6"
FT                   /protein_id="ABP82962.1"
FT                   /translation="MPRASELRALQHLHGQLAEALEQGDWTRIGEIDALIRSCLQLLAG
FT                   LPTLSDEVREAKRRLQQLHGQARIACAQECERVRQLLLRHLEYAEGRSAYLRVDQFQGG
FT                   R"
FT   gene            191848..192906
FT                   /locus_tag="Pmen_0189"
FT   CDS_pept        191848..192906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0189"
FT                   /product="flagellar hook-length control protein"
FT                   /note="PFAM: flagellar hook-length control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82963"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNP7"
FT                   /protein_id="ABP82963.1"
FT                   /translation="MLQSINPSVQVSLSGSAVETLPAGFAEAQAGSGQLQAFDLQLALH
FT                   GFSAAEASTPLEQDPVPAKAPLVEADAEQWLAGMLGQQAVRVEAREVPEQPEQAQPTDD
FT                   IRDPQAVPLAAVLLPQHEPAVVAPAPALEGLSEARQPAPAMQRTTVMTLPLAAEGTGQL
FT                   PSPLALTDEAPEVLERLPGAVESDKPAAGGAPATQAGAQPLTAERSLKLPVAQAQWGEQ
FT                   MLHSLREQVELQINQRIQNATIRLDPPELGSLEIFLSHESGRLNVQLSAANGEVARLLQ
FT                   QISERLRQELVGQNFVQVNVQVSADAQGGRQQQQAQAQRWLVEDEVAAAVALPASGERN
FT                   GAQSTSDVLVTV"
FT   gene            192934..193410
FT                   /locus_tag="Pmen_0190"
FT   CDS_pept        192934..193410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82964"
FT                   /db_xref="GOA:A4XNP8"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNP8"
FT                   /protein_id="ABP82964.1"
FT                   /translation="MTMPRVLLLLVIFNTLVVVGGTIFNYATLKSMQTGQAVLGISVGS
FT                   AGSEAEEAKSEYRFFPIEKVIVSLQGESREHYFVLDLVLQADLETDPKKLEQIDPMVRN
FT                   SVVAHLSAMSFEKLRGMPIPELQSALERALFDDFASKKLAMPFANVLVSKLIVQ"
FT   gene            193427..194161
FT                   /locus_tag="Pmen_0191"
FT   CDS_pept        193427..194161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0191"
FT                   /product="RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82965"
FT                   /db_xref="GOA:A4XNP9"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNP9"
FT                   /protein_id="ABP82965.1"
FT                   /translation="MNATCAIDYRYAAEQGGAALFAPGAEQKWLLQYLPLVKRIVSQLA
FT                   LQANQVLDREDMEQIGLMGLLECLRRYGTPDEQFGRFAALRIRGAILDELRRQDWRPRQ
FT                   VRQQTHRIRDAIRQLARQLGRVPQEEEILAAAGIDAKTYQEFLQADACEAIESLDELLQ
FT                   SGHEGFVCGASAVEERVLKERLLTQALSQLSERERLVLTLYYQHELSLKEIALVLELSD
FT                   ARVCQLSKQAIAKASRYLNERG"
FT   gene            194163..195035
FT                   /locus_tag="Pmen_0192"
FT   CDS_pept        194163..195035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0192"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82966"
FT                   /db_xref="GOA:A4XNQ0"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNQ0"
FT                   /protein_id="ABP82966.1"
FT                   /translation="MQKLLGALIIVGCVLGGYVMAHGELAMLWQPAEVVIIVGAGLGAL
FT                   VVGNPKEVLVEMCQQIKGVFVYKRRGEEFQRQLLMLLYELLEMVEVGGLKVLDAHIEEP
FT                   EQSELFAKYPLIRQEKNLMAFIADNFRLMAMGKISAHELEGFLEQELEAMEHILLQPSR
FT                   SLHKIGEAMPGFGILAAIMGIIITMGNIGGSVAEIGAHVAAALVGTFLGIFMCYCVMEP
FT                   LSNAMSQRIKTELSALECVRTTLVAHVAGKPTLLAVDAGRKLIEQDVKPAFKQLETWVN
FT                   RYEDERDAA"
FT   sig_peptide     194163..194228
FT                   /locus_tag="Pmen_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            195032..195973
FT                   /locus_tag="Pmen_0193"
FT   CDS_pept        195032..195973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0193"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82967"
FT                   /db_xref="GOA:A4XNQ1"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNQ1"
FT                   /protein_id="ABP82967.1"
FT                   /translation="MRKRGGEEHEIIVKRRSKKGGHDEHGGAWKVAFADFTMAMMALFM
FT                   VLWIIQPQNQQQSRADADQLTNPLVEGGAGIFDGSSRTPLDLDGVPVQVSPRKDRDNQA
FT                   RTPQEDPGATLGEGQPGEPRRPHYAEPGQMQELAELLEQLALQLDAEANIEVQVVPQGL
FT                   RILIKDDAQRFMFSRGSARLDPHFEKLLQRLAGILAKVDNHLIISGHTDSTPYRGVVGG
FT                   YNNWNLSGDRALRARNVLVEAGLPTSAVLQVTAQADGMPLLPSDPQNGANRRIELLLLT
FT                   SQAEGLYRELFGDAQVRVDYREGGAQFNAPGS"
FT   gene            complement(196058..196528)
FT                   /locus_tag="Pmen_0194"
FT   CDS_pept        complement(196058..196528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82968"
FT                   /db_xref="GOA:A4XNQ2"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNQ2"
FT                   /protein_id="ABP82968.1"
FT                   /translation="MSQYPQRGLSRRWLLAALASSLGLLLGILSLWLNFKSSAELDGRY
FT                   HSTGQVQLSNGQVLDLSHNLQVQDGRFYAMTRQGDSILETSGEVEYGFLGNYRLRVEDG
FT                   KLTGLSSEADDELVFNLLYGRHKGSTIRLVTFRNCLYGVETRQVYCPTRIRQ"
FT   sig_peptide     complement(196409..196528)
FT                   /locus_tag="Pmen_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.977 at
FT                   residue 40"
FT   gene            complement(196525..197358)
FT                   /locus_tag="Pmen_0195"
FT   CDS_pept        complement(196525..197358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0195"
FT                   /product="transcriptional regulator, CadC"
FT                   /note="PFAM: transcriptional regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82969"
FT                   /db_xref="GOA:A4XNQ3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNQ3"
FT                   /protein_id="ABP82969.1"
FT                   /translation="MNSSPETTAAEPESSIACLIIKTGRNDCYAHFYPALYQLTLVRSG
FT                   IEEKIDLGYSGSRLLERLVREPGEVVAREELMSHAWADRVVGQGSLNQQIYTLRQILGD
FT                   EKSREIIQTLPRRGYLLNPSYLVYPPSIDDIGAVQEADAPGTPPNFLHRHSRRRTSWLV
FT                   LLSALGLMAVGLFVALYQFSLPARLHSSELNLGQISLLYVDQDAQRLQQLILQTHGLAS
FT                   RLSELSAAPAELIIGNSGGFFEVLCMQPGGGARSLMFHESQLAHLADDQLNRCLP"
FT   gene            complement(197677..198576)
FT                   /locus_tag="Pmen_0196"
FT   CDS_pept        complement(197677..198576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0196"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82970"
FT                   /db_xref="GOA:A4XNQ4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNQ4"
FT                   /protein_id="ABP82970.1"
FT                   /translation="MALSIHTNYSSLITQTNLSKTNNALGTNQQRLGTGFRINSAADDA
FT                   AGLQIATRLNAQSRGMDVAIRNTSDSISLLQTAEGALTEMTDIVQRMKDLATQAANATA
FT                   SEKDRDALQAEYDQLGQELGNIVKNTKYAGEGLFSDGTTTDGTGGKFGAAMNFQIGASA
FT                   AETLTLDVSTSLGDLATALDGLSAQFATPDSTTPGTEIAGADTTAANGMIDTLSDALDS
FT                   IGSLRAQFGANINRLNHTANNLSNMKDNTDMAKGRIMDADFAKESANMSKNSMLLQSGI
FT                   SMLKQAGQMPGMVMSLLG"
FT   gene            complement(198855..199022)
FT                   /locus_tag="Pmen_0197"
FT   CDS_pept        complement(198855..199022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0197"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82971"
FT                   /db_xref="GOA:A4XNQ5"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNQ5"
FT                   /protein_id="ABP82971.1"
FT                   /translation="MKKWQCVVCGLIYDESQGWPDDGIAPGTRWEDVPEDWLCPDCGVG
FT                   KMDFEMIEIG"
FT   gene            complement(199140..200840)
FT                   /locus_tag="Pmen_0198"
FT   CDS_pept        complement(199140..200840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0198"
FT                   /product="L-lactate permease"
FT                   /note="PFAM: L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82972"
FT                   /db_xref="GOA:A4XNQ6"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNQ6"
FT                   /protein_id="ABP82972.1"
FT                   /translation="MSQTLLSILAFVPLVLAGVLLIGFRWPAKYAMPLVFVLTALIGLL
FT                   AWDMSLNRVIASSLQGLILTASILWIIFGAILLLNTLKHSGGIAAIRRGFSNISPDRRV
FT                   QALIVAWLFGCFIEGASGFGTPAAVAAPLLVALGFPALAAVVLGMMVQSTPVSFGAVGT
FT                   PILVGVGAGLDRTGITEQLVATGSTWETFFHLIYSRVAITHGLIGLLMPLIMVMIMTRF
FT                   FGRNQSWKEGLAVAPFAIFTAFAFSLPYMAAGVFLGPEFPSMIGALVGLAIVVPAAKAG
FT                   FLLPKETWDFADPRDWPSEWMGKIEMKLDEVAGKTPISVPMAWAPYLLLAVFLVISRTF
FT                   PQVKAALMSLSFGWKDILGETGVSGTIEPLYLPGGILCMVVLVTFFLHRMRLSELKAAV
FT                   GESSKTLLGAGFVLIFTIPMVRILINSGVNGADLVSMPVAMAQLVADSVGGIYPFFAPA
FT                   VGGLGAFIAGSNTVSNLMLSQFQFNAAQLLGVSGAMMVALQSVGAAAGNMIAIHNVVAA
FT                   SATVGLLGREGITLRKTILPTLYYLAMAGAIALFAMYVMGIGDPLLASR"
FT   sig_peptide     complement(200787..200840)
FT                   /locus_tag="Pmen_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.907) with cleavage site probability 0.889 at
FT                   residue 18"
FT   gene            complement(201068..203245)
FT                   /locus_tag="Pmen_0199"
FT   CDS_pept        complement(201068..203245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0199"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="TIGRFAM: malate synthase G; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82973"
FT                   /db_xref="GOA:A4XNQ7"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNQ7"
FT                   /protein_id="ABP82973.1"
FT                   /translation="MTERVQCQRLQVAAELKQFIESEVLPGSGVEAAAFWSGFDALVHD
FT                   LAPRNRALLAERERLQAELDAWHRAHPGPITDMSAYRAFLESIGYLLPQPEKVKVSTAN
FT                   VDSEIASQAGPQLVVPVMNARYALNAANARWGSLYDALYGTDAINEEGGASKGPGYNEV
FT                   RGAKVIAFARAFLDQAAPPAQGSHADASAYAVVAGQLQVTLSSGAQTSLAQPEKFVGFQ
FT                   GEAAAPSAVLLKNNGLHVEIQIDPASPIGRTDAAGVKDLLMEAALSTIMDCEDSVAAVD
FT                   AADKVLVYRNWLGLMKGDLAEELDKGGKRIVRRLNADRVYTAADGSELTLHGRSLLFVR
FT                   NVGHLMSNPAIIDGEGHEIPEGILDAVVTSLIALHDLKRRGNSRTGSVYIVKPKMHGPF
FT                   EVAFANELFGRVEQLLGMPANTLKMGIMDEERRTSVNLKACIEAASARVAFINTGFLDR
FT                   TGDEMHTAMEAGAMLRKGDMKSSAWIAAYERNNVLVGLACGLRGKAQIGKGMWAMPDLM
FT                   AAMLEQKIGHPKAGANTAWVPSPTAAVLHALHYHQVDVQAVQSELERIDLASQRDSLLG
FT                   DLLSVPVSAERPWSASDIQQELDNNCQGILGYVVRWVEQGVGCSKVPDIHNVGLMEDRA
FT                   TLRISAQHIANWLHHGVVSEAQVRETLQRMAQVVDGQNAGDPAYRPMAPNFEQSHAFRA
FT                   ACDLVFKGREQPSGYTEPLLHAWRLRFKKEA"
FT   gene            complement(203399..203839)
FT                   /locus_tag="Pmen_0200"
FT   CDS_pept        complement(203399..203839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0200"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82974"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNQ8"
FT                   /protein_id="ABP82974.1"
FT                   /translation="MRGGGRTAKHTRYAMQHKAVLSQREVSQILQAARSEAQQQGWAVA
FT                   IAVVDDGGHPLALERLDGCAPIGAYIATEKARSAALGRRETKGYEDMVNGGRTAFVSAP
FT                   LLTSLEGGVPLLVDGQVIGAVGVSGVKAEQDAQVARAGIAAL"
FT   gene            complement(203876..205093)
FT                   /locus_tag="Pmen_0201"
FT   CDS_pept        complement(203876..205093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0201"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82975"
FT                   /db_xref="GOA:A4XNQ9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNQ9"
FT                   /protein_id="ABP82975.1"
FT                   /translation="MQTNLSEQAKRLPRAEEAERVLRSCVHCGFCNATCPTYQLLGDEL
FT                   DGPRGRIYLIKQMLEGGEVTAKTQQHLDRCLTCRNCETTCPSGVQYHDLLDIGRELVEL
FT                   TVPRPPSQRLLRQGLRAVVPRPALFKALTQTGLALRPLLPAALKAKLPREVRPAKPRPT
FT                   QQHARRVLMLEGCVQPGLSPNTNAATARVLDRLGISVTPIREAGCCGAVDYHLNAQEAG
FT                   LQRARQNIDAWWPAIEAGAEAIVQTASGCGAFVKDYGHLLASDPAYASKAARVSALAKD
FT                   LVEVLQGEPLEQLQVRAEQRLAFHCPCTLQHAQKLGGAVEGVLTRLGFGLTAVPDGHLC
FT                   CGSAGTYSLTQPALSRQLRDNKLNALESGKPDAIVTANIGCQTLLDGAGRTPVRHWIEI
FT                   VEEAMA"
FT   gene            complement(205097..206152)
FT                   /locus_tag="Pmen_0202"
FT   CDS_pept        complement(205097..206152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0202"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82976"
FT                   /db_xref="GOA:A4XNR0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNR0"
FT                   /protein_id="ABP82976.1"
FT                   /translation="MQQDFDASAALLEQVNHALNSATPLRIQGSGSKAHLGRATPGEVL
FT                   DTRQHRGIVSYDPTELVLTARAGTPLAEIESALEANNQMLPCEPPHLGDGATLGGMVAA
FT                   GLSGPRRPWAGSVRDQVLGTRVITGQGKLLRFGGEVMKNVAGYDLSRLMAGSFGCLGLL
FT                   AEVSLKVLPKPRQVLSLRLVMDAQQALNKLAEWGQQPLPISAASHDGAALHLRLEGGEG
FT                   SVLAARQRLGGEEIDNAYWYELREQRLPFFAGEGTLWRLSLPLNSALLVLPGRQLIDWG
FT                   GAQRWLKSDADGELIQRVAAKLGGHATCFAAGQTQPFQPLAAPLLRYQRQLKNQLDPQG
FT                   IFNPGRLYAEV"
FT   gene            complement(206152..207651)
FT                   /locus_tag="Pmen_0203"
FT   CDS_pept        complement(206152..207651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0203"
FT                   /product="glycolate oxidase, subunit GlcD"
FT                   /note="TIGRFAM: glycolate oxidase, subunit GlcD; PFAM: FAD
FT                   linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82977"
FT                   /db_xref="GOA:A4XNR1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR004490"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNR1"
FT                   /protein_id="ABP82977.1"
FT                   /translation="MSILYDERIDGALPKVDKAALLAELHQRLPDLDILHTQEDLKPYE
FT                   CDGLSAYRTTPMLVVLPERIQQVQQLLQICHARAVPVVARGAGTGLSGGALPLEQGILL
FT                   VMARFNQILEINREGRFARVQPGVRNLAISQAAAPFDLYYAPDPSSQIACSIGGNVAEN
FT                   AGGVHCLKYGLTVHNLLKVDILTVEGEFMTLGSDALDTQGFDLLALFTGSEGMLGIVTE
FT                   VTVKLLPKPQVAKVLLAAFDSVEKAGRAVGDIIAAGIIPGGLEMMDNLAIRAAEDFIHA
FT                   GYPVEAEAILLCELDGVEADVADDCERVRAVLTKAGAIEVRQARDEAERVKFWAGRKNA
FT                   FPAVGRISPDYYCMDGTIPRRELPGVLRGIAELSAEYGLRVANVFHAGDGNMHPLILFD
FT                   ANVPGELERAEAIGGKILELCVKVGGSITGEHGVGREKINQMCAQFNSDEITLFHAVKA
FT                   AFDPAGLLNPGKNIPTLHRCAEFGAMHVHHGQLPFPELERF"
FT   gene            207891..208664
FT                   /locus_tag="Pmen_0204"
FT   CDS_pept        207891..208664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0204"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82978"
FT                   /db_xref="GOA:A4XNR2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNR2"
FT                   /protein_id="ABP82978.1"
FT                   /translation="MDAKQGAARRQVSDVVAERIERLIVDGVLKVGQPLPSERRLCEKL
FT                   GISRSALREGLKVLRGRGIIETAQGRDSRVAKLSGERDASPLMHLFNSQPRTLYDLLEV
FT                   RGLLEGESARLAALRGTEADFVLLTRRYEEMLAAHAQENPVDPREHARLDHAFHLAICE
FT                   ASHNPVLVHTLQSLTDLMLSTVFASVNNLYHRPAQKRQIDRQHSRLYHAVIERLPEQAQ
FT                   RAARDHIHSIRDNLQEIEQEEQRLVRATMRLEGWA"
FT   gene            complement(208742..209587)
FT                   /locus_tag="Pmen_0205"
FT   CDS_pept        complement(208742..209587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0205"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82979"
FT                   /db_xref="GOA:A4XNR3"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNR3"
FT                   /protein_id="ABP82979.1"
FT                   /translation="MPNLQESSRPLIYQDFLGAHGALRVALLPHRRSRERKSGKVFSAC
FT                   ALALFLFALLPSAVLRAEVEAAGQIDQAIAAHMQQQLAAEAKRQAWQGMRHSLGITLLS
FT                   SAEQLPACSQALELTVASDDPSPLARQRLQLRCADAPGWTRVALVQASVFVAAVHAARV
FT                   IERGQTIAAEQVQLQEVNVGRSSRGFYSSLDEVVGQGAKRRIRAGALIAPSLLSAPLLV
FT                   RRGQQVTIVANQDGISASATGEALGNGREGEVIRVRNLGSQKVIEAQVVEEGVVTSTFR
FT                   "
FT   gene            209639..209992
FT                   /locus_tag="Pmen_0206"
FT   CDS_pept        209639..209992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0206"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82980"
FT                   /db_xref="GOA:A4XNR4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNR4"
FT                   /protein_id="ABP82980.1"
FT                   /translation="MSIRIDDVVGLHSRALELRMQRSEILAANLANEDTPGFLARDIDF
FT                   AGEMQRLDPQQRFAASSAELKYRVPTQPSQDGNSVELSVEQAAFSKNAMDFQTSLTFLS
FT                   MKFRGLKQAIEGR"
FT   gene            209995..210423
FT                   /locus_tag="Pmen_0207"
FT   CDS_pept        209995..210423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0207"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82981"
FT                   /db_xref="GOA:A4XNR5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNR5"
FT                   /protein_id="ABP82981.1"
FT                   /translation="MAFDSIYRIAGSSMNAQTVRLNTVASNLANADSAAAKAEDVYQAR
FT                   KPVFAAVYNNDELTRGVGMGGAHVQVLDVVTAGREPVRRYEPDNPLADDQGYVFYADID
FT                   QIEEMTDMMSATRSFETSVEVLNRLKSMQQGLLKLGES"
FT   gene            210423..211100
FT                   /locus_tag="Pmen_0208"
FT   CDS_pept        210423..211100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0208"
FT                   /product="flagellar hook capping protein"
FT                   /note="PFAM: flagellar hook capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82982"
FT                   /db_xref="GOA:A4XNR6"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025963"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNR6"
FT                   /protein_id="ABP82982.1"
FT                   /translation="MTAVSNNSQNNPVYGIDEAVKQAVNVSDATQLENNFLTLMVAQIQ
FT                   NQDPTKPVDSTEFLNQFAAMSQVKSLENMASLSKSNLVLLDNLQTLTAAGLVGQEVKVA
FT                   TEKLELGADKVKGEVNLEHAAGKLTLVVTDSNGVKKEIALGSQAPGRVPFELDPKALGL
FT                   APGSYKVEVQSDSGEYPKVEVAGRVTQVRVSAEGPVLEIVGIGSVPFYNITEFGQTQTV
FT                   GLL"
FT   gene            211137..212324
FT                   /locus_tag="Pmen_0209"
FT   CDS_pept        211137..212324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0209"
FT                   /product="flagellar basal body FlaE domain protein"
FT                   /note="PFAM: flagellar basal body rod protein; protein of
FT                   unknown function DUF1078 domain protein; flagellar basal
FT                   body FlaE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82983"
FT                   /db_xref="GOA:A4XNR7"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNR7"
FT                   /protein_id="ABP82983.1"
FT                   /translation="MSFNIAMTGLSAVNEQLNTISHNIANAGTTGFKSSRTEFGSIYAD
FT                   SQAMGVEVLATTQSISQGGSLVTTGRSLDLAISGGGFFVTRGSNGDVSYTRAGVFGADK
FT                   DNYIVNAAGLKLQGYPVDAAGNLLVGAMGDLQLQNANLPARATDSLAFVMNLDSNQSVP
FT                   TAAPFDPADVNTYNSTYTTKVFDSQGKEHTLTQYFVKTGDNAWEAHYYADGAAVGGPQA
FT                   LTFGTNGSLTAPVGPVAVGFPLPGVDPMNIAIDYSNSSQYGSDFVVTSNRASGYAAGEQ
FT                   TGLSVEKDGMVYANYSNGQRMLQGQVALATFANAGGLKNVSGTAWVESAESGAALIGVP
FT                   GVGPFGELVAGSLENSNVDLTQQLVGLMEGQRNYQANTKVLTTNKELTQVLFGAI"
FT   gene            212334..213065
FT                   /locus_tag="Pmen_0210"
FT   CDS_pept        212334..213065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0210"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgF;
FT                   PFAM: flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82984"
FT                   /db_xref="GOA:A4XNR8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNR8"
FT                   /protein_id="ABP82984.1"
FT                   /translation="MDRLGYTAMTAASRTMSSLTVRANNLANVNTPGFRADLEQAQAVA
FT                   VEGYGYDSRHLAQVKNNGVSLAPGALMATGRDLDVAIQGQGLFAVEGDDGAERYTRNGA
FT                   LQVDADLRLTLNGRAVLGEGGPIVLPEYDSLHIGRDGTVSVIPRGDFLTAEVDRIRVVD
FT                   VAAGDLIKDASGLLARSDGQPAEDMEAPVLVSGYLEASNVGAIDQLVATMSLNRLFETQ
FT                   VKMMKAAEDLSEAGNRMIRGS"
FT   sig_peptide     212334..212405
FT                   /locus_tag="Pmen_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.730) with cleavage site probability 0.724 at
FT                   residue 24"
FT   gene            213261..214046
FT                   /locus_tag="Pmen_0211"
FT   CDS_pept        213261..214046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0211"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="TIGRFAM: flagellar basal-body rod protein FlgG;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82985"
FT                   /db_xref="GOA:A4XNR9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNR9"
FT                   /protein_id="ABP82985.1"
FT                   /translation="MSSALWVSKTGLAAQDKAMSAVANNLANVNTTGFKSDRVVFEDLF
FT                   YAIELQPGAQADQVNTVPSGIQLGSGVRVAGTQKVFTEGSIQTTGQPMDLAIIGNGFFQ
FT                   VEAPNGDIYYTESGQFQLNAEGVIVNAQGLPLVPGIEVPAGSSRFTVGSDGIVTAVMAG
FT                   ETLPVELGQITLANFANPGGLEALGGNLYRETVASGEPVEGTPGEDGLGNLKQGVLEGS
FT                   NVQVVEAMVNMIAIQRAYEANAKVLDAASGMQQFLNQTV"
FT   gene            214052..214714
FT                   /locus_tag="Pmen_0212"
FT   CDS_pept        214052..214714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0212"
FT                   /product="flagellar L-ring protein"
FT                   /note="PFAM: flagellar L-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82986"
FT                   /db_xref="GOA:A4XNS0"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNS0"
FT                   /protein_id="ABP82986.1"
FT                   /translation="MKRLIPLALLLTLGGCASFNEMLPDEDSSHYEPLALDYSQPPTTS
FT                   GGLFRSGYSGSLVGDKRAVRVGDILTVVLDESTQSSKSAGTSFGKSSGVSVGIPTVLGK
FT                   QYDQLESSAEAERDFKGSARSSQQNTLRGSIAVTVHQVLPNGTLLIKGEKALRLNQGDE
FT                   YIRLVGLVRVDDINRSNQVSSQNVANARISYAGRGVLNDSNSAGWLTRFFTHPIFPL"
FT   sig_peptide     214052..214114
FT                   /locus_tag="Pmen_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.774 at
FT                   residue 21"
FT   gene            214724..215818
FT                   /locus_tag="Pmen_0213"
FT   CDS_pept        214724..215818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0213"
FT                   /product="flagellar P-ring protein"
FT                   /note="PFAM: flagellar P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82987"
FT                   /db_xref="GOA:A4XNS1"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNS1"
FT                   /protein_id="ABP82987.1"
FT                   /translation="MFKRSLVFLLLSWPLSTKAVPLMDLVDIEGIRGNQLIGYGLVVGL
FT                   DGTGDKNQVKFTSQSVANMIKQFGINLPPNVDPKLKNVAAVTVTAEIPPSYSPGQTVDV
FT                   TVSSLGDAKSLRGGQLLLTPLHGVDGEIYALAQGALVVGGLNASGQSGSSVAINSANSG
FT                   RVPNGATVERMIPSDFSERAEVMLNLRQPSFQTAAKVVEAVNGRFGSGTASALNATKIA
FT                   IRAPITSTQRIGFMAMLEGLEVEEGRERPKVVFNSRTGTVVVGQGVRVKAAAVAHGTLT
FT                   VTISENPQVSQPNAFSGGQTAVVPRSDVAVSQDKNAMFKWPDGASLDSIISTVNSLGAT
FT                   PDDVMSILQALEQAGALNAELVVI"
FT   sig_peptide     214724..214783
FT                   /locus_tag="Pmen_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.971 at
FT                   residue 20"
FT   gene            215822..216946
FT                   /locus_tag="Pmen_0214"
FT   CDS_pept        215822..216946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0214"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82988"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNS2"
FT                   /protein_id="ABP82988.1"
FT                   /translation="MSIVSLAQHMNSHRGAADGIGNAREQQLQAAAEQFEALFLQQILK
FT                   QMRKASDVLAAGNPMRSRELDTMRDFYDEVLAETLAGRKQTGIADMLVKQLSGGGDSAP
FT                   DLEAAAAAARSAELPQRSSSSLLEPLRSTWQRGVDSLGQVWDKGSAGFLALVERVIQQE
FT                   SAGRVDAVSPKGARGLMQLMPDTAREMAAELGLPFSEARLTSDADYNRRLGSAYLDKML
FT                   QRYDGHQALALAAYNAGPGRVDEWLKVHGDPRRGEIATGAWIERIPFQQTRDYTRKILG
FT                   DLAKAEQPPKDDAQVSSPLSAQTRQQLASALSADSGLLLGAVAGKQALVRGEFKSAADS
FT                   VALSSVTAQSAADDARAPRLAAFAQPVRFERQES"
FT   gene            216950..218317
FT                   /locus_tag="Pmen_0215"
FT   CDS_pept        216950..218317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0215"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: protein of unknown function DUF1078 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82989"
FT                   /db_xref="GOA:A4XNS3"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNS3"
FT                   /protein_id="ABP82989.1"
FT                   /translation="MTILNQIAYSGVRASQVALASTGQNIANVNTPGFSRLQTITGSLA
FT                   GQGGLSVGGGVEVISIRRMTNDFHNQQLWRATTEQSFYSASQQYLTALEALMSGSGSSI
FT                   SAGLDQFFAALSEASATPGSIALRQQIISEAGNLAQRFNGLNSNIDAQIKALQEQRSAM
FT                   ATEINGLTENIALLNKKIVETESVKGDSTALRDHRESLIGQLSQFAKLRVNETPDGSVS
FT                   VALANGQPLVAGPTAGQLKVAMTASGEQDVSLAFAGTSFPLRQDGFGGAFGGLYEVEYA
FT                   SLRPNQQALHDMASQLAQMVNDVLATGFDLAGNPGQPLFAYDPNSTTALLRVEPLTAEQ
FT                   LAFSSAAGESGNNEVLLDLLGLKNQTITLNGSQVTLNDAYAGLLGQVASDSRQNQADLK
FT                   SATAVTQQAQSQRDSVSAVSLDEEAVNLMTYQQAYQANMKVISTANQLFDDMLAAF"
FT   gene            218341..219258
FT                   /locus_tag="Pmen_0216"
FT   CDS_pept        218341..219258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0216"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82990"
FT                   /db_xref="GOA:A4XNS4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNS4"
FT                   /protein_id="ABP82990.1"
FT                   /translation="MMRITNSQITSMMHNSMNASSAELGKLMQQMASGKRILLPSDDPI
FT                   ASVRVLRVQREEASLEQFRKNIANVSGSLSTQEANLKSTSDSMLNVRDLLLWAANGSNT
FT                   SEDLAAMAGELSIIEDTIFSFANVRDEEGRYLFSGTLSDTPALSFDAATQTYSLTGNDK
FT                   HRQAAVANGVLVDENVTAASVFGAGVDMLNQLRGLINTLRDPALDASDPAVRQQIVDTL
FT                   GALDDTHGRVLGSITELGGRQNALSLLKDSNEDVSLVNQKIEGELSQLDYAGATIDLNN
FT                   YQLALGATQKTYLKINEMSLFSLL"
FT   gene            219271..220296
FT                   /locus_tag="Pmen_0217"
FT   CDS_pept        219271..220296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82991"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNS5"
FT                   /protein_id="ABP82991.1"
FT                   /translation="MIKVDKQLPVVTALDPQTRRPVQGEQAVQRQRKQAPAEPAAQPRG
FT                   KSTSFNLQLNQQLTSMQAADSYLGELAGRLGQLKLSLSRELSNAQAGEREGLKRELEQV
FT                   RQLLAERGQRSGEALDASFKLRLTEPVRSRFSLQSLESMAAIQQAGKETLLFSAGRKLA
FT                   EPLAVVLDEGLSEQQILRRFNAGLGPAGIRAEVDNGGALKFSARESDWQQLKGELRVQG
FT                   EGKLAAKAAAPVVSQEEQLLRLPDAARLDGARELRRALDEVVAALDKIGALREQLSHRQ
FT                   EEIREFLARHAEQNEREWARDFAGEVFNLMRRSPSSYAAVTQTVVAQANISRSSVVSLL
FT                   S"
FT   gene            complement(220390..221370)
FT                   /locus_tag="Pmen_0218"
FT   CDS_pept        complement(220390..221370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0218"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82992"
FT                   /db_xref="GOA:A4XNS6"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNS6"
FT                   /protein_id="ABP82992.1"
FT                   /translation="MFKTSLAAALAALLCSAQALAEPILIKFSHVVAEDTPKGKGALMF
FT                   KRLAEERLAGKVQVEVYPNSTLFGDADELQALRDNKVQLLAPSLSKFEQYTTQLQVFDL
FT                   PFLFDDLEAVKRFQKREKSRELLRSMAGHNIYGLAYWNNGMKQLSATRALHTPADAAGL
FT                   AFRIQPSEILEQQFARVGASSLRLPFAETQAALQAGRVQGAENPWSNIVSQQLGALQPY
FT                   VTETDHGVLSYMLVSNSSFWTSIPYPIRVQLEAIVDEVTLAVNREAEALNARDRQRLVA
FT                   AGNQVVSLSNEQRAAWRAAMQPLWQEYEGKIGSDVLRAAQTVNRR"
FT   sig_peptide     complement(221305..221370)
FT                   /locus_tag="Pmen_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            complement(221603..222754)
FT                   /locus_tag="Pmen_0219"
FT   CDS_pept        complement(221603..222754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82993"
FT                   /db_xref="InterPro:IPR021259"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNS7"
FT                   /protein_id="ABP82993.1"
FT                   /translation="MNLSCFAQSYAEARQKFLASCARRGLAVESHVHPLPGRDGEQLAI
FT                   DVARLGAADAANLLVLSSGCHGIEGFCGSAIQIDRLDDDAWFAACQRGDLALLYIHALN
FT                   PYGFSWERRVTQENVDLNRNFQDFAAPLADNPDYRAVAKLLLPERCPPTLASTLGLYGY
FT                   ALRHGRKALQAAISRGQHGDPRGLFFAGTEPTWSNRQLRQILRQHGRQCRRIGWIDVHT
FT                   GLGPSGYGERIYKGRQEPADIARARQWWGPQVTNSAEGNSASSELNGTLDLAVLDECAQ
FT                   AQYNGLTLEYGTQPGLKVLTALRAEQWLENRPDTDAATRARIKAQLRAAFYVETDAWKR
FT                   QVLEQAREVLELTRQGLATPLRALHQSESQAIAEQYSGMRARS"
FT   gene            complement(222897..224366)
FT                   /locus_tag="Pmen_0220"
FT   CDS_pept        complement(222897..224366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0220"
FT                   /product="Putative enzyme of poly-gamma-glutamate
FT                   biosynthesis (capsule formation)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82994"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNS8"
FT                   /protein_id="ABP82994.1"
FT                   /translation="MQHRVPTPQQRPESLELQPNWRQAEVEDGFCVVAVGDIIITHAIA
FT                   AKLARKSPELLQILRRGDVLVGNYEGTAIDLNSFAGYPEALSGFSWLISDPDAPADLAE
FT                   LGFNLLARANNHALDWGVAGMRMTDALLDAAGIAHAGTGDSLAAARAPAFINTAKARVS
FT                   LTSYATTFEANAPAADGLGQVAPRPGLNPLRTTPHRLVSAEDFAVLKRLNAQEAYQDHY
FT                   LLKALHGEHSLHLGMALHYRVDPEAAPGSLRIHYQCDPRDQAEILRHQRQAKQTSDFSI
FT                   VAQHTHEPDNFTAAVPDYLPALARQLVDNGADMLCGHGPHQLRGIEIYAGKPLLYSLGN
FT                   FCFMDNSMQIVPADKWESREWQAAEALIGPKGITNPRLSTPAEFLEWKRVAGLFGAPIW
FT                   FESVVAECRFRADGQLRELLLHPIELGHGGRDAERGIPRLAFDTADNQHQARRILERLA
FT                   GLSAEFGTRIEIETVEYAGRASSLGRIVLDA"
FT   gene            complement(224384..225679)
FT                   /locus_tag="Pmen_0221"
FT   CDS_pept        complement(224384..225679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0221"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82995"
FT                   /db_xref="GOA:A4XNS9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNS9"
FT                   /protein_id="ABP82995.1"
FT                   /translation="MTQPNPSRRILVVALLMAVMIISVLDKTIFAFAGPQIIDELQLSP
FT                   EQFGFIGSAFFFLYSISGVLVGFLANRLPSRWILSGMSLVWMAAQLLTALATSFYTLVA
FT                   SRLLLGAGCGPGTAVTQHACFKWYAPRERVLPAALIQVAIMLGAIAGALALPLLIERLG
FT                   WRAGYLLLAGVGLLWLLLWQLCGREGQYDDANDDSGGAALPYRHLLLNRTFVGITLIAF
FT                   CSYLPNALLYSWLPTYLQKGLGLTPMQSGYLVLSTTLGVIVLNLLVSSLSQRALQRGAS
FT                   VRAAMVMPPLLACLVAALAFALMGLSATGLAATLGLFLVGGILVNLLSAFGYSIVAYIV
FT                   PARQRGSMLAIHIGLLTSAGMLAPHLVGQAIGWQGGDLAAGFELAIGLFGLALLASTLL
FT                   GLLLIDPERSRRDLAAHADTPETIPAPAPSQA"
FT   gene            complement(225807..226730)
FT                   /locus_tag="Pmen_0222"
FT   CDS_pept        complement(225807..226730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0222"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82996"
FT                   /db_xref="GOA:A4XNT0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNT0"
FT                   /protein_id="ABP82996.1"
FT                   /translation="MKLHQLRALLAICESGSIQEASRLLHISQPALSKGIKELEAELGV
FT                   PLLVRSNRGITVTEYGERLVRRARLILEEVRRAREEIESLKGTMDGKLAIGVSPVTPGA
FT                   QFITSLNRYRKRYPRVQVQIHELRPSKLIEGLREGQLDLVLTSLPASRCSDGFHWTELF
FT                   SQPAVLAVRKGHPLGGARSLRELLDEEWLLQDSLELSKVGVMFEQHRIEPPRRIIECAS
FT                   VVLFSELALNTDTVSYWSRRLLDHVQKLGQELQVLDLQEQVPPMNISLVCRDQELMTRE
FT                   AKTLADELVYAYTSPHASRPVGSDAP"
FT   gene            complement(226866..228227)
FT                   /locus_tag="Pmen_0223"
FT   CDS_pept        complement(226866..228227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0223"
FT                   /product="protein of unknown function DUF1329"
FT                   /note="PFAM: protein of unknown function DUF1329"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82997"
FT                   /db_xref="InterPro:IPR010752"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNT1"
FT                   /protein_id="ABP82997.1"
FT                   /translation="MIHKQLIQAGCLGLSLLAAQVLAAVPADQLARLDGDLTPVGAERA
FT                   GNADGSIPAWTGGIGQDAGQRDADGFLSDPFAADQPLFVITAANVEQYRDKLTPGQLAL
FT                   FQRYPATYRIPVYPTRRSVALPQSYLDATRANAAATRLAEGGNGLLDYRSGGLPFAIPQ
FT                   NGLEVIWNHIGRYRSLSFQRQVVQASPQANGAYTPSVIRQQLAYPAGLSDYAPQEMANV
FT                   LYYYREEFLSPARLAGGVLLVHETINQVKEPRMAWQYNAGQRRVRRAPQIAYDSPGAEG
FT                   MRTMDDLDLFNGSPDRFDWQLLGKKEIYIPYNSYKLGSPKLKYADIIQPGHINPEHTRY
FT                   ELHRVWHVSATLKPGQRHVYSRRDLYIDEDSWQAAQADAYDGRGQLWRVSEGHASFFYD
FT                   QQSPQYNAETHYDVLSGRYAVNALYNEEKQAYRFDQTFNRKQFTPSALRASGIR"
FT   sig_peptide     complement(228156..228227)
FT                   /locus_tag="Pmen_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 24"
FT   gene            complement(228248..230059)
FT                   /locus_tag="Pmen_0224"
FT   CDS_pept        complement(228248..230059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0224"
FT                   /product="protein of unknown function DUF1302"
FT                   /note="PFAM: protein of unknown function DUF1302"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82998"
FT                   /db_xref="InterPro:IPR010727"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNT2"
FT                   /protein_id="ABP82998.1"
FT                   /translation="MTTTTRLGALRPTVLSLALGLAPTLPAQAASFNIGEIEARVDSSL
FT                   SIGASWAMDAPDKRFIGRANGGTASTRTSDDGRLNFKRGETFSKIFKGIHDLQLSYGDS
FT                   GLFLRGKYWYDFELKDESRLLYDIDDSGRDRAAKASGSELLDAFVYHNYQLGELPGSVR
FT                   AGRQVVSWGESTFIGNGINAINPADVAAFRRPGSEIKEGLIPVNMLYLTQGLSENLSIE
FT                   AFYQLQWEKTVLDNCGTFFGGDVAPQGCDLGMTTFGSDFNRDPAVYGWVPRLADKEARD
FT                   GGQFGVALRWLVPALNDTEFGVYALNYHSRTPESSWRTGQPSFAAISGAPGPASARYGL
FT                   EYPEDIRLYGLSFATSLANGTALSGEISHRPNMPLALNGTEVSTAASVGQLNDLLGLDG
FT                   LAIFDTGWAATAPGSRVQGYKRMPFTQAQLSAVQVFDQVLRADRLTLVGEVGFSHIGDL
FT                   GPSDGSDLRFGRSSVYGYGVLPDSASGLGLSGNQLCTALLNSANPDQCSDKGFYTQNSW
FT                   GYRLRAMLEFNSAIAGVNLKPNLAFAHDVEGYGPTFTEGNQSLSIGIDADYLSRYSASL
FT                   SYTDYFGGDFNTNTDRDFVALSFGVSF"
FT   sig_peptide     complement(229970..230059)
FT                   /locus_tag="Pmen_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            230370..231347
FT                   /locus_tag="Pmen_0225"
FT   CDS_pept        230370..231347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0225"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; PAS fold-3 domain
FT                   protein; SMART: PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABP82999"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNT3"
FT                   /protein_id="ABP82999.1"
FT                   /translation="MNQAIETDSAVYKTLLESTRAIPWKIDWKTMTFAYIGPQIETLLG
FT                   WSQASWVSAEDWAARMHPEDRERVVGFCVSQSQNGVDHEADYRALTAAGDYVWIRDVVH
FT                   VVRDDKGEVDSLIGFMFDISERKKTEEQLLTLQKQLEEYSYQDGLTGVANRRMFDRVLA
FT                   SEWASAQRSQQPLSLILLDIDHFKQYNDHYGHVQGDDCLKSVGQALTRAASRPRDFVGR
FT                   FGGEEFVLVLPETDEAAARHIAERCRQQVRQQRIPHERSSVSSLLTISLGVGTLVPGAQ
FT                   DRALDFLNAVDKLLYQAKQRGRDRLEVASMTSRSSGGDAADARV"
FT   gene            231453..232058
FT                   /locus_tag="Pmen_0226"
FT   CDS_pept        231453..232058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0226"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83000"
FT                   /db_xref="GOA:A4XNT4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNT4"
FT                   /protein_id="ABP83000.1"
FT                   /translation="MQLIYAAASPFARKVRILAHETGLLARIELLDTTVLPTTLNEQVN
FT                   ARNPLGKIPVLLTDDGEALYDSRVICEYLDTLHDGPRLLPQDDARWSVLRLAALADGLM
FT                   DAAVLARYEKAARKLEQQSPAWLDGQLGKVKRALAELERQTERLQGPLDMAQIGVACAL
FT                   GYLDFRFADLDWRAAHPRLAAFQQTFAQRPSMQASAPV"
FT   gene            232306..233889
FT                   /locus_tag="Pmen_0227"
FT   CDS_pept        232306..233889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0227"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83001"
FT                   /db_xref="GOA:A4XNT5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNT5"
FT                   /protein_id="ABP83001.1"
FT                   /translation="MLSLTGHNYIGGERRAAGTTLLESIDASSGEALPYAFTQATPEEV
FT                   DAAAQAAAAAYPLYRNLSAERRAEFLDAIADELDALGDDFVALVTRETALPAARIQGER
FT                   GRTSGQMRLFANVLRRGDFYGARIDRALQDRQPLPRPDIRQYQIGVGPVAVFGASNFPL
FT                   AFSTAGGDTASALAAGCPVVFKAHSGHMATAECVADAVIRAAEKTGMPKGVFNMIFGGG
FT                   VGELLVKHPAIQAVGFTGSLKGGRALCDMAAARPQPIPVFAEMSSVNPVIVLPGALKAR
FT                   GATVAKELAGSVVLGCGQFCTNPGLVIGIRSTEFSDFVAGLGDAIASQPAQTMLNAGTL
FT                   RSYASGVSQLKAHAKVTHLAGSEQAGNQAQPQLFKADVSMLLEGDHLLQEEVFGPTTVV
FT                   VEVADSAELTRALQSMHGQLTATLIAERDDLSAFRDLLPLLEVKAGRVLLNGYPTGVEV
FT                   CDSMVHGGPYPATSDARGTSVGTLAIHRFLRPVCYQNYPDEVLPEALQNANPLGIQRLV
FT                   DGVHSREALS"
FT   gene            complement(233959..234732)
FT                   /locus_tag="Pmen_0228"
FT   CDS_pept        complement(233959..234732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83002"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNT6"
FT                   /protein_id="ABP83002.1"
FT                   /translation="MFKAKPLLLALAIASPFFALSAQAADAKPSVVIVHGAFADGSDWA
FT                   KVVPLLQDKGIKVTVVQNPLTSLADDVAATQRVLNNQDGNVVLVGHSWGGTVISQAGTD
FT                   DKVRSLVYVAAFAPNAGQSTGELYGGYPTAPGSSQIAADKNGFLYLTSQGMAADFAQDL
FT                   PAKQTAIMTATQGPIRAAAFDDRTSVAAWKQKPSWYIVASDDRMIVPQMQRDFAKKIGA
FT                   QTTEIAASHVPQQSRPSDVAKVIIQAVEKTQAAAK"
FT   sig_peptide     complement(234658..234732)
FT                   /locus_tag="Pmen_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 25"
FT   gene            234834..236258
FT                   /locus_tag="Pmen_0229"
FT   CDS_pept        234834..236258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0229"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /note="PFAM: regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83003"
FT                   /db_xref="GOA:A4XNT7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNT7"
FT                   /protein_id="ABP83003.1"
FT                   /translation="MNDAVALEDVMLALAMVGDLSMGQPIDQSRRTARLAQWLAQACGG
FT                   DRAQIDAARQVALLRWSGCTANADGFMRLLGDDVGGRRAMLAQTLDAAGQRAMLRTTPL
FT                   AQVHCEVAGDIARTLALGTEVERGLRHIFECFDGSGRPLGLRHPDVPPVVYQVVLAGDL
FT                   EILSRAHGLDVALEWIGAQGDRRYPAVLADLLARHAADWLQALRTPEGVQAASGAEVPL
FT                   TLVGDVIDLKLPWLAGYSRQAASLVRDAARLWGLPEARIELLAKAALIHGVGRAAVPNR
FT                   IWSTPGPLLDGDLEAVRLVPYWTHRACSQIGGLNEAGQLAAHAYERLDGSGYFRSLSGD
FT                   ALQVEHRLLSAALAWLALRGERPWRAAFSDEQAARVLLDEAEQGRFDPRACQAVISAAH
FT                   GEQAPLAGKPGNGLLSERETQILQRISSGASNKEVARDLGISPSTVRTHVESVFRKLQC
FT                   STRAAATLKALTLGVI"
FT   gene            236346..236660
FT                   /locus_tag="Pmen_0230"
FT   CDS_pept        236346..236660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83004"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNT8"
FT                   /protein_id="ABP83004.1"
FT                   /translation="MEKDFMLKRIYRIFALAVLVSALSGCGTLFGRSSGGSYGPDYYSG
FT                   TAYNFGLLFGSDELNRGYFPATLWCWASIACPVLTVYSMPVDFVVDTVMLPRDIYEATR
FT                   "
FT   sig_peptide     236346..236441
FT                   /locus_tag="Pmen_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.863 at
FT                   residue 32"
FT   gene            complement(237323..237399)
FT                   /locus_tag="Pmen_R0001"
FT                   /note="tRNA-Arg6"
FT   tRNA            complement(237323..237399)
FT                   /locus_tag="Pmen_R0001"
FT                   /product="tRNA-Arg"
FT   gene            237746..239197
FT                   /locus_tag="Pmen_0231"
FT   CDS_pept        237746..239197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0231"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83005"
FT                   /db_xref="GOA:A4XNT9"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNT9"
FT                   /protein_id="ABP83005.1"
FT                   /translation="MQLKDPQLLRQQAYIHGQWLDADSGQTIAVNNPATGEIIGHVPKM
FT                   GRAETRRAIEAAEKALPAWRALTAKERANKLRRWFELLMENQDDLGRLMTLEQGKPLAE
FT                   AKGEIAYAASFIEWFAEEAKRVYGDVIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVIKPASQTPFSALALVELAERAGIPKGVLSVVTGSAGEVGGELTS
FT                   NPIVRKLSFTGSTEIGRQLMAECAQDIKKVSLELGGNAPFIVFDDADLDAAVEGALISK
FT                   YRNNGQTCVCANRIYVQDGVYDAFAEKLIAAVSKLKIGNGLEDGTTTGPLIDEKAVAKV
FT                   QEHIADAVNKGAKLALGGKPHALGGTFFEPTILVDVPKTAAVAKEETFGPLAPLFRFKD
FT                   EAEVIAMANDTEFGLASYFYARDLGRVFRVAEALEYGMVGINTGLISNEVAPFGGVKAS
FT                   GLGREGSKYGIEDYLEIKYMCLGGI"
FT   gene            239295..240617
FT                   /locus_tag="Pmen_0232"
FT   CDS_pept        239295..240617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0232"
FT                   /product="4-aminobutyrate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.19"
FT                   /note="TIGRFAM: 4-aminobutyrate aminotransferase; PFAM:
FT                   aminotransferase, class I and II; aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83006"
FT                   /db_xref="GOA:A4XNU0"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNU0"
FT                   /protein_id="ABP83006.1"
FT                   /translation="MLNRPLAGDGHEDTMSKTNESLLQRRAAAVPRGVGQIHPIVAERA
FT                   ENATVWDVEGREYIDFAGGIAVLNTGHLHPKVVAAVQEQLTKLSHTCFQVLAYEPYIEL
FT                   CEEIAKRVPGNFAKKTLLVTSGSEAVENAVKIARAATGRAGVIAFTGAYHGRTMMTLSL
FT                   TGKVVPYSAGMGLMPAGVYRAQAPCPLHGVSEDESIASIERIFKNDAQPQDIAAIIIEP
FT                   VQGEGGFYVNSPAFMQRLRALCDQHGILLIADEVQTGAGRTGTFFATEQLGVVPDLTTF
FT                   AKSVGGGFPISGVCGKAEIMDKIAPGGLGGTYAGSPIACAAALAVLKVFDEEKLLERSQ
FT                   AVGEKLKAGLKTIAEKHKVIGDVRGLGSMVAIELFEGGDHSKPAAELVGKIVARAREKG
FT                   LILLSCGTYYNVIRFLMPVTIPDAQLEKGIAIVAECFDELA"
FT   gene            240881..242566
FT                   /locus_tag="Pmen_0233"
FT   CDS_pept        240881..242566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83007"
FT                   /db_xref="GOA:A4XNU1"
FT                   /db_xref="InterPro:IPR008718"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNU1"
FT                   /protein_id="ABP83007.1"
FT                   /translation="MRVSGFSNSIPPALDGREPSRECAKPQAPANPRQSACGGGGVSWA
FT                   PQGQSQTTPSHSAAAGDTLRGQGLAALREAVLRLFAPSATEVQSASQPATQRNMAAEAA
FT                   KESSDEMPFEEVVSVLGRNENLLKKPRDREGLEKLRDDPNTPTDAKKALDAVLKNPAYY
FT                   EALDQAKTGSTDGKISAKDVQKLQQHPLIRQYADAKAETYTHNYVPSDAAPGSAAREMT
FT                   ENDAMRELYLYSESLPKKLNLETLGKIADGSQSMGKCPPQVAAAAKFFVQNPDKWQQFS
FT                   GKDDPSAKISRDRLCDLATENVKLSPQESKALETLKNNQDIFFKGGGIKPDKLAKIAND
FT                   PQHSQEVRDAANLLSQPNSMLFSMLDNAKHGAGGNFFNKANDRNISKGDLNAFLQKGSN
FT                   EVAGPPQLAKPATGAALAAQNDMHMGQETQPDQKKEKGGGIFKFLEIFSYVASGVMMLI
FT                   PGAGAATLAATAGRVAATTVAKEAAKQAAQHTVKEVAKDTVKETAKREFKDAAIQGTKD
FT                   GLKDYAKDQARDFAKDGLSNAMNQNSPRVASNPHVNEPRVWAQS"
FT   gene            242659..243186
FT                   /locus_tag="Pmen_0234"
FT   CDS_pept        242659..243186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0234"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83008"
FT                   /db_xref="GOA:A4XNU2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNU2"
FT                   /protein_id="ABP83008.1"
FT                   /translation="MNIDSKLISTAEELFGRYGFNATGMDRLAQAAGMSSRTLYKHAGS
FT                   KNELIAAVLMTRGQRFLQRLEVDSVEALFDALASWLREEGARGCLFLRVQGETGGQIRE
FT                   ISEAVAAYKARFSDAVHQVLTRQLGTGVEDELVEQIVILFEGATAAASYRGVEAVAVAR
FT                   RAATLLLRQVRP"
FT   gene            243183..244319
FT                   /locus_tag="Pmen_0235"
FT   CDS_pept        243183..244319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0235"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83009"
FT                   /db_xref="GOA:A4XNU3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNU3"
FT                   /protein_id="ABP83009.1"
FT                   /translation="MSPALRLGITGFGLIGVCYGFARFAFGLFLPQIDAELDLPAAVGG
FT                   LIAGGSFLGYCIAIVVAAQLTERVGARAVAMAAGLIAALGMLGIALAPSALWLAAAVLL
FT                   AGISTGLVSPPMAAAVAAIVQPQRQDAANTLINSGTSAGVILSGPVALLIGAEWRLAYG
FT                   VFAASALVLAVLAGFCVPNTAGPRAQPSPGRPVLNAMLRQLIVASLLMGAASTALWSFG
FT                   SQILAQRLDWGSAGAGLLWVVIGVAGIAGAGAGSLIGRLGIDWVHRLSLAAMALAILLV
FT                   GMGTQPALTLVGGVLFGAAYIMLTGVYLVWGVCALPERPATGLTISFLSIAIGQMLGAP
FT                   AFGLLLSWLTLDHAVIVFTLLALAGGLARSAGARAPGA"
FT   gene            complement(244394..244753)
FT                   /locus_tag="Pmen_0236"
FT   CDS_pept        complement(244394..244753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0236"
FT                   /product="protein of unknown function DUF861, cupin_3"
FT                   /note="PFAM: protein of unknown function DUF861, cupin_3"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83010"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNU4"
FT                   /protein_id="ABP83010.1"
FT                   /translation="MNIEQIVDFAQAATAADHYRPAPEKVLKGDPEQSVRNHYGSPCGQ
FT                   FSSGIWEGAVGQWTVNYTEHEYCEILQGVSVLRDADGNAKTVRAGDRFVIPAGFSGTWE
FT                   VLEACRKVYVIFEPK"
FT   gene            245006..246499
FT                   /locus_tag="Pmen_0237"
FT   CDS_pept        245006..246499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0237"
FT                   /product="gamma-glutamyl-gamma-aminobutyraldehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.99.3"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83011"
FT                   /db_xref="GOA:A4XNU5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNU5"
FT                   /protein_id="ABP83011.1"
FT                   /translation="MTSLTRADWEQRAKTLTIETRAFVHGEYRAAESGATFECISPVDG
FT                   RLLGLVASCDQADAELAVKDARATFESGVWSRLAPVKRKKVMIRFAELIEQHGEELALL
FT                   ETLDMGKPISDSLSIDVSSAANAIRWSGEAIDKIYDEVAATAHDELGLVTREPVGVVAA
FT                   IVPWNFPLLMTCWKLGPALATGNSIILKPSEKSPLTGIRIAQLAIEAGIPAGVFNVLPG
FT                   FGHTVGKALALHMDVDTLVFTGSTKIAKQLMVYAGESNMKRVWLEAGGKSPNIVFADAP
FT                   DLKAAAEAAASAIAFNQGEVCTAGSRLLVENSIKDTFVPMVVEALKAWKPGNPLDPATN
FT                   VGALVDTTQMNNVLSYIQAGHDDGAKLVAGGKRVMEETGGTYVEPTIFDGVNNAMRIAK
FT                   EEIFGPVLSVIGFDNQDEAIAIANDTIYGLAAAVWTSNLSRAHLVGKALRAGSVWINQY
FT                   DGGDMTAPFGGFKQSGNGRDKSLHAFDKYTELKSTWIKL"
FT   gene            246805..247953
FT                   /locus_tag="Pmen_0238"
FT   CDS_pept        246805..247953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0238"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83012"
FT                   /db_xref="GOA:A4XNU6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNU6"
FT                   /protein_id="ABP83012.1"
FT                   /translation="MRWGTYFAVCAAVISIGLALGVTMPLVSLRLESWGYDSFAIGVMA
FT                   ATPAVGVLLGASLAGRLAARVGTTRLMQLCLLLGALSVALLALVQNYAVWVALRLFLGV
FT                   ALTVVFILGESWINQLAVEKWRGRLVALYGTGYALSQLSGPLLLTAIGTATDSGFWTGV
FT                   GLLIGGSLVLLGRSGAPRVDAHSASGRGLPAFCRKLPAIAWAVVLFAAFEAMMLTLLPI
FT                   YGLRQGFTQEVALLMVSVVVVGDAALQLPIGWLADRMSRQTLFRACGVVLLSSSLAIPV
FT                   LLHTPVIWPVLVAFGASAGGLFTLSLILIGERYRDDELVRANAHVAQLWGIGCLIGPLA
FT                   TGAVSQWVSGHALPLMMALGAAGFIVLAFRGSLGSDLAQAER"
FT   sig_peptide     246805..246870
FT                   /locus_tag="Pmen_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.927 at
FT                   residue 22"
FT   gene            248041..248994
FT                   /locus_tag="Pmen_0239"
FT   CDS_pept        248041..248994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0239"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83013"
FT                   /db_xref="GOA:A4XNU7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR032608"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNU7"
FT                   /protein_id="ABP83013.1"
FT                   /translation="MRIIAGLCLGMLWAAGAAADIAGSADHPAIPRYEGAEIYAYQTQA
FT                   YTDWRFFRAPATVYGGLQKNLDATETLEGKLTRLSYRAPAERTPLEVFRNYQQALSEAG
FT                   FETLYSCEREDCGGRNFNHAITLDMHFREYHQDQRYLYARLPRPEGDLYAALYVVLNQS
FT                   GGGPNKGRSLIQLDVLERKAMEQRMVLVEAGELQRGLDAQGRVALYGLYFDTDKADMRA
FT                   DSQPQLAEIAKLLQASAQLQVLVVGHTDAQGALDYNRDLSQRRAQSIVEALVSQHGIAR
FT                   QRLSAVGVGMAAPVASNRDEAGRALNRRVELVERLP"
FT   sig_peptide     248041..248100
FT                   /locus_tag="Pmen_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.917 at
FT                   residue 20"
FT   gene            complement(248995..250416)
FT                   /locus_tag="Pmen_0240"
FT   CDS_pept        complement(248995..250416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0240"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83014"
FT                   /db_xref="GOA:A4XNU8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNU8"
FT                   /protein_id="ABP83014.1"
FT                   /translation="MTLYLNLAEELAARIEQGLFRPGERLPSVRTLSQEHGVSLSTVQQ
FT                   AYRQLEDQGLATPRPKSGYFVNQLRQQPELPQISRAPQRPVEVSQWEQVLELVSEPPSS
FT                   DVLQLSRGIPDIDVPTLKPLLRSLSRLSRRQSLRELSYGAVEGEISLRQEVARLTLDSG
FT                   CQLAAEDIVITTGCHEALSAALRAICQPGDIVAVDSPSFHGVMQALKGFGMKALELPTD
FT                   PLTGISLEALEMALEQWPIKAIQLTPSCNNPLGYVMPEANKRALLALAQRFDVAIIEDD
FT                   IYGDLAYHYPRPRSIKSFDEDGRVLLCSSFSKTLAPGLRIGWIAPGRYLQQVLHMKYMG
FT                   TGMSAQLPQLAIAEFIRDGLYQPHLRQMRKQYARGREQMTGWVSRYFPPGTRVSQPQGG
FT                   FMLWVEMPQGFDSLRLNRRLAASKLQVAPGSIFSAAGKYRNCIRLNFACSHQPSMEAAI
FT                   RQVGETVTLLLAEDA"
FT   gene            250578..250796
FT                   /locus_tag="Pmen_0241"
FT   CDS_pept        250578..250796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0241"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83015"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNU9"
FT                   /protein_id="ABP83015.1"
FT                   /translation="MRTFDEMAGVAGGSARTVRPCQPRSFGRDWPSFWRRLRTRRALLR
FT                   LSDQALADVGLTRAQAEREARLPFWQL"
FT   gene            complement(250803..252116)
FT                   /locus_tag="Pmen_0242"
FT   CDS_pept        complement(250803..252116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0242"
FT                   /product="gamma-glutamylputrescine oxidase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83016"
FT                   /db_xref="GOA:A4XNV0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNV0"
FT                   /protein_id="ABP83016.1"
FT                   /translation="MNARVHQPVHGPQHAASYYAASVNRQLAYPPLGGELQVDVCVVGG
FT                   GFSGLNTAIELAQKGLSVALLEARKIGWGASGRNGGQLIRGVGHGVEQFESVVGKDGVR
FT                   QFKLMGLEAVEIVRSRVAQFQIDCDLTWGYCDLANKPSHMQGFAEDKAELESLGYRHEL
FT                   RLVPKERIHEVVGSDNYHGAMIDMGSGHLHPLNLALGEAAAAQGLGVRLFEDSPVTRID
FT                   YGPEVRVHTAHGRVRARHLVLACNAYINGLNPHLSGKVLPAGSYVIATEPLSEEQARQL
FT                   IPQNMALCDQRVTVDYYRLSADRRLLFGGACHYSGRDPADIAAYMQPKMLKVFPQLQGV
FT                   RIDYQWGGMIGIGANRLPQIGRLKDQPNVFHAQAYSGHGLNATHLAGKLLAEAIAGQES
FT                   RGFDLFAQVPHMTFPGGRYLRSPLLALGMFWHRLKEVL"
FT   gene            252353..252706
FT                   /locus_tag="Pmen_0243"
FT   CDS_pept        252353..252706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0243"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83017"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR016928"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNV1"
FT                   /protein_id="ABP83017.1"
FT                   /translation="MSCTDRKIDHLRRQIPRFDCVPGCHDCCGPVTASSEELARLPVKS
FT                   DAEHDAALAEYNCVHLGANGCEVYDQRPLICRLFGTTPNLPCPHGRGPEQPIEPAVERQ
FT                   VHRLIATTRQRLV"
FT   gene            complement(252765..253253)
FT                   /locus_tag="Pmen_0244"
FT   CDS_pept        complement(252765..253253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0244"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83018"
FT                   /db_xref="GOA:A4XNV2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNV2"
FT                   /protein_id="ABP83018.1"
FT                   /translation="MRTQHQSRRELDKIDRNILRILQEDGRISFTELGERVGLSTTPCT
FT                   ERVRRLEREGIIMGYHARLNPQQLKANLLVFVEISLDYKSGDTFEEFRRAVLKLPHVLE
FT                   CHLVSGDFDYLVKARINEMASYRKLLGDILLKLPHVRESKSYIVMEEVKESLALPVPD"
FT   gene            253411..254709
FT                   /locus_tag="Pmen_0245"
FT   CDS_pept        253411..254709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0245"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83019"
FT                   /db_xref="GOA:A4XNV3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNV3"
FT                   /protein_id="ABP83019.1"
FT                   /translation="MRVLVLGSGVIGTASAYYLARQGHEVVVVDRQNGPALETSFANAG
FT                   QVSPGYASPWAAPGVPLKAIKWLLQKHAPLAIKATGDVDQYLWMAQMLRNCTAARYAVN
FT                   KERMVRLSEYSRDCLDELRAETGIAYEGRQLGTTQLFRTQAQVDAAAKDIAVLEASGVP
FT                   FELLDRDAIARVEPALAGVKHKLAGALRLPNDQTGDCQMFTTKLADMAKALGVEFRFGQ
FT                   NIQRLDAVGDRLNGVWIDGKLETADRYVLALGSYSPQLLKPLGVRAPVYPLKGYSLTVP
FT                   ITNAEMAPTSTILDETYKVAITRFDNRIRVGGMAEIAGFDLSLNPRRRETLEMITADLY
FT                   PQGGDLSQAEFWTGLRPATPDGTPIVGATAYRNLFLNTGHGTLGWTMACGSGRLLADLI
FT                   GSKRPQISAEGLDISRYSGKNRELEAAPQPLRT"
FT   sig_peptide     253411..253473
FT                   /locus_tag="Pmen_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.618) with cleavage site probability 0.498 at
FT                   residue 21"
FT   gene            254747..255097
FT                   /locus_tag="Pmen_0246"
FT   CDS_pept        254747..255097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0246"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83020"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNV4"
FT                   /protein_id="ABP83020.1"
FT                   /translation="MSIQRLHVEKRYSEVVIHNGTVYLAGQLADDYSGDIRQQTRETLA
FT                   NIDRMLAEAGSDKSKILSVTIYLKDMDAHYDGLNAEYDAWVAEGAAPARACVEAKMYKP
FT                   EVLVEMMVVAAL"
FT   gene            255241..256329
FT                   /locus_tag="Pmen_0247"
FT   CDS_pept        255241..256329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0247"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; PFAM: alanine racemase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83021"
FT                   /db_xref="GOA:A4XNV5"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNV5"
FT                   /protein_id="ABP83021.1"
FT                   /translation="MRPARALIDLDALRHNYQLARELSGARALAVVKADAYGHGAVRCA
FT                   QALQSEADGFAVACIEEALALREAGIRAPILLLEGFFEADELALIDQHELWCVVHAQWQ
FT                   IEAIEQARLSRPLTLWLKLDSGMHRVGLHPAEYQEAYRRLLASGKVGKIVLMSHFARAD
FT                   EPECERTVEQLAVFQQARQGLAAEVSLCNSPAVLGWPQLFEKTGASDWVRPGIMLYGAT
FT                   PFEQAQEQAARLQPVMTLESKVISVRELPAGEPVGYGARFVSERPTRVGVVAIGYADGY
FT                   PRHAPTGTPVAVDGQLTRLIGRVSMDMLTVDLTDLPQAGLGSRVELWGKQVLASDVAMA
FT                   AGSIPYQIFCNLRRAPLLYLGG"
FT   gene            256433..256981
FT                   /locus_tag="Pmen_0248"
FT   CDS_pept        256433..256981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0248"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83022"
FT                   /db_xref="GOA:A4XNV6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNV6"
FT                   /protein_id="ABP83022.1"
FT                   /translation="MDVGVRLQSIRKLKGLSQRELAKRAGVTNSTISMIEKNSVSPSIS
FT                   SLKKVLGGIPMSLVEFFSLDLEQENQTQVVYRASELTDICSGAITMKLIGKAHPSRAIA
FT                   FLDETYPAGADTGDEMYAHEGEEAGMLVEGKLELTVGSEVFVLEPGDSYYFESSKPHRF
FT                   RNPFDEPARLISATTPANF"
FT   gene            257104..257514
FT                   /locus_tag="Pmen_0249"
FT   CDS_pept        257104..257514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0249"
FT                   /product="Cytochrome c5-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83023"
FT                   /db_xref="GOA:A4XNV7"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNV7"
FT                   /protein_id="ABP83023.1"
FT                   /translation="MKKMLAVPAAVLALWAVTAQATTDEAIAERLKPVGEVCIMGEECK
FT                   GVGAVAVAAGGARSTDDIIAKHCNACHAAGVLGAPKIGDTAAWKERADHQGGLDGILAA
FT                   AISGINAMPPKGTCADCSEDELRDAIKKMSGL"
FT   sig_peptide     257104..257169
FT                   /locus_tag="Pmen_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 22"
FT   gene            257927..260062
FT                   /locus_tag="Pmen_0250"
FT   CDS_pept        257927..260062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0250"
FT                   /product="Acetyl-CoA hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83024"
FT                   /db_xref="GOA:A4XNV8"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNV8"
FT                   /protein_id="ABP83024.1"
FT                   /translation="MPHSCTLEQAVDHVLSELDGPIHLGLPLGLGKPNRWVNALYARVR
FT                   EMPERHLTIYTALCLGRPRAGQELQRRLLDPFVARVYGDYPELDFLADLHAGSLPANVR
FT                   VEQFFFQPGSLLDCEPAQQDYISSNYSHVARDLNAKGLNLVAQLVAADDQRPEHFSLSC
FT                   NPDVTLDLLPLLQRRRAAGEKVLSVAQIHHDLPYMAGDAQLPRDTFDIHIVEDERTTLF
FT                   STPNMPVTTQDHCIGLFASTLVRDGGTLQIGIGAMGDALAAALIARQADNARYRAVLQA
FT                   LRGGEGWAGEIAANGGLAPLEQGLYGCSEMFVNGLLALAEAGLLRRAVYPDLRLQRLAL
FT                   AGALDASGRPHSVQALVDAGLPARLQPGDLGWLRDSGLLQGDLQLEEGWLYLPDGSRTV
FT                   ADLTDPQTQACLAPYLGAAQGGVVLHGGFFLGPGAFYSRLRELDDAARQRFAMTGIRYI
FT                   NELYGQEELKRLQRRDARFINTVFTMTLLGAGVADQLEDGRVLSGVGGQYNFVAQAHAL
FT                   EGARSILLLRSWRESGGQVSSNIVWDYGHATIPRHLRDMVVTEYGIADLRGKTDAQVIE
FT                   ALLAISDSRFQPELIAQAQQAGKLAADFRLDARFSNNLPERLDKVRGDFPALFPEYPLG
FT                   SDFSSVEADLVRALGWLKSKLHLSEALELGKATLDAPEPLAYAEHLRRMGLEAPDGVRE
FT                   TLYQRLLLAGLQATASA"
FT   gene            complement(260123..260695)
FT                   /locus_tag="Pmen_0251"
FT   CDS_pept        complement(260123..260695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0251"
FT                   /product="xanthine phosphoribosyltransferase"
FT                   /note="TIGRFAM: xanthine phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83025"
FT                   /db_xref="GOA:A4XNV9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010079"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNV9"
FT                   /protein_id="ABP83025.1"
FT                   /translation="MESLKQKILSEGIVLSDQVLKVDAFLNHQIDPALMQQIGHEFAQR
FT                   FAGQGITKIVTIEASGIAPAVMAGLELGIPVIFARKFQSLTLKDDLLISKVFSFTKQTE
FT                   STIAISARHLTAADKVLVIDDFLANGHAAKALIDLIQQAGAQVAGIGIVIEKSFQEGRN
FT                   LLESEGYRVESLARVAALENGQVRFLD"
FT   gene            complement(260830..261312)
FT                   /locus_tag="Pmen_0252"
FT   CDS_pept        complement(260830..261312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83026"
FT                   /db_xref="InterPro:IPR005361"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNW0"
FT                   /protein_id="ABP83026.1"
FT                   /translation="MRTFTLDLDALTRLINGREQQENWLDLDSGKVLTLPAEDQYSEER
FT                   QQVELEPDRYTRIPNLDVMQRVAMRESFLFTLDDLHAHPLLSAALTGRKPLRSFDYEIE
FT                   AFPALREQWLAFELKQLREFALNWLYELGLEPAPDKLPLDTRGIPKDILRRLTKSA"
FT   gene            complement(261491..263500)
FT                   /locus_tag="Pmen_0253"
FT   CDS_pept        complement(261491..263500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0253"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83027"
FT                   /db_xref="GOA:A4XNW1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNW1"
FT                   /protein_id="ABP83027.1"
FT                   /translation="MSRLNPRQQEAVNYVGGPLLVLAGAGSGKTSVITRKIAHLVQNCG
FT                   IQARHIVAMTFTNKAAREMKERVGTLLRGSEARGLTVSTFHNLGMNIIRKEYARLGYKP
FT                   GFSIFDDGDIKALLTDIMQKEYAGDDGADEVKNLIDSWKNDLILPDEALAKARGPKEQT
FT                   AAIVYLHYQRTLKAYNAVDFNDLILLPVKLFQEHPDILEKWQNRIRYLLVDEYQDTNAS
FT                   QYLLVKMLVGMRNQFTVVGDDDQSIYAWRGARPENLMLLKEDYPSLKVVMLEQNYRSTS
FT                   RILKCANILIANNPHVFEKQLWSEMGHGDEIRVIRTRNEEAECERVALEILTEHLRTQR
FT                   PYSDFAILYRGNYQAKLMELKLQHHQIPYRLSGGTSFFARQEVKDLMSYFRLLVNPDDD
FT                   NAFLRVINVPRREIGSTTLEKLGNYASERKISMYAAAGEIGLGEHLDARFTERLQRFTR
FT                   WMDRVRQECAQNDPIAAIRSMVMDIDYENWLRQNASSDKVADARMGNVWFLVDALKNTL
FT                   ERDEDGDMTIEDAIGKLVLRDMLERQQEEEEGAEGVQMMTMHASKGLEFPSVYIIGFEE
FT                   EILPHRSSIEADTIEEERRLAYVGITRAKRNLTLTFAAKRKQYGEVIDCSPSRFLDELP
FT                   PEDLVWEGLEEAPVEVKAARGNDALANMRAMLKR"
FT   gene            263771..265444
FT                   /locus_tag="Pmen_0254"
FT   CDS_pept        263771..265444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0254"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83028"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNW2"
FT                   /protein_id="ABP83028.1"
FT                   /translation="MSTLVEPLRLVLLADTSDWAELLREQLSALGSPSPLITAPSWAAA
FT                   STLFDDHASGLLLTTADRLPDPHQCPLPIVLLLDEEPVEEPSGVSDWLVRGSLNLDVLR
FT                   RCLRYVREQGNLRQTLQRLAEQDPLTGIANRQGFQTLLAARLAECNGRGLVLGHLDLDN
FT                   FRHANDALGYQAGDRLILQVVARLKSLLQPCDQIARLGSDEFALLLDVRRDPLRVESLA
FT                   ERITEVLAEPYWVDGESLLIGCSLGLAHARAGEGADPLLWHAHIAMQQAKSQQGCVFHV
FT                   YDERLNRSARSQADLEGELRRALRRDELELHYQPRLCLQSGRIVGLEALVRWQHGERGL
FT                   LSPNEFVPLAEETGLIVPLGYWVISRALRDMQWLRGRGLPALHMAINLSFRQFQDSQLL
FT                   PTLSRLIEERGVDAQWLEFELTETAVMRRSDQVQQTMLALGRLGVRFSLDDFGTGFSSF
FT                   VHLNSLPITLLKIDRSFVGGMGARAENRQLVRAMINLAHNLNLEVVAEGVENIEQLDML
FT                   RQFGCDQVQGYLISKAVPLAELARFLVFGQRQPLLAVTPS"
FT   gene            complement(265479..266864)
FT                   /locus_tag="Pmen_0255"
FT   CDS_pept        complement(265479..266864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0255"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83029"
FT                   /db_xref="GOA:A4XNW3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNW3"
FT                   /protein_id="ABP83029.1"
FT                   /translation="MKNSLGHELGALLRLAGPLISAQLAHALMIFTDTLMMAMLGPKQL
FT                   AGGALGATCYFIFSIFCTGVIAAVGSLVAIRHGAGDPQGVTRLLQNGLWLALLLGMVSA
FT                   LCLNGLGPLLPHLGQAPDAAGLAMEFLRPLSLALPGYLCFMALRGFTSAIGHPGPVMAI
FT                   SIAGTAANFVINYALIKGWFGLPSLGLGGIGMTTALVSTGMALALALYILRAPHYRLYG
FT                   LRSGLGRPQRAQMRSLLRLGLPIGGTYAAEQGLFTFATLCMGALGSVQLAAHQIAMQTV
FT                   ALAFIVPQGLSYAVTFRVGLHYGAGRLPLSRLSGHLGMGLGAALMLLFALLFWLLPEWI
FT                   IGLFLDRHDPAFAEIVTLAVSLLAIAAWFELFDGLQSIAMGAIRGLNDGRTTLVIGLAG
FT                   YWCVGAPLAWLLAFALGWGAQGVWWGLAAGLAVTASGLVLGFQWKTARLQRQDRVDGEV
FT                   CLS"
FT   sig_peptide     complement(266781..266864)
FT                   /locus_tag="Pmen_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.528 at
FT                   residue 28"
FT   gene            266995..267921
FT                   /locus_tag="Pmen_0256"
FT   CDS_pept        266995..267921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0256"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83030"
FT                   /db_xref="GOA:A4XNW4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNW4"
FT                   /protein_id="ABP83030.1"
FT                   /translation="MGAMNRRLPPLYALRAFEAAARHASFTRAAEELAITQSAVSRHIR
FT                   TLEDYFGCRLFERRGRVLQLTDPARALLPGLSEGFDALERASAALRADDQVLRLKAPST
FT                   LTMRWLLARLSHFRLANPDSEVQLTSAWMDVDKVDFRHEPFDCAVLLSDGQFPDEWESV
FT                   LLFEEWLTPVCAAADTEAGPWSLARLQAAEQLHPTPDRRDWRRWLQVTGLGERIPLKTG
FT                   QLFDMLELGIVAAARGYGVSIGDLLMVAEDVNAGRLGLPWRQAVFSGASYYLVWPRTHR
FT                   AQARLQRLRDYLLAEVAAMRLPEVERL"
FT   gene            complement(268018..269511)
FT                   /locus_tag="Pmen_0257"
FT   CDS_pept        complement(268018..269511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0257"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83031"
FT                   /db_xref="GOA:A4XNW5"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNW5"
FT                   /protein_id="ABP83031.1"
FT                   /translation="MSLAIVHSRAQVGVEAPAVTVEAHLANGLPALTLVGLPETAVKES
FT                   KDRVRSAILNAAFEFPNRRITLNLAPADLPKDGGRFDLAIALGILAASGQVPAASLDEY
FT                   ECLGELALSGAVRPVQGVLPAALATRAAGRTLLVPAANAEEASLASGLKVIAVDHLLQI
FT                   AAHLNGSAPLAPYQAQGLLRQSLPYPDLAEVQGQLAAKRALLVAAAGSHNLLLSGPPGT
FT                   GKTLLASRLPGLLPPLDESEALQVAAIHSVASHTPLQHWPQRPFRTPHHSASGPALVGG
FT                   GSRPQPGEITLAHQGVLFLDELPEFDRKVLEVLREPLESGHIVIARARDKVRFPARFQL
FT                   VAAMNPCPCGYLGDASNRCRCTPEQIQRYRAKLSGPLLDRIDLHLTVARESTALEVPAQ
FT                   DGESTAEAAAKVARARELQLQRQGVANAFLDLPGLRQHCALSETDRHWLENACERLGLS
FT                   LRAAHRVLKVARTLADLADERQIARAHLAEALQYRPGMG"
FT   gene            complement(269546..269893)
FT                   /locus_tag="Pmen_0258"
FT   CDS_pept        complement(269546..269893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0258"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83032"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNW6"
FT                   /protein_id="ABP83032.1"
FT                   /translation="MLKNCAARPGTSHVQLRATLPAVCTRNPTMLPPKALLDTLSSHAS
FT                   RLFSGDSPLPRAELEAQFKALLQSGFSKLELVSREEFDSQMVVLARTRARLEALEAKVA
FT                   ELEAKLNPPTD"
FT   gene            270217..270555
FT                   /locus_tag="Pmen_0259"
FT   CDS_pept        270217..270555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0259"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83033"
FT                   /db_xref="GOA:A4XNW7"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNW7"
FT                   /protein_id="ABP83033.1"
FT                   /translation="MKLVTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIDVAIADDQLDRVIEAITKAANTGKIGDGKIFVVNLEQAIRIRT
FT                   GETDTDAI"
FT   gene            270885..272135
FT                   /locus_tag="Pmen_0260"
FT   CDS_pept        270885..272135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0260"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83034"
FT                   /db_xref="GOA:A4XNW8"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR019879"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNW8"
FT                   /protein_id="ABP83034.1"
FT                   /translation="MDNTALTALQYGFDTFYFLICGALVMWMAAGFAMLESGLVRAKNT
FT                   TEILTKNVALYAVASVMYLVIGYHIMYSSPEGGILPSLGFLIGDENTAEAVLAGGDDAP
FT                   YYSTRSDFFFQVVFAATCMSIVSGAVAERMKLWAFLAFAVVMTGFIYPVQGFWKWGSGF
FT                   LNEAGFLDFAGSGVVHMAGASAALAGVLLLGARKGKYGSNGQVNAIPGCNLPLATLGTF
FT                   ILWMGWFGFNGGSQLKMSTIEDANAVAQVFVNTNMAAAGGLIAALIVARILFGKADLTM
FT                   ALNGALAGLVAITAEPLTPSALQATLIGGVGGALVVFSILGLDKVKIDDPVGAISVHGV
FT                   VGVWGLLAVCLTNSDATLGAQLLGIASIFAWVFVASLIVWSIIKAVIGLRVSEEEEYEG
FT                   VDIAECGMEAYPEFTNK"
FT   gene            272234..272659
FT                   /locus_tag="Pmen_0261"
FT   CDS_pept        272234..272659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0261"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83035"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNW9"
FT                   /protein_id="ABP83035.1"
FT                   /translation="MWQQRIISLRPRERGFHLVTEEVLELLPELSQVRVGLLHLWLQHT
FT                   SASLSVNENADPAVRRDFERFFNRLVPQGEAGYEHDYEGPDDLPAHFKSSLLGCALQLP
FT                   IQDGRLALGTWQGIYLGEHRDHGGSRRVVATLYGEAI"
FT   gene            272737..273060
FT                   /locus_tag="Pmen_0262"
FT   CDS_pept        272737..273060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83036"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNX0"
FT                   /protein_id="ABP83036.1"
FT                   /translation="MSDEDLEQDDLEGADEDDGEELAAADDGDSGDDDGDGEIVASGKK
FT                   SKAKAVEVDEMPSIEAKQKERDALARAMEEFLARGGKVQEVEPNVVADPPKKPDSKYGS
FT                   RPI"
FT   gene            complement(273185..273886)
FT                   /locus_tag="Pmen_0263"
FT   CDS_pept        complement(273185..273886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0263"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83037"
FT                   /db_xref="GOA:A4XNX1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNX1"
FT                   /protein_id="ABP83037.1"
FT                   /translation="MSIELITFDLDDTLWDVTPVMQDAEAALRNWLALHAPRLGAVPVE
FT                   HLWTVRSRLLNAEPMLKHRLSELRRRILFHALEEAGYPHGEAQALAEAGFQVFLNARHQ
FT                   VELFAEVHPTLEALAERFMLGVITNGNADVRRLGLSEYFRFALCAEELGIGKPDPKPFR
FT                   EALSRAGGVAAERAVHIGDHPSDDIAGAQAAGMRAIWFNPQGRSWEGETTPDAQIASLA
FT                   ELPALLGSWTR"
FT   gene            complement(273883..274830)
FT                   /locus_tag="Pmen_0264"
FT   CDS_pept        complement(273883..274830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0264"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: phage
FT                   integrase family protein; phage integrase domain protein
FT                   SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83038"
FT                   /db_xref="GOA:A4XNX2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNX2"
FT                   /protein_id="ABP83038.1"
FT                   /translation="MAHSSSTIGPFGTRHVTFEAHLDAYLEHLRRERQVSVHTLDGYRR
FT                   DLGKLLAFCEAEGLSDWAALDTRSLRRLIARLHAQGLASRSLARLLSATRGLYQYLLRE
FT                   GLCRHDPAAGLSPPKRERRLPRTLDADRSAQLLDGAVEDDFIARRDQAMLELFYSSGLR
FT                   LSELVGLDVDGLDLPAGLVRVRGKGNKTRELPVGSMARQALEQWLPLRKLAGPSDGAVF
FT                   ISQQGRRLGPRAVQLRVRQAGVRELGQHLHPHMLRHSFASHMLESSQDLRAVQELLGHA
FT                   DIATTQIYTHLDFQHLATVYDQAHPRAKRKGGSE"
FT   gene            complement(274845..275543)
FT                   /locus_tag="Pmen_0265"
FT   CDS_pept        complement(274845..275543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0265"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83039"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNX3"
FT                   /protein_id="ABP83039.1"
FT                   /translation="MTDQQDSPKPLDSETVAAYLRLHPEFFIDHEELIPELRIPHQPGN
FT                   AVSLVERQVKLLRERNIEMRHRLGQLMDVARDNDRLFDKTRRLVLDLLDAGSLEEVVGA
FT                   VEDSLRREFQVPFVGLILFSDSKLPVGRSVSSAEAHQQIGGLLSGGKTICGVLRPHELE
FT                   FLFGKDEAAQVGSAAVVSLSHQGLHGVLAIGSADPQHYKSSLGTLFLGYIAEVLARVVP
FT                   SFSTPLRSVR"
FT   gene            complement(275540..276370)
FT                   /locus_tag="Pmen_0266"
FT   CDS_pept        complement(275540..276370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0266"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83040"
FT                   /db_xref="GOA:A4XNX4"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNX4"
FT                   /protein_id="ABP83040.1"
FT                   /translation="MLLRFTKMHGLGNDFMVLDLISQHAHVQPKHAKQWGDRHTGVGFD
FT                   QLLIVEPPSHPDVDFRYRIFNSDGSEVEQCGNGARCFARFVLDKRLTTKKTIRVETKSG
FT                   VIELRVQNDGQVCVNMGAPRLEPAQVPFQAEQAALTYRVDVEGQSVELAALSMGNPHAV
FT                   LRVDNVDSAPVHTLGPKLEHHPRFPQRVNVGFLQVLDRKHARLRVWERGAGETQACGTG
FT                   ACAAAVAAIRQGWMDSPVQLELPGGKLSIEWAGEGQPVMMTGPAARVYEGQVRL"
FT   gene            complement(276381..277628)
FT                   /locus_tag="Pmen_0267"
FT   CDS_pept        complement(276381..277628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0267"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83041"
FT                   /db_xref="GOA:A4XNX5"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNX5"
FT                   /protein_id="ABP83041.1"
FT                   /translation="MEAFTYRDGELFAEGVALSALAQRFGTPTYVYSRAHIEAQYRAYA
FT                   DALAGMPHLVCFAVKANSNLGVLNVLARLGAGFDIVSSGELERVLAAGGEPSRIVFSGV
FT                   GKSRDDMRRALEVGVHCFNVESSVELERLQKVAAELGLKAPVSLRVNPDVDAGTHPYIS
FT                   TGLKENKFGIDIEQAEAVYARAAELPNLEVVGVDCHIGSQLTTLEPFLDALDRLLLLVD
FT                   RLAARGIHIKHLDLGGGLGVQYRDEQPPLAGDYIAAVRKRLAGRDLALVFEPGRFIVAN
FT                   AGVLLTQVEYLKHTEHKDFAIIDAAMNDLIRPALYQAWMDVSPVQPRDGEARHYDLVGP
FT                   ICETGDFLAKDRQLVLEEGDLLAVRSAGAYGFVMSSNYNTRGRAAEVLVDGEQAYEVRR
FT                   RETVQELYAGESLLPA"
FT   gene            277945..278982
FT                   /locus_tag="Pmen_0268"
FT   CDS_pept        277945..278982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0268"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83042"
FT                   /db_xref="GOA:A4XNX6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNX6"
FT                   /protein_id="ABP83042.1"
FT                   /translation="MDNPATLAGSVSVAYLQGLVDHLQRQGVAPAALLAHAQLTPDVLT
FT                   QRDQRIAASAYLTLLGEAVRYSADDCLGLHLGESVRPGYYGVLGYLIMSCATLADALHR
FT                   QARYASLVGNLGLVGLDDEPPRPGCEAQVAHTWQPLLAQQQRQLSEETLAGWVSFGRWI
FT                   SGLDIAPTEVRFQHSAPADTSEHARIFRCPVLFDQADNALVFPKRLLAAPLGQADAQVR
FT                   RMLDAYAERLLAELNQGHSVLDRARLELARQLPEQGPDLETIASALALSPRTLQRRLRE
FT                   AGLSFSQLVDETRQQLVLHYLRDPALELAEIAFLVGFSEPGSLVRAFRRWTGGSPGEYR
FT                   RHLLG"
FT   gene            279052..279384
FT                   /locus_tag="Pmen_0269"
FT   CDS_pept        279052..279384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0269"
FT                   /product="Frataxin family protein"
FT                   /note="PFAM: Frataxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83043"
FT                   /db_xref="GOA:A4XNX7"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNX7"
FT                   /protein_id="ABP83043.1"
FT                   /translation="MSLSEARFHDLVDATQQAVEDIFDDSGLDVDLENSAGVLTVRFDN
FT                   GSQLIFSRQEPIRQLWLAARSGGYHFDYDEAEGRWICDSSDEQLGEMLVRITLEQSGAE
FT                   LEFDEL"
FT   gene            279374..279571
FT                   /locus_tag="Pmen_0270"
FT   CDS_pept        279374..279571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0270"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83044"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNX8"
FT                   /protein_id="ABP83044.1"
FT                   /translation="MSSDSADRPLESPCRRQCCLDEHDQCLGCGRTLQEILDWGAADNA
FT                   RRRQIAAAAEQRLRQRRSTP"
FT   gene            279689..280096
FT                   /locus_tag="Pmen_0271"
FT   CDS_pept        279689..280096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0271"
FT                   /product="GreA/GreB family elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83045"
FT                   /db_xref="GOA:A4XNX9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNX9"
FT                   /protein_id="ABP83045.1"
FT                   /translation="MNNAPAITITRLDLQRLERLLDSLDEFGPGAAALQAELDRAEVVG
FT                   LDEVPAGLVTMNSRVHCREESSGKDYHLTLVYPQDAGGEGTVSILAPVGSALLGLSVGQ
FT                   HIDWPAPGGKQLKLTLLAVEYQPEAAGEYDR"
FT   gene            280155..280955
FT                   /locus_tag="Pmen_0272"
FT   CDS_pept        280155..280955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0272"
FT                   /product="lipase, class 3"
FT                   /note="PFAM: lipase, class 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83046"
FT                   /db_xref="GOA:A4XNY0"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNY0"
FT                   /protein_id="ABP83046.1"
FT                   /translation="MSSLPLYFPPTYQLARAQRCAELVILAYDQYAQWLAQQRPRKPQQ
FT                   FHWQPPQQAGWQLSAPIWSILSEWYVLDESEPFGFAARDAQGDCYLVFRGTESVQDWLD
FT                   DLDLDQRAYPWQAGGGLVHDGFLKLYASLRDQALLALEQLQPQGMLWVCGHSLGCALSS
FT                   LAVPDLRRRWPFLALQHYNFASPRLASPAFANYYNALAVPTYRLVNDSDLVPELPPADS
FT                   DGWLYQHLGLAVTFTASYAGVADNHSMGGCYLFALNNPQSPMRG"
FT   gene            complement(280970..283828)
FT                   /locus_tag="Pmen_0273"
FT   CDS_pept        complement(280970..283828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0273"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase, class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83047"
FT                   /db_xref="GOA:A4XNY1"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNY1"
FT                   /protein_id="ABP83047.1"
FT                   /translation="MTRTLEIRPDIDDGIDRKVLTQLRARFLKINQGRLQRTMLGLSSR
FT                   QQLVLKLLPLLLHVNHPLLPGYVSAATPAGLSGFEPDDEVLAEVQRLTRSFVYKPRRGQ
FT                   GSAPLHGLFLMGSLGTVAQAEQSDMDLWLCHSPTLTAQQLQELRKKSDLLESWAATQGA
FT                   EVHVFLVDPQRFTQGAREAQLTSDDCGTTQHYLLLDEFYRTAIWLGGRTPLWWLVPVYE
FT                   EPRYHDYCRTLLSKRFVRAEDVLDLGHLAHIPPDEFIGAGMWQLYKGIESPYKSVLKLL
FT                   LTEVYASEHPRVECLSLRFKQAVFEGRLDLDELDPYVVVYRRLEEYLSARGDLERLELV
FT                   RRCLYLKVNKKISRPPTRGRAKSWQRLLLERLTAEWGWNTRQLNLLDSRSQWKVRQVAA
FT                   ERRVLVNELTYSYRFLSQFARSAQAGSSLNNRDLNVLGRRLYAAFERKAGKVEFINPGI
FT                   APDLAEDILTLVQHPSPEAPNDYQWALFTGSLGAQEWPDFAPLKRTRELVELLAWCHRN
FT                   GVIDAATRLSLHPGSSDLTDFELSNLITSLQHSFPLPQPGVEEAALLRASVPSQVLLLV
FT                   NVGVDPLPQHSQMNVHMTTGRTDALGYSGVRENLVLTLDQVVLNSWNELQVSRYDGSDA
FT                   LLDCLCDLLNSLPPGGPQPGVQVRCYCRNRAPAIAERVEELLRDLLATYAEGRQARYLV
FT                   QVRQHYHVLQLTPGQVSHAALGDLPALLEHLGAEQELYSPLHLDRHALEGDDLALILPM
FT                   GRPQCIQLFYRQHETSGEAELTLLDENNALWRRRLPFRDEQSLLTPLQRFLQSLQYRRN
FT                   AMLPLDSSDNQAPLEILYYQLLPAAPLRAQRLERRPAPQAQVSHPFYDVQAIIEPGDGR
FT                   QRHVTLYCNHREFSELEYGRELYRAVAQHILAQRAGGERYPCYITDLDLSAVLAGQQAQ
FT                   TVHYLRYKSELEDALNAALQQA"
FT   gene            complement(283949..284203)
FT                   /locus_tag="Pmen_0274"
FT   CDS_pept        complement(283949..284203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83048"
FT                   /db_xref="InterPro:IPR013468"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNY2"
FT                   /protein_id="ABP83048.1"
FT                   /translation="MKSFTAELIDELEILALYNLDNHQEGLKVHNNASFKAQGAITRLY
FT                   EKGLVSQADGGYLTSLGIDAAEHAQALLTILSTRQTTPA"
FT   gene            complement(284278..284607)
FT                   /locus_tag="Pmen_0275"
FT   CDS_pept        complement(284278..284607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83049"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNY3"
FT                   /protein_id="ABP83049.1"
FT                   /translation="MSACACSASTRKTAMSEHDDNDEDFAEATLIQAIENQLESGEPAA
FT                   AKAVYNKLTLVGYEREEILELMALVLAHEVDAMLREDRPFDGAWYEQALRALPELPPEE
FT                   QSDDQ"
FT   gene            complement(284588..285046)
FT                   /locus_tag="Pmen_0276"
FT   CDS_pept        complement(284588..285046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83050"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNY4"
FT                   /protein_id="ABP83050.1"
FT                   /translation="MRHALFSGLLALSVPMALASEGDYWQVQTSVYTRHYHPEPDHNNH
FT                   QRLIGLERGYASGNLWGGAVFRNSFDQNSQYAYLGRRFDSERHPFYAKLTGGLLHGYRG
FT                   EYRDKIPLNRLGVAPAIIPSLGVHGHGLAAELVLLGNAALMVNVGLRL"
FT   sig_peptide     complement(284987..285046)
FT                   /locus_tag="Pmen_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 20"
FT   gene            complement(285099..286493)
FT                   /locus_tag="Pmen_0277"
FT   CDS_pept        complement(285099..286493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0277"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83051"
FT                   /db_xref="GOA:A4XNY5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XNY5"
FT                   /protein_id="ABP83051.1"
FT                   /translation="MSSEKTNQSWGGRFSEPVDAFVARFTASVEFDKRLYRHDIMGSIA
FT                   HASMLAKVGVLTDAERDAIEGGLKQIQGEIEAGQFDWRVDLEDVHMNIEARLTDRIGVT
FT                   GKKLHTGRSRNDQVATDIRLWLRDEIDVILAEITRLQQGLLGLAEAEADTIMPGFTHLQ
FT                   TAQPVTFGHHLLAWFEMLSRDYERLVDCRKRTNRMPLGSAALAGTTYPIQREITAELLG
FT                   FDAVGGNSLDGVSDRDFAIEFCAAASLAMMHLSRFSEELVLWTSAQFQFIDLPDRFCTG
FT                   SSIMPQKKNPDVPELVRGKTGRVFGALTGLLTLMKGQPLAYNKDNQEDKEPLFDAADTL
FT                   RDSLRAFADMVPAIKPKREIMREAALRGFSTATDLADYLVRKGLPFRDCHEIVGHAVKY
FT                   GVHSGKDLAEMSLDELRQFSDQIDDDVFAVLTLEGSVGARDHIGGTAPNQVRAAVARGR
FT                   ELLSAR"
FT   gene            286726..287808
FT                   /locus_tag="Pmen_0278"
FT   CDS_pept        286726..287808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0278"
FT                   /product="Sensory transduction protein kinase AlgZ"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: histidine kinase internal region"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83052"
FT                   /db_xref="GOA:A4XNY6"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNY6"
FT                   /protein_id="ABP83052.1"
FT                   /translation="MHTQSLAKNKHNDPADEFFVPELCQPEALLSMVLLAELLVLVLVL
FT                   AQPMTPGFDWVRLALTSLFVQWIVLLSAAVLCRLRPLLARLRPAIAGGLCCALVVLLTL
FT                   GCTAVADYYDLGGPLPRSGEVNLYLRHALIGLIMSALLLRYFYLQSQWRRQEQAELRAR
FT                   IESLQARIRPHFLFNSLNSIASLVTLDPHKAEQAVLDLSDLFRASLAKPGTLVPWKEEL
FT                   ELAKRYLSIEHYRLGERLQLQWEVEGVPEDLPIPQLTLQPLLENALIYGIQPRIEGGLV
FT                   RVEADYQNGVFSLCVSNPYEERGEQHPSRGTQQALSNIDARLAALFGPRASLSVERRDG
FT                   RHYSCLRYPCARLTQEARAI"
FT   gene            287805..288551
FT                   /locus_tag="Pmen_0279"
FT   CDS_pept        287805..288551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0279"
FT                   /product="Two-component response regulator AlgR"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83053"
FT                   /db_xref="GOA:A4XNY7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNY7"
FT                   /protein_id="ABP83053.1"
FT                   /translation="MNVLIVDDEPLARERLSRMVGELEGYRVLEPAASNGEEALTLIDS
FT                   LKPDVVLLDIRMPGLDGLQVAARLCEREAPPAVIFCTAHDEFALEAFQVSAVGYLVKPV
FT                   RAENLSEALKKAERPNRVQLAALTRPAAESGGGPRTHISARTRKGIELVPLDHVVYFIA
FT                   DHKYVTLRHEGGEVLLDEPLKALEDEFGDRFVRIHRNALVARERIERLQRTPLGHFQLF
FT                   LKGLDGDSLVVSRRHVAGVRKLMQSL"
FT   gene            288636..289574
FT                   /locus_tag="Pmen_0280"
FT   CDS_pept        288636..289574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0280"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83054"
FT                   /db_xref="GOA:A4XNY8"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNY8"
FT                   /protein_id="ABP83054.1"
FT                   /translation="MPREIRIATRKSALALWQAEYVKARLEQAHPGLLVSLVPMVSRGD
FT                   KLLDAPLAKIGGKGLFVKELETALLENEADIAVHSMKDVPMDFPEGLGLYCICEREDPR
FT                   DAFVSNTYDSLDALPAGSVVGTSSLRRQAQLLARRPDLKIQFLRGNVNTRLAKLDAGEY
FT                   DAIILAAAGLIRLGFQDRIRSSISAEDSLPAGGQGAVGIECRSADAEIHALLAPLHHRE
FT                   TALRVTAERALNKRLNGGCQVPIACYALLENDQLWLRGLVGQPDGGLLLRAEHRAASSD
FT                   AEALGVRVAEALLAQGAEAILKAVYGEAGHP"
FT   gene            289571..290344
FT                   /locus_tag="Pmen_0281"
FT   CDS_pept        289571..290344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0281"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83055"
FT                   /db_xref="GOA:A4XNY9"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNY9"
FT                   /protein_id="ABP83055.1"
FT                   /translation="MSAWRLLLTRPAEDCAALAQTLAEHGITGSCMPLLGIEPLPETAE
FT                   QRIAFAELQRYCAVIVVSKPAARLGLALLDGHRAEPVTGQPWFAVGAATAALLTEHGLP
FT                   VHYPERGDDSEALLALPALQGALAAESAPRVLILRGEGGREFLGQCLRGQGASVDYLPL
FT                   YRRVLPPYPAGELSRRVQAERLNGLVVSSGQGFEHLLQLAGDDWPALARLPLFVPSPRV
FT                   AEQARAAGAQIVVDCRGASAAALLAALEQFPAAAL"
FT   gene            290357..291487
FT                   /locus_tag="Pmen_0282"
FT   CDS_pept        290357..291487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0282"
FT                   /product="protein of unknown function DUF513, hemX"
FT                   /note="PFAM: protein of unknown function DUF513, hemX"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83056"
FT                   /db_xref="GOA:A4XNZ0"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNZ0"
FT                   /protein_id="ABP83056.1"
FT                   /translation="MSEAATPQTPEEKPASEAVNTTPTPPVKPARIGAATGLAAFALLI
FT                   GLAGAGAGGWSLWQLQQMQSRDQQQAEALQRTRDDSAKQLQGLARQLDARLAELPSASE
FT                   LNERRRLLANLQSDQQRLSQRLESVLDGSRQDWRLDEAEHLLRLASLRLSALQDVAGAE
FT                   ALVLTADDILREQDDPAAFAAREQLSRSLEALRTTQRPDRVGLFLQLGALREQAATLNP
FT                   LAPTFEGQGDVLSDLAAEGDGSAWWGEWVKKLSEYFRIEFDADRNVRPLLSGQSLSQVR
FT                   LSLSLALEQAQWAALHGQTGVYRQALKQAEEILDAHFNLDNPDSRALRQRFAELADATV
FT                   EVKVPDLSDSLDALQAYLHRKQAQRRQGAAAAEEAQ"
FT   gene            291484..292731
FT                   /locus_tag="Pmen_0283"
FT   CDS_pept        291484..292731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0283"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83057"
FT                   /db_xref="GOA:A4XNZ1"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNZ1"
FT                   /protein_id="ABP83057.1"
FT                   /translation="MRRLLWLLVLLAVAAGLYLLHLAMEADRGYVLFAYQGFRYQSGLW
FT                   AFLGLVLAVVVLYYLIKWTLRLLLSSTRLANPWSRLHRNRRVRLASEQGLLDLAEGRWA
FT                   RAQRQLTRAAEADSQPLMYYLGAARAANKLGQHEQSDELLERALHKQPQAELAIALTHA
FT                   ELQRSRGDNEAALETLQVMRQRHPGHHLVLRQLQRLYLQRQDWSALLGLLPELRKEKAL
FT                   PAAEIDELERETWRGRLADAGLAGQGQGETALQPLTQAWQQLSAPLRQEPELVATYVEQ
FT                   LRRLGAQEEAEEVLRSTLKRSYDSRLARFYGVLRGADPARQLQTAELWLKQHPQDPALL
FT                   LTLGRLCLQNQLWGKARDYFETSLKLERHPETCAELARLLAQLGELERSNQLLLESLGL
FT                   LHQGLPPLPQPQGASA"
FT   sig_peptide     291484..291561
FT                   /locus_tag="Pmen_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.760 at
FT                   residue 26"
FT   gene            292884..293375
FT                   /locus_tag="Pmen_0284"
FT   CDS_pept        292884..293375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0284"
FT                   /product="disulfide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83058"
FT                   /db_xref="GOA:A4XNZ2"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNZ2"
FT                   /protein_id="ABP83058.1"
FT                   /translation="MHLASPRPLFFLAFIGCVLLMAAALYLEHVVGLEPCPMCVLQRIC
FT                   VIAFGVVCLLAAIHGPARLGRRIYALLALLFAGAGAATAGRQIWLQSVPADQLEACLPS
FT                   LEFMMQALPMQDIVRLVFQGSADCAEVKWTLFGMSIPEWSLLGFIGMIGFCLFQLLRRG
FT                   "
FT   sig_peptide     292884..292952
FT                   /locus_tag="Pmen_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.808 at
FT                   residue 23"
FT   gene            293685..294158
FT                   /locus_tag="Pmen_0285"
FT   CDS_pept        293685..294158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0285"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit,
FT                   Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83059"
FT                   /db_xref="GOA:A4XNZ3"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNZ3"
FT                   /protein_id="ABP83059.1"
FT                   /translation="MLESCQNAQERWGGVHQLIDRWLGERRELVLAYTALSKAPQAPAI
FT                   NGEALQGFCEILVDYVSAGHFEVYEQLTSEAKAFNDKRGLELAKQIYPRIEAITEVALA
FT                   FNDRCDNGDCRDSVSLVAELNRLGQLLHERFELEDCLIEVLHNAHQEQAAEVL"
FT   gene            complement(294216..294863)
FT                   /locus_tag="Pmen_0286"
FT   CDS_pept        complement(294216..294863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0286"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83060"
FT                   /db_xref="GOA:A4XNZ4"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNZ4"
FT                   /protein_id="ABP83060.1"
FT                   /translation="MSRAVLAALAICCSLSAQADQHQQDLAYSLGVRLGERLHEEVPDL
FT                   PLGELLEGLRQAYEGKPLRLDAARIEQLLEEHEARIEASPQRHDKAIEAEQRFLAGESR
FT                   RPNVRELGNGVLVTELSPGSGPRPTARSRVQVSYRGELADGSVFDESSTPQWFRLDSLI
FT                   AGWRSALLQMPKGAHWRLVIPSNQAYGEEGAGDLIPPHAPLVFDLRLLDVTD"
FT   sig_peptide     complement(294804..294863)
FT                   /locus_tag="Pmen_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 20"
FT   gene            295000..295953
FT                   /locus_tag="Pmen_0287"
FT   CDS_pept        295000..295953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0287"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83061"
FT                   /db_xref="GOA:A4XNZ5"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNZ5"
FT                   /protein_id="ABP83061.1"
FT                   /translation="MSAKKKTISTPLHLLHQLSASLLEHLENACSQALVDAEKLLAKLE
FT                   KQRGKAQEKLHKARGKLQDAAVAGKTKAQAKAKDVVAELEELLDTLKARQSETRGYIAQ
FT                   LKRDAQESLKLAQGVGKVKEAAAKALDGREAKAAAPAAKPASKPAAAKKPAAAKAPAKK
FT                   APAKPAAKPAAASKPAAKPAAGKPVAAKAAAAKAPAKPVAPKAAAKPAAPKAAAKPAAA
FT                   KAPAKPVASKPAAKPSAAKPAADKPAAKSAPAKPAAKPASKPVAAKKPATAKAPAKKAP
FT                   AKPAAAKPAAAPAAPAAPAAPAATNGAAAPVAPSAS"
FT   gene            complement(295950..296393)
FT                   /locus_tag="Pmen_0288"
FT   CDS_pept        complement(295950..296393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0288"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83062"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNZ6"
FT                   /protein_id="ABP83062.1"
FT                   /translation="MQDLWNFALELYARPGVEQACLDLQDAGSDVCLLLTGAWLQQRGV
FT                   RCVDERLRALTEVAGPWQREVVSPLRQTRRHWRTAAGQDDELAALREQIKKLELQAERV
FT                   LLERLQALAANWPDEEAQSDWLLALTGENSAALQVLRGAIRLA"
FT   gene            296432..298342
FT                   /locus_tag="Pmen_0289"
FT   CDS_pept        296432..298342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0289"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83063"
FT                   /db_xref="GOA:A4XNZ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNZ7"
FT                   /protein_id="ABP83063.1"
FT                   /translation="MIRLQNLTLQRGPQRLLEGAELTLHAGQKVGLIGANGAGKSSLFA
FT                   LLRGELGPDAGDCQLPPDWRIAHMRQEVDNLERLAVDYVLDGDVHLRAIQAELARAEAA
FT                   HDGSAIARLHSELDNAQGYSADSRARKLLAGLGFTSEQMDRRVGDFSGGWRMRLNLAQA
FT                   LMCPSELLLLDEPTNHLDLDAILWLEEWLKGYPGTLLLISHDRDFLDAVVDHVAHLEQQ
FT                   KLTLYRGGYSAFERTRAERLAQQQQAYEKQQAQRAHMEDFIRRFKAKATKARQAQSRIK
FT                   ALERLEELAPAHVDSPFDFVFREADKVSSPLLNLSEARLGYGDKTVLEKVKLSLAPGAR
FT                   IGLLGPNGAGKSTLIKTLAGDLAVLGGELARGENLAIGYFAQHQLDALDPKASPLLHLQ
FT                   RLAPSEREQTLRDFIGGFDFRGERCDEPVLNFSGGEKARLALALIAWQKPNLLLLDEPT
FT                   NHLDLEMRLALTMALQEFAGAVLVVSHDRHLLKSTTDEFLLVADGRIQPFEGDLDDYAR
FT                   WLIDFRARQQPVAAPAAGAEKTDKRAQRQAAAALRQQLAPHKKQADKLEQELGKVQEKL
FT                   AAVEAQLGDSGLYESARKDELRERLAEQAQLKAREAELEEAWLLALETLEALQQQLEEA
FT                   E"
FT   gene            298342..298881
FT                   /locus_tag="Pmen_0290"
FT   CDS_pept        298342..298881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83064"
FT                   /db_xref="GOA:A4XNZ8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNZ8"
FT                   /protein_id="ABP83064.1"
FT                   /translation="MEQLELLVAWREPLIRAGQVLLIILLAWIAQRILTRAISRLGARY
FT                   SLLPQEVLQPLRGLLRWLIMGSAFMLVLERLGVSATVLWTALTGFTAVAAVAFFAIWSV
FT                   LSNMFCALLIFTMGPFRIGDTVEVIDSADKPGVKGRVIAINLFYTTLQDLAEDAAGALL
FT                   QVPNSLFFQKSVRRWR"
FT   gene            298916..299590
FT                   /locus_tag="Pmen_0291"
FT   CDS_pept        298916..299590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0291"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83065"
FT                   /db_xref="GOA:A4XNZ9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A4XNZ9"
FT                   /protein_id="ABP83065.1"
FT                   /translation="MEPFSRFLLPEVRIMALETWLAFFVACWVISLSPGAGAVASMSAG
FT                   LQYGFWRGYWNALGLQLGLALQIAIVAAGVGAILAASALAFSLIKWFGVAYLVFLAYKQ
FT                   WVALPSDLDAGATERPSGRPLTLVLRGFLVNASNPKAIVFMLAVLPQFINPHAPLLAQY
FT                   LVMGLTMIVVDLIVMAGYTGLASRVLRALRTPRQQRVMNRSFAALFAAAAGLLATVKRA
FT                   AV"
FT   gene            299719..301608
FT                   /locus_tag="Pmen_0292"
FT   CDS_pept        299719..301608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0292"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: cytochrome c, class I; iron permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83066"
FT                   /db_xref="GOA:A4XP00"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP00"
FT                   /protein_id="ABP83066.1"
FT                   /translation="MSRFRFALSWLTLPLLAMLSFLAIGEPLDGAAQALHLIGYIGADY
FT                   PATVAGGQVIDAGEYQEQLEFLDVLQGLVVALPARAGRDELERGVVDLRQAIAQRQPGE
FT                   TVAAAARQLGARLAELYQVAQTPILTPDPERGAPLYAQHCSVCHGDTGLGDGPAGIGLE
FT                   PAPANLRDAARLDRLSLYDLYNTLGLGIEGTDMPAFADQLDERQRWDLAAYIAGFTAAS
FT                   AQSQTRFAMIELAGRTPAEIAAAGGDVAAFRAQRAHPLLEQRGPQQLIGYTRSTLERSL
FT                   QAYRDGDREQAYDLSVGAYLEGFELVESALDNLDAVQRKITERALMAYRQALQDGASVT
FT                   QAARALEQAKVELDKSAALLAEGAMDGSLSFFASLLILLREGLEAILVLAAILAFLRNT
FT                   GQQQAVRSVHIGWGLALLAGVATWAVAAYLIDISGAQRELLEGATALFASVVLLWVGVW
FT                   MHDRRHAAAWQDYIKSSLVGGGGRFGFAVLAFFSVYRELFEVILFYETLWLQAGPAGHG
FT                   AVLAGAAAALVLLIGLAWVILRGSRKLPLATFFGVNAVLLCVLSVVFAGHGVAALQEAG
FT                   VLGTRPVAFFEFDWLGIHADAWSLSAQGLALAGIALLYGRSLRGERRRLAEQA"
FT   sig_peptide     299719..299796
FT                   /locus_tag="Pmen_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 26"
FT   gene            301731..302066
FT                   /locus_tag="Pmen_0293"
FT   CDS_pept        301731..302066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83067"
FT                   /db_xref="InterPro:IPR027945"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP01"
FT                   /protein_id="ABP83067.1"
FT                   /translation="MSSTVHSTHYADSPDLALAALRHPPLEQALAAACAELSVQQAYLA
FT                   ALRDPAIGPQPRLLLAVEGANVQVQRRLAALVAELLPDEVELDLIELADDNLSRAVRER
FT                   CQAFYNA"
FT   gene            302128..302577
FT                   /locus_tag="Pmen_0294"
FT   CDS_pept        302128..302577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0294"
FT                   /product="protein of unknown function DUF188"
FT                   /note="PFAM: protein of unknown function DUF188"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83068"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XP02"
FT                   /protein_id="ABP83068.1"
FT                   /translation="MRVWIDADACPRAARDQVVKFALKRGFEVVLVAGQAVARPNFACV
FT                   KLIVVPSGPDAADDHLVEHAVPGELVICSDVPLADRLVKKGVAALDPRGREFDERNMGE
FT                   RLAVRNLFTDLREQGQVGGGQAPYSEKDRQAFANALDRILTRLSR"
FT   gene            complement(302689..303156)
FT                   /locus_tag="Pmen_0295"
FT   CDS_pept        complement(302689..303156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0295"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83069"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP03"
FT                   /protein_id="ABP83069.1"
FT                   /translation="MTQPFVLSPDLQQAVAAFFQRIPFNQVLGIELDELSPERVTMHLP
FT                   MKPELIGNFVHGILHGGVISSLLDVCGGAMALIGAFANHQHLPPAERMSKLSKLGTIDL
FT                   RIDYLRPGRGQRFTATALPLRAGNKVAVIRMELHNDEGVLVAVGTGTYLCG"
FT   gene            complement(303387..304046)
FT                   /locus_tag="Pmen_0296"
FT   CDS_pept        complement(303387..304046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0296"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83070"
FT                   /db_xref="GOA:A4XP04"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP04"
FT                   /protein_id="ABP83070.1"
FT                   /translation="MSKKVAVILSGCGVYDGAEIHESVITLLRLDQRGAVVQCFAPNVP
FT                   QLHVVDHYSGDEMDETRNVLVESARIARGKIKDVKELHVAEFDALILPGGFGVAKNLSD
FT                   FATSGAGCTVQPDVLAACKAFVDAGKPVGLMCIAPALAAKIFGAGVICTIGTDHDTAAA
FT                   LTQMGAEHHECEVSDIVEDHARKLVTTPAYMLAQSIAEAASGINKMVDRVLELAHH"
FT   gene            304209..305501
FT                   /locus_tag="Pmen_0297"
FT   CDS_pept        304209..305501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0297"
FT                   /product="Sterol desaturase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83071"
FT                   /db_xref="GOA:A4XP05"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP05"
FT                   /protein_id="ABP83071.1"
FT                   /translation="MNNRLAPRQAQRYGSAMNYVLYAVPFFFLLIALELLADRLRGMRS
FT                   YRLADALGSLGTGVLSQTTGVLTKVVGLLTYAFAWEHLALFELAEGSLWVWVFAFVFYD
FT                   FCYYWNHRLGHERNVLWAAHAVHHQSEDYNLTTALRQTSTGFVFGWIFYLPMAVLGVPP
FT                   LVFLTVAALNLLYQFWVHTRHIPKLGWFEWLFITPSNHRVHHAQNPIYMDRNYGGVFIV
FT                   WDRLFGTFQEELDEEPVIFGVTVPLASWNPLWANLQVYAGLWHDARRAGSWWDRLRIWF
FT                   MPTGWRPADVAARHPQAKPDLSNFRKFEVALGRGAQVYALLQFVCYLLAGVWLLAQGDA
FT                   LATGAVLLACLWMALGLCSIGLWLENRSHAWQLECLRLAGNLPAFWLAGELGMLTLDLT
FT                   VWVWLSAYSLSSLLGIWLARGSAAPALTPPV"
FT   gene            complement(305469..306023)
FT                   /locus_tag="Pmen_0298"
FT   CDS_pept        complement(305469..306023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0298"
FT                   /product="Uncharacterized membrane-associated protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83072"
FT                   /db_xref="GOA:A4XP06"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP06"
FT                   /protein_id="ABP83072.1"
FT                   /translation="MLQDLIRQFGYPALILGTFLEGEVSLLLAAYMAVRNVLEIEWVAL
FT                   CAFLGTFASDQLWYYLGRRHGRALLARKPRWQPLGERASALIKRYPDLWVLCFRFLYGL
FT                   RTVMPLTIGLSGYSWRRYLLLDAIGAGVWAGGISLLAYSLGHAMGGLLEELRNYQVILL
FT                   AAVVLLLALAWLHRWRQRRRG"
FT   gene            306217..307230
FT                   /locus_tag="Pmen_0299"
FT   CDS_pept        306217..307230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0299"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83073"
FT                   /db_xref="GOA:A4XP07"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP07"
FT                   /protein_id="ABP83073.1"
FT                   /translation="MSVTPANRLFPATRLRRNRRDDFSRRLVREHRLSVDDLILPVFVL
FT                   DGDNRREAVPSMPGVERLSIDLLLQEAEHWVELGIPALALFPVTPLEKKSLDGAEAWNP
FT                   DGIAQRAIRALRAKFPELGVISDVALDPFTTHGQDGILDDSGYVQNDITVDALVKQALS
FT                   HAEAGAQVVAPSDMMDGRVQAIREALELADHPNVRIMAYSAKYASAYYGPFRDAVGSAA
FT                   NLGKGNKLGYQMDPANGNEALHEVAADLAEGADMVMVKPGMPYLDILWRVKDAYKVPTF
FT                   VYQVSGEYAMHMAAIQNGWLGEAVILESLTAFKRAGADGILTYFAVRAAELLKQGR"
FT   gene            307250..309433
FT                   /locus_tag="Pmen_0300"
FT   CDS_pept        307250..309433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0300"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="PFAM: Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83074"
FT                   /db_xref="GOA:A4XP08"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP08"
FT                   /protein_id="ABP83074.1"
FT                   /translation="MNSEGLNSEVLDNNPPQAEVVAETPVVETPPPAPIPSLDDSSLYI
FT                   HRELSQLQFNIRVLEQALDESYPLLERLKFLLIFSSNLDEFFEIRVAGLKKQINFAREQ
FT                   AGADGLQPHQALARISELVHEQVERQYAILNDTLFPALAKHNINFIRRRFWTTKLKAWV
FT                   RRYFRDEIAPIITPIGLDPTHPFPLLVNKSLNFIVELEGIDAFGRDSGLAIIPAPRLLP
FT                   RIIRVPEEVGGPGDNYVFLSSMIHAHADDLFQGMKVKGCYQFRLTRNADLSVDTEDVED
FT                   LARALRGELFSRRYGDAVRLEVVDTCPKHLRDHLLKQFGLTESELYQVNGPVNLTRLFS
FT                   ITGLDNHPELQHAPFTPVIPKLLQNAENIFSVVSKQDILLLHPFESFTPVVDLLRQAAK
FT                   DPHVLAIKQTLYRSGANSEIVDALVEAARNGKEVTAVIELRARFDEESNLQLASRLQQA
FT                   GAVVIYGVVGFKTHAKMMLILRRENGEIVRYAHLGTGNYHAGNAKLYTDYSLLTADVAL
FT                   GEDVAKLFSQLIGMGKTLRMKKLLHAPFTLKKTLLDLIAKETAAAADGKPAQIIAKFNS
FT                   LTDPKVIRALYKASQTGVKIDLVVRGMCCLRPGIAGVSHNIQVRSIIGRFLEHTRVFYF
FT                   LNGGDEKIYLSSADWMERNLDKRVETCFPVEGKKLITRVKKELESYLTDNTHAWVLQAD
FT                   GRYLRQQPTGNQNPRSAQSGLLEKLTAPVVSAR"
FT   gene            complement(309603..311105)
FT                   /locus_tag="Pmen_0301"
FT   CDS_pept        complement(309603..311105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0301"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83075"
FT                   /db_xref="GOA:A4XP09"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP09"
FT                   /protein_id="ABP83075.1"
FT                   /translation="MPKAPAENYPLIAAIDLGSNSFHMVLAKADHGEIRILERLGDKVQ
FT                   LAAGIDEERQLSEEAMQRGLDCLRRFAQFTNSLPEGAVRIVGTNALREARNRAVFIRRA
FT                   EEILGHQVEVISGREEARLIYLGVSHSIADTPGKRLVADIGGGSTEFIIGQRFEPLLRE
FT                   SLQMGCVSFTQRYFKDGKITPARYAQAYTAARLELMGIEQALRRLGWEDAVGASGTIKA
FT                   IGLATKAAGLGNGEVTVEGLAWLKRKLFKLGEVEKIDLDGIKPDRRSIFPAGLAILEAI
FT                   FDACEIQRMSHSEGALREGVLYDLLGRHQHEDVRERTLSAFMERYHVDLDQAARVETKA
FT                   LSALDKVADDWGLTDDWHRELLSWGARVHEVGLDIAHYQYHKHGAYLIEHSDLSGFSRQ
FT                   DQQMLALLVRGHRRNIPRDKFAEFGEEGVKLMRLCVLLRFAILFHHIRGTQDMPQVQLK
FT                   AGENSLEVHFPDGWLAANPLTQADFEAEAEWLKRIDLTLSVR"
FT   gene            complement(311192..311713)
FT                   /locus_tag="Pmen_0302"
FT   CDS_pept        complement(311192..311713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0302"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /EC_number="3.5.3.19"
FT                   /note="PFAM: Ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83076"
FT                   /db_xref="GOA:A4XP10"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP10"
FT                   /protein_id="ABP83076.1"
FT                   /translation="MNAPAPRPLRIEPLTRAAFAPFGEVIETAGANAFPINAGTTTRYH
FT                   DLAQVELGGEAPRTLVNLFEGKAWHAPIEIRMLERHPLGSQAFYPVDGACMLIVVAPPG
FT                   ELDESKIRAFISAPDQGVNYARGTWHHPLLCLQHPGRFLVVDRGGPGRNCDEQALEQPL
FT                   SVLNLRQAQV"
FT   gene            complement(311710..312441)
FT                   /locus_tag="Pmen_0303"
FT   CDS_pept        complement(311710..312441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0303"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83077"
FT                   /db_xref="GOA:A4XP11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP11"
FT                   /protein_id="ABP83077.1"
FT                   /translation="MSLLNVTALHKYYGDNHVLKGIDLKVEEGEVVAIIGRSGSGKSTF
FT                   LRTLNGLESINDGVIEVDGEYIDAARADLRSLRQKVGMVFQQFNLFPHLTVGENVMLAP
FT                   QVVKKTARAEAERIARQMLERVGLAEKFDAYPERLSGGQQQRVAIARALAMSPKVLLCD
FT                   EITSALDPELVNEVLAVVKQLASEGMTLIMVTHEMRFAREVGDKLVFMHQGKVHEIGDP
FT                   KALFAAPQTEELRNFIGSVNL"
FT   gene            complement(312428..313075)
FT                   /locus_tag="Pmen_0304"
FT   CDS_pept        complement(312428..313075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0304"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83078"
FT                   /db_xref="GOA:A4XP12"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP12"
FT                   /protein_id="ABP83078.1"
FT                   /translation="MDFTLWDILRNLLTGLQWTLLLSLVAFVCGGIAGLLVMLARLSPL
FT                   AAPRILARGYIELFQGTPLLMQLFLVFFGIALLGVDVSPWLAAATALTLFTSAFLAEIW
FT                   RGCVESIGRGQWEASESLAMSRLETLRHVVLPQALRIAVAPTVGFSVQVIKGTAVTSII
FT                   GFTELTKTGSMLANATFEPFMVYGFVALGYFLLCYPLSLAAYRLERRLNVTA"
FT   sig_peptide     complement(312935..313075)
FT                   /locus_tag="Pmen_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.655) with cleavage site probability 0.624 at
FT                   residue 47"
FT   gene            complement(313075..313740)
FT                   /locus_tag="Pmen_0305"
FT   CDS_pept        complement(313075..313740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0305"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83079"
FT                   /db_xref="GOA:A4XP13"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP13"
FT                   /protein_id="ABP83079.1"
FT                   /translation="MAYQFDFVAVLQHSDLLLQGAAFTLGLTAIGTLLGVALGIVGAIL
FT                   RAWRIRPFDRIFGVYVELIRNTPFIVQLFFIFFGLPSLGVRLSEWEAAVLAMVINLGAY
FT                   STEIIRAGIQAIPHGQLEAAAALAMSRFETFRHVVLRPALGKVWPALSSQIIIVMLGSA
FT                   VCSQISTEELSFAANFIQSRNFRAFETYLLTTALYLLMAILIRQLLAWVGRRFIMGER"
FT   gene            complement(313760..314545)
FT                   /locus_tag="Pmen_0306"
FT   CDS_pept        complement(313760..314545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0306"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83080"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP14"
FT                   /protein_id="ABP83080.1"
FT                   /translation="MGKFHRTLLGTLFAALAFGAAAAHADALEDISAAGVLKVAVPQDF
FT                   PPFGSVGPDMKPRGLDIDTAQLLADKLQVKLELTPVNSTNRIPFLTTGKVDLVISSLGK
FT                   NPEREAVIDFSAPYAPFYLGVFGPEDAAIASLDDLAGKTISVTRGSIEDIELSNVAPKG
FT                   ATIKRFEDNNSTIAAYLSGQVELIASGNVVMVAIAERNPKRIPSMKLKLKDSPVYVGVN
FT                   KSQTALLDKVNAIIADAKADGSLEALSQKWLKQPLPADL"
FT   sig_peptide     complement(314468..314545)
FT                   /locus_tag="Pmen_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 26"
FT   gene            314833..315537
FT                   /locus_tag="Pmen_0307"
FT   CDS_pept        314833..315537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0307"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; Helix-turn-helix, type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83081"
FT                   /db_xref="GOA:A4XP15"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP15"
FT                   /protein_id="ABP83081.1"
FT                   /translation="MHASAPRAVPEYALQAIRRLIEEEGYRPGDALPSQRDLAERLGVS
FT                   RASLREALSSLSALGLISVQAGKGVFVQQAPKAEAAGAFVWPFAAQVSAADTFQLRFAL
FT                   EGFACGLAAGMMTAEDLDSLEDNVEQMRLELRAGDFEQAARLDFEFHQRILAASGNQAM
FT                   FALVTSSADIFLESQKLPFIRPERAMETWQEHRRILKALARHAAGPAQKAMQQHIRAAA
FT                   LRTGIAFATLGD"
FT   gene            315647..315973
FT                   /locus_tag="Pmen_0308"
FT   CDS_pept        315647..315973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0308"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83082"
FT                   /db_xref="GOA:A4XP16"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP16"
FT                   /protein_id="ABP83082.1"
FT                   /translation="MSEFITNVSDASFDQDVIQAEGPVLVDYWAEWCGPCKMIAPVLDE
FT                   IAKDYQGKLKICKLNIDENQETPPKYGVRGIPTLMLFKNGNVEATKVGALSKSQLAAFL
FT                   DSNI"
FT   gene            316206..317465
FT                   /locus_tag="Pmen_0309"
FT   CDS_pept        316206..317465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0309"
FT                   /product="transcription termination factor Rho"
FT                   /note="TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; Rho termination factor domain protein; Rho
FT                   termination factor, RNA-binding; Ribonuclease B, OB region
FT                   N-terminal domain; SMART: AAA ATPase; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83083"
FT                   /db_xref="GOA:A4XP17"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP17"
FT                   /protein_id="ABP83083.1"
FT                   /translation="MNLTELKQKPIAELLDMAEQMGLENMARSRKQDIIFALLKKHAKS
FT                   GEEISGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTIVGKIRPP
FT                   KEGERYFALLKVDSINFDRPENAKNKILFENLTPLFPNKRLTMEAGNGSTEDITGRVID
FT                   LCAPIGKGQRGLIVAPPKAGKTIMLQNIASNITRNNPEVHLIVLLIDERPEEVTEMQRT
FT                   VRGEVVASTFDEPPTRHVQVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDAHALEKPKRFFGAARNIEEGGSLTILATALIETGSKMDEVIYEEFKGTGN
FT                   MELILDRRVAEKRTFPAININKSGTRREELLTGEEELSRMWILRKLLHPMDEIAAIEFL
FT                   IDKLKATKTNDEFFLSMKRK"
FT   gene            317715..319181
FT                   /locus_tag="Pmen_0310"
FT   CDS_pept        317715..319181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0310"
FT                   /product="3-octaprenyl-4hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83084"
FT                   /db_xref="GOA:A4XP18"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XP18"
FT                   /protein_id="ABP83084.1"
FT                   /translation="MQYRDLRDFIRELEKRGELKRIQTPVSPILEMTEICDRTLRKGGP
FT                   ALLFEKPTGFDVPVLGNLFGTPKRVALGMGAEDVAELREIGKLLAFLKEPEPPKGLKDA
FT                   WSKLPIFKKVISMAPKVVKDAPCHEVIEEGEDVDLNRLPIQHCWPGDVAPLITWGLTIT
FT                   KGPNKERQNLGIYRQQVIGRNKVIMRWLSHRGGALDYREWCQKYPDKPYPVCVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGHRTELIKAVGSDLQVPASAEIVLEGVIHPGETAP
FT                   EGPYGDHTGYYNEVDTFPVFTVERITRRREPIYHSTYTGRPPDEPAILGVALNEVFVPI
FT                   LQKQFPEITDFYLPPEGCSYRMAVVTMKKQYPGHAKRVMLGVWSFLRQFMYTKFVIVTD
FT                   DDINARDWNDVIWAITTRMDPKRDTVMIDNTPIDYLDFASPISGLGSKMGLDATHKWPG
FT                   ETSREWGRAIEKDPAVVARVDALWGELGID"
FT   gene            319181..320149
FT                   /locus_tag="Pmen_0311"
FT   CDS_pept        319181..320149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0311"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83085"
FT                   /db_xref="GOA:A4XP19"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP19"
FT                   /protein_id="ABP83085.1"
FT                   /translation="MNVTLQPSGVTLTLQPGERILDGARRLGYDCPQSCRNGNCHICAA
FT                   LLVEGRVRQNGAELDHGELFTCLAEPLEDCVLHWDGVLAPGELPVRELSCQLIECQDVG
FT                   GDVFRVRLRAPAGRVPRYHAGQYLLLQRHDGEMAAFSLASAPHSGRELELHILARDDNT
FT                   RALLAHLREQGLARVQLPFGDTHLAELPDGPLVLIAAGTGMAQMHSLIEHCRATGFAHP
FT                   VHLYWGARRADDFYALPHWTDWQRLGNLHLHQVVSDQRGWPGRCGLLHEAVREDFPDLK
FT                   ALHVYASGSPAMVYATLDALVEAGMDAHQMRADVFAYAPRP"
FT   gene            320439..320597
FT                   /locus_tag="Pmen_0312"
FT   CDS_pept        320439..320597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83086"
FT                   /db_xref="GOA:A4XP20"
FT                   /db_xref="InterPro:IPR021738"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP20"
FT                   /protein_id="ABP83086.1"
FT                   /translation="MGLGTILLIILILMLIGAIPAWPHSRSWGYGPTGGLGLVLVIVLV
FT                   LLLLGYI"
FT   gene            complement(320784..321764)
FT                   /locus_tag="Pmen_0313"
FT   CDS_pept        complement(320784..321764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0313"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83087"
FT                   /db_xref="GOA:A4XP21"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP21"
FT                   /protein_id="ABP83087.1"
FT                   /translation="MKALLCKAFGPAETLVLEDIASPEPKKNEVLIEVHAAGVNFPDTL
FT                   IIEGKYQFKPPFPFAPGGEAAGVVKAVGEKVSHLRTGDRVMALTGWGGFAEEVAVPAYN
FT                   VLPVPKSMDLTTAAAFGMTYGTSMHALKQRAGLKPGETLLVLGASGGVGLAAVEIGKAM
FT                   GARVIAAASTAEKLEVARKAGADELINYSEQSLKDEVKKLTGGQGVDVIYDPVGGALFE
FT                   EAFRSIAWNGRFLVVGFAAGGGIPALPANLPLLKGASLVGVFWGSFAQRQPQDNAENFQ
FT                   QLFAWHAEGKLSPLVSQTFPLERGGEAINALGQRKAVGKVVVQVR"
FT   gene            321914..322318
FT                   /locus_tag="Pmen_0314"
FT   CDS_pept        321914..322318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0314"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83088"
FT                   /db_xref="GOA:A4XP22"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP22"
FT                   /protein_id="ABP83088.1"
FT                   /translation="MRVLSALLLSLSLCLPALASSEKKEEVPQTLYYNLVPALIGNLAD
FT                   GGNRLKFFKADVALRVNGAEAEARIKHHDPLIRHQLVLLFSAQTSESINAPEGRENLRQ
FT                   EALKQVQQALTAEEGKPVVEDLLFNNLIIQ"
FT   sig_peptide     321914..321973
FT                   /locus_tag="Pmen_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 20"
FT   gene            complement(322382..323506)
FT                   /locus_tag="Pmen_0315"
FT   CDS_pept        complement(322382..323506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0315"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83089"
FT                   /db_xref="GOA:A4XP23"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP23"
FT                   /protein_id="ABP83089.1"
FT                   /translation="MESLGNIFHLGIKELRSLQHDLALVLLILWAFSMGVYSAATSIPE
FT                   SLHNAAIAVVDEDQSQLSERLIQAFQPPYFRTPERIDLSQMDQGMDSGRYTFTLNIPPN
FT                   YQRDVLAGRSPAIQLNVDATQVSMAFTGAGYIQNIGASEVAEFVRRYRGEAQQPAELVV
FT                   RVAFNPNLTRAWFGSVMEVINQITMLSIILTGAALIREREHGTVEHLLVMPVTPLQIML
FT                   AKVWSMGLVVLTAAALSLLLVVQGWLQVPIEGSLALFLAGAALHLFATTSMGIFFGTVA
FT                   RSMPQLGLLIILVLLPLQILSGGTTPRESMPELVQQIMLAAPTTHFVDLAQAILYRGAG
FT                   LAIVWPQLLTIAVIGTLFFLAALARFRKTLAQMA"
FT   sig_peptide     complement(323390..323506)
FT                   /locus_tag="Pmen_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.742) with cleavage site probability 0.356 at
FT                   residue 39"
FT   gene            complement(323506..326211)
FT                   /locus_tag="Pmen_0316"
FT   CDS_pept        complement(323506..326211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0316"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC-2 type
FT                   transporter; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83090"
FT                   /db_xref="GOA:A4XP24"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP24"
FT                   /protein_id="ABP83090.1"
FT                   /translation="MNAPVARLSGVGLRYGQTRALDAIELALPAQRMVGLIGPDGVGKS
FT                   SLLALIAGARKIQDGSVEVLGGDMATAHHRRNVCPHIAYMPQGLGKNLYPTLSVFENLD
FT                   FFGRLFGQDAAERERRIDDLLRSTGMAAFRERPAGKLSGGMKQKLGLCCALIHDPDLLI
FT                   LDEPTTGVDPLSRNQFWELIARIRTQRPQMSVLVATAYMEEAERFDHLVAMDAGRVLAE
FT                   GSPAELRTRTSSASLEQAFIALLPEERRRGHQQVVIPPLRDSNEIAIEAKGLTMRFGDF
FT                   IAVDAVSFRIRRGEIFGFLGSNGCGKSTTMKMLTGLLPASEGEALLFGQAVDPRDMATR
FT                   KRVGYMSQAFSLYGELTVRQNLVLHAQLFHVPTAEIEPRVAQMAVRFDLGEVMDMLPER
FT                   LPLGIRQRLSLAVAVIHKPEILILDEPTSGVDPVARDGFWQLMLDLSRQDGVTIFISTH
FT                   FMNEAQRCDRISLMHAGRVLDSDTPQGLMEKRGLDSLEATFIAYLQEAVGEQPVSEAPP
FT                   LEQAAQPQRQHFSLRRLLSYARREALELRRDPIRGGMALLGTVLLLFIIGYGISLDVED
FT                   LSFAVLDRDQTTTSQEYHRNLSGSRYFLEKAPLSNYDELERRLRNGDISLAVEIPPHFG
FT                   RDLKRGASPQIGMWIDGAMPTRAETIKGYVSGLHQHYLSELARRSPQPQAANAATLAVR
FT                   YRYNPDVESLKAMVPAVIPLLLMLIPAMLTALGVVREKELGSIINLYVTPVTRLEFLLG
FT                   KQLPYIGLGLFNCALLVLLAVTVFDVPLKGSPFTLALGVLLYLACATGLGLLMSTFTNS
FT                   QIAAVFGTAIATLVPAIQFSGLIYPVASLEGIGALVGQLYPTSQFLVISRGLFSKALEL
FT                   QDMLGYFAALLLTIPLLTLLSASLLRKQEV"
FT   gene            complement(326208..327272)
FT                   /locus_tag="Pmen_0317"
FT   CDS_pept        complement(326208..327272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0317"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83091"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP25"
FT                   /protein_id="ABP83091.1"
FT                   /translation="MKKPRHLPYLLAAGLAVLAALAWWQLRPDGLGEGFASGNGRIEAT
FT                   EVDVATKLAGRIASIEVDEGDFVEPGQILARMDTQALEAQLAQARAQLRQAENGQNTAA
FT                   SQIRLRESEKLSAEAMVRQRQAELDAARKRHARSATLVQRNAMAQQQLDDDLARLQSAE
FT                   AALAAARAQVSSAEAGIAAAQSQAIEAQSATEAARASVERLQVDIDDGLLRAPRAGRVQ
FT                   YRVTQPGEVLGAGGKLLNLVDLTDVYMTFFLPERQAGRVALGSEVRLVIDAAPQYVIPA
FT                   RVSYVASVAQFTPKTVETANEREKLMFRVKARIDPELLSRHLQQVKTGVPGMAYLRLDP
FT                   DAEWPAHLAIKVPQ"
FT   sig_peptide     complement(327204..327272)
FT                   /locus_tag="Pmen_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 23"
FT   gene            complement(327366..329204)
FT                   /locus_tag="Pmen_0318"
FT   CDS_pept        complement(327366..329204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0318"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83092"
FT                   /db_xref="GOA:A4XP26"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP26"
FT                   /protein_id="ABP83092.1"
FT                   /translation="MPASSAWPARLALAFLLLVLSGASVLLWRQIEGVQQQRLDERLGY
FT                   QARTLARQLESTLYLEVDGLERIARLWNRLGRLPRDSWEEEAQRTLAGFPAYQSIQWLG
FT                   EDLRMRWLLPLAGNEAALSFRLTPDHPNYALAMEARATGEQRFSNSFQLVQGGRGFVLY
FT                   TPLYREQDGVRVFDGFLQGVFRVEPLMQQLLAQLDPGSFNVELLEDGQRLFRHGAVEQA
FT                   PQRSLQLPLSLLNNQAFSLRLSPTQELLEQLHSPLPGVVLGASLAISLLLVAALALALE
FT                   NSRRAQALQAANRRYKIEETRRQETEQRLHESRERLQLVLDLTDSSHDGLFIFDTTSRE
FT                   LLHMNQATYASLGYRPEQFAQLLRNDPEKLLPGFHRWLEQARQAQRDNLSRIFQRELIR
FT                   RDGSRQPAEINTQLVQLHGREFLIAVSRDNSERLQLEAQLQRLSQLDGLTGLYNRRYFD
FT                   QQLPAELRRLRRSGAPLALLMLDIDHFKAYNDALGHLAGDDALRKVSSVLRESLQREGD
FT                   VACRYGGEEFAIILANTGLDGGEHVAARIHEAIASLAIVHPASPLGRLSLSIGLTVLDP
FT                   VSDEQPGELVSRSDQALYSAKHRGRNCTYLWQPPAA"
FT   sig_peptide     complement(329121..329204)
FT                   /locus_tag="Pmen_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.292 at
FT                   residue 28"
FT   gene            complement(329256..329705)
FT                   /locus_tag="Pmen_0319"
FT   CDS_pept        complement(329256..329705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0319"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83093"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP27"
FT                   /protein_id="ABP83093.1"
FT                   /translation="MPYWLMKSEPDELSIHDLQRLGKARWDGVRNYQARNFLRAMRPGD
FT                   QFFFYHSSCPQPGIAGIGRIAGETYPDPTALDPHSHYHDPKASAEKNPWSALDVEFVEA
FT                   FAEVLPLQQLKNNPLLADLALVQRGSRLSVMPVSEAEWAAILAMR"
FT   gene            329899..330030
FT                   /locus_tag="Pmen_0320"
FT   CDS_pept        329899..330030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83094"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP28"
FT                   /protein_id="ABP83094.1"
FT                   /translation="MKRKPDLLWVLVILFSLGVVTTGYTQSLWERQSDASVNVTQQP"
FT   sig_peptide     329899..329976
FT                   /locus_tag="Pmen_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.341 at
FT                   residue 26"
FT   gene            complement(330083..330679)
FT                   /locus_tag="Pmen_0321"
FT   CDS_pept        complement(330083..330679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0321"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83095"
FT                   /db_xref="GOA:A4XP29"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP29"
FT                   /protein_id="ABP83095.1"
FT                   /translation="MTTSSALSRPQLRRLLRQRRRALSASQQRLAARNLYRQLAQSPAF
FT                   RRARHIALYLPNDGEIDPRPLLAAAQKRGKHTYLPVLSAWPSTKMVFQRFTRHEKLARN
FT                   RFRILEPRPQPKRQRKVWALDLVLLPLVGFDDRGGRLGMGGGFYDRSLAYLHRRKNWHM
FT                   PTLLGLAHECQRVDELALASWDVPLQATVTDKAWY"
FT   gene            complement(330980..331285)
FT                   /locus_tag="Pmen_0322"
FT   CDS_pept        complement(330980..331285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0322"
FT                   /product="cell division protein ZapA"
FT                   /note="PFAM: protein of unknown function DUF710"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83096"
FT                   /db_xref="GOA:A4XP30"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP30"
FT                   /protein_id="ABP83096.1"
FT                   /translation="MTQSNTVTVHILDKEYCIACPQDERANLESAARYLDGKMREIRTS
FT                   GKVIGADRVAVMAALNITHDLLHKQQRLDQDASSTRQQVRDLLDRVDQALADDQAS"
FT   gene            complement(331282..331491)
FT                   /locus_tag="Pmen_0323"
FT   CDS_pept        complement(331282..331491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83097"
FT                   /db_xref="InterPro:IPR012662"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP31"
FT                   /protein_id="ABP83097.1"
FT                   /translation="MEDADLHVLTAKLELLIQRVEQLKAHNRLLLANEQAWREERAHLI
FT                   EKNELARHKVESMISRLKALEQDT"
FT   gene            331682..332236
FT                   /locus_tag="Pmen_0324"
FT   CDS_pept        331682..332236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0324"
FT                   /product="protein of unknown function UPF0149"
FT                   /note="PFAM: protein of unknown function UPF0149"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83098"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XP32"
FT                   /protein_id="ABP83098.1"
FT                   /translation="MSTSSSPYAAFAALLSSAGHSVSPAELHGLLLGRSCAGAGFDADA
FT                   WLLDAADLLGGEPQDSVRQALIGLQEMVKGELCSEDMAVVLLLPDDETPLAQRAVALGQ
FT                   WCQGFLGGFGLTARDGALSAEAMEVLQDLSAIAQVQSALEESEDGENDYMEVMEYLRVA
FT                   PLLLFTECAKPAAPAAKPSLH"
FT   sig_peptide     331682..331747
FT                   /locus_tag="Pmen_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.916 at
FT                   residue 22"
FT   gene            332255..333589
FT                   /locus_tag="Pmen_0325"
FT   CDS_pept        332255..333589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0325"
FT                   /product="aminopeptidase P, Metallo peptidase, MEROPS
FT                   family M24B"
FT                   /EC_number="3.4.11.9"
FT                   /note="PFAM: peptidase M24; peptidase M24B, X-Pro
FT                   dipeptidase/aminopeptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83099"
FT                   /db_xref="GOA:A4XP33"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP33"
FT                   /protein_id="ABP83099.1"
FT                   /translation="MISIPKSEYARRRKALMAQMEPNSIAILPAAPVYIRNRDVEHVYR
FT                   QDSDFQYLTGFPEPEAVMALIPGREHGEYVLFCRERDPERELWDGLRAGQDGAIATYGA
FT                   DDAFPIGDIDDILPGLIEGRERVYYAIGCNQEFDHRLMEWINHIRAKARQGASPPNEFV
FT                   ALDHLLHDMRLYKSAAEVKVMREAAEISARAHVRAMHASRAGLSEYHLEAELDYEFRKG
FT                   GAKMPAYGSIVAAGRNACILHYRENDAPLRDGDLVLIDAGCEIDCYASDITRTFPVNGK
FT                   FSAEQKAIYELVLAAQEAAFKEIAPGKHWNEAHEATVRVITKGLVELGLLSGEVDELIA
FT                   SEAYKAFYMHRAGHWLGMDVHDVGDYKVGGEWRVLEPGMAMTVEPGIYIAVDNDKVAKK
FT                   WRGIGVRIEDDVVVTRTGCEILTGGVPKTVAEIEALMAAARAQAA"
FT   gene            333594..334778
FT                   /locus_tag="Pmen_0326"
FT   CDS_pept        333594..334778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0326"
FT                   /product="2-octaprenyl-6-methoxyphenol hydroxylase /
FT                   2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; 2-polyprenyl-6-methoxyphenol
FT                   4-hydroxylase; PFAM: monooxygenase, FAD-binding; FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83100"
FT                   /db_xref="GOA:A4XP34"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP34"
FT                   /protein_id="ABP83100.1"
FT                   /translation="MSRVQLAIIGGGLVGASLALALQETARQRGWRIALIEPFAPGSDY
FT                   QPSYDARSTALSYGSRLIYERLGVWQAIAQRAEAIQQIHVSDRGRFGATRLLAMEEGVP
FT                   ALGYVVENAWIGHCLWQALDAEVVQWHCPAEVASLQRLDDGYRLNLSDERQLDCDLAVL
FT                   ADGGRSGLREQLGIGVSHRPYGQSAVIANVTPLEAHRGQAFERFTDEGPMALLPLEGNR
FT                   CALVWTRASADAERLLKLGDAAFLAELQQAFGYRLGALQQVGVRHLYPLALSEASEQVR
FT                   PHLVVLGNAAHSLHPIAGQGYNLSLRDTLALAEVLQDGSAPLGDFATLQRYLQRQQLDQ
FT                   QLTVGFSDRVTRLFSNAQPLLTAGRNLGLLGLDLLPPAKRWFARQAMGMGTRSL"
FT   sig_peptide     333594..333659
FT                   /locus_tag="Pmen_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.978 at
FT                   residue 22"
FT   gene            334881..336104
FT                   /locus_tag="Pmen_0327"
FT   CDS_pept        334881..336104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0327"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83101"
FT                   /db_xref="GOA:A4XP35"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP35"
FT                   /protein_id="ABP83101.1"
FT                   /translation="MDMRADLIIVGAGMVGSTLALALEHSGLEILIVDGSPLSVSPFAA
FT                   QAPFEPRVSALSMASQRILERLGAWPGISARRACPYGEMRVWDGSGTGSIHFAAASVHA
FT                   ETLGHIVENRVVQDALLERLHDSQIGLLPGARLEQLRRSGDDWLLTLEGGRQLRAPLLV
FT                   AADGGNSAVRRLAGCATREWDYLHHAIVTSVRCERPHQATAWQRFTDDGPLAFLPLAGS
FT                   AGEHWCSIVWSTVPVEAERLMALGDEAFCAELGRAFENRLGKVLHADRRLCIPLRQRHA
FT                   KRYVEPGLALIGDAAHTIHPLAGQGVNLGFLDAAVLAEVLLHAAARGENLAEERVLSRF
FT                   ERRRMPHNLAMMAAMEGFQRLFQADPLPLRLLRNVGLDLVDGQAEAKALFVRQALGLSG
FT                   DLPELAKA"
FT   sig_peptide     334881..334949
FT                   /locus_tag="Pmen_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.640) with cleavage site probability 0.609 at
FT                   residue 23"
FT   gene            336144..336440
FT                   /locus_tag="Pmen_0328"
FT   CDS_pept        336144..336440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83102"
FT                   /db_xref="GOA:A4XP36"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP36"
FT                   /protein_id="ABP83102.1"
FT                   /translation="MKHLLQCLLVAALSLSAGCGTMAGRGGTAEPMPVETYKSVNGDLH
FT                   LLGLRPGPSGSGNAGPVMCLISIVCPLLVVVSLPVDAVIDTLLLPADLLAARE"
FT   sig_peptide     336144..336233
FT                   /locus_tag="Pmen_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.370 at
FT                   residue 30"
FT   gene            336548..337550
FT                   /pseudo
FT                   /locus_tag="Pmen_0329"
FT   gene            337706..339322
FT                   /locus_tag="Pmen_0330"
FT   CDS_pept        337706..339322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0330"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83103"
FT                   /db_xref="GOA:A4XP37"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP37"
FT                   /protein_id="ABP83103.1"
FT                   /translation="MPHPVQRRWYPIVFAIALLVLMPLSVLLLSWHEVDAKIWTHLWQT
FT                   QMARLIGNTLTLVLGVGVGVTLLGVSLAWLTSLCEFPGRRWLDWALMLPFAIPAYVLAF
FT                   VFVGLLDFAGPVQTLLREWLGSDFRLPRVRSTGGVIIVLVLVFYPYVYLLARGAFLAQG
FT                   KGLMEAARVLGQSPWQAFWRVALPMARPAIGAGLALAIMETLADFGAVAVFNFDTFTTA
FT                   IYKTWYSFYSLTSATQLASLLLLAVALVLYGERRARGAARPANERPRGKALYHLHGWKA
FT                   FAASAWCGLVFACAFLIPVLQLLLWFWQRGRFDLDERYAGLILHTLYLGGMAALITVSV
FT                   AMLLAFARRQAPTRGVRLGVALGNLGYALPGSVLAVAIMLAFSFLDRELVIPLSSALGG
FT                   AGKPLLLGSLTALLLAYLIRFMAVAFGPLETSLARIRPSLPEASRSLGVGGIGLFFKVY
FT                   LPLLLPGTLSAALLVFVDVLKEMPATLLMRPFGWDTLSVRVFEMTSEGEWARASLPALT
FT                   LVLVGLLPVILLIRRSARGIG"
FT   gene            339634..340731
FT                   /locus_tag="Pmen_0331"
FT   CDS_pept        339634..340731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0331"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein, C-terminal barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83104"
FT                   /db_xref="GOA:A4XP38"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP38"
FT                   /protein_id="ABP83104.1"
FT                   /translation="MGQRTPLYDLHLALGAKMVDFGGWDMPLHYGSQVEEHHQVRRECG
FT                   VFDVSHMCVVDVTGSQAQAFLQRLLANDVARLDSAGKALYSAMLNEQGGVIDDLIVYLT
FT                   GSSAQEQSYRLVVNAGTRDKDLAWMHAQAGDFDVQLRERRDLAMLAIQGPKARARVAEL
FT                   LTQARAALIHELRPFQGLAEGDWFIARTGYTGEDGLEIVLPVAEVVPLLNELVGAGIAP
FT                   IGLGARDTLRLEAGMNLYGQDMDESVSPLAANMAWTIAWEPAARAFIGRAALEAQRAAG
FT                   CPSKLVGLVLEERGVLRAHQVVRVEGIGEGEITSGSFSPTLNKSIALARVPTATGERAE
FT                   VEIRGKWYPVRVVRPSFVRNGKTLI"
FT   gene            340826..341215
FT                   /locus_tag="Pmen_0332"
FT   CDS_pept        340826..341215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0332"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83105"
FT                   /db_xref="GOA:A4XP39"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP39"
FT                   /protein_id="ABP83105.1"
FT                   /translation="MSNIPADLRYAASHEWARLEADGSVTVGISDHAQEALGDVVFIEL
FT                   PEVGKQLDAGQEAGVVESVKAASDIYAPVGGEVIAINEALVDSPESVNSDPYGSWFFKL
FT                   KPSDASELDKLLDASAYQAAADADA"
FT   gene            341362..341676
FT                   /locus_tag="Pmen_0333"
FT   CDS_pept        341362..341676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0333"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83106"
FT                   /db_xref="GOA:A4XP40"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP40"
FT                   /protein_id="ABP83106.1"
FT                   /translation="MDEPIGIQQLRANADAAGQLLKALANPDRLLLLCQLSQGERNVSE
FT                   LETLLGIQQPTLSQQLAVLRREGLVETRRDGKQIFYRISSPAALAVIETLYRLFCEGRQ
FT                   "
FT   gene            341673..342107
FT                   /locus_tag="Pmen_0334"
FT   CDS_pept        341673..342107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0334"
FT                   /product="protein of unknown function DUF395, YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395, YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83107"
FT                   /db_xref="GOA:A4XP41"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP41"
FT                   /protein_id="ABP83107.1"
FT                   /translation="MSIDWAAFTPWSALAGGALIGLAAALFALVNGRVAGISGLLGSLL
FT                   QPQSEGRGEKMAFLLGLLLAPLLWATFAALPPVHFGTGSLGLIAAGLLVGIGTRYGSGC
FT                   TSGHGVCGVSRLSPRSLVATLCFMAAGFATVFALRHLLRG"
FT   sig_peptide     341673..341759
FT                   /locus_tag="Pmen_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.594 at
FT                   residue 29"
FT   gene            342110..342529
FT                   /locus_tag="Pmen_0335"
FT   CDS_pept        342110..342529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0335"
FT                   /product="protein of unknown function DUF395, YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395, YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83108"
FT                   /db_xref="GOA:A4XP42"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP42"
FT                   /protein_id="ABP83108.1"
FT                   /translation="MARLSALACGVLFGLGLLLAGMADPAKVLAFLDLAGDWDPSLALV
FT                   MAGAVGVAALPLNLAPRRARALLGGAMQLPTRRDLDARLITGSLLFGVGWGIAGICPGP
FT                   ALAILLTGHWQAALFVAAMLAGMLIFTALEGRRGR"
FT   sig_peptide     342110..342181
FT                   /locus_tag="Pmen_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.835 at
FT                   residue 24"
FT   gene            342544..342732
FT                   /locus_tag="Pmen_0336"
FT   CDS_pept        342544..342732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83109"
FT                   /db_xref="GOA:A4XP43"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP43"
FT                   /protein_id="ABP83109.1"
FT                   /translation="MKANVGTLDRSLRIAAGLILIALSLAGVIGLWGWIGVVPLATGVF
FT                   RFCPAYPLLGINTCKVK"
FT   sig_peptide     342544..342624
FT                   /locus_tag="Pmen_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.602) with cleavage site probability 0.285 at
FT                   residue 27"
FT   gene            complement(342811..343917)
FT                   /locus_tag="Pmen_0337"
FT   CDS_pept        complement(342811..343917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0337"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="PFAM: Porphyromonas-type peptidyl-arginine
FT                   deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83110"
FT                   /db_xref="GOA:A4XP44"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XP44"
FT                   /protein_id="ABP83110.1"
FT                   /translation="MTTLTTTPRADGFHMPAEWAPHSQTWMVWPERPDNWRNGGKPAQA
FT                   AFTAVAKAIAQFEPVTVCVSAAQYENARARLDDDNIRLVEITTDDAWVRDTGPTFVING
FT                   RGEVRGVDWTFNAWGGFDGGLYWPWQRDDQVARKILDIEGCKRYRTEGFVLEGGSIHVD
FT                   GEGTLITTEECLLNRNRNPHLSREEIEAVLREHLAIDTVIWLPEGLYNDETDGHVDNFC
FT                   CYVRPGEVLLAWTDDQNDPNYPRCQAAMRVLESVRDAKGRQLIVHKMPIPGPIHASEEE
FT                   CAGVDAAEGSQERSPAVRLAGSYVNFLIVNGGIVAPSFDDPKDAEARAILQQVFPEHRV
FT                   VMVPGREILLGGGNIHCITQQQPAPQGA"
FT   gene            complement(343987..344871)
FT                   /locus_tag="Pmen_0338"
FT   CDS_pept        complement(343987..344871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0338"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83111"
FT                   /db_xref="GOA:A4XP45"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP45"
FT                   /protein_id="ABP83111.1"
FT                   /translation="MSRIVTVAATQMACSWDTAANIANAERLVRQAAAQGAQIILIQEL
FT                   FETPYFCQKPNADFTQLATTAEENPAILHFRKVAAELKVVLPISFFERAGRARFNSIAI
FT                   IDADGSNLGIYRKSHIPDGPGYHEKYYFNPGDTGFKVWDTAYARIGVGICWDQWFPECA
FT                   RSMALMGAEILFYPTAIGSEPHDPTISSRDHWQRVQQGHAGANLMPLVASNRIGREEQD
FT                   GYDITFYGSSFIANQFGEKVEELGQSEEGVLVHRFDLTALEKVRTAWGVFRDRRPNLYW
FT                   PLSTLDGETPSTP"
FT   gene            complement(345135..345776)
FT                   /locus_tag="Pmen_0339"
FT   CDS_pept        complement(345135..345776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0339"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83112"
FT                   /db_xref="GOA:A4XP46"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP46"
FT                   /protein_id="ABP83112.1"
FT                   /translation="MSRPASPRKPRASSQARIAQILAAARELLAEQGMANLSIYTVAEH
FT                   AGIPPSSVYHFFASVPALLEGLTSDVHAAFRACLLEPVDHGGLHSWHDLSRIVEQRMLA
FT                   VYAADAAARQLILAQHGLAEVTQADHQHDIELSRLMQALFDRHFPLPQLPVDIDVFALA
FT                   MELGDRVYARSVQLHGEIIPRLAAEGMRVFDAYLGLYLPAALPKRATPLT"
FT   gene            complement(345848..346906)
FT                   /locus_tag="Pmen_0340"
FT   CDS_pept        complement(345848..346906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0340"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83113"
FT                   /db_xref="GOA:A4XP47"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP47"
FT                   /protein_id="ABP83113.1"
FT                   /translation="MQRALAAALLGLTCALAQAADSIRVYNWNDYIAPQVLNDFTRDTG
FT                   IAVEYHTFASAEELNAALHSGEAIDVAVPSHNDLPALIADARIQPLDLARLPNRQHLDK
FT                   QLLSKLAAVDPQNGYAVPYLWGAVGLAINTPQAEAAYGGALPGSWSLLFDAEQSARLAK
FT                   CGISVLDAPDETLSLLLNYQGRSLARSAPSRVERAGSVLEALRPHLRYIDSERYIDDLS
FT                   NGRLCLAMAWVGDALAAAQAGQPVSFVVPQEGSVLFIDNLVIPASAARPDLAHRFIDYL
FT                   MQPQVIARITAETLYPNGNADSVQFIDSALLQQPGLYPDQDTKRRLYPLEVLSDKHAQV
FT                   RSQVWQRFRDGS"
FT   sig_peptide     complement(346847..346906)
FT                   /locus_tag="Pmen_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(347083..348462)
FT                   /locus_tag="Pmen_0341"
FT   CDS_pept        complement(347083..348462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0341"
FT                   /product="glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83114"
FT                   /db_xref="GOA:A4XP48"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP48"
FT                   /protein_id="ABP83114.1"
FT                   /translation="MSVPPRAVQLNEANAFLKEHPEVQFVDLLIADMNGVVRGKRIDRN
FT                   ALHKVYEKGINLPASLFALDINGSTVESTGLGLDIGDADRICFPIPNTLCNEPWQKRPT
FT                   AQLLMTMHELDGTPFFADPREVLRQVVQKFDELGLRICAAFELEFYLIDQENVNGRPQP
FT                   PRSPISGKRPHSTQVYLIDDLDEYVDCLQDMLEAAKEQDIPADAIVKESAPAQFEVNLH
FT                   HVEDAIKACDYALLLKRLIKNIAYDHEMDSTFMAKPYPGQAGNGLHVHISLLDKKTGKN
FT                   IFAADNPLENTSLRHAVGGILDTMAASMAFLCPNVNSYRRFGAQFYVPNAPSWALDNRT
FT                   VAVRVPTGSPDAVRIEHRVAGADANPYLMLASILAGIHHGLTNQIEPGEPIEGNAYEQL
FT                   EPSLPNNLRDALRELDDSEVLNKYIDPKYIDIFVACKEAELQEFETTISDLEYNWYLHT
FT                   V"
FT   gene            349220..350578
FT                   /locus_tag="Pmen_0342"
FT   CDS_pept        349220..350578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0342"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83115"
FT                   /db_xref="GOA:A4XP49"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP49"
FT                   /protein_id="ABP83115.1"
FT                   /translation="MSTKLDQLTSWLKERKITEVECLISDLTGIARGKISPTNKFLDEK
FT                   GMRLPESVLLQTVTGDYVEDDIYYELLDEADIDMFCRPDENAVFLVPWAIEPTAMVIHD
FT                   TFDKQGNPIELSPRNILKTVLKLYADKGWRPIVAPEMEFYLTKRNSDPDFPLVAPMGRS
FT                   GRPEVGRQSFSIDAANEFDPLFEDVYDWCELQGLDLDTLIHEDGPAQMEINFRHGDALH
FT                   LADQITVFKRTMREAALKHDVAATFMAKPITDEPGSAMHIHQSVVDIKTGKNIFSNEDG
FT                   TMSELFLQHIGGLQKYIPELLPLFAPNVNSFRRFLPDTSAPVNVEWGEENRTVGLRVPE
FT                   AGPQNRRVENRLAGADANPYLVLAASLLCGYIGMVEGIKPSAPVKGRGYERRNLRLPLT
FT                   IEAALERMEACKAAEKYLGEKFMRGYVAVKRAEHENFKRVISSWEREFLLLSV"
FT   gene            350662..352035
FT                   /locus_tag="Pmen_0343"
FT   CDS_pept        350662..352035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0343"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83116"
FT                   /db_xref="GOA:A4XP50"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP50"
FT                   /protein_id="ABP83116.1"
FT                   /translation="MNKQANNPQTAHWQALSQAHHLAPFSDYKQLAEKGPRIITEAKGV
FT                   HLWDSEGNKILDGMAGLWCVAVGYGREELVEAAATQMRQLPFYNTFFQTAHPPVLELAH
FT                   AISQLAPAGMNHVFFTGSGSEGNDTMLRLVRHYWACKGKASKKIIIGRENGYHGSTVAG
FT                   ASLGGMKFMHEQGDLPIPGIAHIPQPYWFGEGGDQSPEEFGIWAADQLEKKILELGEEN
FT                   VAAFIAEPIQGAGGVIIPPETYWPRIKEILAKYDILFVADEVICGFGRTGEWFGSQYYD
FT                   LKPDLMTIAKGLTSGYVPMGGLIVSDKVFEVIEAHGDFNHGFTYSGHPVAAAVGLENLR
FT                   LLREEGIVERVKAETAPYLQQRLRELADHPLVGEVRGLGMLGAIELVQDKATRKRYPDT
FT                   VAAGMVCRGHCFNNGLIMRAVGDTMIIAPPLVISRAEIDELVEKARKCLDLTLRDLSV"
FT   gene            352167..353264
FT                   /locus_tag="Pmen_0344"
FT   CDS_pept        352167..353264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0344"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83117"
FT                   /db_xref="GOA:A4XP51"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP51"
FT                   /protein_id="ABP83117.1"
FT                   /translation="MKTFGKTLLALSLTAAVAGAAQADSKVLHVYNWSDYIAEDTLANF
FT                   EKETGIKVVYDVFDSNEVLEAKLLAGSSGYDVVVPSNPFLAKQIKAGVFQKLDKSKLPN
FT                   WSNLDQDLLKALDPSDPGNQYSIPYMWGTIGIGYNVDKVKAVLGDDAPVDSWDLVFKPE
FT                   NMEKLKSCGVSFLDSPTEILPAALHYLGYAPDSSKADELKKAEELFLSIRPSVAYFHSS
FT                   KYISDLANGNICVAIGYSGDIYQSKARAEEAKNGVNVGYNIPKEGAGSFFDMLAVPADA
FT                   KNVEAAHVFLNYLMEPAVMANITNYVQFPNGNAAATPLVDEALRTDPGVYPTPEVLKKI
FT                   YTFPDLAPAVQRNMTRSWTKIKSGR"
FT   sig_peptide     352167..352238
FT                   /locus_tag="Pmen_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 24"
FT   gene            353332..354426
FT                   /locus_tag="Pmen_0345"
FT   CDS_pept        353332..354426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0345"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83118"
FT                   /db_xref="GOA:A4XP52"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP52"
FT                   /protein_id="ABP83118.1"
FT                   /translation="MRRSILLAGLVAAAIGMSAAQAANRVVKVYNWSDYIAPDTIAEFE
FT                   KETGIKVVYDVFDSNETLDGKLATGQSGYDVVVPTNHYLAKQVRAGTYLKLDKSKLPNL
FT                   VNLDPTIMQNLAAGDPGNEYSVPYLWGTNGIGLNATKARAVLGEDAPLDSWALLFEPQY
FT                   AEKLAKCGIALLDSGDEVLPQTVNYLGLSPHTTKREDYDKAFEQMMKVRPYITYFHSSK
FT                   FISDLANGEICAAFGYSGDVLQAADRAEEAGRSDEIIYIIPKEGTAMWADLLAIPKDAK
FT                   NVDEAHAFINYLLRPDVIAKISNYVAYANPNLKATELVDEGVRENPGVYPSAEVMAKLY
FT                   VAEERTPEVQRWLTRDWTRIKSGR"
FT   sig_peptide     353332..353400
FT                   /locus_tag="Pmen_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 23"
FT   gene            354494..355585
FT                   /locus_tag="Pmen_0346"
FT   CDS_pept        354494..355585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0346"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83119"
FT                   /db_xref="GOA:A4XP53"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP53"
FT                   /protein_id="ABP83119.1"
FT                   /translation="MRVTLPKSLIALAASAVCGVALAQPKVHIYNWSDYIGEETLAKFE
FT                   AQTGIKPIYDVFDSNETLEGKLLAGRSGYDVVVPSNHFLGKQIRAGAFQPLDRAKLPNW
FT                   DNLDQALLKQLETNDPGNQYSVPYLWGTNGIGYNVEKIKAVLGVEEIDSWAVLFEAENI
FT                   KKLSQCGVAFLDSADEMIPAMLNYLGLDPNSTNPDDYAKAEAKLLEVRPYVTYFHSSKY
FT                   IGDLANGNICVAAGFSGDILQAADRAEEAGKGIEIAYAIPKEGANLWFDMLAIPADAAN
FT                   VEQAHAFINFLLDPQVIADVSNYVGYANPNTKAGELMDQDVRNDPSVYPPQAVLDKLYI
FT                   SAELPVRVQRLMTRAWTKVKSGQ"
FT   sig_peptide     354494..354565
FT                   /locus_tag="Pmen_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            355639..356793
FT                   /locus_tag="Pmen_0347"
FT   CDS_pept        355639..356793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0347"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83120"
FT                   /db_xref="GOA:A4XP54"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP54"
FT                   /protein_id="ABP83120.1"
FT                   /translation="MAVASSAYKKALEGNQTPKEVLVKIDRVTKKFDETVAVDDVSLTI
FT                   NKGEIFALLGGSGSGKSTLLRMLAGFERPTEGRIILDGVDITDMPPYQRPINMMFQSYA
FT                   LFPHMTVAQNIAFGLKQDKLPQAEIDERVAEMLKLVHMTQYAKRKPHQLSGGQRQRVAL
FT                   ARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCVMVTHDQEEAMTMAQR
FT                   IAIMHLGWIAQTGSPVDIYETPTSRLVCEFIGNVNLFDGQIVSDEADHAIIDCPQLDKP
FT                   IYIGHGVSTRAEDKKVSYALRPEKLLMATALPADHEHPEYNWSRGHVHDIAYLGGHSVY
FT                   HVKLSSGQIVQCFIANAERRGKRPTWDDPVVVYWEDDSGVVLQS"
FT   gene            356790..357698
FT                   /locus_tag="Pmen_0348"
FT   CDS_pept        356790..357698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0348"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83121"
FT                   /db_xref="GOA:A4XP55"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP55"
FT                   /protein_id="ABP83121.1"
FT                   /translation="MKPSKLARYLPSGRHAVIGIPFLWLFLFFLLPFVIVLKISFAEAD
FT                   VAIPPYTEIYQWADNKLTLLLNFGNYIFLTEDALYVSAYLGSLQVAFFSTLLCLVIGYP
FT                   MAYAIARAPKERQTVLLLLIMMPTWTAILIRVYAWMGILGNNGLLNSLLMGIGLIDTPL
FT                   QILNTNTAVYIGVVYSYLPFMILPLYANLVKHDPSLLEAASDLGSSNFNNFWRITVPLS
FT                   KNGIIAGSMLVFIPVVGEFVIPELLGGPETLMIGKVLWQEFFNNRDWPVASALAVVMLA
FT                   ILIVPIILFNRNQAKELEGRP"
FT   gene            357695..358582
FT                   /locus_tag="Pmen_0349"
FT   CDS_pept        357695..358582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0349"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83122"
FT                   /db_xref="GOA:A4XP56"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP56"
FT                   /protein_id="ABP83122.1"
FT                   /translation="MKRFSFSSIMLWAGLVFIYLPMVILVIYSFNASRLVTVWGGWSVK
FT                   WYVGLLDNTQLMNSVMRSLEIACYTAIAAVALGTLAAFVLTRITRFKGRTLFGGLVTAP
FT                   LVMPEVITGLSLLLLFVLMAQLIGWPAQRGMTTIWIAHTTFCSAYVAVVVSSRLRELDM
FT                   SIEEAAMDLGAKPWKVFFLITVPMIAPSLAAGAMMSFALSLDDLVLASFVSGPGSTTLP
FT                   MEIFSAVRLGVKPEINAVASLILLAVSFATFLAWFFAHRAEEKRKKALQQAMDETTSPS
FT                   WQQVVDSRRSASSN"
FT   gene            complement(358663..360027)
FT                   /locus_tag="Pmen_0350"
FT   CDS_pept        complement(358663..360027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0350"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83123"
FT                   /db_xref="GOA:A4XP57"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP57"
FT                   /protein_id="ABP83123.1"
FT                   /translation="MVKETEIKLRASRATLAALREHPLLKKRNKSGWQHTPLFNQYYDT
FT                   PDRDLASAKVALRLRRDGEQFIQTLKSRGQSVAGLSERNEWDWYLSKAKLDLKKLDDSC
FT                   WPASLAELDKKALQPLFSTDFVREKAEIAWGRGKAKVVIEAALDLGKVSAGEGEEEICE
FT                   LELELRQGEPAALLELACELAAELPLMPCDISKAERGYRLFDAGSYSLSLPAPQLTAEM
FT                   PLDEAFAALAWHLLGTSQRLAEQYRFNGHWSLLQDWLAQLIELRALLASLGQAAPRASS
FT                   RELREQLDALLADWRPRLAAGQDDGSMRRNAPALFAAELDGCRWGLLSLKLSLWLLQRG
FT                   WTVERNNRGNRQGSAALGNWLPTLLAEEGAALQLRRYQQQPEDLAEQMPRLERLLVWLR
FT                   LARGVLEVPEVDRLYGELNKLYGLAQQELDDEQRQVRATQTQIVNSLKAWKALVK"
FT   gene            360139..360816
FT                   /locus_tag="Pmen_0351"
FT   CDS_pept        360139..360816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0351"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83124"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP58"
FT                   /protein_id="ABP83124.1"
FT                   /translation="MPINPFVSLFGRSPIGPMQQHIAKAHECAANLVPFFEAVMAEDWA
FT                   TVEQVQQEMSRLEHEADKLKKSVRLHLPKSLFLPVPRSDLLELLSVQDKVANRAKDIAG
FT                   LMLGRQMAIPQALQPLMRTYVQRSVDASAQALKAMNELDELLETGFAGREAVLVETLIE
FT                   ELGSIENDTDRLQIEVRRNLFKLEKDLPPVDVMFLYQIIDWVGDVADRAQRVGNRLEQL
FT                   LAR"
FT   gene            360855..362126
FT                   /locus_tag="Pmen_0352"
FT   CDS_pept        360855..362126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0352"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83125"
FT                   /db_xref="GOA:A4XP59"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP59"
FT                   /protein_id="ABP83125.1"
FT                   /translation="MSLIADYGLVLLVLACLFGFFMAWGVGANDVANAMGTSVGSRALT
FT                   IKQAIIIAMVFEFAGAYLAGGEVTETIKNGIVDANLISPNLMVLGMMSALLAAGTWLLV
FT                   ASTRGWPVSTTHTIVGAVIGFAAVGVSMDAVHWGGVGPIVASWVVTPLLAGIISFCLFV
FT                   SVQKLIIDTDNPFLNAKRYVPLYMFITGFVISLMTLTKGLKHVGLNLSSTEGFLLSVAI
FT                   GVLVMLIGIAMLSRIHVDVEADKAFHFSSVEKVFAILMIFTACSMAFAHGSNDVANAVG
FT                   PLAAIVGVIQSGGELAAGAKSLVPGWILLLGALGIVVGLATYGYKVIATIGKEITELTP
FT                   SRGFAAELAAATTVVSASGLGLPVSTTHTLVGAILGVGLARGIGALNLGMIGKIFLSWI
FT                   ITLPAGAILSIIFFFILRALFGGV"
FT   sig_peptide     360855..360941
FT                   /locus_tag="Pmen_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.698 at
FT                   residue 29"
FT   gene            362194..363360
FT                   /locus_tag="Pmen_0353"
FT   CDS_pept        362194..363360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0353"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83126"
FT                   /db_xref="GOA:A4XP60"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP60"
FT                   /protein_id="ABP83126.1"
FT                   /translation="MPLPSFREQFAALIAAPSVSCTQPSWDQSNAPVIELLAAWLGDLG
FT                   FACETQQIAPGKFNLLASYGSGPGGLVLAGHSDTVPFDAALWQSDPLKLTEVGDRWVGL
FT                   GSCDMKGFFALAIEAVRPLLDQPFQQPLLILATCDEESSMAGARALADAGRPLGRAAVI
FT                   GEPTGLKPIRLHKGVMMERIDILGRSGHSSDPSLGHSALEAMQDVMGELRGLRAQWQRE
FT                   FNNPQFGVPQPTLNLGCIHGGDNPNRICGQCALEFDLRPLPGMDPEQLRAAIRGKLQPL
FT                   ALKHQVRIDYGPLFPEVPPFEQRADAELVRLAERLTGHAAQAVAFGTEAPYLQRLGCET
FT                   LVLGPGDIDCAHQPGEHLELARIEPTVALLRQLIQHYCLTRSEDVQRR"
FT   gene            363424..364722
FT                   /locus_tag="Pmen_0354"
FT   CDS_pept        363424..364722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0354"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: amino-acid N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase;
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83127"
FT                   /db_xref="GOA:A4XP61"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XP61"
FT                   /protein_id="ABP83127.1"
FT                   /translation="MHDYVTWLRHASPYINAHRDRTFVVMLPGEGIAHPNFANIVHDLV
FT                   LLHSLGVRLVLVHGSRPQIEARLAARGLTPHFHRDLRITDAPTLECVIDAVGQLRIAIE
FT                   ARLSMDMAASPMQGSRLRLTSGNFVTARPIGVLDGVDYHHTGEVRRIDRKGINRQLDER
FT                   SIVLLSPLGYSPTGEIFNLACEDVATRAAIDLGADKLLLFGAEDGLLDEHGQLVRELRP
FT                   QQVPAHLARLGSNYQGELLDAAAQACRGGVGRSHIVSYATDGALLSELFTRTGNGTLVA
FT                   QEQFESLREATIEDVGGLIELISPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACA
FT                   ALYPIADSDCGELACLAVNPDYRHGGRGDELLARIEARARAQGLKTLFVLTTRTAHWFR
FT                   ERGFEPSSVERMPAARASLYNYQRNSKVFEKAL"
FT   gene            complement(364870..365097)
FT                   /locus_tag="Pmen_0355"
FT   CDS_pept        complement(364870..365097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83128"
FT                   /db_xref="InterPro:IPR007040"
FT                   /db_xref="InterPro:IPR023200"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP62"
FT                   /protein_id="ABP83128.1"
FT                   /translation="MANVKNGRRAAPMAEDATPQWSLESLTKAYQQGYMAGLTGQARDR
FT                   QPYPEEIPAAAWEAGWDDGFEQMRLQQHSA"
FT   gene            complement(365265..366845)
FT                   /locus_tag="Pmen_0356"
FT   CDS_pept        complement(365265..366845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0356"
FT                   /product="glutamate-cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="TIGRFAM: glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83129"
FT                   /db_xref="GOA:A4XP63"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XP63"
FT                   /protein_id="ABP83129.1"
FT                   /translation="MSDLLSRRLAQLGEPANLSLLGECLHGIERECLRVDHDGQLALTP
FT                   HPQALGSALTHAQITTDYSESLLEFITGTATDPAATLAELESIHRFAYEKLGGELLWSP
FT                   SMPCALPDEETIPIARYGSSNIGRLKYVYRKGLALRYGKTMQCIAGIHYNFSLPEALWQ
FT                   LQQRSEGNTQSTRDYQSARYIALIRNFRRYSWLLMYLFGASPALDKGFMRGRPHQLQEL
FT                   DASTLYLPYATSLRMSDLGYQSSAQSGLTPCYNDLASYTDSLRLAVGTPYPAYVEAGTK
FT                   RGDEWLQLNTNILQIENEYYSSIRPKRVTYSGERPIQALTSRGVQYVEVRCLDINPFLP
FT                   LGIDLPQARFIDAFLLFCALEDSPLLESGECGACTSNFLKVVKEGRRPGLHLQRDGRSI
FT                   ELKTWASELLERIHPLCELLDRSQGGNAHIEALAQQQAKVADVEMTPSAQVLAILRQGQ
FT                   SFTEFALQQSLRHAEYFRAEPLSAEQQQAFEQAAHDSLAEQAELEAQPKGDFDAFVAAY
FT                   QASILALAV"
FT   gene            complement(366949..367335)
FT                   /locus_tag="Pmen_0357"
FT   CDS_pept        complement(366949..367335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0357"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83130"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP64"
FT                   /protein_id="ABP83130.1"
FT                   /translation="MSSAQEVGASSAFSRLLGLEILQVGGGEARVRLALTDELRNLHGK
FT                   LHGGALFSLIDTAMGQASHSLGDGGPSSVTLECKINYIRPVSEGSVLCHAKVLHAGRRT
FT                   QVVEAEVLQGDKLVAKAQGTFACV"
FT   gene            complement(367332..369656)
FT                   /locus_tag="Pmen_0358"
FT   CDS_pept        complement(367332..369656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0358"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase, RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83131"
FT                   /db_xref="GOA:A4XP65"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP65"
FT                   /protein_id="ABP83131.1"
FT                   /translation="MDSINNRIAEELGVRPQQVAAAVALLDEGSTVPFIARYRKEVTGS
FT                   LDDTQLRHLEDRLRYLRELDERRVAILASIEEQGKLTPELKREIDLADTKTRLEDLYLP
FT                   YKQKRRTKGQIALEAGLGELADALFNDPNLTPEQEAERFIDADKGFADVKAVLEGAKYI
FT                   LMERFAEDASLLDKLRSFLKDNATLSARLVPGKENEGAKFSDYFEHDEPLKGVPSHRAL
FT                   AIFRGRNEGILSASLKVGEELPGTLHPCELMIGERFGLQNQGRAADKWLAEVVRWTWKV
FT                   KLYNHLETDLLGELREKAEDEAIAVFARNLHDLLLAAPAGPRATLALDPGLRTGCKVAV
FT                   VDATGKVLETATVYPHAPRNDWDGTLAILAKLCAKHGVDLISIGNGTASRETDKLAAEL
FT                   IKKVPGLKLTKVMVSEAGASVYSASELAAREFPDLDVSLRGAVSIARRLQDPLAELVKI
FT                   DPKSIGVGQYQHDVSQLKLARSLDAVVEDCVNAVGVDVNTASAALLARISGLNATLAQN
FT                   IVQYRDANGAFASRAELKKVPRLGEKTFEQAAGFLRVMNGDNPLDASAVHPETYPLVER
FT                   IAQDTGRDIRSLIGDSAFLKRLDPAKFTDERFGLLTVGDILKELDKPGRDPRPEFKTAE
FT                   FQEGVETLNDLKLGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFIKDPHEAVK
FT                   AGDVVKVKVMEVDIPRNRIALSMRMGDTPGEKVEGARGGARGGNRGGNTPRSERHSSQD
FT                   KPAPATGGMAALFANAKQLKR"
FT   gene            369863..370600
FT                   /locus_tag="Pmen_0359"
FT   CDS_pept        369863..370600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0359"
FT                   /product="Two-component response regulator OmpR"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83132"
FT                   /db_xref="GOA:A4XP66"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP66"
FT                   /protein_id="ABP83132.1"
FT                   /translation="MTQSAATVAEGEKILIVDDDARLRRLLERFFDEQGYRVRAVENVE
FT                   QMDRLLARELFNLVVLDLMLPGEDGLSACRRLRESNNQIPIIMLTAKGDESSRIQGLEL
FT                   GADDYLAKPFNPRELLARIKAVLRRQVPVVPGAPGTEDESVSFGEYELSLATRELKKGD
FT                   QVHMLTTGEFAVLKALVQHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRLIEPD
FT                   PSKPRYIQTVWGVGYVFVPDGNK"
FT   gene            370677..371993
FT                   /locus_tag="Pmen_0360"
FT   CDS_pept        370677..371993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0360"
FT                   /product="Osmolarity sensor protein envZ"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83133"
FT                   /db_xref="GOA:A4XP67"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP67"
FT                   /protein_id="ABP83133.1"
FT                   /translation="MKAPYWFPQSFFARTLWLVLIVVLFSKALTLVYLMMNEDVLVDRQ
FT                   YSHGAALTLRAYWAANPEDRDHIAQAAGLKRIPRDKVPASEQHWPYSEIFQRQMQTELG
FT                   PDTETRVRATSPPALWVHAPSLGDGWVRVPMYPHPLRGQRIWSVLGWFLGIGLLSTAAA
FT                   WIFVRQLNAPLKRLVFAARQLGQGRSVRLPVGDTPSEMTEVYRAFNQMAEDVEQAGRER
FT                   ELMLAGVSHDLRTPLTRLRLALEFMQSDSELTEDMVRDIEDMDAILDQFLAFIRDGRDE
FT                   PVEELDFAELVRETLAPYNQNGERVRLCLEPIPPFPLRRVSTKRLLTNLVENALNHGGG
FT                   DAVEVVASLAGDHSAPYVVLSVLDRGNGIDPAELDSIFNPFIRGDRARGGRGTGLGLAI
FT                   VKRIAALHGGSVELRNRSGGGLEARVRLPLGLLLPRDAV"
FT   gene            372096..375860
FT                   /locus_tag="Pmen_0361"
FT   CDS_pept        372096..375860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0361"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   MASE1 domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83134"
FT                   /db_xref="GOA:A4XP68"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP68"
FT                   /protein_id="ABP83134.1"
FT                   /translation="MPTAFSHRLPRWSWWLPLPLFHLGTWISLATRLNDGVALCYLPLV
FT                   LGLVLCLWWGPRVLPALYLNALLSVPLWGLPWQWAPLYALPETVAVALGWWLLRRHSFD
FT                   PALGSLADLLRFLAFGVLAPAALVALGLQANLWLTGLQLGEHWAQASLAVWLNDAINLL
FT                   ALATPLLVFGSPLLRARGWLPESTAADAQALSISRSWRGWLLAFGIFLALMALVGSLPL
FT                   LVALPFLGIGMLALALRYAFAGALYGAVLVFAATLPLPLLRGDPGFAMLDLPRSQLQLA
FT                   VLLLMGAALLVGRALGDLRQALSRSARMQQQLARANLAMEASPLGVTIADARQPDLPLV
FT                   YCNAAFTQITGYSADETLGRNCRFLVADDHAQLELQPLRSALREGRSGHAVVRNYRKDG
FT                   RPFWNEVVLAPMRDERGISHFVGLQQDVTERVELAAQVEQQRAQLLRQNHLFSQTEDIA
FT                   NLGGWVFELGDSSMFWSDGCYRIVERDIHLGPPSFEQALHYYDAPSQTLIIETLQAALG
FT                   GLDEVDVELRLAARLGGRLVRVRGMAERDDDGSLVRVYGVVQDISERKRTESQLRERDE
FT                   RLRLFFEAPLIGMALTTQSFGWEEVNQKLCSILGRSRDELMASSWHQLSHPDDLAGEQA
FT                   RLEEVLLGSSDGFEMDKRFLRADGQVVFTRLSLRAVRGGAGRQTLFLLLVEDTSARREA
FT                   EARYHTLVEHAPEAILLFSPEGGIVECNENALQLLRYRREDLLGKTIQSISPPRQADGS
FT                   LSSRTGREHLQRAIAGDTPVFEWTHRDSAGRQLPCEVRLVRMPGEELLIRASVLDISER
FT                   QRYQREIERLAYSDELTGLPNRRLLLDRLQHAMDRENREGSLGALLFIDLDHFKTVNDS
FT                   LGHLIGDALLCEVTTRLARELRTEDTLARLGGDEFVVLLEALGSEPQAVAEHAAAVGEK
FT                   LLRGLQGSCLIEGHELAISASIGIALHPLGLQRAADILKQADTAMYRAKHAGRNALHFF
FT                   APEMQAAIDQRLQLQGELRQAIARQQLQLVFQPQLVLADDTVAGAEVLLRWLHPERGEI
FT                   SPDQFIPLAEETGLIQDIGQWVLEQSCATLARWQAQWPQLVLAVNLSPRELRQAGCVAR
FT                   VEDCLRRHGVPAQALELEITEGVLLEDVDRCIGNMQQLKAQGVRFAIDDFGTGYSSLTY
FT                   LKRLPLDRLKIDRSFVADLDGDASGRMLVQTILMIARNLDLECVAEGIEQPSQLALLRE
FT                   QGCALGQGYLFGKPMVEAEFLAWLQARQG"
FT   gene            complement(375867..376763)
FT                   /locus_tag="Pmen_0362"
FT   CDS_pept        complement(375867..376763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0362"
FT                   /product="murein tetrapeptidase LD-carboxypeptidase, Serine
FT                   peptidase, MEROPS family S66"
FT                   /EC_number="3.4.17.13"
FT                   /note="PFAM: peptidase U61, LD-carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83135"
FT                   /db_xref="GOA:A4XP69"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP69"
FT                   /protein_id="ABP83135.1"
FT                   /translation="MSRAFDGRLALIAPAAAIAEDVLEATLAQLDVLGVRYHLGRHVRA
FT                   RHRYLAGTPEQRLDDLHQAFSLPDIAAVWCLRGGYGCAQLLADIDWALLRQASPRPLIG
FT                   FSDLSILLSAFAQHGLPAIHGPVATALGHQVLSAPGGQRERLASMQALWSLLKGQHRQL
FT                   PLRHISGPQHAIEGTLQGGNLTALASVCGTGAALHLAEDSILILEDVGEPYYRLERSFW
FT                   QLLHSFAGHRPRAVCLGSFTDCPRRGVHHSLEQIIGEYLAPLGVPLYGDLPSGHGDSNF
FT                   PWPCGKKARLSPGSLSW"
FT   gene            complement(376760..377665)
FT                   /locus_tag="Pmen_0363"
FT   CDS_pept        complement(376760..377665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0363"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83136"
FT                   /db_xref="GOA:A4XP70"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XP70"
FT                   /protein_id="ABP83136.1"
FT                   /translation="MKIAVLSRNPRLYSTRRLVEAGQQRGHEMQVIDTLRAYMNIASHK
FT                   PQIHYRGRALEGFDAVIPRIGASVTFYGCAVLRQFEMMGVYPLNESVAISRSRDKLRAL
FT                   QLLSRKGIGLPVTGFAHSPDDIPDLIQMVGGAPLVIKVLEGTQGMGVVLAETTKAAESV
FT                   IEAFFGLKQDIMVQEYIQEAGGADIRCFVVGDKVIASMKRQAKAGEFRSNLHRGGSASL
FT                   IKITPEERMTAVRAAKVMGLNVAGVDILRSNHGPLVMEVNSSPGLEGIETTTGKDVAGM
FT                   IIQYLEKNAEPGQTRTKGRG"
FT   gene            complement(377662..378132)
FT                   /locus_tag="Pmen_0364"
FT   CDS_pept        complement(377662..378132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0364"
FT                   /product="protein of unknown function DUF785"
FT                   /note="PFAM: protein of unknown function DUF785"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83137"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP71"
FT                   /protein_id="ABP83137.1"
FT                   /translation="MKTFDQLSVIGLREWINLPELGIIGLRAKIDTGASTSSLHASDIQ
FT                   PFQRDGEDWVRFTAYLGTQVQRRHRCEAPLVSVKRIKSSNGQAQSRYVIRTDLALGDRL
FT                   WPVEFTLACRKTMRYRVLLGSKALITGQLVVNPALSYVQEKPSLSSSLPGAQ"
FT   gene            378165..378677
FT                   /locus_tag="Pmen_0365"
FT   CDS_pept        378165..378677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0365"
FT                   /product="heat shock protein Hsp15"
FT                   /note="PFAM: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83138"
FT                   /db_xref="GOA:A4XP72"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP72"
FT                   /protein_id="ABP83138.1"
FT                   /translation="MIPRILVVPYDNCIRRPCRMRNPSESQMSEKDDDKVRLDKWLWAA
FT                   RFYKTRALAKAAIEGGKVHHRGERCKPGKEPRIGDEYVLRTGFDERTVVVLALSAVRRG
FT                   APEAQLLYRETDESIARREQAAAMRKAGALGMQTDGRPSKKQRRQIHQFNEQQEGGLRH
FT                   PWADEDE"
FT   gene            complement(378756..379550)
FT                   /locus_tag="Pmen_0366"
FT   CDS_pept        complement(378756..379550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0366"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83139"
FT                   /db_xref="GOA:A4XP73"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP73"
FT                   /protein_id="ABP83139.1"
FT                   /translation="MSNTFINSQWRPRALLACHLLAALLLLSWLWQPTRDLWDGFDLWL
FT                   FQLLNDPVHAAGLWAKVWAIGSMRPVDLGVGVVMLAVMLKADLVFQGHQVRRALFAFLT
FT                   ALLALLLLRVGFAELVKVMGWQRPSASLVVEGSARLTELFPDWEERWDMKDSASRSFPG
FT                   DHASVLLIWALFMSFFARNWRLLLVWAIAVIGMLPRLVAGAHWGSDAFVGGVFLSLLAL
FT                   AWSCYTPLGYRASEWLEKVTLPLTSRLAKLPLLGRMSIVSGR"
FT   gene            379760..380647
FT                   /locus_tag="Pmen_0367"
FT   CDS_pept        379760..380647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0367"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83140"
FT                   /db_xref="GOA:A4XP74"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XP74"
FT                   /protein_id="ABP83140.1"
FT                   /translation="MNDFSQRFLFDDTDVRGEMVALRESYAHVLAKHAYPQPVAQLLGE
FT                   MMAAAALLVGTLKFDGLLVLQARAEGPLSLLMVECSSARELRGIARYDAEQIGADADLQ
FT                   SLMPNGVLAITIDPSRGQRYQGIVDLDGVDLAECLSNYFASSEQLPTRFWLKADGQRAR
FT                   GLLLQQLPPHHQSEPQERQESWNHVLTLADTLTAEELLGLDNPTLLHRLYHQENVRLFD
FT                   EQPLQFRCSCSRERSASALASLGQADAELLLAEQGGSVVIDCQFCNERYAFDAADIAQL
FT                   FAGAGSEAPSQTRH"
FT   gene            380805..382346
FT                   /locus_tag="Pmen_0368"
FT   CDS_pept        380805..382346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0368"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83141"
FT                   /db_xref="GOA:A4XP75"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XP75"
FT                   /protein_id="ABP83141.1"
FT                   /translation="MTQANNAVYTDISAAQLVEEAIRRGEGELAANGALVVRTGHRTGR
FT                   SPADRFIVQEPSTEAQIAWGAINRPFPADKFDALWDRVASFNNAQEHFVSHVHVGSAEA
FT                   HYLPVKMTTATAWQNLFGRQLFINPSAYNPAGKAEWEILNVANFECVPERDGTNSDGCV
FT                   IINFAAKKVLIAGMRYAGEMKKAMFSVQNFLLPEKDVLPMHCAANIGEEGDVTLFFGLS
FT                   GTGKTTLSADESRYLIGDDEHGWGEGVVFNIEGGCYAKCIDLSEKNEPVIWKAIQFGTV
FT                   LENVVLDEQRTPDYSDDSLTQNSRAAYPLEYVEKRSEKNLGGEPNAVIFLTCDLTGVLP
FT                   PVSILNNEQAAYHFLSGYTALVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGVYAELLIK
FT                   RINAFGSKVYLVNTGWTGGGYGVGKRFNIPTTRGVIAAIQSGALIGAETEHLPIINLDV
FT                   PKSVPGVETNLLNPRNTWADKNAYDEAAKGLAKLFIDNFAKFDVSEAIKNAGPQL"
FT   gene            382505..384433
FT                   /locus_tag="Pmen_0369"
FT   CDS_pept        382505..384433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0369"
FT                   /product="ATP-dependent DNA helicase, RecQ-like protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   PFAM: helicase domain protein; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83142"
FT                   /db_xref="GOA:A4XP76"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP76"
FT                   /protein_id="ABP83142.1"
FT                   /translation="MSTLKRVFGFDQLRPGQEAVISAVLAGRSAAAIFPTGSGKSLCYQ
FT                   LPALHLPHLTLVISPLLALMQDQLAFLHAHGIAAASIDSAQTREQAAEVMNRARSGELK
FT                   ILMISVERLKNERFRNFIAQVPISLLVVDEAHCISEWGHNFRPDYLKLPDYQRQFGIKQ
FT                   VLLLTATATPRVIADMREKFAIAEADVVTTGFYRPNLNLLVEPVPGGAKTQRLQQWLAP
FT                   RRGQASIVYVTQQKTAEQVAERLARDGLAVSAYHAGMAHEVRESIQRRFMAGELECIVA
FT                   TIAFGMGIDKRDIRNVVHFDLPKSVENYSQEIGRAGRDGQASDCLVLASRDGLSVLENF
FT                   VYGDTPELAGIRAVLDDLRAVGTGGQWELMLGQLSEHSNIRALPLKTLLVQLELRGIIA
FT                   PRYAYFAEYRFKLLLEDEALLAQFEGERRQFVEAILACSKRARTWSTLDFDALYRQHGA
FT                   ERARVVKALDYFQERGWLELESKQMTEVYAVLDGGFEVEALADDLHAHFRAHEASEIAR
FT                   IQAMLALFESRECLSRRLALYFGDEQAPERCGHCSVCQGRVATLPPPPELPPLSGRNAQ
FT                   ALCAAFVEKHLQHAGCTPSQECLTRFLCGVTTPLLTKLKARQLAGFAALEEYPYAEVRG
FT                   WLTASFT"
FT   gene            complement(384493..385092)
FT                   /locus_tag="Pmen_0370"
FT   CDS_pept        complement(384493..385092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0370"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83143"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP77"
FT                   /protein_id="ABP83143.1"
FT                   /translation="MKRLTLLLAATLLGACSILPQSEPLDIYLLPAAQLPAQSQRVDWA
FT                   LRINSPSSSQLLDGTRIVVLPEPDRVNTYQGVRWSERTPQLLRNRLLDAFQDDGRIQAL
FT                   SNEEQRLQADLELVSDLRSFHSEYRDGIPYALIRLEVNLVDARDQRILASRRFSISQQA
FT                   SDTSVPAVIAAFGQAGDQLSRELVDWTLNQGRRATQ"
FT   sig_peptide     complement(385024..385092)
FT                   /locus_tag="Pmen_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            complement(385089..386006)
FT                   /locus_tag="Pmen_0371"
FT   CDS_pept        complement(385089..386006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0371"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83144"
FT                   /db_xref="GOA:A4XP78"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP78"
FT                   /protein_id="ABP83144.1"
FT                   /translation="MEPRAHHVLIGLFTVLTVGAALLFALWLNKAGADRAFTDYEVIFN
FT                   EAVSGLSQGSAVQYSGIKVGDVISLGLDPEDPRTVRARIRIAGHTPIKQDTRARLSITG
FT                   ITGLAVIQLYSGSPESPPLEGKDGQPGIIIADRSPLSRLMANGEDLVSNITRLLNRANR
FT                   MLSRENAERVSRTLENLEQATAGIASQRDELSAALQQAGAATREAAELMRTANRLLDGQ
FT                   GSQALDNAERLMASLERSSRSIEQLLESNRSALDSGMQGLGELGPAIGELRDTLSALRG
FT                   FSRRLEQDPTGYLLRSDSIKEFQP"
FT   sig_peptide     complement(385929..386006)
FT                   /locus_tag="Pmen_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.625 at
FT                   residue 26"
FT   gene            complement(386007..386792)
FT                   /locus_tag="Pmen_0372"
FT   CDS_pept        complement(386007..386792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0372"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83145"
FT                   /db_xref="GOA:A4XP79"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP79"
FT                   /protein_id="ABP83145.1"
FT                   /translation="MSRDAIIEVRGLCNRFGSQVVHEHLDFDLYRGEILGVVGGSGTGK
FT                   SVLLRSIVGLRQPNAGTVRVFGEELLSLSAERRSQLERRFGVLYQRGALFSSLTVSENI
FT                   ALPLIEHAGLSRAAAERLARVKIALAGLPSNAADKYPSSLSGGMVKRAALARALALDPD
FT                   ILFLDEPTAGLDPIGAAAFDQLIRTLSDSLGLSVFLVTHDLDTLYSICDRVAVLAQKKV
FT                   LVADRLEAVAATDDAWIQDYFHGPRGRAAAQAATAAGSQ"
FT   gene            complement(386789..387928)
FT                   /locus_tag="Pmen_0373"
FT   CDS_pept        complement(386789..387928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0373"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83146"
FT                   /db_xref="GOA:A4XP80"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP80"
FT                   /protein_id="ABP83146.1"
FT                   /translation="MTTPYLTPLQTSSTDAASGLRIGGDWTLAHYSRLEPQVLALRERL
FT                   HGQESVDLDELAALDTAGAALLVELLGSERLRQLAQQDNLSTERRALLLAVADAMAGSQ
FT                   QVQQHATPSALREVLGHIGEAVETTWCHGRELLGFMGLTLSGMLTILLRPARWRLTSLA
FT                   AHLEQCGLNAVPIVALLTFLVGAVVAFLGATILADFGASIYTVNLVAFSFLREFGVLLT
FT                   AILMAGRTASAFTAQIGSMKANEEIDAIRTLGLSPIELLVLPRVFAMLIALPILTFIAM
FT                   LSGIVGGAVVCAVSLDIPLTMYMSILQDSDLLRHFLVGLLKAPIFAFLIALIGCLEGFK
FT                   VSGSAQSVGEHTTSAVVQSIFVVILLDALAALFLMEMGW"
FT   gene            388088..389575
FT                   /locus_tag="Pmen_0374"
FT   CDS_pept        388088..389575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0374"
FT                   /product="flavoprotein involved in K+ transport-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83147"
FT                   /db_xref="GOA:A4XP81"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP81"
FT                   /protein_id="ABP83147.1"
FT                   /translation="MSVEHLDVLIIGAGLSGVGAACHLKRLCPGKRFALLEGREAMGGT
FT                   WDLFRYPGIRSDSDMYTLGYNFKPWTDPQAIADGPSIRRYIEETAREYGVDGLIRYRHR
FT                   VLKADWCSASATWQLLVQRGEDSEPLRMSCQFLMMCTGYYRYEAGYTPEFAGREDYRGT
FT                   FIHPQLWPEGFDYDGKRILVIGSGATAVTLVPALAERAAQVTMLQRSPSYVINLPQRDA
FT                   LSNALRRVLPEKWVYRLARGRNVTLQLVFYKLAKRFPNLVRRVLLGLVRRQLGERVDLR
FT                   HFSPSYKPWDQRVCAVPDGDLFRVLRQGKAQVVTAEIERFTAQGIRLKNGEELAADVIV
FT                   SATGLQLQLFGGIEVQVDGVPFEAPKSMGYRGIMLRDLPNLAVVMGYTNASWTLKADLS
FT                   SEYFCRLIRHMDAIGRRQVTPRAGDGTVRPEPFLDLQSGYIERAAHLLPAQGDRAPWKL
FT                   HQNYLLDLALLRYGRVDDGYLLFSAPHAAQQAAVAQL"
FT   gene            389675..389887
FT                   /locus_tag="Pmen_0375"
FT   CDS_pept        389675..389887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83148"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP82"
FT                   /protein_id="ABP83148.1"
FT                   /translation="MSQRVQRHPSHEESAMKEQRHLPALRAHIEQLLSKGWVIASRSPM
FT                   TLRNGSRCYLVSHGMLISESPSRAA"
FT   gene            390127..391047
FT                   /locus_tag="Pmen_0376"
FT   CDS_pept        390127..391047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0376"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83149"
FT                   /db_xref="GOA:A4XP83"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP83"
FT                   /protein_id="ABP83149.1"
FT                   /translation="MPSRRRFLHGSASLAALAALAPWLPSSALASSTLMTRTIPSSGEP
FT                   LPVIGLGTSRTHDVAMTDEALEPLRDVLRELVNGGASLVDTAPSYGRAEAVCGALAAEN
FT                   DLRRKLFLASKVSSSGRAAGERQVQTSFAALKTDTIDLMQVHNLQDTRTQLGLLRELKE
FT                   QGRVRYIGVTHYLDSAHERLLEVLRQEPVDFVQFNYSIGERNAERELLPYCADKGIAVL
FT                   INRPFQRSALFDRVRGKELPDWATVELDANSWAQLMLKFILANPAVTAVIPATSNPRYM
FT                   ADNILAGQGRLPDAAQRQRIIELFA"
FT   sig_peptide     390127..390219
FT                   /locus_tag="Pmen_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 31"
FT   gene            391049..392341
FT                   /locus_tag="Pmen_0377"
FT   CDS_pept        391049..392341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0377"
FT                   /product="ATP/ADP translocase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83150"
FT                   /db_xref="GOA:A4XP84"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP84"
FT                   /protein_id="ABP83150.1"
FT                   /translation="MQALTRRLARAINAEEQELAAVLAGFALFFCLFSGYFMLRPIREA
FT                   MGITGGVNNLQWLFTATFVAMLLAVPLLAWLNSKVPRIHFIDWVYGFFCLNLLVFVLLF
FT                   RLDHDSVWLARVFYVWISVYNLFVVSVAWSLMADVFDGAQARRLFAFIAAGASVGGLCG
FT                   PLLSALLIGAIGESGLMLMAAVLLAAAMALKRYLMAWRERQGAGRPGAAPSESPRRPVP
FT                   GNPFSGLTRMLGSRYLLGIGAFILLLTSVSTFLYFEQARLVAELFPDRAAQVRVFGVID
FT                   FVVQAGALATQVFITGRVAQKLGVRVLLSAVPALVCLGFIGLALAPTFAMLAGLMIVRR
FT                   IGEYAFVRPGREMLFAPLDAESKYKAKNFIDTVVYRGGDALSGWAKAGLDMLGHGAWLV
FT                   AVVGALCAALWGVLGWYLGGRADHQAQRSGG"
FT   gene            complement(392365..393261)
FT                   /locus_tag="Pmen_0378"
FT   CDS_pept        complement(392365..393261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0378"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83151"
FT                   /db_xref="GOA:A4XP85"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP85"
FT                   /protein_id="ABP83151.1"
FT                   /translation="MNFTNFDLNLLRVLDALLREQNVSRAAEHLALSQPAVSNALGRLR
FT                   ELLGDPLLVRVGRRMQPTPRALALEAPIRSALRQLEQSLSAGEAFEPGESRQRFRIAIT
FT                   DYVELVCMPRLLDRLSHKAPGIGIDIRHLSPSLPMEALDKGELDLVLGRFDEMPARFAR
FT                   RHWMSETLKLAVRREHPLLHQRSLDLETFLRLRHLWVHGGQTRGMVDQWLGEQGLSRQI
FT                   LYTTPNYLQAAHIVAGSELAAVLPTALARHFATLLPLELFDLPFALGPFHLEIVSLAQR
FT                   QRDAALQWLIEEIVAVA"
FT   gene            393360..394601
FT                   /locus_tag="Pmen_0379"
FT   CDS_pept        393360..394601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0379"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83152"
FT                   /db_xref="GOA:A4XP86"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP86"
FT                   /protein_id="ABP83152.1"
FT                   /translation="MTQVVSPLRCAAVIGAGTMGRGIVISLANAGLRVLWLDNNPQMVE
FT                   QGLGMAEDTWAHNVAKGRIDAAEAAARRARVEAVDGYAALADADLVIEAVYENLELKQR
FT                   IFRELDAVMKPGAILASNTSALDIDAIAAVTARPEAVLGLHFFSPAHIMKLLEIVRGGK
FT                   TAPAVLQAAQELGERMGKVAVVAGNCHGFIGNRMLHTYVREARMLLLEGAWPHQVDAAL
FT                   QGFGFAMGPFRMYDVVGIDLEWRARELAGQGQDDAAVQVDNRLCELGRFGQKSGQGYYR
FT                   YAPGSRQAEHDPEVDALVQAESERLGFTRRDIGTEEILERCLLALVNEGAKILEENIAA
FT                   NSRDIDLVYLNGYGFPAERGGPMAWADGEGVAAIHRRLLQLTERFGAHWQPAPLIERLA
FT                   AENKHFSDVQEGRV"
FT   gene            394598..396388
FT                   /locus_tag="Pmen_0380"
FT   CDS_pept        394598..396388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0380"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83153"
FT                   /db_xref="GOA:A4XP87"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP87"
FT                   /protein_id="ABP83153.1"
FT                   /translation="MSYQAPLRDMRFVLHELFDAAGHCERLGNGLDRELIDGVLEEAAA
FT                   FAAGEVAPLNRNSDEEGCRLENGQVSTPRGFAEAYRQYVDNGWASMTGPVEYGGQGFPQ
FT                   LVAFAFHEMLMGASLSFRVYSGLTEGAVLALHKHGSETLKQQYLGKLVSGQWSGTMCLT
FT                   EPQAGTDLALLRTRAEPQADGSYKVSGSKIFISGGEQDLSENIVHLVLARLPDAPAGVK
FT                   GISLLLVPKFIAAADGTPGERNTLSCGAIEHKMGIKGASTCVMNFDGATGWLVGEANQG
FT                   LACMFTMMNDARFQVGLQGLGIGEAAFQGALRYARERLQSRGLAGVQAPDKAADPIIVH
FT                   PDVRRMLLTQKTLVEGSRMLAAYTARQLDLEHGAESADARKAAGKRAALLIPIVKAFFT
FT                   DMGQEVASHGVQVYGGHGFIREWGMEQLMRDSRITQLYEGTNGIQALDYIRRKLLGDGG
FT                   AELSALQAEFSALCDAQTTRPALKEMATVVQARIGEWRELSTEVLAACQRDAQEIGATS
FT                   VDFLQYSAYVLLAGFWLQAAARAQDVLEAGSGEAAFYQAKLHSAEFYLRRVLPRASAHR
FT                   EALLGGAQCLMAMDEDSFAF"
FT   gene            396527..397690
FT                   /locus_tag="Pmen_0381"
FT   CDS_pept        396527..397690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0381"
FT                   /product="Alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83154"
FT                   /db_xref="GOA:A4XP88"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP88"
FT                   /protein_id="ABP83154.1"
FT                   /translation="MHPFSFATTAQILCESGASLRLAELCRERGAQRVLIVTDAGITRL
FT                   GLLEPLLPGFARAGMGVQVFDQVLADPPEAVVLAAVAQARELQAELVVGFGGGSSMDVA
FT                   KLVALLAHPDCAQALSEIYGVGNARGRRLPLIQVPTTAGTGSEVTPIAIVTTGETTKMG
FT                   VVSPLLLPDLALLDADLTLGLPPAVTAATGIDAMVHAIEAYTSALKKNPLSDLLAREAL
FT                   RLLAANLDEVVRNGGNREARQAMLLGACLAGQAFANAPVAAVHALAYPLGGHFHIPHGL
FT                   SNALVLPQVLAFNAPVAAPLYAELAPLVLGEQLRAGNAAAQTEQLIEALAAFSQRSGLP
FT                   TRLRDAGVSEAMLPTLAADAMLQQRLLVNNPREMNEQQALAIYQAAY"
FT   gene            397788..398219
FT                   /locus_tag="Pmen_0382"
FT   CDS_pept        397788..398219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0382"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83155"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP89"
FT                   /protein_id="ABP83155.1"
FT                   /translation="MSQPQHLRGDYRHFQPITTRWHDNDIYGHVNNVTYYSYFDSAVNA
FT                   YLIAAGGLDIHAGEVVGFVVSSACDYFASIAFPDAIEVGLRVGKLGNSSVQYELAIFKA
FT                   GEEQACAAGRFVHVFVDRQSNRPVSIPPALRAALERLLA"
FT   gene            398283..399347
FT                   /locus_tag="Pmen_0383"
FT   CDS_pept        398283..399347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83156"
FT                   /db_xref="GOA:A4XP90"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP90"
FT                   /protein_id="ABP83156.1"
FT                   /translation="MSDPEREQAQQRVARITAFREELDELRREQVLQLSEAQEQAVAAH
FT                   HRQLLTHYRQTLDIDADARARQLSLGMRLASLFGALALAAGLFFLFYQFWGLFDVPAQV
FT                   AILLGSSLGSLLLCFWLQARDSSGYYAKLAAVLAFVCFVLNLSMLGQIFNITPSDKALL
FT                   PWAALALLLAYQCRQRLLLVVALLCFGLFVAARLGDWAGWHWWTLGERPELFMPLAALM
FT                   LVPQWLDQRRHAGFAACYRVMGLLYLLGPVLVLSYWGSGSYLAWPTGWIEAFYQTLGFV
FT                   LAGLTLWLGIRRGWGEVVNTGLVFALIMLFAKLFDWWWQLLPRYLFFLLLGLIAVLLLV
FT                   MLQRWRRSAPGGVQ"
FT   gene            399344..400114
FT                   /locus_tag="Pmen_0384"
FT   CDS_pept        399344..400114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83157"
FT                   /db_xref="InterPro:IPR032249"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP91"
FT                   /protein_id="ABP83157.1"
FT                   /translation="MKRALWLGLGVVLLSNAVALGGVWYNRSGALEAQLLLSERELQRV
FT                   YGGWLRQQDDGVLRLQLSWRHAGEGWQLPWLDEAKLRELGFAAGTDEQAWSRQPAREVW
FT                   LVLELDGPVHRRQIEQARQALEAAEAELQARPESEVLQQERDEHRRRLLHEQQQASRLI
FT                   LVDAGVDAEVLRQRWPDRQRQVVLVGRMEPYRHGAEAGYGASIRLENDRLSVPHAYREL
FT                   ARGWERSYEQSGFKAQVEVAFGRRHEPWVLSIRQ"
FT   sig_peptide     399344..399409
FT                   /locus_tag="Pmen_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.486 at
FT                   residue 22"
FT   gene            complement(400108..400560)
FT                   /locus_tag="Pmen_0385"
FT   CDS_pept        complement(400108..400560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0385"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83158"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP92"
FT                   /protein_id="ABP83158.1"
FT                   /translation="MKSLQLLLLSLGLTSGGVALAGNTEAGLGGALGGAVGAMVGQQVG
FT                   GNTGAAVGAGLGGAAGSMVGADRRSRTEAAIGGALGAAGGNVIGQQVGGNTGGVVGAAV
FT                   GGGAGGALGNHMGNTSYRDDRRGYREVHHHHYHGKKKHKKHWHRHH"
FT   sig_peptide     complement(400495..400560)
FT                   /locus_tag="Pmen_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 22"
FT   gene            complement(400692..401780)
FT                   /locus_tag="Pmen_0386"
FT   CDS_pept        complement(400692..401780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0386"
FT                   /product="transcriptional regulator of molybdate
FT                   metabolism, LysR family"
FT                   /note="PFAM: regulatory protein, LysR"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83159"
FT                   /db_xref="GOA:A4XP93"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP93"
FT                   /protein_id="ABP83159.1"
FT                   /translation="MIRIDIQPRWRFHQRDGSSLDPHGLELLQAVHDTGKLTEAAARVG
FT                   YSYRHAWNLLGKWQAFFGSPLIELERGKGARLAPLGEKLLWADQRIRARLSPQLDNLAS
FT                   ELELELNRVLQASNPGLRIHASHGFAVAALREWLERDPSWQWEVQFRSGSEAMIALQRH
FT                   DCEVAGLHVPAGPLGTLSMSRIQPWLRPDQRVITFVVRTQGLMLAPGNPHGVRGLADLA
FT                   RGELRFVNREPGSGTRLLLQDLLQQGGLDSATIKGFHNEEFTHAAVAAFVASGMADVGF
FT                   GVEAAARQFGLDFIPMAREHYCLLCREDSLELPAMAALLRVLQNPEFQARIGQLPGYAL
FT                   SRPGEVLPLTQALEQWGRESLL"
FT   gene            401979..402473
FT                   /locus_tag="Pmen_0387"
FT   CDS_pept        401979..402473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0387"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 24 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83160"
FT                   /db_xref="GOA:A4XP94"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP94"
FT                   /protein_id="ABP83160.1"
FT                   /translation="MALLPQRFAPEQCEAVTREVLAAHRGQPGALLPILHDIQDRLGAV
FT                   PPELLPLIAEDLCLSRAEVHGVVSFYHDFRATPPGRQVLKLCQAEACQSMGVKALTAEL
FT                   ESKLGLPLGETREDGSLSFEPVYCLGNCACAPSVMLNGELHGRVDAEEVLALLAEQGGQ
FT                   A"
FT   gene            402470..404041
FT                   /locus_tag="Pmen_0388"
FT   CDS_pept        402470..404041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0388"
FT                   /product="formate dehydrogenase beta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain,
FT                   51 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83161"
FT                   /db_xref="GOA:A4XP95"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP95"
FT                   /protein_id="ABP83161.1"
FT                   /translation="MSEPIKIFVPRDATALSLGADKVAKAIAAEAAARGIEVQLVRNGS
FT                   RGLFWLEPLVEVATPTGRVAYGPVKARDVAGLFDAGFLEGKQHALGHGLTDEIDYLKRQ
FT                   ERLTFARVGITDPLSLEDYIAHDGYRGLKRALGMTPEAIVAEVTESGLRGRGGAAFPTG
FT                   IKWRTVLGCQAEQKYIVCNADEGDSGTFSDRMVMEDDPYVLIEGMTIAGLAVGATKGYI
FT                   YLRSEYPHAEAVLLETIARATAAGYLGDDVLGSGKAFHLELRRGAGAYICGEETALLES
FT                   IEGKRGTVRPKPPLPAIEGLFGKPTVINNVISLASVPIILDKGGAYYKDYGMGRSLGTL
FT                   PIQLTGNIARGGLIEKAFGITLRELLYEYGGGSASGRPIRAVQVGGPLGAYLPESQFDT
FT                   PLDYEAFAALGAVLGHGGIVVFDDTVDMADMARYAMEFCAVESCGKCTPCRIGSTRGEE
FT                   LLSQIIVARSEGPQPGRIELLKSLCDTMLGASLCALGGMTPYPVLSAINHFPEDFGVSQ
FT                   DSAEAR"
FT   gene            404057..406891
FT                   /locus_tag="Pmen_0389"
FT   CDS_pept        404057..406891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0389"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   ferredoxin; 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83162"
FT                   /db_xref="GOA:A4XP96"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP96"
FT                   /protein_id="ABP83162.1"
FT                   /translation="MALYRELDYGTPARSGAPVTLEIDGNAITVPAGTSLMRAAQEAGI
FT                   AVPKLCASDSLEPFGSCRLCMVEIEGRRGFPASCTTPVEPGMVVRTQSPKLAELRRGTM
FT                   ELYISDHPLDCLTCSANGNCELQDMAGVVGLREVRYDPVKTHLAEAKDESNPYFSYDPS
FT                   KCIVCNRCVRACEEVQGTFALTIDGRGFDSRVAAGQAEDFLDSECVSCGACVNACPTAT
FT                   LMEKSVIELGQAERSVATTCAYCGVGCSFNAEVKGNTVVRMVPNKNGHANHGHACVKGR
FT                   FAWGYATHPDRIKTPMIRDSIHEPWRSVSWDEAIGYAARRFKEIQAQYGRNAVGGLTSS
FT                   RCTNEETYLVQKLVRAAFGNNNVDTCARVCHSPTGYGLKVTLGESAGTQDFDSVLSADV
FT                   VLVIGANPTDGHPVFGSQLKRRLREGAKLIVADPRGIDLVRSPHIRAEHHLQLRPGSNV
FT                   ALLNSLGHVIATEGLINEAFVAERCEAEAFEQWRTFVSEQRNSPEAMEVLTGVPAASVR
FT                   AAARLYATGGNAAIYYGLGVTEHSQGSSTVMAIANLAMATGNIGRPGVGVNPLRGQNNV
FT                   QGSCDMGSFPHELPGYRHVSDPVARPQFEAAWGVKLLDEPGLRIPNMLAAAHAGTFKGM
FT                   YIQGEDPAQSDPDTQHVTDALKAMECVVVQDLFLNETAKYAHVFLPGASFLEKNGTFTN
FT                   AERRISPVRKVMPALAGKEDWEVTVALSNALGYPMNYKHPSEIMDEIAALTPTFTGVSY
FT                   AKLDRLGSIQWPCNDEAPEGTPIMHEDAFVRGKGRFVVTEFIPTEERTSRKRPLVLTTG
FT                   RILSQYNVGAQTRRTANKAWHAEDILELHPVDAEDRGIKDGDWVGINSRAGETVMRAKV
FT                   TERMQPGVVYTTFHHPESGANVITTDNSDWATNCPEYKVTAVQVCKVEVPSQWQQEFDT
FT                   FTREQVSLLPVVQL"
FT   gene            407040..407288
FT                   /locus_tag="Pmen_0390"
FT   CDS_pept        407040..407288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0390"
FT                   /product="formate dehydrogenase delta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83163"
FT                   /db_xref="GOA:A4XP97"
FT                   /db_xref="InterPro:IPR021074"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP97"
FT                   /protein_id="ABP83163.1"
FT                   /translation="MGMNATQLIKMANQIGAFFASQPDPVQARTEYAQHLKRQWDPQMR
FT                   TALYAHLDASAGEGLSEFALQVLRDLRGQIEPRAASV"
FT   gene            407489..408313
FT                   /locus_tag="Pmen_0391"
FT   CDS_pept        407489..408313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0391"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83164"
FT                   /db_xref="GOA:A4XP98"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP98"
FT                   /protein_id="ABP83164.1"
FT                   /translation="MSHRTADPLTDDRAAAPAPDGYAYVELDETAHHGHAVLAEECALA
FT                   IAYNGISHAVMMVSPSALEDFVVGFSLTSAVVAAAEDIYDIQLKRAGEAFSAEVEIASR
FT                   AFWALKQQRRNLAGTSGCGLCGVEALEQALPQLDTLSLNPLPPAAHLADLRTRIGEVQK
FT                   LARQSGALHAALFVDESGEIVLCREDIGRHNALDKLIGALNRESRDARRGFAVVTSRCS
FT                   LELIHKAVRAGFASLVSLSAPTDLCVRWARRHRLNLIHLPHHSPPRVYSPAP"
FT   gene            complement(408370..409032)
FT                   /locus_tag="Pmen_0392"
FT   CDS_pept        complement(408370..409032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0392"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83165"
FT                   /db_xref="GOA:A4XP99"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4XP99"
FT                   /protein_id="ABP83165.1"
FT                   /translation="MPALPWHQIDTVLLDMDGTLLDLHFDNHFWLTHLPQRYAEHHGIS
FT                   LALAEAELLPLFRQHAGTLNWYCTDFWSRELRLSIRDLKREVAHLIALRADAELFLRAL
FT                   REAGKRVVLITNAHRDSLSLKLERVELAPWFERLISSHDYGFPKENQQFWFALRQDTDF
FT                   DPARSLFIDDSLPILRSAARFGVAHLLAVRQPDSQAGPKDTEEFEAVEDYRELLQGL"
FT   gene            409142..409708
FT                   /locus_tag="Pmen_0393"
FT   CDS_pept        409142..409708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0393"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83166"
FT                   /db_xref="GOA:A4XPA0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPA0"
FT                   /protein_id="ABP83166.1"
FT                   /translation="MRQKPTVLAREIVASSRLFRVEQVQLRFSNGAERTYERLVGKGSG
FT                   HGAVMVVAMLDAEHAVLIEEYCGGTDDYQLSLPKGLIEPGEDVLVAANRELKEEAGFGA
FT                   HELEYITELSLSPGYMSQKIQVVLARNLYEERLPGDEPEPMRVERISLRELSSLAQHEQ
FT                   FSEGRALAALYLVRDLLTQRGEYRP"
FT   gene            409705..410523
FT                   /locus_tag="Pmen_0394"
FT   CDS_pept        409705..410523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0394"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83167"
FT                   /db_xref="GOA:A4XPA1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPA1"
FT                   /protein_id="ABP83167.1"
FT                   /translation="MSHPYIPKVIELVRAAGAATLPYWRSDVAVTEKADASPVTAADLA
FT                   AHHILFAGLQALAPEIPVLSEEAADIPLSERSAWTRWWLVDPLDGTKEFIAGSEEFTVN
FT                   VALIEQGRVVFGVVGIPANGRCYYGGAGLGAWRSNAPGEEQSISVRVAPAQGFTLVASK
FT                   RHSSPAQETLLAGLATRFGEPELANIGSSLKFCLLAEGNADCYPRLAPTSQWDTAAAQG
FT                   VLEGAGGEVLNLAGEVLTYEARESFLNPSFLALPAAAEWRGELIELARTL"
FT   gene            complement(410576..412483)
FT                   /locus_tag="Pmen_0395"
FT   CDS_pept        complement(410576..412483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0395"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83168"
FT                   /db_xref="GOA:A4XPA2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPA2"
FT                   /protein_id="ABP83168.1"
FT                   /translation="MSRLPVIVGFGGYNAAGRSSFHHGFRRTVQESLEPQARQETLAGL
FT                   AQMMKLVRVVDGQYQDQDGQALSLAEIESRYGKQILAGTLVRRIEKQHLDPDAAHWQKS
FT                   IDVAPANGANLSFITQRKQLPEPLPANWSIEELDGNEVRVTLHDSCEFKVDSYRPLAVK
FT                   SAGQLPTGFEPSELYNSRFHPRGLAMTVVGVTDALRSVGIDWQRIVQHVAPDEIAVFAS
FT                   CIMSQLDENGFGGMMQSRLKGGRVTAKQLALGLNTMPADFINAYVLGSVGTTGSITGAC
FT                   ATFLYNLQKGIEQIASGKARVVIVGSSEAPINQECIEGYGAMGALATEEGLRQIEGKSD
FT                   VDFRRASRPFGDNCGFTLAEACQFVVLMDDELALELGADIHGAVPDVFINADGFKKSIS
FT                   APGPGNYLTVAKAVASAVQLLGLDAVRNRSFVHAHGSSTPANRVTESEILDRVAAAFGI
FT                   EQWPVTAVKAFVGHSLATASGDQVIAALGAFKYGIVPGLKTIDAVAADVHQAHLSLSTI
FT                   DRKVGEHALDVAFINSKGFGGNNASALVLAPHVVERMLRKRHGQAAFDAYLARREGTRA
FT                   AAAAYDQQALQGKLDIIYNFGNDMIDDQAISITTEEVKVPGFDQPLVFRKDERYSDMLD
FT                   "
FT   gene            complement(412740..414011)
FT                   /locus_tag="Pmen_0396"
FT   CDS_pept        complement(412740..414011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0396"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83169"
FT                   /db_xref="GOA:A4XPA3"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPA3"
FT                   /protein_id="ABP83169.1"
FT                   /translation="MRTAILGARVIDPASGLDQVTDLYIDGTKLVAFGQAPAGFTADKT
FT                   LNAQGLIAAPGLVDLSVALREPGYSRKGSIATETLAAAAGGVTSLCCPPLTKPVLDTPA
FT                   VAELILDRAREAGHTKVFPIGALSKGLAGEQLAELVALRDAGCVAFGNGLDNFRSARTL
FT                   RRALEYAATFDLQVIFHSQDFDLAEGGLAHEGPTASFLGLAGIPETAETVALARDLLLV
FT                   EQSGVRAHFSQITSARGAELIANAQARGLPVTADVALYQLILTDEALIDFSSLYHVQPP
FT                   LRSRADRDGLREAVKAGVISAIASHHQPHERDAKLAPFAATEPGISSVQLQLPLAMSLV
FT                   QDGLLDLPTLLARLSSGPAAALRLPAGTLSVGGAADIVLFDAQASTVAGEQWYSKGSNC
FT                   PFIGHCLPGAVRYTLVDGHISYQS"
FT   gene            complement(414011..415018)
FT                   /locus_tag="Pmen_0397"
FT   CDS_pept        complement(414011..415018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0397"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83170"
FT                   /db_xref="GOA:A4XPA4"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPA4"
FT                   /protein_id="ABP83170.1"
FT                   /translation="MTPLAAKRPLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEV
FT                   GARAVKKVPLLRGKTVCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLF
FT                   DTLRNLEAMAADIFVVRHADSGAAHFIAEHVCPNLAIINGGDGRHAHPTQGMLDMLTIR
FT                   RHKGDFENLSVAIVGDILHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGLEESYGVRV
FT                   FSDANEGLKDVDVVIMLRLQRERMQGGLLPSEGEFYRLFGLTEQRLKLAKPDALVMHPG
FT                   PINRGVEIESAVADGPQSVILNQVTYGIAIRMAVLSMAMSGQNAQRQLNAEEAN"
FT   gene            complement(415030..415533)
FT                   /locus_tag="Pmen_0398"
FT   CDS_pept        complement(415030..415533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0398"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83171"
FT                   /db_xref="GOA:A4XPA5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPA5"
FT                   /protein_id="ABP83171.1"
FT                   /translation="MLPNPNDLLPAMASALTQHLNQRQISEPRFIGIRTGGVWVAQALL
FT                   QALGRNDALGILDVSFYRDDFTQNGLHPQVQPSELPFEIEGQHLVLIDDVLMSGRTIRA
FT                   ALNELFDYGRPASVTLVSLLDLNARELPIRPDVVGATLSLAASERVKLSGPTPLTLELQ
FT                   TLAN"
FT   gene            complement(415680..416114)
FT                   /locus_tag="Pmen_0399"
FT   CDS_pept        complement(415680..416114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0399"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase, RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83172"
FT                   /db_xref="GOA:A4XPA6"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPA6"
FT                   /protein_id="ABP83172.1"
FT                   /translation="MSDKPVRLLLGFDYGTKQIGVAVGQVITGQARELCVLKAQNGVPD
FT                   WNRVEALIKEWQPDAVVVGLPLNMDGTPSEMSARAEKFARRLNGHFNLPAYTHDERLTT
FT                   FEAKGQRLREGQSGGYRERPVDAIAAALLLQGWLEENCTL"
FT   gene            complement(416114..416719)
FT                   /locus_tag="Pmen_0400"
FT   CDS_pept        complement(416114..416719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0400"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83173"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPA7"
FT                   /protein_id="ABP83173.1"
FT                   /translation="MKPGALKPKLAVMKNSAPTSLKYHFLIAMPHMDDPNFAQTVTYLV
FT                   EHNAQGAMGLVINKPNGLSLADVLEQLRPEAEPAALCHSLPIFAGGPVQTDRGFVLHPA
FT                   GQQFQATLDLGELGLSTSQDVLFAIADGSGPDKYLITLGYAGWDAGQLEAELADNAWLT
FT                   CPADSSILFDLPFDQRLNAAAARLGVNLSLLSSQVGHA"
FT   gene            complement(416778..417674)
FT                   /locus_tag="Pmen_0401"
FT   CDS_pept        complement(416778..417674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0401"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83174"
FT                   /db_xref="GOA:A4XPA8"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPA8"
FT                   /protein_id="ABP83174.1"
FT                   /translation="MNAAASPTSAPSATVRPADRLGFTLFLAAALHVAVILGVGFTLES
FT                   PPEISKTLEITLSTFKSKKAPDKADFLAQDNQQGSGTLEHTAAPKTTEQAPFQDSEVRK
FT                   VTPPATPQQPATRQEAPKAAVATRAPQQQKTPVKREEAKPVATTRPAPVFDAAQLSAEI
FT                   ASLEAELAQEVQAYAKRPKIHRLNAASTTRDKGAWYKDEWRKKVERIGNLNYPDDARRQ
FT                   RIYGSLRLLVSINRDGSLYEVQVLESSGQAVLDQAAQRIVRLAAPYAPFTGDLADIDRL
FT                   EIIRTWRFERGDRLSSN"
FT   gene            complement(417763..418719)
FT                   /locus_tag="Pmen_0402"
FT   CDS_pept        complement(417763..418719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0402"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutathione synthetase; PFAM: glutathione
FT                   synthetase domain protein; glutathione synthetase,
FT                   ATP-binding; RimK domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83175"
FT                   /db_xref="GOA:A4XPA9"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPA9"
FT                   /protein_id="ABP83175.1"
FT                   /translation="MSLRLGIVMDPIASISFKKDSSLAMLLAAQARGWSLFYMEQQDLY
FT                   QVRGQARARMRPLEVFNDPQRWFALDAEQDTPLAELDVILMRKDPPFDNEFVYSTYLLE
FT                   QAERDGVLVVNRPQSLRDCNEKFFATQFPRYTPPTLVTRRPDIVRQFADEHRDIILKPL
FT                   DGMGGSQIFRHREGDPNLSVILEALTLHGRQQIMVQAYLPAIKDGDKRILMIDGEPIPY
FT                   CLARIPAAGETRGNLAAGGRGEARPLTERDREIAAAVGPTLREKGLIFVGLDVIGDHLT
FT                   EINVTSPTCIREIDAAFDARIGERLMDCIARKRGLKA"
FT   gene            418961..419368
FT                   /locus_tag="Pmen_0403"
FT   CDS_pept        418961..419368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0403"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83176"
FT                   /db_xref="GOA:A4XPB0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPB0"
FT                   /protein_id="ABP83176.1"
FT                   /translation="MEQHSEGLKVMVIDDSKTIRRTAETLLKKVGCDVITAVDGFDALA
FT                   KIADTHPSIIFVDIMMPRLDGYQTCALIKNNSAFKSTPVIMLSSKDGLFDKAKGRIVGS
FT                   DQYLTKPFSKEELLGAIKAHVPDFTPVEQAS"
FT   gene            419415..419780
FT                   /locus_tag="Pmen_0404"
FT   CDS_pept        419415..419780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0404"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83177"
FT                   /db_xref="GOA:A4XPB1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPB1"
FT                   /protein_id="ABP83177.1"
FT                   /translation="MARILIVDDSPTEMYKLTAMLEKHGHQVLKAENGADGVALARQEK
FT                   PDAVLMDIVMPGLNGFQATRQLTKDAETSHIPVIIVTTKDQETDKVWGKRQGAKDYLTK
FT                   PIDEDTLLKTLNAVLAG"
FT   gene            419826..420359
FT                   /locus_tag="Pmen_0405"
FT   CDS_pept        419826..420359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0405"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83178"
FT                   /db_xref="GOA:A4XPB2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPB2"
FT                   /protein_id="ABP83178.1"
FT                   /translation="MSAQTPFQILLEIDQRCRALAAGLPSQQAAVQTWSGIGFRMGERL
FT                   FVAPMGEVGEVLHEPRYTLLPGVKSWVKGVANVRGRLLPIMDLCGFFGNELSPLRKLRR
FT                   VLVVDHQEIFAGLTVDEVFGMQHFPVDAYSEQLPPLEASIAPFIHGVFQREQPWLVFSP
FT                   YALAADPGFLDVAY"
FT   gene            420444..422480
FT                   /locus_tag="Pmen_0406"
FT   CDS_pept        420444..422480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0406"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83179"
FT                   /db_xref="GOA:A4XPB3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPB3"
FT                   /protein_id="ABP83179.1"
FT                   /translation="MKKLNAGNLLAGARSSTLITALFVVLIVSIVLLFANFAYINTQSG
FT                   YDTEYISHSGELRVLSQRIANNATEAAAGKAEAFGLLRAARNDFQRRWSYLTDGDANTG
FT                   LPPAPSSVQAQMAAVQQDWDSLRQNTDAIIASEQTVLSLHQVAATLAETIPQLQVEYEE
FT                   VVDILLESGAPAAQVSVAQRQSLLAERILGSVNKVLAGDEDSVQAADMFGRDASLFGRV
FT                   LAAMLEGNAAMEISQVTDEEALERLAEISELFEFVSGSVDEILETSPELFQVRESANSI
FT                   FTVSQTLLDKASELAAGFEDLADGRAINTLFGYVLGGLALGSIILIGLVMVRETNRRLA
FT                   ETAEKNERNQAAILRLLDEIADLADGDLTVAATVTEDFTGAIADSINYSIDQLRDLVAT
FT                   INLTAVQVAGAAQETQATAMHLAEASEHQAQEIAGASAAINEMAVSIDQVSANASESSA
FT                   VAERSVAIANKGNEVVHNTITGMDNIREQIQDTSKRIKRLGESSQEIGDIVSLINDIAD
FT                   QTNILALNAAIQASMAGDAGRGFAVVADEVQRLAERSSAATKQIEALVKTIQTDTNEAV
FT                   ISMEQTTSEVVRGARLAQDAGVALEEIEKVSKTLAALIQNISNAARQQASSAGHISNTM
FT                   NVIQEITSQTSSGTTATAKSIGNLAKMASEMRKSVSGFTLPDA"
FT   sig_peptide     420444..420560
FT                   /locus_tag="Pmen_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.850) with cleavage site probability 0.473 at
FT                   residue 39"
FT   gene            422541..423401
FT                   /locus_tag="Pmen_0407"
FT   CDS_pept        422541..423401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0407"
FT                   /product="Protein-glutamate O-methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="PFAM: MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83180"
FT                   /db_xref="GOA:A4XPB4"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPB4"
FT                   /protein_id="ABP83180.1"
FT                   /translation="MQSAGVWALRPVADMSQADFHDWQTLLEARTGVVISEQRRAFLQT
FT                   NLSARMRELGVTDYASYYQQVTDGPRGAVEWSTLLDRLTVQETRFFRHGPSFEVLAQYL
FT                   QERLAAGLGKPWEFWSVGCSSGEEPYSLAIMAAEALQGSELPEHFAVTGTDISQGVLSK
FT                   AREACYSARRLEQVSDELRERYFLAQADGRFKVVPSLAARVCCARLNVLELANAPMCGM
FT                   DVIFCQNLLIYFRRWRRRDILNRLAESLAPGGLLVVGVGEVAGWQHPQLVPVADERVLA
FT                   FTRKG"
FT   gene            423412..430683
FT                   /locus_tag="Pmen_0408"
FT   CDS_pept        423412..430683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0408"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83181"
FT                   /db_xref="GOA:A4XPB5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPB5"
FT                   /protein_id="ABP83181.1"
FT                   /translation="MSGVAMGDRHDYVALEWVKGEIGETLKQARQALEAFVENPQDPTR
FT                   MRFCLTYVHQVHGTLQMVEFYGAALLAEEMEQLAKALMEGRVANQGEALEVLMQAILQL
FT                   PVYLDRIQTARRDLPMVVLPLLNDLRAARGEKLLSETSLFSPDMSARMPALPEGSMVRL
FT                   RTAELPVLLRKLRQMLQMALVGVIRNQDLATNLGYMARVFARLETLCQDAPLGGLWQIA
FT                   SGMVEGLANGSVVNGTSVRTLLRQVDKELKRLVEQGADGINQSAPDELTKNLLFYVAKS
FT                   PAQSPRIRALKEQYRLDEALPDTDVVDEERARLAGPDRDAMRSVVAALCEELVRVKDSL
FT                   DLFVRSDRTQPGELDALLAPLKQIADTLAVLGFGQPRKVILDQIDVVHSLSLGQREPND
FT                   AVLMDVAGALLYVEATLAGMVGPSDDSKNEQSHLPTTDVAQIHQLVIKEARNGLEQAKD
FT                   AIIEFIASQWNHEHLARVPGLLTQVRGGLAMIPLQRAADLLNACNRYIQEQLLACKAVP
FT                   NWQSLDTLADAITSVEYYLERLAEDHGTQGDLILDVAEESLETLGYPLKEKPSILDRVE
FT                   SQEESLAPLADPLQEIELLSAEDEQLEEPLAEIEPLALEPDEPANDIVVDLPSLDDEPE
FT                   LPATSESADTFTFELDELEELPALQSEEIVAAPLLDAEQEPALELEELSLDLQAETPQW
FT                   DELELADLDLPEVELPSAPESVPELDAVAAEKPLSMADVMAAPVQAINPPAADVPPSLL
FT                   PPPADEEPVDDDLLEVFIEEAGEVLETIAEYLPQWQADTANKEALVEVRRAFHTLKGSG
FT                   RMVRALVLGELAWSIENLLNRVMDRSIEPSAPVQQVVLDVVALMPALVEEFAAKAQRQR
FT                   DDVDLLAATAHALAKGLTPPKSNAPAAQQVAEPVGVDDATEVVAHDQVPDDEPIAGDSP
FT                   IDEPLDGEPLDPQLLEIFRNEAETHLDTLVGFLADCAQELPQPVTDSLQRALHTLKGSA
FT                   YMAGILPVAEIAAPLEKLVKEFKTNLIQVDLAAAELLSTAEGLFRAGLDNLESQPLAPI
FT                   PGAEAFLARVQALHQERLASAEDERQAQSGETRDPQLIGIFLAEGMDILLDAEDLLRKW
FT                   REHPSERQELSALLEELTTLGRGAEMAELPQVDELCEALLDLYGAVEEGSLAVSERFFD
FT                   EAEKAHEALIGMMDQVAAALQVSPQPERVQALRDLLSEAIDPNTLALLTPGAEGMEIIE
FT                   LDQATAEAEQALAEPHSVEPFAEAESVEDAGEAPQAEDESAAAYADLDEEMVEIFLEEA
FT                   VDILESAAQALERWLGEPDNTLPLSALQRDLHTLKGGARMAAIRPIGDLGHELESLYEG
FT                   LVDRRYSHSPALGTLLQQSHDRLAQMLDQLQARQTLASADELILAIRQFRHGGAPHSLS
FT                   AAVAHVEPAPESPLSELPEPEVERIELPPLALVEDEIVFDEVPEPEAQSPTVESVEPPL
FT                   PQALPAVDETLPEPQSMTLANWHDERDPELVEIFLEEGFDIIDSAGAALQRWMANVDNS
FT                   IELEALQRDLHTLKGGARMAEIREIGDLAHELEFLYEDLGAGRLRASPELFGLLQACHD
FT                   RLAEMLDAVRGQRVVPQGTALIETIKRFRGNPNEQLSIPQAVQLKAVVDSDAAEEADSD
FT                   ILDIFLEEGDDLLEAMEAVIGRFETQRDDVSAIEEMQRILHTLKGGARLAGQKRLGDLS
FT                   HDLEQHLTEALQQGAPWPESLFLDVQSGFEGLQQELDLLRQRLSASLAGQEEAAPVSEA
FT                   DPGANTLTPLLNPIVAASDVPSQVQARKVLPFVQRAQEAAQEAAARRAPQELVKVPAEL
FT                   LEGLVNLAGETSIFRGRVEQQVSDVGFTLSEMEATIDRVRDQLRRLDTETQAQILSRYQ
FT                   AEAERAGYEDFDPLEMDRHSQLQQLSRALFESASDLLDLKETLAAKNRDAETLLLQQAR
FT                   VNTELQEGLMRTRMVPFDRLVPRLRRIVRQVAGELGKQVEFVVGNAEGEMDRTVLERIV
FT                   APLEHMLRNAVDHGIEQAEVRRAAGKPDTGTIRLNLGREGADIVLTLDDDGAGIRLDAV
FT                   RRKAIERGLMDADSDLSDHEVLQFILEAGFSTAEKVTQISGRGVGMDVVHSEVKQLGGS
FT                   MSIESSLGQGTRFTIRLPFTVSVNRALMVYSGEDLYAIPLNTIEGIVRVSPFELEAYYA
FT                   PDAPRFEYAGQTYELKYLGDLLNNGQQPKLVGQSLPLPVILVRSSEHAVAVQVDSLAGS
FT                   REIVVKSLGPQFAGVHGISGATILGDGRVVVILDLLATIRVRHAHLQNQLMPRLASRQA
FT                   ANEEVEADRPPLVMVVDDSVTVRKVTSRLLERNGMNVVTAKDGVDAIAQLQEHRPDIML
FT                   LDIEMPRMDGFEVATLVRHDERLKDLPIIMITSRTGEKHRERAMSIGVNQYLGKPYQES
FT                   LLLDTIAQLVGSHRVKRT"
FT   gene            430680..431699
FT                   /locus_tag="Pmen_0409"
FT   CDS_pept        430680..431699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0409"
FT                   /product="CheB methylesterase"
FT                   /note="PFAM: CheB methylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83182"
FT                   /db_xref="GOA:A4XPB6"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPB6"
FT                   /protein_id="ABP83182.1"
FT                   /translation="MTDKTSARIAVIADTSLQRHVLQQALAGGGYQVVLNSDPARLDEE
FT                   QLAACETDLWLVDLAQSEDSPLVDSLLERVSAPVLFGEGHAPERHSENYPRWERSLFGK
FT                   LKRLVGDPTQAVGPSLQALLDEAQRPARLELPQALANTPLKAGEPARQVWLLAASLGGP
FT                   AAVKAFLDALPGGLPIGFIYAQHIDASFEAALPQAVGRHSQWHVNSARHGDPVRCGEVV
FT                   VVPISNELGFAEDGAMQIAERGWPEPYSPSIDQMMLNLAQQFGAQCGVIAFSGMGSDGS
FT                   AAAAYVKRQGGLIWTQRADSCASPSMPDSLREGGYSSFSADPRELAVALVNHLAEHCS"
FT   gene            431710..432180
FT                   /locus_tag="Pmen_0410"
FT   CDS_pept        431710..432180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0410"
FT                   /product="putative CheW protein"
FT                   /note="PFAM: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83183"
FT                   /db_xref="GOA:A4XPB7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPB7"
FT                   /protein_id="ABP83183.1"
FT                   /translation="MSQAVATQNSAASLTGLLVPLADRTLLLPNVAVAELIPYRAPQVT
FT                   EGTPDWFLGQIAWRDLRLPLLSFEAASGGQAHVASGARVAVINALGGRPKVKFIALLVQ
FT                   GIPRSLKVGSDLPAADVELAPLELGAARVGEEVVRIPDLVALEQLLADAGLI"
FT   gene            complement(432261..433742)
FT                   /locus_tag="Pmen_0411"
FT   CDS_pept        complement(432261..433742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0411"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83184"
FT                   /db_xref="GOA:A4XPB8"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPB8"
FT                   /protein_id="ABP83184.1"
FT                   /translation="MNELVSTINGLVWSPALIYLCLGVGLYFSLRGRFLQVRHFKEMIR
FT                   LMFTGKTDEHGITSFQALTMTLAGRVGTGNIAGVATAITFGGPGAVFWMWMVAFLGASS
FT                   AFVESTLGQVYKEKLNGEYRGGPAFYIERGLGLKWYAWLFAIVTVFACGLLLPGVQANS
FT                   IASSAQTAFGIDPNVTAAALAVLIGLIIFGGVKRIAHFTQVVVPFMALGYILVAMVIIL
FT                   LNIEKLPEVLLLIVKSAFGLEAGFGAIVGMAIQWGVKRGVYSNEAGQGTGPHASSAAAV
FT                   SHPVKQGLVQGFSVYIDTLFVCSATAFMLLITGQYNVQAPDGSAMFTGIAGVAAGPGYV
FT                   QTAMENMMPGFGNAFVAIALFFFAFTTILAYYYIAETNIAYINRKVKRPILTLLLKFGI
FT                   IAATVYGTVHTATFAWDLGDLGVGLMAWLNIIAILLMHKVAYKCLKDYEQQLDEGKDPV
FT                   FHPEKLGIKNADYWGTSTSEENLNIEKGEVQQPQR"
FT   gene            complement(433950..434675)
FT                   /locus_tag="Pmen_0412"
FT   CDS_pept        complement(433950..434675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0412"
FT                   /product="16S rRNA m(3)U-1498 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: protein of unknown function DUF558"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83185"
FT                   /db_xref="GOA:A4XPB9"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPB9"
FT                   /protein_id="ABP83185.1"
FT                   /translation="MRLSRFFIDAPLSLGQHDLPEAQAHYIGRVLRHAVGDALQLFDGS
FT                   GQEYLGELIEVGKKSVRVELREAIAGMSESPLRIHLGQGLSRGERMDWAIQKATELGAA
FT                   EITPIVSARCEVRLKDERADKRMAHWRQVAISACEQCGRSVLPLINPPLELAAWLQQIE
FT                   ADLKLVLHPVAAPLQSHDKPNSLAFLVGPEGGLSEAEVDQTKAAGFHAARLGPRVLRTE
FT                   TAPVVALSVAQQLWGDLQA"
FT   gene            complement(434805..436208)
FT                   /locus_tag="Pmen_0413"
FT   CDS_pept        complement(434805..436208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0413"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.62"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83186"
FT                   /db_xref="GOA:A4XPC0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPC0"
FT                   /protein_id="ABP83186.1"
FT                   /translation="MSLNDHWMQRDLNVLWHPCTQMKDHERLPLVPIRRASGVWLEDFD
FT                   GTRYLDAVSSWWVNVFGHANPRINQRIKDQLENLEHVMLAGFTHEPVIELSERLVAITP
FT                   AGLNKVFYADNGSSGIEVALKMSFHYWLNNGQANKKRFVTLSNSYHGETVAAMSVGDVS
FT                   LFTDTYKPLLLDTLKVPSPDCYLRPEGVSWEEHSRVMFAHMEQTLAEHHHEVAAVIVEP
FT                   LIQGAGGMRMYHPVYLKLLREACDCYGVHLIHDEIAVGFGRTGTMFACEQAGITPDFLV
FT                   LSKALTGGYLPMAAVLTTDQVYSAFYDDYATLRAFLHSHTYTGNPLACAAALATLDIFR
FT                   DDDVIERNKTLAARMASATAHLAEHPHVAEVRQTGMALAIEMVADKAGKTAYPWQERRG
FT                   LRVYQHALERGALLRPLGSVVYFLPPYVITPEQIDFLAEVASEGIDIATRSSVSVAVDD
FT                   RFPDHRDPG"
FT   gene            complement(436372..437868)
FT                   /locus_tag="Pmen_0414"
FT   CDS_pept        complement(436372..437868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0414"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83187"
FT                   /db_xref="GOA:A4XPC1"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPC1"
FT                   /protein_id="ABP83187.1"
FT                   /translation="MSIVGHLINGELRTDASRTQDIFNPATGLAEKQLALAPKATVEEA
FT                   IATAEAAFPQWRDTPPIKRARVMFRFKELLEQHADEICRLIGQEHGKIVHDAAGELQRG
FT                   IENVEYACGAPELLKGEHSKNVGPNIDSWSEFQPLGVVAGITPFNFPVMVPLWMFPMAI
FT                   VCGNTFVLKPSERDPSSTLLLGKLLHEAGLPAGVFNIVNGDKEAVDTLLHDSRVQAVSF
FT                   VGSTPIAEYIYATASANGKRCQALGGAKNHAIVLPDADMDNVVNSLLGAAFGSSGERCM
FT                   ALSVAVAVGDKAADELISKMQEAIKGLKVGAYDDKSNDFGPVITREHQARVVGHISSAE
FT                   AQGATVVVDGRDPQIEGYANGFFVGATLIDHVTTDMDSYKAEIFGPVLQVVRVSTMREA
FT                   MDIIDAHEYGNGTCIYTRDGEAARYFSDHIKVGMVGINVPLPVPVAYHSFGGWKRSLFG
FT                   DLHAYGPDAVRFYTRRKTVTQRWPSANVREGAEFSMPTMK"
FT   gene            complement(437939..439096)
FT                   /locus_tag="Pmen_0415"
FT   CDS_pept        complement(437939..439096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0415"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83188"
FT                   /db_xref="GOA:A4XPC2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPC2"
FT                   /protein_id="ABP83188.1"
FT                   /translation="MASIILPRVLEVGSGAIQKLPELLATLACRKPLIITDKMMVKLGY
FT                   SDRIQTLLAASGIDSEVFDDTVPEPTAASIQAGVDKVRQGDYDAIVALGGGSPIDSAKA
FT                   IAILGKFGGEIRDYRFPRQVNETGLPIIAIPTTAGTGSEATRFTIITDETTDEKLLCVG
FT                   VGFMPIAALVDFELTLSLPARTTADTGIDAMTHAIEAYVSKKASPYSDQQALAAMRLIG
FT                   PNLRRAYHDGSDREAREAMMLGSTLAGIAFSNASVALVHGMSRPIGAFFHVPHGLSNAM
FT                   LLPAVTAYSIPAARERYADCARALGFASQQDSNEQANEKLLATLVALNAELQVPTLAEF
FT                   GVGREKFFSVVQTMAEQALASGSPGNNPRVPSTEEMVQIYTRLWA"
FT   gene            complement(439138..440532)
FT                   /locus_tag="Pmen_0416"
FT   CDS_pept        complement(439138..440532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0416"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Gluconate transporter; Citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83189"
FT                   /db_xref="GOA:A4XPC3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPC3"
FT                   /protein_id="ABP83189.1"
FT                   /translation="MAGLLGIALSLALLIYLAYRGINVLILAPLLALLAVICSGEGDRL
FT                   LGTYTQVFMHSLGGYIIKYFPLFMLGAIFGKLMDDSGSARTIAYWLIRQLGSQRAVLAI
FT                   GLACGLLTYGGVSLFVVGFAVFPIAAALFREAQVPKRLIPGAIALGSLSFTMTALPGTP
FT                   AIQNAIPMPFFGTDAFAAPILGLIGALIMFIGGISWLEYRTRQARRAGEGYGDHDEHDD
FT                   ATSGEKTGMPSLTVALVPILLVIVANFVLSKYLLPQLDSSYLAEPKYGSTELSAVIGLW
FT                   SIITALVMACVVLVLLNWNKWVDLKSTINKGTLGSLLPIFNTASEVGYGSVIASLAAFV
FT                   VLREFMVGLSPDNILISEAIVVNVLAGITGSASGGLSIALNTMGDTYLQLAQAAGISPE
FT                   LLHRVASMASGGLDTLPHNGAVVTLLAICGLTHRSSYADIFMVTIPPTIAGLAVVITLG
FT                   TLFGSF"
FT   gene            440708..441466
FT                   /locus_tag="Pmen_0417"
FT   CDS_pept        440708..441466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0417"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83190"
FT                   /db_xref="GOA:A4XPC4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPC4"
FT                   /protein_id="ABP83190.1"
FT                   /translation="MSENKKEKGSSITRVLEIIEMLSQAQRPMAPADIAHYLDIPKPSI
FT                   HRLLQQLEADGFLQVDLRGLWGPGAKLHGLAWAVLRNQRFKNERMAILHELAGKIGETC
FT                   GISIPHGLDMVYADRVHANWPLQIHLPEGSQVPIWCTASGKLYLSSFPRAQRDRIISKL
FT                   PLTRMTCNTLCTLDALKAELDRTCERGMGVDNEEFVDGMVACSVPVADDEGVLLACLFV
FT                   HAPVIRVSAEQLMAFKPLLTDAAAELANLL"
FT   gene            441564..442154
FT                   /locus_tag="Pmen_0418"
FT   CDS_pept        441564..442154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0418"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83191"
FT                   /db_xref="GOA:A4XPC5"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPC5"
FT                   /protein_id="ABP83191.1"
FT                   /translation="MFTVRLAQSSLRMTSMQWRNTSSRYGLVSILMHWVVALAVFGLFA
FT                   LGFWMVGLSYYDPWRQTAPDLHKSIGVVLFALMLLRVLWRLLNPAPAPLASHGKLTRQA
FT                   SRLGHVLLYLGLFGVMLSGYLISTADGRGIEVFGLFSVPATLTGIAQQEDIAGAIHEYL
FT                   AWGLVIFAALHGLAALKHHFIDRDSTLLRMFGR"
FT   gene            442213..442788
FT                   /locus_tag="Pmen_0419"
FT   CDS_pept        442213..442788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0419"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83192"
FT                   /db_xref="GOA:A4XPC6"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR023480"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPC6"
FT                   /protein_id="ABP83192.1"
FT                   /translation="MLKNALAALVLGSALIGGQAMAADYAIDKQGQHAFVNFKISHLGY
FT                   SWLYGTFKDFDGKFSFDAANPEASKVSVTLNTASVDTNHAERDKHIRSADFLNVSKHGT
FT                   ATFESTSVKSTGEGTADITGDLTLNGVTKPVVIAAKFIGEGKDPWGGYRAGFEGTTTLK
FT                   LKDFDITKDLGPASETVELILSIEGIRQ"
FT   sig_peptide     442213..442281
FT                   /locus_tag="Pmen_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(442890..444776)
FT                   /locus_tag="Pmen_0420"
FT   CDS_pept        complement(442890..444776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0420"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83193"
FT                   /db_xref="GOA:A4XPC7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPC7"
FT                   /protein_id="ABP83193.1"
FT                   /translation="MSFASLGLSEALVRAVEAAGYTQPTPVQQRAIPAVLQGRDLMVAA
FT                   QTGTGKTGGFALPILERLFPDGHPDREQRHGPKQPRVLVLTPTRELAAQVHDSFKLYAR
FT                   DLKFVSACIFGGVGMNPQVQALAKGVDVLVACPGRLLDLANQKAIDLSHVEILVLDEAD
FT                   RMLDMGFIHDVKKVLAKLPAKRQNLLFSATFSKDITDLAGKLLHNPERIEVTPPNTTVE
FT                   RIEQRVFRLAASHKRALLAHLITQGAWEQVLVFTRTKHGANRLAEYLEKHGLPAAAIHG
FT                   NKSQNARTKALADFKANKVRILVATDIAARGLDIDQLPHVVNFELPNVEEDYVHRIGRT
FT                   GRAGRSGEAISLVAPDEEKLLKSIERMTKQKIPDGDLMGFDASAVEAERPEVREPRQPR
FT                   NAGQKKQKAEGGDKPKGERHGSGRKDKGKDSGKEQKAKPQGQKRRGQGPRNDGPSQPAA
FT                   AIPPLPPDRDPEEFLDDEIDNFGNRVDYVSPNQNKQQGRGRRPGAAPANGAPQGQRQNG
FT                   KGPRNNNGGGNGAGKNRRQGSGQGGQPGQGRNGSNRGRGRPAHDGRITSLDRDELPRTE
FT                   AAVRNPREKQPVIVHKGSRLDRFPTAEQLDELSNSTRPRGEKPALLTRNRDE"
FT   gene            complement(444964..445722)
FT                   /locus_tag="Pmen_0421"
FT   CDS_pept        complement(444964..445722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0421"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83194"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPC8"
FT                   /protein_id="ABP83194.1"
FT                   /translation="MPLFQRQIIATLLLYCCAFAARGETLRLVTDAWAPYVYEEDGQAA
FT                   GLDYELTREVLQRLGVKLDLQFLPWKRCLLELEQGNADGILDIFHLPEREASMLFVEEP
FT                   LSDVELVLFYARNRPYPYDSLEDLRDLVIGISPGYWYNDETFRNSPLFSREVAPTHEAN
FT                   LGKLIRHRVDLVINDRRAGLYLTTQMGLQQQVDYNRKAVGHDRLYLALRHDPALASLAR
FT                   DFADELRRFKREPAYAQLQQRYANPDRLRP"
FT   sig_peptide     complement(445651..445722)
FT                   /locus_tag="Pmen_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.883 at
FT                   residue 24"
FT   gene            complement(445775..447148)
FT                   /locus_tag="Pmen_0422"
FT   CDS_pept        complement(445775..447148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0422"
FT                   /product="conserved hypothetical protein 730"
FT                   /note="PFAM: conserved hypothetical protein 730"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83195"
FT                   /db_xref="InterPro:IPR021826"
FT                   /db_xref="InterPro:IPR027820"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="InterPro:IPR037153"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPC9"
FT                   /protein_id="ABP83195.1"
FT                   /translation="MLKRPRINASVSPKGSLETLSQREVQQLRETGSGSVYHLFRQCAL
FT                   AILNTGSHSDNAKTILEAYPDFEVKIHQQDRGIRLELINAPADAFVDGEMITSTHEMLF
FT                   SALRDIVYTQSELENKRIDLDSSEGITDYVFHLLRNAQTLRSGVEPKIVVCWGGHSIST
FT                   EEYKYTKKVGHELGLRGLDICTGCGPGVMKGPMKGATISHAKQRNLKGRYLGLTEPGII
FT                   AAEAPNPIVNELVILPDIEKRLEAFVRVGHGIIIFPGGAGTAEEFLYLLGILIHPDNQD
FT                   LPFPVILTGPKSAEPYLQQLHDFIGATLGEAAQQRYRMIVNAPAKVAREMAAGIKAVHQ
FT                   FRRERNDAFHFNWLLKIDESLQHPFEPTHEAMASLNLTREQPLHHLAANLRRAFSGIVA
FT                   GNVKENGIRLIEEHGPYEIRGETTIMRPLDRLLQAFVEQHRMKLPGGSAYEPCYRIVD"
FT   gene            complement(447247..448011)
FT                   /locus_tag="Pmen_0423"
FT   CDS_pept        complement(447247..448011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83196"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021488"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD0"
FT                   /protein_id="ABP83196.1"
FT                   /translation="MGAATQVLLVGLLLLAAGLPAQAARVDASEHQAFWLWAGVTPQPV
FT                   LAQARTLYVLQGQIDGPRRAGNPSARMQAQNPATPRLSKDVELWVVYRAHTLDWNDEVF
FT                   ALLLSQLQRWQRSGNRVSGVQIDFDAQTLRLDRYAAFLEDLRQRLPRQYRLSITGLLDW
FT                   AGNADPVALNRLAGVVDEVVMQTYQGRHSIAGYQRYLPSIARLQLPFRIGLIQNGEWQA
FT                   PDYLQSSPWFRGYVVFLLNPSEPATDTPSARP"
FT   sig_peptide     complement(447940..448011)
FT                   /locus_tag="Pmen_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            complement(447981..448847)
FT                   /locus_tag="Pmen_0424"
FT   CDS_pept        complement(447981..448847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83197"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD1"
FT                   /protein_id="ABP83197.1"
FT                   /translation="MNALAFSQETLRGLALEAKGEQAAALQHWQTLLARSQDPLQRAQL
FT                   QLALALNHERSGELGKVFAADSPITTAPIRERLLTYGAGPELLRQQAGNEQAPADERAT
FT                   ALYALLYRDLDYGRYADFLRDFAQFPYKATQPAQHLDPGLFAWSGGSDAGYVCPSLVRI
FT                   AERLAANAEDAQGMLCLGDFIRIHGLDDHWLNRPPATGELGSAPSQFQGASFSRLAAYQ
FT                   LLLTAPQVSREDKAYALFRAINCYAPSGYNSCDGQDISKDQRKQWFQTLKRSYADTQWA
FT                   QRLKYYW"
FT   gene            449065..450111
FT                   /locus_tag="Pmen_0425"
FT   CDS_pept        449065..450111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0425"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="TIGRFAM: recA protein; PFAM: RecA domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83198"
FT                   /db_xref="GOA:A4XPD2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD2"
FT                   /protein_id="ABP83198.1"
FT                   /translation="MDQAKSKALEAALSQIEKQFGKGSIMRLGSDRTMDIDVISTGSLG
FT                   LDIALGVGGLPRGRIVEIYGPESSGKTTLTLSVIAEAQRQGLTCAFVDAEHALDPIYAA
FT                   KLGVNIDELLCSQPDTGEQALEIVDILTRSGAVNLIVVDSVAALVPKAEIEGEIGDSHV
FT                   GLAARMMSQAMRKITGNLKNSNTMCIFINQIRMKIGVMFGSPETTTGGNALKFYASVRL
FT                   DIRRTGAVKEGEEVVGSETRVKVVKNKVAAPFRQAEFQIVYGQGISKAGEIVDLAVANN
FT                   FVEKSGAWYSFEGNKIGQGKANTMKWLLENKPTMDKLEGMIREKLMSKPQAETSARLAT
FT                   QEELADDY"
FT   gene            450481..451080
FT                   /locus_tag="Pmen_0426"
FT   CDS_pept        450481..451080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0426"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83199"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD3"
FT                   /protein_id="ABP83199.1"
FT                   /translation="MSRFVPADRDTAYLLSPSVDEWLPADHLARFVVEVIEQLDLSELT
FT                   GQYAGRGSAVLLGLLIYGYANGMHSSRKIERATYDSVAFRYVAANTHPDHDTLATFRRR
FT                   FLKEVESLFVQVLMLAREMKLLKLGHIALDGTKIQANASKHKALSWAHANKIEAQLRQE
FT                   VQQLLALTESSDRSAIPDGMEVPAENIKRLHVLRAM"
FT   gene            451432..452733
FT                   /locus_tag="Pmen_0427"
FT   CDS_pept        451432..452733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0427"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83200"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD4"
FT                   /protein_id="ABP83200.1"
FT                   /translation="MNNLTFSSPDLSSFCQLNNLGLTATGQHLCAERAVIECRLTKAPE
FT                   PCPKCGAAGVSRGTVDRHLAHTPYGQRPTRLLLRIRRWRCACGCFWHEDTNSAAPPRSK
FT                   LSYGAIRWALAAIVLDHLSVSRVASQLDVAWHTANNAIINEGRRLLFNDSTRFDGVTVL
FT                   GVDEHVWRHTRCGDKYVTIVVDLTPVRNKNGPARLLDVLEGRSKQAFKQWLQSRPKSWR
FT                   DQIESIAMDGFTGFKSAAQEALPQAQTVLDPFHVVRWASNMLDECRRRVQHDILGRRGR
FT                   KNDPLYKSRRTLLTRISYLSDANKKQLFQLFADEHHLEVDCTWSMYQRVVSAYNEPDRK
FT                   RGKKLMEEVINIITASDLPKALIEVKGLGETLKKYAESILAYFDRPGTSNGPTEAINGR
FT                   LEHLRGTALGFRNLTNYIARCLLKSGGFRNQLHP"
FT   gene            452888..453346
FT                   /pseudo
FT                   /locus_tag="Pmen_0428"
FT   gene            453606..456260
FT                   /locus_tag="Pmen_0429"
FT   CDS_pept        453606..456260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0429"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83201"
FT                   /db_xref="GOA:A4XPD5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD5"
FT                   /protein_id="ABP83201.1"
FT                   /translation="MKIIINNDFPVAKVGADQITTLVSAKVHSCIYRPRLSIADGAAPR
FT                   VCLYRAPPGYGKTVALAFEWLRHRTAGRPAVWLSLRASSYSEFDICAEIIEQLETFEMV
FT                   KFSRVREGVSKPALLRDLASSLWQSTSNNEIETLVCLDNINHDLDLPLLHALMEFMLNT
FT                   PKNIRFAVAGNTIKGFSQLKLAGAMREYTEKDLAFSAEEAVAVALAEAESVLGVPEEQI
FT                   ETLVQEVEGWPALVVFLLKRELPAKHISAVVEVDNYFRDEIFEAIPERYRVFLANSSLL
FT                   DFVTPDQYNYVFKCVNGVSCIKYLSTNYMLLRHVSGEPAQFTLHPVLRNFLREITWTEN
FT                   PAKRSYLLKRAAFWHWRRGEYQYAIRISLRANDCRWAVSMSERIILDLSFRQGEIDALR
FT                   QWLSELPKQAWHKKPIVLISYAWVLYFSQQGARAEKLIKDLSSQSDKKNKWQEKEWLQL
FT                   VLAIGKATKDEMLSSEELCNKWISLFGDSNAVGKGAALTCLAFIFASEYRFAELEKVLA
FT                   QAQAVNKFAKQNFAFGWLYVARFQQALASGKMGWARQIITQARTDSRAQMMESEFTSKM
FT                   FDALELELHYELRCLDTSEEKLSKILEFISNHGVTDVFFSVCRAVSAWRLGRSDLNGSI
FT                   EILEWAKAHAVEKNLPRLEVMSQIEIYQRLVCQGITGINNLKTLEDHKIFSGQHSAPLK
FT                   ARLLLVQSLVLSRDQNFHSAAHRALLAIQQARKINAGQLEVRGLLCLAGAQAGAGDLKK
FT                   AQLNIVYAVEIAKQLQCFQTVLDEVCLIERIIPASCEAFTAVNLDQAIGAFSLPRIVEI
FT                   GKSAENKADALLTRKQIAVLRLVKEGCSNKQIATNMHVTEDAIKWHMRKIFATLNVVNR
FT                   TQATIEAERQGII"
FT   gene            456310..457467
FT                   /locus_tag="Pmen_0430"
FT   CDS_pept        456310..457467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0430"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83202"
FT                   /db_xref="GOA:A4XPD6"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD6"
FT                   /protein_id="ABP83202.1"
FT                   /translation="MAIVVVGAGTAGVNAAFWLRQYGYKGEIRIFSRESVAPYQRPPLS
FT                   KAFLTSEIAESAVPLKPEGFYTNNNITISLNTPIVSIDVGRKIVSSKDGKEYAYEKLIL
FT                   ATGASARRLTCEGSELSGVCYLRSMEDAKDLRRKLVESASVVVLGGGVIGLEVASAAVG
FT                   LGKRVTVIEAAPRVMARVVTPAAANLVRARLEAEGIEFKLNAKLTSIKGRNGHVEQCVL
FT                   ESGEEIQADLIVVGIGAIPELELATEAALEVSNGVVVDDQMCTSDTSIYAIGDCAMARN
FT                   PFWGTMVRLETIHNAVTHAQIVASSICGTSTPAPTPPRFWSDLKGMALQGLGALKDYDK
FT                   LVVAINNETLELEVLAYKQERLIATETINLPKRQGALAGSIKLPD"
FT   gene            complement(457751..459313)
FT                   /locus_tag="Pmen_0431"
FT   CDS_pept        complement(457751..459313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0431"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83203"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD7"
FT                   /protein_id="ABP83203.1"
FT                   /translation="MIAVPAPLPDDPILLKHLLLLASEQAAAKDARIEQLQEQVALLRH
FT                   KLFSPKSERSPEDADSPQLAMFNEVEELIEAAAAPSEAEAEAEAEAEEIVAPVKRRGKR
FT                   KPLPANLPRVEVIHDLPEHELTCACGACKQVIGEETSEQLEIIPMQVRVIRHIRKTYAC
FT                   KACEAAPLTADKPAQLIEKSLASPSVLAMLLTTKYADGIPLYRFEKMLSRHGVDIPRQT
FT                   LARWVIQSGEQLQPLLNLLRDKLLEYPVLHCDETRLQVLHEPGRDPTAQSWMWVQSGGP
FT                   PDKPVILFDYTASRAQEVPLRLLDGYRGYLMTDDYAGYNAVAAQEGIERLGCWAHARRK
FT                   FVEAQKVQPKGKTGRADMALNLINKLYGIERDLKDACDTERLVARQQRSQPLLDQLKTW
FT                   LDKTQPQVVGQTALGRAVNYLASNWRKLVRYVEGGHLPIDNNRAENAIRPFVIGRKNWL
FT                   FSDTPKGATASAQIYSLIETAKANGQEPYAWLRHILERLPAANSVEDYEALLPWNCSPV
FT                   SAS"
FT   gene            complement(459333..459692)
FT                   /locus_tag="Pmen_0432"
FT   CDS_pept        complement(459333..459692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0432"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83204"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN95"
FT                   /protein_id="ABP83204.1"
FT                   /translation="MMRPDAKVQKVYLYPKPVDFRKSINGLAALVELDIKVEVFNPVLF
FT                   VFLNRTRSQVKILYWERNGFCLWLKRLEAERFKTKPDAGDEAIELTVDELNWLLDGIDL
FT                   WRNRPHQILTPRFVT"
FT   gene            459892..460230
FT                   /locus_tag="Pmen_0433"
FT   CDS_pept        459892..460230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0433"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83205"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD9"
FT                   /protein_id="ABP83205.1"
FT                   /translation="MMRPDTKVQKVCLYPKPVDFRKSINGLPLLFVFLNRTRSQDKILY
FT                   WERKGFCLWLKRLEAERFKTKHNAGDTRADLDLKRQVHAQVFPEALSPLAAGGTRAGVD
FT                   VVEWLRRL"
FT   gene            complement(460424..461986)
FT                   /locus_tag="Pmen_0434"
FT   CDS_pept        complement(460424..461986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0434"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83206"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD7"
FT                   /protein_id="ABP83206.1"
FT                   /translation="MIAVPAPLPDDPILLKHLLLLASEQAAAKDARIEQLQEQVALLRH
FT                   KLFSPKSERSPEDADSPQLAMFNEVEELIEAAAAPSEAEAEAEAEAEEIVAPVKRRGKR
FT                   KPLPANLPRVEVIHDLPEHELTCACGACKQVIGEETSEQLEIIPMQVRVIRHIRKTYAC
FT                   KACEAAPLTADKPAQLIEKSLASPSVLAMLLTTKYADGIPLYRFEKMLSRHGVDIPRQT
FT                   LARWVIQSGEQLQPLLNLLRDKLLEYPVLHCDETRLQVLHEPGRDPTAQSWMWVQSGGP
FT                   PDKPVILFDYTASRAQEVPLRLLDGYRGYLMTDDYAGYNAVAAQEGIERLGCWAHARRK
FT                   FVEAQKVQPKGKTGRADMALNLINKLYGIERDLKDACDTERLVARQQRSQPLLDQLKTW
FT                   LDKTQPQVVGQTALGRAVNYLASNWRKLVRYVEGGHLPIDNNRAENAIRPFVIGRKNWL
FT                   FSDTPKGATASAQIYSLIETAKANGQEPYAWLRHILERLPAANSVEDYEALLPWNCSPV
FT                   SAS"
FT   gene            complement(462006..462365)
FT                   /locus_tag="Pmen_0435"
FT   CDS_pept        complement(462006..462365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0435"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83207"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A4XN95"
FT                   /protein_id="ABP83207.1"
FT                   /translation="MMRPDAKVQKVYLYPKPVDFRKSINGLAALVELDIKVEVFNPVLF
FT                   VFLNRTRSQVKILYWERNGFCLWLKRLEAERFKTKPDAGDEAIELTVDELNWLLDGIDL
FT                   WRNRPHQILTPRFVT"
FT   gene            complement(462619..463311)
FT                   /locus_tag="Pmen_0436"
FT   CDS_pept        complement(462619..463311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0436"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83208"
FT                   /db_xref="GOA:A4XPE2"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPE2"
FT                   /protein_id="ABP83208.1"
FT                   /translation="MSFSNYKVIAMPVLVANFVLGAATAWANENYPAKSAGYNQGDWVA
FT                   SFNFSKVYVGEELGDLNVGGGALPNADVSIGNDTTLTFDIAFFVSSNIAVDFFVGVPAR
FT                   AKFQGEKSISSLGRVSEVDYGPAILSLQYHYDSFERLYPYVGVGVGRVLFFDKTDGALS
FT                   SFDIKDKWAPAFQVGLRYDLGNSWMLNSDVRYIPFKTDVTGTLGPVPVSTKIEVDPFIL
FT                   SLGASYVF"
FT   sig_peptide     complement(463228..463311)
FT                   /locus_tag="Pmen_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.976 at
FT                   residue 28"
FT   gene            complement(463413..465056)
FT                   /locus_tag="Pmen_0437"
FT   CDS_pept        complement(463413..465056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0437"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83209"
FT                   /db_xref="GOA:A4XPE3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPE3"
FT                   /protein_id="ABP83209.1"
FT                   /translation="MMLGQMMRNQLVIGSLVEHAARYHGAREVVSVETSGEVTRSCWKE
FT                   VELRARKLASALGKMGLTPSDRCATIAWNNIRHLEVYYAVSGAGMVCHTINPRLFIEQI
FT                   TYVINHAEDKVVFLDDTFLPIIAEIRGSLPKVKAFVLMAHNNSNASAQMPGLIAYEDLI
FT                   GQGDDNYIWPDVDENEASSLCYTSGTTGNPKGVLYSHRSTVLHSMTTAMPDTLNLSARD
FT                   TILPVVPMFHVNAWGTPYSAAMVGAKLVLPGPALDGASLSKLIASEGVSIALGVPVVWQ
FT                   GLLAAQAGNGSKSQSLTRVVVGGSACPASMIREFNDIYGVEVIHAWGMTELSPFGTANT
FT                   PLAHHVDLSPDEKLSLRKSQGRPPYGVELKIVDDEGIRLPEDGRSKGNLMARGHWVIKD
FT                   YFHSDPGSTLSDGWFSTGDVATIDSDGFMTICDRAKDIIKSGGEWISTVELESIAIAHP
FT                   HIVDAAVIAARHEKWDERPLLIAVKSPNSELTSGEVCNYFADKVARWQIPDAAIFVEEL
FT                   PRNGTGKILKNRLREKYGDILLRSSSSVCE"
FT   gene            complement(465130..468215)
FT                   /pseudo
FT                   /locus_tag="Pmen_0438"
FT   gene            complement(465679..466980)
FT                   /locus_tag="Pmen_0439"
FT   CDS_pept        complement(465679..466980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0439"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83210"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPD4"
FT                   /protein_id="ABP83210.1"
FT                   /translation="MNNLTFSSPDLSSFCQLNNLGLTATGQHLCAERAVIECRLTKAPE
FT                   PCPKCGAAGVSRGTVDRHLAHTPYGQRPTRLLLRIRRWRCACGCFWHEDTNSAAPPRSK
FT                   LSYGAIRWALAAIVLDHLSVSRVASQLDVAWHTANNAIINEGRRLLFNDSTRFDGVTVL
FT                   GVDEHVWRHTRCGDKYVTIVVDLTPVRNKNGPARLLDVLEGRSKQAFKQWLQSRPKSWR
FT                   DQIESIAMDGFTGFKSAAQEALPQAQTVLDPFHVVRWASNMLDECRRRVQHDILGRRGR
FT                   KNDPLYKSRRTLLTRISYLSDANKKQLFQLFADEHHLEVDCTWSMYQRVVSAYNEPDRK
FT                   RGKKLMEEVINIITASDLPKALIEVKGLGETLKKYAESILAYFDRPGTSNGPTEAINGR
FT                   LEHLRGTALGFRNLTNYIARCLLKSGGFRNQLHP"
FT   gene            complement(468254..469705)
FT                   /locus_tag="Pmen_0440"
FT   CDS_pept        complement(468254..469705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0440"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83211"
FT                   /db_xref="GOA:A4XPE5"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPE5"
FT                   /protein_id="ABP83211.1"
FT                   /translation="MTIPISLAKLNSSADTHSALEVFNLQKVASSARRGKFGIAERIAA
FT                   LNLLKETIQRREPEIIAALAADFRKPASEVKLTEIFPVLQEINHAKRNLKDWMKPRRVR
FT                   AALSVAGTRAGLRYEPKGVCLIIAPWNYPFNLSFGPLVSALAAGNSVVIKPSELTPHTA
FT                   TLIGSIVREAFSVDLVAVVEGDAAVSQELLALPFDHIFFTGSPRVGKLVMEAASKTLAS
FT                   VTLELGGKSPTIIGPTANLPKAARNIVWGKFSNNGQTCIAPDHVFVHRCIAQKFNEILV
FT                   KEIVRVYGKDFAAQRRSADYCRIVNDQHFNRINKLLTDAKAKGAKILQGGQVDATERLV
FT                   VPTVLSNVTAAMDINHEEIFGPLLPIIEYDDIDSVIKRVNDGDKPLALYVFSEDKQFVN
FT                   NIVARTSSGSVGVNLSVVHFLHPNLPFGGVNNSGIGSAHGVYGFRAFSHEKPVLIDKFS
FT                   ITHWLFPPYTKKVKQLIGITVKYLS"
FT   gene            complement(469752..470285)
FT                   /locus_tag="Pmen_0441"
FT   CDS_pept        complement(469752..470285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0441"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83212"
FT                   /db_xref="GOA:A4XPE6"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPE6"
FT                   /protein_id="ABP83212.1"
FT                   /translation="MVMSMASYKCPDCNYVYDESAGNVHEGFSPGTPWHLIPEDWCCPD
FT                   CAVRDKLDFMLIESGVGEKGVTSTHTSPNLSEVSGTSLTAEAVVAPTSLEKLPSADVKG
FT                   QDLYKTQPPRSDAQGGKAYLKWICITCGHIYDEALGDEAEGFTPGTRFEDIPDDWCCPD
FT                   CGATKEDYVLYEEK"
FT   gene            complement(470321..470719)
FT                   /locus_tag="Pmen_0442"
FT   CDS_pept        complement(470321..470719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0442"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83213"
FT                   /db_xref="GOA:A4XPE7"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPE7"
FT                   /protein_id="ABP83213.1"
FT                   /translation="MSRYQCPDCQYIYDENKGEPHEGFHPNTSWNDIPKDWACPDCAVR
FT                   DKVDFIFLADSPSKETQLGVNSQLANSESGISDATPTGMAVLAAELVIPLNQENKNEGC
FT                   AAKTEVLDQASTPQVVRKSSTRKKMRNK"
FT   gene            complement(470936..472141)
FT                   /locus_tag="Pmen_0443"
FT   CDS_pept        complement(470936..472141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0443"
FT                   /product="alkane 1-monooxygenase"
FT                   /EC_number="1.14.15.3"
FT                   /note="PFAM: fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83214"
FT                   /db_xref="GOA:A4XPE8"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPE8"
FT                   /protein_id="ABP83214.1"
FT                   /translation="MLEKHRVLDSAPEYVDKKKYLWILSTLWPATPMIGIWLANETGWG
FT                   IFYGLVLLVWYGALPLLDAMFGEDFNNPPEEVVPKLEKERYYRVLTYLTVPMHYAALIV
FT                   SAWWVGTQPMSWLEIGALALSLGIVNGLALNTGHELGHKKETFDRWMAKIVLAVVGYGH
FT                   FFIEHNKGHHRDVATPMDPATSRMGESIYKFSIREIPGAFIRAWGLEEQRLSRRGQSVW
FT                   SFDNEILQPMIITVILYAVLLALFGPKMLVFLPIQMAFGWWQLTSANYIEHYGLLRQKM
FT                   EDGRYEHQKPHHSWNSNHIVSNLVLFHLQRHSDHHAHPTRSYQSLRDFPGLPALPTGYP
FT                   GAFLMAMIPQWFRSVMDPKVVDWAGGDLNKIQIDDSMRETYLKKFGTSSAGHSSSTSAV
FT                   AS"
FT   gene            472301..472402
FT                   /pseudo
FT                   /locus_tag="Pmen_0444"
FT   gene            complement(472350..473366)
FT                   /locus_tag="Pmen_0445"
FT   CDS_pept        complement(472350..473366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83215"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPE9"
FT                   /protein_id="ABP83215.1"
FT                   /translation="MNNEKIKKSSPSTATSQAILPSWIHPNSSNMKWYLPRTGTKVTVS
FT                   EDPNSSRYVKLSFDYQLFDGSSTSDLIWNLFIRDLQSSAIALIESSKSKRPCALVGFVR
FT                   TAFEIADHVYEARHRLNQPPKIVTLADITLEDIKTFLEAHDLTLMGINLLNLDTQLGPT
FT                   PRGRENIASCISGMHIPPITQKILIQKLKNNRSDICREFTCTHSANEENEENEEDTLSI
FT                   STIQNKCTNLTYLHSTKEYQIHSFKVGTHDISDVINSMTGRFVDKSQTPLMPTNIAFHY
FT                   ISNAIVFHRNYAPHIRAYIKQLDNHYNREIIDKYAASTIRSKSCLGAATALGPPDSH"
FT   gene            complement(473359..475107)
FT                   /locus_tag="Pmen_0446"
FT   CDS_pept        complement(473359..475107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83216"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPF0"
FT                   /protein_id="ABP83216.1"
FT                   /translation="MSRMREDLVDSIRACCPEDILIWVEKHPPKRRAPLIRVFFMIAHE
FT                   LDSEWYRNPVAITNACRQFLSHRRSAISEITGKPIKEVTVISDYTAVRYYLNRLQKAKK
FT                   LPSNALILPVPNSTDVFSEKECNILGYLTLEHAIQANSMENALNEIAHQIEKHRTVILS
FT                   KCKRIVAEGYARFLEVPGMIRRSDVAAIRLTKDNLDPNLRGSRSGQHISFFSPSHPNGF
FT                   SNSVAYLATEQDGLFTRKSFPGAHHIYSWSTTKIKSYLGITEEFAVAAMCIIIDELGIN
FT                   VFDLANAQVKKTKDGQFVTIREDGGITITTLKPRANKLIERHAPKATDEIEIDAESIDA
FT                   HTALWMLLQMRVQHSKALNSNYLFVMDGSSPTRHGDEHLYRILDTRRKNTFKAIIDSLP
FT                   SWVAEAEPTMPKIRVSRGLLKWIESGGDTLETTIYLGNSLLTALRNYIPPSIQEFVYRR
FT                   RTRDHQKIQLLIAEDISTHSPRIKNNNYECAKMQFIEAVKFLRTNSRHTTTHNPGQVFC
FT                   FLCSPEAIGLIVSYATYGTKQELISTCKKIITKIQDEGSRKMIKLLADATPIPMNFELL
FT                   EVHVNE"
FT   gene            complement(475224..476462)
FT                   /locus_tag="Pmen_0447"
FT   CDS_pept        complement(475224..476462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83217"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPF1"
FT                   /protein_id="ABP83217.1"
FT                   /translation="MTLKHLLPLTLLCALHAPAALASSDMTCTPSWKLISDQLSGCNNL
FT                   AFLSPGNDSRVNLQLLLDDAGHLKLTRQPQALEGYEYGYGLVPFSLGMLDASRALGEAT
FT                   ETDEQGGDPDAAYLTQALQRLGIDSDADALAVHRFAEGEGNRCRSNDLQAMRGFVDALA
FT                   ATPELAASEAQALARSRRSLLSLCGEGDPQTQDILPPATQLQSPAAQAFGNYLRGADAF
FT                   YRGDFEQARERFAELADSEQPWLRETTQYLLGRVALNQAQLNAFDEYGFFSPEQVDNTS
FT                   LDSSAKAFEQYLSNYPQGLYSDSARGLQRRVYWLAADTRRFAEAFARQFERGAQQVDMP
FT                   ALIEELDGKLLPSLAPDAIEDPLLLAMVDLIQLRDPGSNREPRLSLEQLQAQQPRFASQ
FT                   PGLQGKQYGFGFI"
FT   sig_peptide     complement(476394..476462)
FT                   /locus_tag="Pmen_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 23"
FT   gene            complement(476509..477354)
FT                   /locus_tag="Pmen_0448"
FT   CDS_pept        complement(476509..477354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0448"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /note="TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
FT                   PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83218"
FT                   /db_xref="GOA:A4XPF2"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPF2"
FT                   /protein_id="ABP83218.1"
FT                   /translation="MSQERRYSFEFFPTKTEAGHEKLMDVARQLATYKPDFFSCTYGAG
FT                   GSTRDRTLNTVLQLDGEVKVPTAPHLSCVGDSKAELRELLNLYKNAGIKRIVALRGDLP
FT                   SGMGMASGELRYANELVEFIRTETGDHFHIEVAAYPEMHPQARNFESDIANFVRKAKAG
FT                   ADSAITQYFFNADSYFYFVERVRKLGVDIPVVPGIMPITNYSKLARFSDACGAEIPRWV
FT                   RKQLEAYGDDADSIRAFGEQVITEMCERLLQGGAPGLHFYSMNLAGPSLAIWNNLGLKR
FT                   "
FT   gene            complement(477445..478854)
FT                   /locus_tag="Pmen_0449"
FT   CDS_pept        complement(477445..478854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0449"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83219"
FT                   /db_xref="GOA:A4XPF3"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPF3"
FT                   /protein_id="ABP83219.1"
FT                   /translation="MSAVLTPAGFTDYKVADISLADWGRKELIIAESEMPALMGLRRKY
FT                   AASQPLKGAKILGCIHMTIQTGVLIETLTALGAEVRWSSCNIFSTQDQAAAAIAAAGIP
FT                   VFAWKGETEEEYEWCIEQTILKDGKPWDANMVLDDGGDLTEILHKKYPQMLERIHGITE
FT                   ETTTGVHRLLDMLKAGTLKVPAINVNDAVTKSKNDNKYGCRHSLNDAIKRGTDHLLSGK
FT                   QALVIGYGDVGKGSAQSLRQEGMIVKVSEIDPICAMQACMDGFELVSPYKNGINDGTES
FT                   SVDAALLGKIDLIVTTTGNVNVCDAGMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWE
FT                   EVKPQVHKIHRTGAGQFDPTNDDYLILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQI
FT                   FLFEQKFADLPAEKKAERLTVEVLPKKLDEEVALEMVKGFGGVVTQLTKQQAEYIGVTV
FT                   EGPFKPDTYRY"
FT   gene            479186..479572
FT                   /locus_tag="Pmen_0450"
FT   CDS_pept        479186..479572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0450"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83220"
FT                   /db_xref="GOA:A4XPF4"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPF4"
FT                   /protein_id="ABP83220.1"
FT                   /translation="MTLAYWCVLIAILLPYLATTTAKFFGPGYGPRANSDPRAFLAGLE
FT                   GWRKRANNAQLNGFEVTPAFAAAVIIAHQAGGAEQGLLDQLAMAFIVSRVLYLICYLAD
FT                   WGPVRSLVWFAGMGLIVALFVVSA"
FT   gene            479729..480175
FT                   /locus_tag="Pmen_0451"
FT   CDS_pept        479729..480175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0451"
FT                   /product="Cytochrome c556-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83221"
FT                   /db_xref="GOA:A4XPF5"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPF5"
FT                   /protein_id="ABP83221.1"
FT                   /translation="MKFKALLLACACLFLVACGGVDPDSPLGQRQALFKQMLKVSEDLG
FT                   GMLRGRIAYDEARFVTGAAELDRLSREPWQHFPDVRDDERSKANPELWQRQEQFQQMAR
FT                   DLEQATAALVQATVSPPLRRSRLEPAVREVEDSCEACHKAFRAY"
FT   sig_peptide     479729..479788
FT                   /locus_tag="Pmen_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.701 at
FT                   residue 20"
FT   gene            complement(480169..480570)
FT                   /locus_tag="Pmen_0452"
FT   CDS_pept        complement(480169..480570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0452"
FT                   /product="protein of unknown function DUF1090"
FT                   /note="PFAM: protein of unknown function DUF1090"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83222"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPF6"
FT                   /protein_id="ABP83222.1"
FT                   /translation="MIRQATLLGLLLAAGLHATPLLAAEADADVDCPTKRQILQEKIET
FT                   ARAQGNSQELDGLHRALGNVEAHCDEASLHRQRLAGVEEARQEVQRREMDLRDAMGKGD
FT                   QEKIAKRQAKLAEARSELEQAEAEARADQ"
FT   sig_peptide     complement(480499..480570)
FT                   /locus_tag="Pmen_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(480654..482342)
FT                   /locus_tag="Pmen_0453"
FT   CDS_pept        complement(480654..482342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0453"
FT                   /product="DNA ligase (NAD(+))"
FT                   /EC_number="6.5.1.2"
FT                   /note="PFAM: NAD-dependent DNA ligase, OB-fold;
FT                   NAD-dependent DNA ligase, adenylation; SMART: NAD-dependent
FT                   DNA ligase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83223"
FT                   /db_xref="GOA:A4XPF7"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPF7"
FT                   /protein_id="ABP83223.1"
FT                   /translation="MLAMKRWIAPLLLPLIAQAEPCPDWPDSRAQVEFAALSQQIAQWD
FT                   DAYHNQGRSPIADELYDQARERLQRWQQCFAPARQPLPEPLTGSAGPIAHPVPQTGLRK
FT                   LNDAAIGEWIGSRDDLWIQPKVDGVAVTLVYRQGRLHQAISRGDGRHGQDWSARARQLP
FT                   AVPTRLPEALDLVLQGELYWRLEDHLQARDGGAGARGKVAGMMARHELSDTDGAAIGLF
FT                   VWDWPDGPASMDERLSQLQALGFADSQHYSKPIRSVEEARQWRQHWYRHRLPFASDGVV
FT                   LRQGTRPAGARWQAEAPHWAVAWKYPASQALAVVQAVDFRIGRSGRITPVLRLQPVDLD
FT                   DRRISRVALGSVPTWKSLDVRPGDQVAIRLAGLTIPRLDSVIWRSPHRAPVEVPRSADY
FT                   HALSCWRSSPSCQHQFQARLAWLSSKQGLALSGVGPGTWSSLPLQGLLDWLELDKAQLQ
FT                   SLPGIGPRRAAQLQQAFAQARDRPLQQWLRALGAPPGFDAGGLDDWPSLIERQRDDWLR
FT                   RPGVGPKGADRLLAFFSHPEVQRLGRQLQQAGVAGFQPQAGPPRS"
FT   sig_peptide     complement(482283..482342)
FT                   /locus_tag="Pmen_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.938 at
FT                   residue 20"
FT   gene            complement(482483..483673)
FT                   /locus_tag="Pmen_0454"
FT   CDS_pept        complement(482483..483673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0454"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83224"
FT                   /db_xref="GOA:A4XPF8"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPF8"
FT                   /protein_id="ABP83224.1"
FT                   /translation="MSEYSLFTSESVSEGHPDKIADQISDAVLDAIIVQDKHARVAVET
FT                   LVKTGVAIVAGEVTTSAWVDLEQIVRDVICNIGYTSSDVGFDGNTCGIINIIGKQSPDI
FT                   NQGVDRAKPEDQGAGDQGLMFGYASNETDVLMPAPIVLSHRLVERQAEARKSGLLPWLR
FT                   PDAKSQVTCRYENGKVVGIDAVVLSTQHNPEISQADLQEAVMELIVKHTLPAELLHKDT
FT                   QYHINPTGKFVIGGPVGDCGLTGRKIIVDSYGGMARHGGGAFSGKDPSKVDRSAAYAGR
FT                   YVAKNIVAAGLAERCEIQVSYAIGVAQPTSISVNTFGTNKVSEETIIKLVREVFDLRPY
FT                   AITRMLDLLHPMYQDTAAYGHFGRTPQQKTVGEDSFTTFTWERTDKAADLRAAAGL"
FT   gene            complement(483670..484674)
FT                   /locus_tag="Pmen_0455"
FT   CDS_pept        complement(483670..484674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0455"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; Methyltransferase
FT                   type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83225"
FT                   /db_xref="GOA:A4XPF9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPF9"
FT                   /protein_id="ABP83225.1"
FT                   /translation="MTLRAPQLDFDPCDELAALCKAGGDALRLNVLRALSNDSFGVLEL
FT                   AQIFAIGQSGMSHHLKVLAQAGLVATRREGNAIFYRRALPGGRLHAALLDDIDELPLPG
FT                   EVQARIATVHQQRATVSRDFFARMAASFQAQQDLIAGLPQYRDSLLALLDALQFAPDAS
FT                   ALEIGPGDGAFLPELARRFTRVTALDNSPAMLELASQRCAAEGLANVELKLADALQDEQ
FT                   PPADCVVLNMVLHHLATPAEAFRQLARLVAPGGSLLLSELCSHDQSWAREACGDLWLGF
FT                   EQDDLARWATAAGLVPGESLYIGLKNGFQIQLRHFAKPITRPATRYGTQGTHP"
FT   gene            complement(484747..485631)
FT                   /locus_tag="Pmen_0456"
FT   CDS_pept        complement(484747..485631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0456"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83226"
FT                   /db_xref="GOA:A4XPG0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPG0"
FT                   /protein_id="ABP83226.1"
FT                   /translation="MNLHHLKVFLAVAEAGSISAGAERLHISQPAVTREIRELEANLDL
FT                   RLFDRLPRGVQLTEGGQRLLDYARRIFALEQAAERDLRDFAQLEQGELHLGASATLGAY
FT                   LLPPLISRFRALHPQIFVSLEVSNTEAVTRQLDDGRISLGFVEGPFAQADYDHRLLARD
FT                   ALLPVVAPRHPLARTAAPLQASELQAYPLYMREPGSGARASVEHAYRVHGLEPRAGMAI
FT                   GSTEALKRLLADGQGIAWLSQRVVERELASGELQRLTVQDLQIERELHVLWRPGASLSP
FT                   APAAFLALSEPPH"
FT   gene            485741..486895
FT                   /locus_tag="Pmen_0457"
FT   CDS_pept        485741..486895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0457"
FT                   /product="C4-dicarboxylate transporter/malic acid transport
FT                   protein"
FT                   /note="PFAM: C4-dicarboxylate transporter/malic acid
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83227"
FT                   /db_xref="GOA:A4XPG1"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPG1"
FT                   /protein_id="ABP83227.1"
FT                   /translation="MPRPFSRLPEPLAVIRHFTPSWFAVTMGTGVLALVVAHLPWQLPG
FT                   LLLLAEGLWLFGVALFVLFSLLFMLRVALFRETIAPMLLHPVQSMFLGAIPMGLAVLIK
FT                   GLLLFGAPRWGEGVYALAHALWWLDAALALLGALLVPYLMFTRQHHALEKLTAVWLLPI
FT                   VAPEVAASTAGSLAPHLAATDAQLLLVAGFVLWGVSLSLAFSLITLVLLRLALHKLPDT
FT                   DFAATSWLPLGPLATGCLGLLSMGQAAPLAFAGTPLSGAAELARDLGLIGGLALWGAGL
FT                   WWLVIATLFTRHYIRDNMPFNLGWWGFTFPLGVFTLATFELQALTGLAFFAFVGVLLTV
FT                   QLAAVWSLVLSRTLAGVWHGELFQAPCLGGPGSPAVGVLSEQAS"
FT   gene            487008..489008
FT                   /locus_tag="Pmen_0458"
FT   CDS_pept        487008..489008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0458"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83228"
FT                   /db_xref="GOA:A4XPG2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPG2"
FT                   /protein_id="ABP83228.1"
FT                   /translation="MPSRRERANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDYL
FT                   KHNPSNPNFADRDRFVLSNGHGSMLIYSLLHLTGYDLGIEDLKQFRQLHSRTPGHPEYG
FT                   YTPGVETTTGPLGQGIANAVGFAIAEKVLGAQFNRDGHQIVDHFTYVFLGDGCMMEGIS
FT                   HEVCSLAGTLGLGKLIAFYDDNGISIDGEVEGWFTDDTPKRFESYGWQVIRNVDGHDAD
FT                   EIKMAIDTARKSADQPTLICCKTTIGFGSPNKQGKEECHGAPLGNDEIALTRAALNWNH
FT                   GPFEIPAEIYAEWDAKAAGAAAEAAWNEKFAAYAAAFPELAAEFKRRIAGELPADFAEK
FT                   AAAYIKDVAEKGETIASRKASQNALNAFGPLLPEFLGGSADLAGSNLTLWKGCKGVTEE
FT                   DAAGNYLFYGVREFGMSAIMNGIALHGGFVPYGATFLIFMEYARNAVRMSALMKQRVLY
FT                   VFTHDSIGLGEDGPTHQPIEQLASLRGTPNLDTWRPCDAVESAVAWKHAIERADGPSAL
FT                   VFSRQNLPHQTRDAQQLADIARGGYVLKDCTGEPELILIATGSEVALAMQAAAKLDEQG
FT                   RKVRVVSMPSTSVFDAQDAAYKQAVLPLQVGARIAIEASHADYWYKYVGLDGRIIGMTS
FT                   FGESAPAPALFEHFGFTVENIVVTAEELLDA"
FT   gene            489134..490201
FT                   /locus_tag="Pmen_0459"
FT   CDS_pept        489134..490201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0459"
FT                   /product="D-erythrose-4-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="TIGRFAM: D-erythrose-4-phosphate dehydrogenase;
FT                   PFAM: glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83229"
FT                   /db_xref="GOA:A4XPG3"
FT                   /db_xref="InterPro:IPR006422"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPG3"
FT                   /protein_id="ABP83229.1"
FT                   /translation="MSNRPYRVALNGYGRIGRCVLRALHERGAGAGLEIVALNDLADQA
FT                   SIEYLTRFDSTHGRFPGEVKVDGDCLHINGDCVKVLRQREPEAIDWAALDIDLLLECSG
FT                   QYVTRAEAQRFIDAGAPRLLLSQPMASEADIDATVVYGVNQACLSGSELLVSNASCTTN
FT                   CSVPLLKLLDESVGLEYVSITTIHSAMNDQPVIDAYHHEDLRRTRSAFQSVIPVSTGLA
FT                   RGIERLLPELAGRVQAKAIRVPTVNVSCLDITLQTARDTSAAEINSVLRQAAEAGPLKG
FT                   LLAYTELPHASCDFNHDPHSAIVDGSQTRVSGPRLVNLLAWFDNEWGFANRMLDVAEHF
FT                   LAVSTSSVQPAPVKD"
FT   gene            490206..491366
FT                   /locus_tag="Pmen_0460"
FT   CDS_pept        490206..491366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0460"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83230"
FT                   /db_xref="GOA:A4XPG4"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPG4"
FT                   /protein_id="ABP83230.1"
FT                   /translation="MTVLKMTDLDLAGKRVLIREDLNVPVKDGVVKSDARILASLPTIK
FT                   LALEKGAAVLVCSHLGRPEEGVYSEEDSLAPVAAYLSKALGREVPLVKDYLGGVEVKAG
FT                   ELVLLENVRFNKGEKKNSDELAQQYAALCDVFVMDAFGTAHRAQGSTHGVAKFAKVACA
FT                   GPLLAAELEALGKALDKPARPMLAIVAGSKVSTKLDVLNSLADICDSLIVGGGIANTFL
FT                   AAAGLPVGKSLYEADLVDTAKAIAAKVSVPLPVDVVVAKAFAEDAEATVKSVKDVADDD
FT                   MILDIGPQTAQQFAEMLKASQTILWNGPVGVFEFDQFGNGTKALALAIAESPAFSIAGG
FT                   GDTLAAIDKYGVSEQISYISTGGGAFLEFVEGKVLPAVEVLEQRAK"
FT   gene            491720..492046
FT                   /locus_tag="Pmen_0461"
FT   CDS_pept        491720..492046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83231"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPG5"
FT                   /protein_id="ABP83231.1"
FT                   /translation="MIGIRLAGLSALAVLLAACSSQPAAPDHWNRWVCDSQAAVQWRFA
FT                   NGGYDQVDLRLGGDDIVYRLTQEPAASGALYSDGRLSFHTKGEEGLVYWTATDDLIGRG
FT                   CKAQ"
FT   sig_peptide     491720..491785
FT                   /locus_tag="Pmen_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.717 at
FT                   residue 22"
FT   gene            492144..493208
FT                   /locus_tag="Pmen_0462"
FT   CDS_pept        492144..493208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0462"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="TIGRFAM: ketose-bisphosphate aldolase;
FT                   fructose-bisphosphate aldolase, class II, Calvin cycle
FT                   subtype; PFAM: ketose-bisphosphate aldolase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83232"
FT                   /db_xref="GOA:A4XPG6"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPG6"
FT                   /protein_id="ABP83232.1"
FT                   /translation="MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPV
FT                   IVQASAGARKYAGAPFLRHLILAAIEEFPHIPVCMHQDHGTSPDVCQRSIQLGFSSVMM
FT                   DGSLKEDGKTPADYDYNVRVTQQTVAFAHACGVSVEGELGCLGSLETGMAGEEDGVGAE
FT                   GVLDHSQLLTDPEEAAAFVKATQVDALAIAIGTSHGAYKFTKPPTGDVLSIERIKEIHK
FT                   RIPNTHLVMHGSSSVPQDWLAIINEYGGDIKETYGVPVEEIVEGIKHGVRKVNIDTDLR
FT                   LASTGAIRRFLEQNKAEFDPRKYFAKTIEAMRDICIARYEAFGTAGNASKIKPISLEGM
FT                   YKRYASGELAAKVN"
FT   gene            complement(493287..493970)
FT                   /locus_tag="Pmen_0463"
FT   CDS_pept        complement(493287..493970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83233"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR014895"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPG7"
FT                   /protein_id="ABP83233.1"
FT                   /translation="MIELAMWNLSVPVGVPATTIETRVLAGGYQDHYFQSKEGAIFFWA
FT                   PVNGTTTESAKYPRTELRETFADGRLRNWTYPEADHFLRASLSVSQVPSTGKIVIGQIH
FT                   AFKSSEPLLKLEYQYKTKTADGNIVAKVRPSPDAAIQTVTVASGIRLNQPFRYVINLKP
FT                   DGTLAISLNSINWSARMDPTWAARPLYFKAGVYTQDNTGYETEAGAARFDQLSIEHRSL
FT                   LGSAK"
FT   gene            494365..494841
FT                   /locus_tag="Pmen_0464"
FT   CDS_pept        494365..494841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83234"
FT                   /db_xref="GOA:A4XPG8"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPG8"
FT                   /protein_id="ABP83234.1"
FT                   /translation="MSSKPRLLLAFVLAVLLAALLASIFQTQTNLAALQALGAPMPLQV
FT                   RVGTTCLDLLGFAPVFALLAALGFLFALPLATWCAQRLPPLRWMIFLLAGALAIWVALA
FT                   LANMLAPMPTLIAANRTLIGTLGLMASGSAGALLFALLARRVRYLTQPTSSDLP"
FT   sig_peptide     494365..494463
FT                   /locus_tag="Pmen_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.555 at
FT                   residue 33"
FT   gene            494855..495955
FT                   /locus_tag="Pmen_0465"
FT   CDS_pept        494855..495955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0465"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: glucose sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83235"
FT                   /db_xref="GOA:A4XPG9"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPG9"
FT                   /protein_id="ABP83235.1"
FT                   /translation="MSRLIRALLVGALLASVPALAQAYRIETFSEGLEHPWSLAFLPDG
FT                   RILVTERVGRLRIVEADGSLDPDPVAGLPEIFVAAQAGLMEVALDPDYVSNRWLYLSYA
FT                   HGTTQANNTRLARARLVDDELRDFEVLFTAQPLKAGASHYGGRIAFLADKTLVLTLGDG
FT                   FDWREEAQNLANHLGKIVRLNRDGSVPADNPLVGQTGAAAEIYSLGHRNVQGIVFDAEA
FT                   GRLYSHEHGPRGGDELNLIEAGNNYGWPLATFGIDYTGARVSPYTELPGLTQPLLHWTP
FT                   SVAPASLTQYRGALFPDWQGDLFAATLAERSVRRVRLHEGMLAGEEILFEELGERIRDV
FT                   RAGPDGALYLLTDNADGRLLRVVPGD"
FT   sig_peptide     494855..494920
FT                   /locus_tag="Pmen_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 22"
FT   gene            496011..496502
FT                   /locus_tag="Pmen_0466"
FT   CDS_pept        496011..496502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0466"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83236"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPH0"
FT                   /protein_id="ABP83236.1"
FT                   /translation="MKYLQGYPVALQQQVRQLIADDRLGDYLAQRYPGRHEVQSDKALY
FT                   GYVMALKQEHLKNAPAIDKVLYDNRLDLTHRALGLHTAISRVQGGKLKAKKEIRVASLF
FT                   RDAAPAFLQMIVVHELAHLKEAEHNKAFYKLCDHMLPGYAQIEFDLRMYLTWREMTGSA
FT                   "
FT   gene            complement(496604..496837)
FT                   /locus_tag="Pmen_0467"
FT   CDS_pept        complement(496604..496837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83237"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPH1"
FT                   /protein_id="ABP83237.1"
FT                   /translation="MEAPVHSLPALFKQLGLPDDAASINAFISTHSPLPDACKLSEAPF
FT                   WTPAQAALLREEILEDADWAPVVDQLNVRLHG"
FT   gene            complement(496900..497382)
FT                   /locus_tag="Pmen_0468"
FT   CDS_pept        complement(496900..497382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0468"
FT                   /product="GreA/GreB family elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83238"
FT                   /db_xref="GOA:A4XPH2"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPH2"
FT                   /protein_id="ABP83238.1"
FT                   /translation="MNKTLLLQAVLSQLQADLEQANLAALSAHETATHEENVAENKYDT
FT                   LGLEAAYLASGQARRVEELRQTLITWRQLRPRPFDEAQGIELGALVLLAGEDGHEQWLF
FT                   LGPQGASMKLQHAGRSIQVLGNAAPLGRLLLGKRPGDEINLPMGKRLQLFEVLAAE"
FT   gene            complement(497444..499249)
FT                   /locus_tag="Pmen_0469"
FT   CDS_pept        complement(497444..499249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0469"
FT                   /product="periplasmic/7TM domain sensor diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Diverse 7TM receptor, extracellular
FT                   region 2; Diverse 7TM receptor, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83239"
FT                   /db_xref="GOA:A4XPH3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPH3"
FT                   /protein_id="ABP83239.1"
FT                   /translation="MSASPSSSRTLPVSLPSLLLALCLLLAGPQAWAGLMLDETTPPRN
FT                   LHGLVDFLDDPQADLSLLDVSRANAPFRPSSERRDLSFGYVPGVVWLRLPLQSSAAATL
FT                   SWRLELNYASLDEVRLYDVGADGVRETRSGDTVPYAQRSVGHRNPVFEIVLRPGEQRTL
FT                   YLRADSRGSMTLSGELMSARAFEQHSQKGYLVHALYCGVLTALGLYNLLLFLALRERPF
FT                   LNYVLFMFAFALSVLSLNGLGAQYLWPHAAPWSNRMLPVSLTLAALLAVVFARSFLDTR
FT                   QWLPRWDRVLQVLCGVTLLAVLATLLLPVQTALQTMSLTGLIVTLTLLLTSFVCVGYRV
FT                   PGARLFALAWLMLLSGAVLLALRNFALIPSNFITLYAMQIGSGLEMILLSFALAARFNE
FT                   LKRQREAALQLNEQILAKRVTERTLALELANQRLSELALQDPLTGLANRTALQQHLEQA
FT                   IARSQRRNELLAVMLIDLDGFKPVNDQYGHGFGDQVLAEVARRLRHYLRDADLPARLGG
FT                   DEFVVICENVQTAADARDLAKRVLEGLDTPIYLEGRAVRVGASIGIALYHGEDDATALI
FT                   RRADAAMYRAKATGRNRVHLTAEPD"
FT   sig_peptide     complement(499148..499249)
FT                   /locus_tag="Pmen_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 34"
FT   gene            complement(499316..501484)
FT                   /locus_tag="Pmen_0470"
FT   CDS_pept        complement(499316..501484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0470"
FT                   /product="integral membrane protein, YccS/YhfK family"
FT                   /note="TIGRFAM: hypothetical membrane protein; integral
FT                   membrane protein, YccS/YhfK family; PFAM: protein of
FT                   unknown function DUF893, YccS/YhfK"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83240"
FT                   /db_xref="GOA:A4XPH4"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPH4"
FT                   /protein_id="ABP83240.1"
FT                   /translation="MPRPHLSQTLRRLWALDKFSASLRVFIALAGALALCWWQGWVHGL
FT                   IPLFLGIIASALTETDDSWQGRLGTVLVTLVCFSAAAYAVEFLFPYPWLFVVALACSAF
FT                   CLTMLGALGERFATLGSGTLILAVYSMIGLEQRGGVAGLWLEPLLLVAGAAWYGLLSVI
FT                   WHALFAHQPVQLALARLFRELGKYLKLKAALFEPLRQLDVEQRRLELAQQNGRVVSALN
FT                   AAKEIILHRVGGARPAPKVNRYLKLYFLAQDIHERASSSHYPYNELAEAFFHSDVLFRC
FT                   QRLLRLHGEACQRLATAIELRQPFEYRELCSQALEDLHASLDHLHLQSNPAWRRLLRSL
FT                   GALAGNLATLDQLLGNASNPDALAEEQDSSLLDREPHSLREVIERIGQQLTPTSLLFRH
FT                   ALRLSIALAAGYGLLHLIHPTQGYWILLTTLFVCQPNYGATRLKLVQRILGTLLGLGIG
FT                   WALFDLFPDPRIQALFAVVAGVAFFATRATRYTLATAAITLLVLFCFNQIGDGYGLFLP
FT                   RLIDTLLGGLIAGLAVFLILPDWQGRRLGRMLANTLSCNSAYLRQIIAQYAHGKRDDLG
FT                   YRLARRNAHNADAALSTTLGNMLMEPGHFRKDADLGFRFLVLSHTLLSYLSALGAHRGE
FT                   QLPQAVQAQLLEQAEHLAASLDEIAAGLRGERPLAIHSDEEQELAQALEQIADDADERQ
FT                   RLVQTQLALICRQLAPLRTLGAHLHKDG"
FT   gene            501656..503101
FT                   /locus_tag="Pmen_0471"
FT   CDS_pept        501656..503101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0471"
FT                   /product="Nodulation efficiency protein NfeD"
FT                   /note="PFAM: protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83241"
FT                   /db_xref="GOA:A4XPH5"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPH5"
FT                   /protein_id="ABP83241.1"
FT                   /translation="MLRKGPPPRVRYQCGSRESNVLPGWLRLCLCALILCASVGVSAAP
FT                   GAVVQLQVDGVIGPASADYLVRGLAKAVDEGAQLVVIEIDTPGGLDTAMRAIIKAILAS
FT                   PIPVASYVAPGGARAASAGTYILYASHVAAMTPGTNLGAATPVAIGMPGAPSQPEGDDK
FT                   GEKDKATQGDKGTGDAMTAKQVNDAAAYIRGLANMRGRNAEWAEQAVREAVSLSAEEAL
FT                   EQKVIDYLARDTADLLRQLDGKTLQAAGVELTLATAGAPLISHAPDWRTRLLAVITNPS
FT                   VALILMMIGVYGLFFEFSNPGSGVGGVLGGISLVLALYALQLLPVNYAGVALILLGIAF
FT                   ITAEAFLPSFGVLGIGGVVAFVFGGLILIDTDVPGFGIPLALIITLALVSAALILAIVG
FT                   MALRARRRQQVAGDSGLVGSLVAIAAVREDDPRAGWVALQGERWQVQGAAPLQPGQQVR
FT                   VTAREGVHLQVSAVDEPPPRGGN"
FT   sig_peptide     501656..501787
FT                   /locus_tag="Pmen_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.976 at
FT                   residue 44"
FT   gene            503101..503850
FT                   /locus_tag="Pmen_0472"
FT   CDS_pept        503101..503850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0472"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83242"
FT                   /db_xref="GOA:A4XPH6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPH6"
FT                   /protein_id="ABP83242.1"
FT                   /translation="MGFELSFLSLAIIVLALLASAFRILREYERGVVFQLGRFWRVKGP
FT                   GLILVIPGLQQMVRVDLRTLVLDVPTQDVISRDNVSVKVNAVVYYRVLDPQRAIIQVED
FT                   YHSATSQLAQTTLRAVLGKHELDDMLAERERLNVDIQQVLDAQTDAWGIKVANVEIKHV
FT                   DLDESMVRAIARQAEAERERRAKVIHAEGELQAAEKLMQAAEILGRQSGAMQLRYMQTL
FT                   GSIASDKSSTIVFPLPVELLQGIAEKK"
FT   sig_peptide     503101..503166
FT                   /locus_tag="Pmen_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.584 at
FT                   residue 22"
FT   gene            503958..505079
FT                   /locus_tag="Pmen_0473"
FT   CDS_pept        503958..505079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0473"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="TIGRFAM: alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83243"
FT                   /db_xref="GOA:A4XPH7"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPH7"
FT                   /protein_id="ABP83243.1"
FT                   /translation="MRIGVPKEIKNHEYRVGLTPQSVAELAALGHEVWVEALAGAAIGF
FT                   ADQDYREAGAQIAASAGEVFQQAQLIVKVKEPLAVERAKLRPHHTLFTYLHLAPDRAQT
FT                   EELMAGGATCIAYETVTDAQGRLPLLAPMSEVAGRMSIQAGAGCLEKARGGRGVLLGGV
FT                   PGVAPGKVVILGGGVVGSHALAMAVGLGADVTVLDKSVDALRRLDSLYGSRITTLYSTR
FT                   AAVREQVLAADLVIGGVLIPGAAAPKLITAEMVRQMKAGAVLVDVAIDQGGCAETSRAT
FT                   THAEPTYVVDEVVHYCVANMPGAVARTSTLALNNATLPFVIALAQKGTRRALEEDAHLL
FT                   AGLNVAKGVITCGSVAEAHGLPFQSAAGVLEHL"
FT   gene            505225..505968
FT                   /locus_tag="Pmen_0474"
FT   CDS_pept        505225..505968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0474"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83244"
FT                   /db_xref="GOA:A4XPH8"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR039387"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPH8"
FT                   /protein_id="ABP83244.1"
FT                   /translation="MGRPQPFGQRLIARQRHRLRPRWPLRRRTRAVEESTMSSRRHLLL
FT                   AAGGALLASPSLVLAERLLTPRQTLGPFYPDQLPLDNDNDLVQVEGRAEEARGIRVQLH
FT                   GSILDAGGRPLAGALVEIWQVDANGIYLHSRGGDRQRLDPGFQGYGRFVTEADGRYGFR
FT                   TIRPVSYPGRTPHIHLAVTLPGMPRFATQCYIRGEPGNQRDGLLNAIRDPRLRELLIVP
FT                   FVPVSGQVNQQIARFDVVLGVTPAS"
FT   sig_peptide     505225..505407
FT                   /locus_tag="Pmen_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.940 at
FT                   residue 61"
FT   gene            complement(505976..507874)
FT                   /locus_tag="Pmen_0475"
FT   CDS_pept        complement(505976..507874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0475"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; TrkA-C domain protein;
FT                   TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83245"
FT                   /db_xref="GOA:A4XPH9"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPH9"
FT                   /protein_id="ABP83245.1"
FT                   /translation="MRRAHQCPGSPATHNRHLSRPAQGQFRAMTLDQGLIFAILVASMG
FT                   LFIWGRWRHDVVALGALLACVIAGLVKEEEAFTGFGHPAVITVACVLVLSHGLQSTGAV
FT                   NRLAQRLLPSGAGVLLSLAALTGLGALLSAFMNNVGALALLMPIALQIAARLELPPGRV
FT                   LMPLAFGTILGGMTTLIGTPPNLIVSSFRAQHGNGPFAMFDFSPVGVAVALAGVLFITL
FT                   LGWRLVPRREVGNAASFDTGRYLTEARVKEGGKAQGKTLREIEQLLDEADAQVVAMVRN
FT                   KLRLSAPNPRRVLQADDVLVIEADPQELGEVLGQLDLLLEAEREAKEAEQQRKDNGGET
FT                   EKKEANSEERGLLELLVKPDSPLIGRSASSTRLRSRYSISLLAISRQSHRSIKRLRSTL
FT                   IQSGDVLLMQGSAEDVSEFASDYGCVPLAARAINIPDPRQANLALGVMLLAIATAAFGL
FT                   LSAAVAFSAGVLAYMLLRLIPLRAVYEAVDWPVIVLLGALIPVAGAMSETGAADLLARV
FT                   LMEHLAQGNAIVTLTLLLVVTMTLSDFMNNAATAAVMCPIALSAASQLGVSPDSLLMAV
FT                   AIGASCSFLTPIGHQNNTLILSPGGFRFGDYWRLGLPMEILVVLVSVPLLLWVWPL"
FT   gene            complement(508050..509234)
FT                   /locus_tag="Pmen_0476"
FT   CDS_pept        complement(508050..509234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0476"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83246"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPI0"
FT                   /protein_id="ABP83246.1"
FT                   /translation="MLQTEVLIIGAGAAGLMCAATAAARGRRVLVLDHANKAGKKILMS
FT                   GGGRCNFTNMYCEPGNFLSQNPHFCKSALARFTQWDFIGLVAKHGVPYHEKKLGQLFCD
FT                   NKSSDILELLLAECSDAGAEIRLNTAVHAIARTEGGFLLQTDLGEVTCQSLVIACGGLS
FT                   IPTLGATGFGYQVARQFGHEVLPTRAGLVPFTLTDPQLKTLCTELSGTSVEDCLVSCNG
FT                   QSFKENILFTHRGLSGPAILQISSYWQPGDTLHIDLLPHIDLPEWLATQQRERGNSELK
FT                   TLLAELFTKKMAALLVDSWFANKPLKQYTPGELKAIAERLSDWQLVPAGTEGYRTAEVT
FT                   LGGVDTREVSSKTLESLKVPGLYFIGEVLDVTGHLGGFNFQWAWASGYAAAQYV"
FT   sig_peptide     complement(509166..509234)
FT                   /locus_tag="Pmen_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.593 at
FT                   residue 23"
FT   gene            509436..510176
FT                   /locus_tag="Pmen_0477"
FT   CDS_pept        509436..510176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0477"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="SMART: extracellular solute-binding protein, family
FT                   3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83247"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPI1"
FT                   /protein_id="ABP83247.1"
FT                   /translation="MPMPAVRTWLLPLLLLSPLLALAEPLRLVADPWPPFTDRRLPANG
FT                   LASDLVVQALKRAGYDSHYAEVPWERAVWGLQRGDYDVLINAWYSADREAFGHYSQPYL
FT                   VNRIRFLQRKGSGIRFASLSDLYPHRIAVVRGYAYAKAFDSDEQLRKVGAVSFESAARM
FT                   LHAGRVQLALEDELVARYHLGRELRAIRGELEFLPLPLSENGLHILVRLGHPEHRQIAT
FT                   RFDGAIQTMREDGSYAATLERHGF"
FT   sig_peptide     509436..509507
FT                   /locus_tag="Pmen_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.975 at
FT                   residue 24"
FT   gene            complement(510143..511411)
FT                   /locus_tag="Pmen_0478"
FT   CDS_pept        complement(510143..511411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0478"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83248"
FT                   /db_xref="GOA:A4XPI2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPI2"
FT                   /protein_id="ABP83248.1"
FT                   /translation="MRNILVIEDSPLVLKILEHLFRQEPDLQPVFCASLGEAEVMLETS
FT                   AGLFFAAIADLHLPDAPNGESVDLVMRYHLPCIVLSGSYNEQRRDDLLAKGVVDYVLKE
FT                   SQHSYEYAFRLLHRLDSNSHIKILVADDSDTTRHYIRNILTPHRYQVLEARDGKETLRL
FT                   LGEQPDIDLLVLDHAMPGVSGFELVKLLRQKLRRNDLIIIGVSADPKGSLSAQFIKHGA
FT                   DDFLRKPFCPEELNCRVMSTLERRDLLRALKQAAQFDALTGLNNRRAFYEQGLQLLQQA
FT                   QREGREVSVAMLDLDHFKQINDGFGHASGDSALVVFARALSAALPQMLLGRLGGEEFAL
FT                   LSLDEADRVEAALDELRHQCAALHYAAGAPPLSFSAGLYRGEPDDLESLLHEADVRLYR
FT                   AKQQGPHARCEADQKPWRSSVAA"
FT   gene            complement(511452..512828)
FT                   /locus_tag="Pmen_0479"
FT   CDS_pept        complement(511452..512828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0479"
FT                   /product="ATP-dependent RNA helicase DbpA"
FT                   /EC_number="5.99.1.-"
FT                   /note="PFAM: helicase domain protein; DbpA, RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83249"
FT                   /db_xref="GOA:A4XPI3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPI3"
FT                   /protein_id="ABP83249.1"
FT                   /translation="MTTNAFASLPLSAAMQANLAAIGYAEMTPIQAASLPLILKGRDLI
FT                   AQAKTGSGKTAAFGIGLLHPLNPRYFGCQALVLCPTRELADQVAKEIRRLARAADNIKV
FT                   LTLCGGVPFGPQIGSLEHGAHVIVGTPGRIQEHLRKGTLKVDGLNTLVLDEADRMLDMG
FT                   FVDSISEIIEQTPARRQTLLFSATYPAGIEQLAARFLRTPERVEVEAQHDDGQIEQRFY
FT                   EIAPGQRMEAVSTLLRHFRKQPVVAFCATRQQCDELAAQLEAEKISAAALHGDLEQRDR
FT                   DQILALFANRSLSVLVATDVAARGLDIAGLEMVINVELSRDAEVHIHRIGRSGRAGEKG
FT                   LALSLVAPAEAGRAQAIETLQGRELAWYPLPAAKASGEPLLPPMHTLCIAAGRKDKLRP
FT                   GDILGALTGDAGLPGSQVGKIALFDYQAYVAVERDVARQALKRLSEGKIKGRSLRVRLL
FT                   "
FT   sig_peptide     complement(512766..512828)
FT                   /locus_tag="Pmen_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.648 at
FT                   residue 21"
FT   gene            complement(512878..514344)
FT                   /locus_tag="Pmen_0480"
FT   CDS_pept        complement(512878..514344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0480"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83250"
FT                   /db_xref="GOA:A4XPI4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPI4"
FT                   /protein_id="ABP83250.1"
FT                   /translation="MAERPQPPLTAGRLMQSTVSQLDPRTARLLPWIVAIAFFMQTLDG
FT                   TILNTALPSMAADLAEDPLRMQSVVIAYMLTVALLIPASGWIADRFGTRRIFFGAIALF
FT                   SLGSLLCALSISLPMLVGARIVQGLGGALMMPVGRLVVLRAYPRSELVRIMSFITLPGL
FT                   LGPLIGPSLGGWLVVVASWHWIFLINLPVGLLGCWAALRHMPDLRGPSRSRFDTPGFLL
FT                   FGAAMLLITVALEGLGELHLPTMRVTLLLLGGLACLAAYWLRAARIEQPLFAPRLFHTR
FT                   SFAVGIIGNLFARLGSGALPFLTPLLLQLALGYSPAQAGMSLIPLALAAMAVKPLAKPL
FT                   IDRLGYRRILTSNTLLLGALIASLALVDGQTSTLQLIVQLSLIGACNSLQFTAMNTVTL
FT                   IDLDNRDASSGNGLLSVVVQLAMGLGVASAAALLGGFSREFSGDEQILRAFQATYLCVG
FT                   LLSMLAAAIFLQLDPADGRRARPLDVPPED"
FT   gene            complement(514463..516160)
FT                   /locus_tag="Pmen_0481"
FT   CDS_pept        complement(514463..516160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0481"
FT                   /product="choline dehydrogenase"
FT                   /EC_number="1.1.99.1"
FT                   /note="TIGRFAM: choline dehydrogenase; PFAM:
FT                   glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83251"
FT                   /db_xref="GOA:A4XPI5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPI5"
FT                   /protein_id="ABP83251.1"
FT                   /translation="MSHEFDYIIIGAGSAGNVLATRLTEDADVSVLLLEAGGPDYRLDF
FT                   RTQMPAALAFPLQGRRYNWAYETDPEPHMNNRRMECGRGKGLGGSSLINGMCYIRGNAL
FT                   DFDNWAKAKGLEDWTYHDCLPYFRKAESRDIGPNDYHGGDGPVSVTTPKAGNNPLFHAM
FT                   VEAGVQAGYPRTDDLNGYQQEGFGPMDRTVTPQGRRASTARGYLDQARERPNLTIVTHA
FT                   TTDRILFDGKRASGVSYLIGNANDATEARARREVLLCAGAIASPQILQRSGVGPAALLR
FT                   ELDIALVHELPGVGQNLQDHLEMYLQYACTQPVSLYPALKLLNQPGIGAQWLFTGNGIG
FT                   ASNQFEAGGFIRTRPEFAWPNIQFHFLPVAINYNGSNAVNEHGFQAHVGSMRSPSRGRI
FT                   QLKSKDPRQHPSILFNYMSHEQDWQEFRDAIRITREIMAQPALDSYRGREISPGIDCQS
FT                   DAELDAFIREHAETAFHPSCSCKMGEDDMAVVDGQGRVHGVQGLRVVDASIMPEIITGN
FT                   LNATTIMMAEKIADRIRDRQPLPRSNAPYFVAGERPVRGQPQRAVSAA"
FT   gene            complement(516240..517712)
FT                   /locus_tag="Pmen_0482"
FT   CDS_pept        complement(516240..517712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0482"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="TIGRFAM: betaine aldehyde dehydrogenase; PFAM:
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83252"
FT                   /db_xref="GOA:A4XPI6"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPI6"
FT                   /protein_id="ABP83252.1"
FT                   /translation="MPRFAEQQLYIGGQYVAASSGQTFDSINPATGEVLAKVQRASQAD
FT                   VDRAVASAAEGQKVWAAMTAMQRSRILRRAVDILRERNDELAELETLDTGKPLSETRYV
FT                   DIVTGADVLEYYAGLIPAIEGEQIPLRESSFVYTRREPLGVVAGIGAWNYPIQIALWKS
FT                   APALAAGNAMIFKPSEVTSLTALKLAEIYTEAGLPAGVFNVLTGSGREVGQWLTEHPGI
FT                   EKVSFTGGTVTGKKVMASASSSSLKEVTMELGGKSPLIVFEDADLDRAADIAVMANFYS
FT                   SGQVCTNGTRVFVPRMLQARFEAKVLERVKRIRLGDPLDDATNFGPLVSYAHMESVLGY
FT                   IEKGRSEGARLLIGGTRVSDGDYAKGAYVAPTVFTDCRDDMTIVREEIFGPVMSILIYD
FT                   SEEEVIRRANDTDYGLAAGVVTRDLNRAHRVIHKLEAGICWINTWGESPAEMPVGGYKQ
FT                   SGVGRENGLVTLGHYTRIKSVQVELGGYSSVF"
FT   gene            complement(518024..518614)
FT                   /locus_tag="Pmen_0483"
FT   CDS_pept        complement(518024..518614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0483"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83253"
FT                   /db_xref="GOA:A4XPI7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPI7"
FT                   /protein_id="ABP83253.1"
FT                   /translation="MPKVGMQPIRRSQLIAATLEAVDQVGMADASIAYIARLAGVSNGI
FT                   ISHYFNDKNGLLEATMRHLMQALSAAVGKRRRALDEDSPRAHLRAMIDGNFDDSQVSGP
FT                   AMKTWLAFWASSMHQPALRRLQRVNDHRLYSNLCGQFRRVLPQDQARFAARGLASLIDG
FT                   LWLRGALSGEAFDTEQARRIAYDYLDLQLNKAR"
FT   gene            complement(518799..519650)
FT                   /locus_tag="Pmen_0484"
FT   CDS_pept        complement(518799..519650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0484"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83254"
FT                   /db_xref="GOA:A4XPI8"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPI8"
FT                   /protein_id="ABP83254.1"
FT                   /translation="MRVFKHLCLGAAALAIGMGSALAADKPTLKIGYVNGWDDSVAVTH
FT                   VAGEILQSKLGYAVELKPVEPAIMWQGVARGDLDATLSAWLPATHGEYYEKLKDKVEVL
FT                   GTNYSGAKIGLIVPDYVEAKTIEDLEKYAKDFDGKITGIDAGAGVMRRTEDAIKEYNLA
FT                   SIKLMPSSGPAMATALTRAEKAQKPIVVTGWIPHWMFAKWKLRFLEDPKKVYGDDERVD
FT                   TVANPELKGKAADAAAFLAKLSWSGEEVGAVMLAIREGAKPEQAAKDWIAANPDRVDSW
FT                   LK"
FT   sig_peptide     complement(519579..519650)
FT                   /locus_tag="Pmen_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(519847..520791)
FT                   /locus_tag="Pmen_0485"
FT   CDS_pept        complement(519847..520791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0485"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83255"
FT                   /db_xref="GOA:A4XPI9"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPI9"
FT                   /protein_id="ABP83255.1"
FT                   /translation="MKTIKTTAAFGLLACLLMQGAMAAEPASCKQVRFAEIGWADIAAT
FT                   TGVAMTLVEGLGYQPRKIMASVPIAFTGVKNGQVDAFLGYWAPSMDAVIEPFLKDGGVK
FT                   VLEKPNLEGAKYTLAVPTYAAEAGLKSFQDIAKFKDQLGGKIYGIEPGNDGNLLIEGMI
FT                   KSDQFGLGSFRMIESSEAGMLVQVSRAIKKKEPVVFLGWAPHPMNTQHDITYLSGGDDV
FT                   FGPDYGAAKVYTVVPPDYEARCANVGKLLNNLQFTVEIESQLMEKVLEKENPQNVAKEW
FT                   IKANPAILDQWLSGVTTFDGQDGVAAVKKHVGL"
FT   sig_peptide     complement(520720..520791)
FT                   /locus_tag="Pmen_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(520819..521703)
FT                   /locus_tag="Pmen_0486"
FT   CDS_pept        complement(520819..521703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0486"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83256"
FT                   /db_xref="GOA:A4XPJ0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPJ0"
FT                   /protein_id="ABP83256.1"
FT                   /translation="MSDKKLDLGSWVNDVVQHLLDNYSGAFDSIGKLVSGFSEGIENLL
FT                   MLPPAWLLIAIFVGLGLWRIGMRFAVFTAVAFILIVMTGFWEQTVVTLGLTFSSTLISL
FT                   LLGIPLGIWAAKSERVATIIRPVLDFMQTMPAFVYLIPAAMLFGLGRVPGIIATVIFAM
FT                   PPAVRLTSLGIRQVNKEIVEAGQSFGCTSRQLLFKVQLPNAMPSIMAGVNQTIMMALSM
FT                   VIIASMVGAGGLGNDVLASIQRLDIGLGFESGMAVVLLAIILDRITESFGTKQTAKRGV
FT                   FAWFSGKLQRQSS"
FT   gene            complement(521696..522901)
FT                   /locus_tag="Pmen_0487"
FT   CDS_pept        complement(521696..522901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0487"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: glycine betaine/L-proline ABC transporter,
FT                   ATPase subunit; PFAM: CBS domain containing protein; ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83257"
FT                   /db_xref="GOA:A4XPJ1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPJ1"
FT                   /protein_id="ABP83257.1"
FT                   /translation="MQSGKIVVEHLYKVFGPNPQEAIDLLKEGWSKERILAEKGAVIGV
FT                   SDVSFSVEEGEIFVLMGLSGSGKSTLIRLINRLVEPSAGDVYIDGQNVAKLPQSQLIDL
FT                   RRRDMSMVFQSFALMPSRSVLDNAAFGLEVAGVGRKEREKRAMEVLKQVGLDTFAHKYP
FT                   HELSGGMQQRVGLARALTVNPSMIIMDEAFSALDPLKRREMQDVLLELQKTHRRTIIFV
FT                   SHDIEEAMRIGTRIGIMEGGRLIQVGTPQELIEKPANEYVRNFFDTVDTSRYLTAGQLK
FT                   ADSVPTYVHNGRAPDAAKICKELQALDKHYAFIVDEDNHFQGSISLEKIALMVDGDEPR
FT                   PLEANVLKQVVPVPEDMPLEDVISRLVDNEGPIPVVDAEGHYCGAISKGRLLTRLQGES
FT                   HE"
FT   gene            complement(523866..524810)
FT                   /locus_tag="Pmen_0488"
FT   CDS_pept        complement(523866..524810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0488"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83258"
FT                   /db_xref="GOA:A4XPJ2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPJ2"
FT                   /protein_id="ABP83258.1"
FT                   /translation="MNGLSRWLLASTLASCATLQAAESERCELVRLSDVGWTDITMTTT
FT                   VARLVMSEIGYRTQVRRLTLPDTYRGLSEGHLDVFLGNWMPAQAELVQPLLDSGRIEKL
FT                   NTNLPTVRYTLAVLTPGYEAGLKDFADIQRYKNELGGQIFGIEPGNEGNEMLKGMIRDN
FT                   TFGLGGFSLVETSESGMLNHVERAQRLGKWAVFLGWEPHPMNERLKMNYLSGGDDYFGP
FT                   NYGAAQVNTVARGNFSQQCPNLARLFRNMTFTITAENQLMSAVLEGNTNRRRVAKRWIE
FT                   DNPQMIAAWLKGVTRYQGGPIDRAFDMPLAANN"
FT   sig_peptide     complement(524745..524810)
FT                   /locus_tag="Pmen_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            524902..525183
FT                   /locus_tag="Pmen_0489"
FT   CDS_pept        524902..525183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83259"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPJ3"
FT                   /protein_id="ABP83259.1"
FT                   /translation="MRSDLDMPEKDVAGMEQNDAIGYARVDFRRGRGGENLIIESADPA
FT                   RHLASLGLTNNAMALIPAGAESLALDAICEVLVRRRRVPLARVVTDGS"
FT   gene            525496..526590
FT                   /locus_tag="Pmen_0490"
FT   CDS_pept        525496..526590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0490"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83260"
FT                   /db_xref="GOA:A4XPJ4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPJ4"
FT                   /protein_id="ABP83260.1"
FT                   /translation="MSQFTQGAQPQNRVAQSIGFLLLDNFTLISLASAVEPLRMANQLS
FT                   GKELYRWHTLTHDGLPVSASDGLQITPDAAMHSAPALDAVIVCGGVDIQHSVKREHVSW
FT                   LQLQARQGRQLGAVCTGSWALAKAGLLDGYDCSVHWECLASMQEAFPRAAITTRLFSID
FT                   RNRHTSSGGTAPMDMMLHLIGQQHGRELAAGISEMFIYERIRNEQDHQRVPLKHMLGSN
FT                   QPKLQEIVALMEANLEEPIDLDELACFVDISRRQLERLFQKYLHCSPSRYYLKLRLIRA
FT                   RQLLKQTSMSIIEVASVCGFVSTPHFSKCYREYFGIPPRDERAGQQGHNLVVLLPIPEQ
FT                   QINSSAVLALNRAQGESTFASVRI"
FT   gene            complement(526776..527027)
FT                   /locus_tag="Pmen_0491"
FT   CDS_pept        complement(526776..527027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83261"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPJ5"
FT                   /protein_id="ABP83261.1"
FT                   /translation="MMHADLIDQEDFRERLIALGLSIPAGASPEQACELAVSGLSPERA
FT                   VALRHLVEELLGGSATLLPNVREAISRHLLPALVPKPA"
FT   gene            complement(527053..527826)
FT                   /locus_tag="Pmen_0492"
FT   CDS_pept        complement(527053..527826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0492"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83262"
FT                   /db_xref="GOA:A4XPJ6"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPJ6"
FT                   /protein_id="ABP83262.1"
FT                   /translation="MTDLNIVALVSVGAHPTSGRSRRAEQDARAVELGLRLAGQNLQLL
FT                   HAGDPQADALRGYLGMGLEQLDVLEQPEGADALPLLVDYLQGSRTQLVLTGSQAETGEG
FT                   SGMLPFLLAERLGWPMVVGLAEVEKVENGVAQVLQALPRGQRRRLKVRLPCVASVDNAA
FT                   PVARQSAFGPARRGQIEAHEVTVVDDPLLAEASLQPAKPRPKRLKVIKAKTGAERMKAA
FT                   TAKASGGGGQVLKDVSPQDGAEAIFKLLIEEGVLR"
FT   gene            complement(527889..529121)
FT                   /locus_tag="Pmen_0493"
FT   CDS_pept        complement(527889..529121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0493"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   electron transfer flavoprotein, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83263"
FT                   /db_xref="GOA:A4XPJ7"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPJ7"
FT                   /protein_id="ABP83263.1"
FT                   /translation="MSDIIRRDPRAEWIARNRLHPLHAAMQSQSQTSWMGPNGIIRKNP
FT                   HAIAAGFIGPAGLKRIDRSGAQQGTAGKRSSASVEVQLPLHVIEQPAFHVCVVPDMVGG
FT                   RLSSHDKDLLGLARKLAGESGAVVAVVFGEDKESAFDTAGVDRLLRIAGDAFDGYAPEA
FT                   RVLALSAVESQLAPRHWLLPDSRTGGGELGRRLAAKLGERPATRVWQVAGEQAIGRAGS
FT                   GQQDIQRALPRLILAAAECAEPVSETRHEARPLELGEKVAHSLPRIEDLGPVAVDPAQI
FT                   PMAEAEFILSGGNGVKDWELFHQAAVALGATEGASRVAVDDGFMPRNRQVGATGTWVTA
FT                   RVYLAVGISGAIQHLQGIGACDKVVAVNMDPGCDMIKRADLSVIGDSAAILRALMERVA
FT                   AWRQEGKRDAA"
FT   gene            complement(529159..531120)
FT                   /locus_tag="Pmen_0494"
FT   CDS_pept        complement(529159..531120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0494"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83264"
FT                   /db_xref="GOA:A4XPJ8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021872"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPJ8"
FT                   /protein_id="ABP83264.1"
FT                   /translation="MLNTILPILLFAALALAVIGAARRFFMWRRGRPAKVDWIGGLLKM
FT                   PRRYLVDLHHVVERDKYMSKTHVATAGGFVLAAVLAIVVHGFGLHNRILGFALLAATVL
FT                   MFVGALFVAKRRRNPPSRLSKGPWMRLPKSLLMFAASFFIATLPVAGILPADFGGWILA
FT                   AILAVGVAWGVSELFFGMTWGGPMKHAFAGALHLAWHRRAERFGGGRSTGLKALDLDDP
FT                   KAPLGVEKPTDFTWNQLLGFDACVQCGKCEAMCPAFAAGQPLNPKKLIQDMVIGLAGGN
FT                   DAQFAGSPYPGKPLGEHSGGPHQPIVSLQGKALVDAETLWSCTTCRACVEECPMMIEHV
FT                   DAIVDMRRHLTLEKGATPNKGAEVLDNLIATDNPGGFNPGGRLNWAADLNLPLLADKQE
FT                   TDVLFWVGDGAFDMRNQRTLRAFVKVLKAADVDFAVLGLEERDSGDVARRLGDEATFQN
FT                   LAKRNIATLSKYRFKRIVSCDPHSFHVLKNEYGALGGHYEVLHHSTFIDELVRKSSLNL
FT                   GQSKATSVTYHDPCYLGRYNGEYEAPRAVLKAIGIEVKEMERSGFRSRCCGGGGGAPIT
FT                   DIPGKQRIPDMRMVDIKETGAELVAVGCPQCTAMLEGVVAPRPEIKDIAELVAEVLIEP
FT                   VEVAAKKPAARRELAEVQ"
FT   sig_peptide     complement(531058..531120)
FT                   /locus_tag="Pmen_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.501 at
FT                   residue 21"
FT   gene            complement(531273..533333)
FT                   /locus_tag="Pmen_0495"
FT   CDS_pept        complement(531273..533333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0495"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83265"
FT                   /db_xref="GOA:A4XPJ9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPJ9"
FT                   /protein_id="ABP83265.1"
FT                   /translation="MAFEAMFQPIQIGKLTIRNRVLSTAHAEVYATDGGMTTERYVKYY
FT                   EEKAKGGIGLAICGGSSVVAIDSPQEWWSSVNLSTDRIIPHFQNLADAMHKHGAKIMIQ
FT                   ITHMGRRSRWDGFNWPTLMSPSGIREPVHRATCKTIEPEDIWRVIGNYAQAARRAKEGG
FT                   LDGVELSAVHQHMIDQFWSPRVNKRTDEWGGSFEGRMKFGLEVLKAVRAEVGPDFCVGM
FT                   RICGDEFHPDGLSHEDMKQIAAYYDATGMIDFIGVVGSGCDTHNTLANVIPNMSYPPEP
FT                   FLHLAAGIKEVVKVPVLHAQNIKDPNQATRILEGGYVDMVGMTRAHIADPHLIAKIKMG
FT                   QVDQIKQCVGANYCIDRQYQGLDVLCIQNAATSREYMGVPHIIEKSTGPKRKVVIVGGG
FT                   PAGMEAARVAAERGHDVTLFEKKDALGGQITTASKAPQRDQIAGITRWYQLELARLGID
FT                   LRLGTAADVATIQDMRADIIILANGGHPYLEQNEHWGAAEGLVVSSWDVLDGKVAPGKN
FT                   VLVYDTICEFTGMSVADFMADKGSQVEIVTDDIKPGVAMGGTSFPTYYRSIYPKEVIMT
FT                   GDMMLEKVYREGDKLVAVLENEYTGAKEERVVDQVVVENGVRPDESLYYALKEGSRNKG
FT                   QIDVEALFAIKPQPCLSEPGDGYLLFRIGDCVAQRNTHAAIYDALRLCKDF"
FT   gene            complement(533432..533962)
FT                   /locus_tag="Pmen_0496"
FT   CDS_pept        complement(533432..533962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83266"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPK0"
FT                   /protein_id="ABP83266.1"
FT                   /translation="MATHAPEMPILVDDETGVWTTDALPMLYVPRHFFVNNHMGIEEVL
FT                   GAEKYAEILYKAGYKSAWHWCEKEAECHGLSGVAVFEHYMKRLSQRGWGLFKIQSIDLE
FT                   AGTCEVRLDHSAFVYVYGKCGRPVDYMFTGWFAGAMDQILQAQGSSIRTVAEQVYGASQ
FT                   EGHDHGLFRVKPL"
FT   gene            complement(534093..535070)
FT                   /locus_tag="Pmen_0497"
FT   CDS_pept        complement(534093..535070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0497"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="PFAM: peptidase M19, renal dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83267"
FT                   /db_xref="GOA:A4XPK1"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPK1"
FT                   /protein_id="ABP83267.1"
FT                   /translation="MSPAELHADSIVIDGLIIAKWNRELFEDMRKGGLTAANCTVSVWE
FT                   GFQATVNNIVASNNLIRDNSDLVMPVRTTADIRKAKEQGKTGILYGFQNAHAFEDQIGY
FT                   VEVFKQLGVGIVQMCYNTQNLIGTGCYERDGGLSGFGREIVAEMNRVGIMCDLSHVGSK
FT                   TSEEVILESKKPVCYSHCLPSGLKEHPRNKSDEELKFIADHGGFVGVTMFAPFLAKGID
FT                   STIDDYAEAIEYVMNLVGEDAIGIGTDFTQGHGKEFFEYLTHDKGYARRLTNFGKIVNP
FT                   LGIRTVGEFPNLTETLLKRGMPERVVRKVMGENWLRVLADVWGE"
FT   gene            complement(535258..536208)
FT                   /locus_tag="Pmen_0498"
FT   CDS_pept        complement(535258..536208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0498"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83268"
FT                   /db_xref="GOA:A4XPK2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPK2"
FT                   /protein_id="ABP83268.1"
FT                   /translation="MTQTFAFLLLPGFSMIGLMSAIEPLRVANRFRGELYRWRLLSLDS
FT                   EAVAASNGMSLNVEAGLELPEDTQALFVVAGFEPLAHYDKRLAHWLQRREREVKVLGAI
FT                   DTGSFVLAEAGLFEQQRLTLHWEAIDAFCERYPQLQVTQELFEIDGRRITSAGGTSSLD
FT                   LMLGLIGRDHGEPLAVQVSEQFVLGRIRTRQDHQRMQIASRYDLHNKKLVRVIGEMERH
FT                   CDQPLPCEELAEQVGVSVRQLERLFRHHLNTTPSAFYLGLRLDKARQLLRQSDLSVLEV
FT                   GLACGFDSASYFSRCYRQHFAASPSQDRHERPAPS"
FT   sig_peptide     complement(536146..536208)
FT                   /locus_tag="Pmen_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.860) with cleavage site probability 0.855 at
FT                   residue 21"
FT   gene            536433..537371
FT                   /locus_tag="Pmen_0499"
FT   CDS_pept        536433..537371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0499"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83269"
FT                   /db_xref="GOA:A4XPK3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPK3"
FT                   /protein_id="ABP83269.1"
FT                   /translation="MKGLTALAACCTLSLFSSSLLAAEDASCQKARIGLVGWTDVVATT
FT                   AVAANLLEGLGYQTTQTQASQQIIFSGIGKKQVDFFLGYWKPLMDDNIKPFQDKGEVKV
FT                   LAEPGLSDGISSLAVPTYLAEAGLRTYADIAKFRDQLEGKIYGIDPGTGANTTIQKMID
FT                   TNQFGLGGFKLVESSEAAMLAAVSRAVKAKKPVVFFGWKPHPMNIKMDLTYLTGSEDVF
FT                   GADEGLATVWTVVAPDYAQRCPNVDRLLNNLTFSAAQESELMEPIMAREDAKAVARRWL
FT                   KENPQDLDRLLAGVTTFDGQDGVAAVRAALD"
FT   sig_peptide     536433..536501
FT                   /locus_tag="Pmen_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 23"
FT   gene            537473..538357
FT                   /locus_tag="Pmen_0500"
FT   CDS_pept        537473..538357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0500"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83270"
FT                   /db_xref="GOA:A4XPK4"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPK4"
FT                   /protein_id="ABP83270.1"
FT                   /translation="MNYEVIVTCAVTGAGDTVGKHPAIPVTPKEIAAAAIEAAKAGATV
FT                   AHCHVRDPQTGKPSRNVALYREVVERIRESDTDVIINLTAGMGGDLEIGRGEQPLEFGA
FT                   GTDLVGPLERLAHVEELLPEICTLDCGTLNFGDGDFIYVSTPAQLRAGAKRITELGVKA
FT                   ELEIFDTGHLWFAKQLLKEGLLEDPLIQLCLGIPWGAPADTTTMKAMADNLPSGITWAG
FT                   FGIGRMQMPMVAQAMLLGGNVRVGLEDNIWLDRGVHASNGQLVERAIEIIERLGGRALT
FT                   PAEGREKMKLKRR"
FT   gene            538491..539456
FT                   /locus_tag="Pmen_0501"
FT   CDS_pept        538491..539456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0501"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83271"
FT                   /db_xref="GOA:A4XPK5"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPK5"
FT                   /protein_id="ABP83271.1"
FT                   /translation="MTFVTDIKTFAALGTGVIGAGWIARALAHGLDVIAWDPAPGAEAA
FT                   LRTRLANAWPALQKQGLAPGASLERLRFVDTIEDCVRDADFIQESAPERLELKCELHAK
FT                   ISAAARPDVLIGSSTSGLLPSEFYADAKHPERCLVGHPFNPVYLLPLVEVVGGAKTAPE
FT                   AVQAAIEVYQSLGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVASTGEIDDAIRF
FT                   GAGLRWSFMGSFLTYTLAGGPAGMRHFMAQFGPALKLPWTYLEAPELTEGLIDAVVEGT
FT                   AEQQGERSLDALERYRDDCLLAVLEAIRQTKAKHGFEFAE"
FT   sig_peptide     538491..538577
FT                   /locus_tag="Pmen_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.954 at
FT                   residue 29"
FT   gene            539565..540041
FT                   /locus_tag="Pmen_0502"
FT   CDS_pept        539565..540041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0502"
FT                   /product="thioesterase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83272"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPK6"
FT                   /protein_id="ABP83272.1"
FT                   /translation="MNLPTYRTTIPPEWVDYNGHLRDAFYLLIFSYATDALMDHLGLDE
FT                   AGRARSGHTLYTLECHLNYLAEIKLGAEVEVHTQLLAHDGKRLHIHHGLYYPEGEELLA
FT                   ASEQMLMNIDTAGGRSAAFDEQVRQRLLALAQAHRSLPIPLHVGRVIALPPARA"
FT   gene            540131..541318
FT                   /locus_tag="Pmen_0503"
FT   CDS_pept        540131..541318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0503"
FT                   /product="gamma-butyrobetaine hydroxylase"
FT                   /EC_number="1.14.11.1"
FT                   /note="TIGRFAM: gamma-butyrobetaine hydroxylase; PFAM:
FT                   Taurine catabolism dioxygenase TauD/TfdA"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83273"
FT                   /db_xref="GOA:A4XPK7"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR012775"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPK7"
FT                   /protein_id="ABP83273.1"
FT                   /translation="MNAVDPSLQAAPIADWRTYPISADLVGLNATRDSLQVTWSDGRVS
FT                   PFHYQWLRDNCPCSQCVYGVTREQLLEIVDVAEELSPQRTRIDEQGHLLIDWLGGHHSR
FT                   FHPGWLRAHAYDPASREERQAQRPQPQLWGAELAEQLPRFDYQAVLEDDATLLRWLLAV
FT                   RDLGLTQLVAVPASEGVLLRLAKRISFIRESNFGVLFDVQSKADADSNAYTAFNLPLHT
FT                   DLPTRELQPGLQFLHCLVNDATGGESVFVDGFAIAEALHQESPELFDILCTTPVEFRNK
FT                   SRTSDYRCLAPIIALDAEGRIGEVRMANFLRGPFDAPVERMPALYRAYRRFIALTREPR
FT                   FRLQRRLEAGQLWCFDNRRVMHARTEFDPASGARHFQGCYVDRDELLSRIRVLQR"
FT   gene            complement(541364..541759)
FT                   /locus_tag="Pmen_0504"
FT   CDS_pept        complement(541364..541759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0504"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83274"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPK8"
FT                   /protein_id="ABP83274.1"
FT                   /translation="MMKPRLIAAAEIDRLETWAKYTADMCHSCISSCCTLPVEVRLNDL
FT                   IRLELVDEFERSEPPKNIAKRLQKDGVVERFNQKSGIFTLTRMSNNDCLFLDRKTRLCT
FT                   VYDKRPDTCRHHPKVGPRPGYCAYKPK"
FT   gene            541984..545607
FT                   /locus_tag="Pmen_0505"
FT   CDS_pept        541984..545607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0505"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83275"
FT                   /db_xref="GOA:A4XPK9"
FT                   /db_xref="InterPro:IPR019286"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPK9"
FT                   /protein_id="ABP83275.1"
FT                   /translation="MQWIFMLVGLVLGAGVSESVTGAILGGLLGLSLGQALRLQGLETR
FT                   NAQLTAQLKEFAERFERGTRAMHERLVKVEQGQRDESAPEPTPVQASVNSEPQAEPALE
FT                   PVVAQAAEPTPEPELDWTLAPEIEAPAPQPAAEPAPAADPAAHRPPPAPQQSPWRSQTP
FT                   REPNLLERGFAAAKAWLLGGNTVLRVGVVLLFLGLAFLLRYATEGVEVPIELRYMGVAA
FT                   SALALLGLGWWLRRRNPGYALVLQGTGIAVLYLTVFAAMRLHPLLDPGMALGLLVAVTL
FT                   FSAILAVQQNALGLAAAAALGGFAAPILTSTGSGNHVALFSYFALLNAGIFAIAWFKAW
FT                   RLLNLIGFVGTFGIGFAWGLRSYTPELLGSTQPFLILFFLMYVAIGLLFARRTLRDAAD
FT                   APETRDELLRWSARRGDYVDATTLFGPPLIGFGLQVALVRHIEFAAAFSALGLGLFYLL
FT                   LARVLKARAGERALLLVETCLALGVVFASLAIPLGLDARWTAAAWAVEGAGIYWLGLRQ
FT                   GRPLARAFALLLQLGAALAFLSGLDLGYASLLDGSPLGALMLGVALLFSYWQLRREPEA
FT                   GSVWERRLLPWLGIAGLAFLYLIAPLLFEAPGTAIAWALAGLATLLVGLRIAAPSFVYS
FT                   AFAVQLLGGLLFLGQMALDSLFGGNSFKAGWFGLLAASMVGFGLIAGMLLAARDPQIRE
FT                   NRRLLGALSMVMLVGLVFINLAVLFVLPWVAAAAVWGGTGLLILWLALYLQQRAAFLFS
FT                   LALQLFAGLAFLAAGPLLLAGISGEGLSPLAHTGFWTPAVLGLAAQIGAWRLHSLAHGG
FT                   HDTGIDGVSLQRLGQLLLAWGAAWWALALASEVLRFVAPQLQVAVLLLAAALTTLLWML
FT                   LVLRTRWRELALLCSLLAPVAGLILAYAWHPLHHPAANFGWLGWAAVLVVHLLALRRLA
FT                   DLLPSRAASVAHVLGCWLLIGVLALELRYLLLSLADHYNAWRWLGWALLPTAYLWLMAQ
FT                   ARRLPWPVAGFEREYRLWAAAPLAALMLAWFWLANANSAGDSDPLPYLPLFNPLELGLL
FT                   LCLGALLAWGRFALPRFGLEPTRALQVVQGVAGLSLFALLTLMVMRTAHHWGGVPWQSA
FT                   ALFDSMLVQAGLSIVWTLIALALMLFGHLRVRRELWLVGAALIALVVAKLFFVELGNRG
FT                   GLERIVSFIGVGVLLLVVGYFAPLPPRKSEPSTSNEQEPAA"
FT   sig_peptide     541984..542052
FT                   /locus_tag="Pmen_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.768 at
FT                   residue 23"
FT   gene            545604..546956
FT                   /locus_tag="Pmen_0506"
FT   CDS_pept        545604..546956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83276"
FT                   /db_xref="GOA:A4XPL0"
FT                   /db_xref="InterPro:IPR025060"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPL0"
FT                   /protein_id="ABP83276.1"
FT                   /translation="MNILRLGLLLSLSLSAALQAAERAQDFRHAAPLQLSGEGPWYRLE
FT                   LPIAAHFAALHGDLRDLRVFDAQGQAQSYALIPGRSETVAHEQEHGVRWFPLHGRADAQ
FT                   AAPALRVERSTTGTLIELRGESAAEPDQQLRGWLLDASAIDAPLVRLSLDWSGGEDGFQ
FT                   RFSIEASDDLQRWQSWGEGQVARLSFADERIDQRQIELPGQRARYLRLLWRAPTQAPQL
FT                   EVAALRSRRQDQQAAPLVWSEPMPAERSADGLYRWQLPLALPLERLRLPLAQANTLAPL
FT                   RIEARSSDQGAWRPLVSGLLYRLPENGWEMVHDELALPGWPVRQLRLQLDPRGGGLGPE
FT                   VPNLQVAVRATQLIFLARGEAPYRLALGNAGAQSAALPLPSLIPGYQAERLASLGRAEL
FT                   GDASALAGSMGEPAAVARADWQRWGLWAVLLLGVGLLAAMAASLLRRPPGA"
FT   sig_peptide     545604..545666
FT                   /locus_tag="Pmen_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 21"
FT   gene            547154..548827
FT                   /locus_tag="Pmen_0507"
FT   CDS_pept        547154..548827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0507"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; PAS fold-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83277"
FT                   /db_xref="GOA:A4XPL1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPL1"
FT                   /protein_id="ABP83277.1"
FT                   /translation="MQACLASGWSLSPPVLMTLLVCFGVVLLAHWVTRQRDFPGRDSFI
FT                   LLHLASLWWMGAAALEMSFFAAECKMFWASMAWPGIVSTPTFWAVFLWQYVNSMRTPLP
FT                   RSSILGLSLVPLLVWALALSNPWHGLFYGAGSAPVDDSLGAPVRYQHGPLFYATAVYVY
FT                   LFMAFCMGVVSRAAALSQGLHRRHYLAFVLVTAVPWVANIGYVVFGWTLFGFDPTPFSF
FT                   AFTLVAFSWLIVGVRLFDLLPVARHLLLEALLDPVLVIDPRGRVIEANPAALKLAGLQQ
FT                   GWQGTELGQWPVFGADLQRLLSEAGESDQERPLTLTSAARYYEVRVRAIERTTRHGPTL
FT                   LGHMLYVRDVTQRHLSELKLAEALALSEERLRTISNLHEQLREQALCDPLTGLYNRRYL
FT                   DEFFSRELARAQRENLPLALALIDLDHFKRLNDECGHLVGDDVLKAVAKHLLDNLRSTD
FT                   AVFRIGGEEFLLILPGVDPVEACERLQNICSQLAGQSIATRGGDQQVTLSAGLAHWPQQ
FT                   GVVLEELLHAADAALYQAKRGGRNRVCCAVGNARVSHPSR"
FT   sig_peptide     547154..547243
FT                   /locus_tag="Pmen_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.739) with cleavage site probability 0.735 at
FT                   residue 30"
FT   gene            548890..549897
FT                   /locus_tag="Pmen_0508"
FT   CDS_pept        548890..549897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0508"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83278"
FT                   /db_xref="GOA:A4XPL2"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPL2"
FT                   /protein_id="ABP83278.1"
FT                   /translation="MSRVTLSRYLIEQTRSHNTPADLRFLIEVVARACKAISHQVSKGA
FT                   LGGVLGSLDSENVQGEVQKKLDVISNEILLEANEWGGHLAGMASEEMDNAYQIPGKYPK
FT                   GAYLLVFDPLDGSSNIDVNVSVGTIFSVLRCPDRNGDTGDLGEDAFLQPGTQQVAAGYA
FT                   IYGPQTMLMLTLGDGVKGFTLDRELGSFVLTHDNIKVPESTKEFAINMSNQRHWEAPVQ
FT                   RYVSELLAGETGPLGRNYNMRWIASMVADVHRILTRGGVFMYPRDAREPDKPGKLRLMY
FT                   EANPMSMIIEQAGGAATDGSQRILDIQPTSLHQRVPVFLGSKEEVLRVTAYHRG"
FT   gene            549901..550500
FT                   /locus_tag="Pmen_0509"
FT   CDS_pept        549901..550500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0509"
FT                   /product="protein of unknown function DUF924"
FT                   /note="PFAM: protein of unknown function DUF924"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83279"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPL3"
FT                   /protein_id="ABP83279.1"
FT                   /translation="MQPWQPLLDWWFGADGSATDIAAARRGLWFGKRDSQDREAEARFA
FT                   ALVEQALAGELKGWADEPQGWLAHLILLDQLPRMIFRDTPRAFAGDALARPLLEAGLER
FT                   GWDRALTPIQRVFAYLIFEHAEDLPLQARAVELFRALLDQAGDAERELFADFLDFAERH
FT                   QRVIARFGRFPHRNAILGRACTDEEQAFLREPGSRF"
FT   gene            550573..550824
FT                   /locus_tag="Pmen_0510"
FT   CDS_pept        550573..550824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83280"
FT                   /db_xref="GOA:A4XPL4"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPL4"
FT                   /protein_id="ABP83280.1"
FT                   /translation="MSMRIVALLACCLLAACNKVNQDNYSKLKAGMSKAEVESLLGAPG
FT                   ECAGALGMTSCTWGDDKSYISVQYAGDKVMMFSGKGLK"
FT   sig_peptide     550573..550641
FT                   /locus_tag="Pmen_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.772 at
FT                   residue 23"
FT   gene            550837..551379
FT                   /locus_tag="Pmen_0511"
FT   CDS_pept        550837..551379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0511"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83281"
FT                   /db_xref="GOA:A4XPL5"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPL5"
FT                   /protein_id="ABP83281.1"
FT                   /translation="MRSILIASAVLALAGCANSGTGRIPQEPPKTVQVDLQRYQGTWYE
FT                   LARLPMFFQRNCVQSEAHYGLRDDGRIDVTNRCRDKDGEWIEAKGVAEPQVQGQTDKLW
FT                   VRFDNWASKLLPIKGDYWVLYRDDDYRVALVGHPQRKYLWLLSRTAEVDQDTRDKLLSI
FT                   AREQGYDTSELIWRQAD"
FT   sig_peptide     550837..550896
FT                   /locus_tag="Pmen_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.966 at
FT                   residue 20"
FT   gene            complement(551505..551942)
FT                   /locus_tag="Pmen_0512"
FT   CDS_pept        complement(551505..551942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83282"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPL6"
FT                   /protein_id="ABP83282.1"
FT                   /translation="MSRRYLTGFLALFFTLLLAGCGGRDDPQAALEAAVKQLQDNIEAK
FT                   SASAVLEQLHGDFLARQELDREWAKRTMTLLFLRHKNIKVIALGKNSWIDPAISSKGYT
FT                   EAQVGLTGAEGLIPDSARHYSVRLEWWQEGGEWKLARLDWE"
FT   sig_peptide     complement(551871..551942)
FT                   /locus_tag="Pmen_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.449 at
FT                   residue 24"
FT   gene            552021..552992
FT                   /locus_tag="Pmen_0513"
FT   CDS_pept        552021..552992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0513"
FT                   /product="prolyl aminopeptidase, Serine peptidase, MEROPS
FT                   family S33"
FT                   /EC_number="3.4.11.5"
FT                   /note="TIGRFAM: proline iminopeptidase; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83283"
FT                   /db_xref="GOA:A4XPL7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPL7"
FT                   /protein_id="ABP83283.1"
FT                   /translation="MQTLYPEIKPYARHELAVEPPHVLYVDESGSADGLPVLFIHGGPG
FT                   AGCDASSRRYFDPNLYRIVTFDQRGCGRSTPHASLENNTTQALIGDIERIREHLGIDKF
FT                   VLFGGSWGSTLALAYAQTHPQRVHGLILRGIFLCRPQEFSWFYQEGASRLFPDYWEDYL
FT                   APIPPDERGDLMQAFYKRLTGADQIAQMHAAKAWSTWEGRTATLRPNTQVVERFSDAHR
FT                   ALSIARIECHYFVNGAFLEPDQLLRDMPKIAHLPGIIVHGRYDAICPLDNAWALHQAWP
FT                   NSELQIIRDAGHAAAEPGITDALVRAADELARRLLDLPPEDA"
FT   gene            552989..553426
FT                   /locus_tag="Pmen_0514"
FT   CDS_pept        552989..553426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0514"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83284"
FT                   /db_xref="GOA:A4XPL8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPL8"
FT                   /protein_id="ABP83284.1"
FT                   /translation="MKLLIQRVSAARVEVEGEVVGGIDQGLLALVGIEPQDDQASLTRA
FT                   LHKLLNYRVFSDEAGKMNRSLTDVQGGLLLVSQFTLAADTKSGMRPSFSSAAPPAQGEA
FT                   LFDALVEAARARHPQVATGRFGANMQVHLVNDGPVTFLLEV"
FT   gene            complement(553508..554218)
FT                   /locus_tag="Pmen_0515"
FT   CDS_pept        complement(553508..554218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0515"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83285"
FT                   /db_xref="GOA:A4XPL9"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPL9"
FT                   /protein_id="ABP83285.1"
FT                   /translation="MNLLLLEDADFVGEDRVRLSGRRLKHLHEVHRAEAGDRLRVGRLG
FT                   GLMGEGRLMALDAEHAELQVSLDQAPPAKLPLTLVLALPRPKMLKRVLQTVSAMGVPRL
FT                   VLVNSYRVEKSFWQTPFLEAEAIREQLILGLEQARDTVLPDVSIEKRFKPFVEDRLPAL
FT                   ATGTLGLIGHPGDYPACPRAVEEPVTLAIGPEGGWIPYEVDLLRQAAGLQPVQLGERIL
FT                   RVETAVPALLARLF"
FT   gene            complement(554215..555009)
FT                   /locus_tag="Pmen_0516"
FT   CDS_pept        complement(554215..555009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0516"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83286"
FT                   /db_xref="GOA:A4XPM0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPM0"
FT                   /protein_id="ABP83286.1"
FT                   /translation="MSKLPDADQEMPLVSHLTELRTRLLRCVVIILLIFAGLFYFAQDI
FT                   YALVAAPLRAYLPDGATMIATGVASPFLTPFKLTLMCALFLGMPVILHQAWGFIAPGLY
FT                   THERRIAVPLLISSIFLFYAGMAFAYFVVFPIMFGFFASVTPEGVAMMTDIGQYLDFVL
FT                   TLFFAFGVAFEIPIATFLLIWVGIVDVATLRKSRPYVIVGCFAVGMLLTPPDVFSQTLL
FT                   AVPMWLLFEAGVLAGALVKRKRDEEKAEEEAKPEDQPPAPLS"
FT   gene            complement(555006..555347)
FT                   /locus_tag="Pmen_0517"
FT   CDS_pept        complement(555006..555347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0517"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83287"
FT                   /db_xref="GOA:A4XPM1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPM1"
FT                   /protein_id="ABP83287.1"
FT                   /translation="MFDIGFTELLLVGLVALVVLGPERLPGAVRTAGLWIGRIKRSFNS
FT                   IKAEVEREIGADEIRRQLHNERILELEREMKAMKQDILDTASLKPSSDADKSSVEPPPP
FT                   AAQDKTSQP"
FT   gene            complement(555351..555584)
FT                   /locus_tag="Pmen_0518"
FT   CDS_pept        complement(555351..555584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0518"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83288"
FT                   /db_xref="GOA:A4XPM2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPM2"
FT                   /protein_id="ABP83288.1"
FT                   /translation="MGFGGISIWQLLIILLIVVMLFGTKRLKSLGSDLGDAIKGFRKSM
FT                   DNGEAEKPAVEEPKGQTIDAQARKVEEPAKKD"
FT   gene            complement(555607..555942)
FT                   /locus_tag="Pmen_0519"
FT   CDS_pept        complement(555607..555942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0519"
FT                   /product="phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /note="PFAM: phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83289"
FT                   /db_xref="GOA:A4XPM3"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPM3"
FT                   /protein_id="ABP83289.1"
FT                   /translation="MSDTLSRLAEVLEARKGAAPDSSYVASLYHKGLNKILEKVGEESV
FT                   ETILAAKDAAASGDCKDLIYETADLWFHSLVMLAALGQHPQAVLDELDRRFGLSGHAEK
FT                   AARPQSE"
FT   gene            complement(555935..556333)
FT                   /locus_tag="Pmen_0520"
FT   CDS_pept        complement(555935..556333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0520"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83290"
FT                   /db_xref="GOA:A4XPM4"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPM4"
FT                   /protein_id="ABP83290.1"
FT                   /translation="MNDWLDEIHWNEDGLVPAIAQDHQTGRILMMAWMNRESLALTVSE
FT                   QRAIYWSRSRGKLWRKGEESGHVQKLHELRLDCDADVIVLMVEQLGGIACHTGRESCFY
FT                   RVYENGGWKTVDAVLKDPHAIYAGHSHE"
FT   gene            complement(556404..557987)
FT                   /locus_tag="Pmen_0521"
FT   CDS_pept        complement(556404..557987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0521"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83291"
FT                   /db_xref="GOA:A4XPM5"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPM5"
FT                   /protein_id="ABP83291.1"
FT                   /translation="MKLLAVRRLLRIQRVVIRYQLDELLLELPLPFWLRALSWLLPWRW
FT                   LPRRPLALSRGARLRLALEDLGPIFIKFGQLLSTRRDLLPPDIADELARLQDQVPPFPE
FT                   DQAIALIERQLGAPVSQLFARFDSQPLASASVAQVHAAQLKSGEEVVVKVVRPGLKPVI
FT                   RQDLAWLFLLARIAERASADARRLRPVEVVSDYEKTIFDELDLLREAANASQLRRNFEG
FT                   SPLLYVPQVYWDLCRHQVLVMERIYGVPVTDLATLADQRTDMKLLAERGVEIFFTQVFR
FT                   DSFFHADMHPGNIFVSTRTPWSPQYIAIDCGIIGSLTDEDQDYLARNLIAFFKRDYRKV
FT                   AQLHIDSGWVPADTKVNEFEAAIRTVCEPIFEKPLKDISFGQLLLRLFQTARRFNMEVQ
FT                   PQLVLLQKTLLNIEGLGRQLYPDLDLWSTAQPFLERWMRERVSPLHLLRNLQQQAEQVP
FT                   HLSQIARDALERLQRPEPPRESDARDQWPLRLLGAALIAAGAVQGLAPLLATWPAWLMV
FT                   GGGLYLVLRR"
FT   gene            complement(557984..558601)
FT                   /locus_tag="Pmen_0522"
FT   CDS_pept        complement(557984..558601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0522"
FT                   /product="protein of unknown function DUF1243"
FT                   /note="PFAM: protein of unknown function DUF1243"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83292"
FT                   /db_xref="GOA:A4XPM6"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPM6"
FT                   /protein_id="ABP83292.1"
FT                   /translation="MLLTGLLAGVETGLNRVLRLDGTALPRLHALSGKVIAVQCQSPAL
FT                   ELFILPSGDGLQLAAQWHAPADCTLTAPVASLARLALSRDKTAVLHRPEVSLDGDSAAL
FT                   LQLAGILQDLELDWEYELSRWLGPVASTLLAGHLRSRVNLASHGAASLTQNLADYLAEE
FT                   SRTLVGQREADARFAELDQLKLALDRLEARIERLTSAHKPDA"
FT   gene            complement(558601..559371)
FT                   /locus_tag="Pmen_0523"
FT   CDS_pept        complement(558601..559371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0523"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: putative RNA methylase;
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase;
FT                   UbiE/COQ5 methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83293"
FT                   /db_xref="GOA:A4XPM7"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPM7"
FT                   /protein_id="ABP83293.1"
FT                   /translation="MSDPRKAQEQEPTTHFGFQDVPESQKAEKVAEVFHSVAAKYDLMN
FT                   DVLSGGLHRLWKRFTIELSGVRPGNRVLDIAGGTGDLTRKFASIVGPTGEVVLADINDS
FT                   MLKVGRDRLLDKGVAGNVQFVQADAEKLPFPDNHFDVVTIAFGLRNVTHKEDALRSMLR
FT                   VLKPGGRLLVLEFSKPGNPLLAKVYDTYSFSFMPLAGKLITNDADSYRYLAESIRMHPD
FT                   QETLKAMMVDAGFERVTYHNMTGGIVALHRGIKP"
FT   gene            559518..559793
FT                   /locus_tag="Pmen_0524"
FT   CDS_pept        559518..559793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0524"
FT                   /product="putative polyhydroxyalkanoic acid system protein"
FT                   /note="TIGRFAM: putative polyhydroxyalkanoic acid system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83294"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPM8"
FT                   /protein_id="ABP83294.1"
FT                   /translation="MSRIRIERSHSLGREVAREKAERLAERLASEYDVRYRWNGDTLEF
FT                   KRSGADGSIAVGENTVRVELKLGLLLSPMGGMIQREIEQVLDKSLA"
FT   gene            559965..560411
FT                   /locus_tag="Pmen_0525"
FT   CDS_pept        559965..560411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0525"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="TIGRFAM: poly(hydroxyalkanoate) granule-associated
FT                   protein; PFAM: poly granule associated family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83295"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPM9"
FT                   /protein_id="ABP83295.1"
FT                   /translation="MSKVAVKKKVEAVAEDKAGLFDDVKGYARKIYLAGLGAYAKAGAE
FT                   GVEYFKELVKTGEGVEVKGKKLVDEQVEAANSQIESVKQSVNSNVTSVKGKVEVQLDKI
FT                   EKAFDTRVAAALNRIGIPSKQDVEALSAKLDELSALLEHVARTK"
FT   gene            560422..561276
FT                   /locus_tag="Pmen_0526"
FT   CDS_pept        560422..561276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0526"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="TIGRFAM: poly(hydroxyalkanoate) granule-associated
FT                   protein; PFAM: poly granule associated family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83296"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPN0"
FT                   /protein_id="ABP83296.1"
FT                   /translation="MAVKKKTEKQTSSWIGEVEKYSRQIWLAGLGAYSKVSKDGTKLFD
FT                   TLVKDGEKAEKLAKSEVDKQVGAVKAGVGAKVGSAKSKVDEVKDKAIGKWSELEEAFDK
FT                   RLNNAISRLGVPSRNEVKALNDKVDSLTKQLEKIAGVSAKSVAKPAAKAAPKPAAKPAV
FT                   KAASKPAAKPAAKPAAKAAAKPAAKPAAAKAAAKPAAAKPAAKPAAKPAAKAAAKPAAK
FT                   PAAAPKPAAKPAAAKKPAAKKPAAPKAAAPKPAAPAPAPAAAATPAAAPAPAATPATPA
FT                   TPS"
FT   gene            complement(561359..561973)
FT                   /locus_tag="Pmen_0527"
FT   CDS_pept        complement(561359..561973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0527"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83297"
FT                   /db_xref="GOA:A4XPN1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPN1"
FT                   /protein_id="ABP83297.1"
FT                   /translation="MKTRERILQAALQLFNEQGEPNVSTLEIANELDISPGNLYYHFHG
FT                   KEPLVLELFERFQAEMAPLLDPPADAELDVEDYWLFLHLIVERLAQYRFLFQDLSNLAG
FT                   RLPKLARGIRHWLNALKRTLAALLARLMADGQLVSGTQALGQLVEQITLTLLFSLDYQR
FT                   ILDQEGEVRLVVYQIMMLVAPHLAQPSRGTVEHLAQRYLEA"
FT   gene            complement(562044..563726)
FT                   /locus_tag="Pmen_0528"
FT   CDS_pept        complement(562044..563726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0528"
FT                   /product="poly(R)-hydroxyalkanoic acid synthase, class II"
FT                   /note="TIGRFAM: poly(R)-hydroxyalkanoic acid synthase,
FT                   class II; PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83298"
FT                   /db_xref="GOA:A4XPN2"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR011287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPN2"
FT                   /protein_id="ABP83298.1"
FT                   /translation="MRDKSNPAPLPAPATFMNAQSAVVGVRGRDLLSTMRLLAVQGLKS
FT                   PVRSSRHLLAFGGQLGRVLLGDTLHKVNPQDARFADPTWHLNPFYRRSLQAYLAWQKQL
FT                   SAWIDNSDLSPDDRARARFLASLMSDALSPSNSPLNPQAVKELFNTGGSSLLKGVRHLF
FT                   DDLLHNNGLPSQVSKHAFEVGRNLACTPGAVVFRNELLELIQYKPMSERQYLRPLLIVP
FT                   PQINKYYIFDLSNDKSFVQYALKNGLQTFMISWRNPDPRHREWGLSSYVQAVEEAIEAC
FT                   RAISGSKEVNLLGACAGGLTIAALQGHLQARRQLRKVSSATYMVSLLDSQIDSPAMLFA
FT                   DEQTLESAKRRSYQQGVLDGRDMARVFAWMRPNDLIWNYWVNNYLLGKQPPAFDILYWN
FT                   NDNTRLPAALHGDLLDFFKHNPLRRAGGLEVCGTPVDLTKVNVDSFSVAGINDHITPWD
FT                   AVYRSTLLLGGNRRFVLSNSGHIQSILNPPGNPKANYYENAKLTSDPRAWFHDAQHQQG
FT                   SWWPQWLEWIQARSGEQRETLMALGNQNHPPMEAAPGTYVHIR"
FT   sig_peptide     complement(563661..563726)
FT                   /locus_tag="Pmen_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.603) with cleavage site probability 0.477 at
FT                   residue 22"
FT   gene            complement(563935..564792)
FT                   /locus_tag="Pmen_0529"
FT   CDS_pept        complement(563935..564792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0529"
FT                   /product="poly(3-hydroxyalkanoate) depolymerase"
FT                   /note="TIGRFAM: poly(3-hydroxyalkanoate) depolymerase;
FT                   PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83299"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR011942"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPN3"
FT                   /protein_id="ABP83299.1"
FT                   /translation="MPSSFVFRTIDLDGQTIRTAVRPGKGPLVPLLIFNGIGANLELVM
FT                   PFVAALDPDLEVIAFDVPGVGGSSTPTTPYRFPGLAKLAARMLDYLDYGQVNAIGVSWG
FT                   GALAQQFAHDYPERCKKLILAATSAGAVMVPGKPKVLWRMASPRRYIQPSYGVRIAPDI
FT                   YGGAFRRDPKLAMAHASKVRSGGKMGYYWQLFAGLGWTSIHWLHKIRQPTLVMAGDDDP
FT                   LIPLINMRLLAWRIPNAELHVIDDGHLFLVTRAEAVAPIIMKFLEEERQRAVMHPQPAP
FT                   LRQH"
FT   gene            complement(564946..566625)
FT                   /locus_tag="Pmen_0530"
FT   CDS_pept        complement(564946..566625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0530"
FT                   /product="poly(R)-hydroxyalkanoic acid synthase, class II"
FT                   /note="TIGRFAM: poly(R)-hydroxyalkanoic acid synthase,
FT                   class II; PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83300"
FT                   /db_xref="GOA:A4XPN4"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR011287"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPN4"
FT                   /protein_id="ABP83300.1"
FT                   /translation="MSDKNNEDLKRQASENTLGLNPVIGIRGKDLLTSARMVLAQALKQ
FT                   PFHSVKHVAHFGLELKNVMLGQSELKPEDGDRRFADPAWSQNPLYRRYLQTYLAWRKEL
FT                   HDWIEHSSLSEQDASRGHFVINLMTEAMAPSNSMANPAAVKRFFETGGKSLLDGLSHLA
FT                   KDMIHNGGMPSQVNMAAFEVGKNLATTEGAVVFRNDVLELIQYKPITESVHERPLLVVP
FT                   PQINKFYVFDLSPDKSLARFLLRSQVQTFVVSWRNPTKAQREWGLSTYIEAFKEAIDVI
FT                   CAITGSKDVNMLGACSGGLTTASLLGHYAALGEQKVHALTLLVSVLDTQLDTQVALFAD
FT                   EKTLEAAKRRSYQAGVLEGSDMAKVFAWMRPNDLIWNYWVNNYLLGNEPPVFDILYWNN
FT                   DTTRLPAALHGEFIEMFQTNPLTRPGALEVCGTPIDLKQVTCDFFVVAGTTDHITPWDS
FT                   CYKSAHLFGGKCEFVLSNSGHIQSILNPPGNPKARYMTNSEMPLDPKAWQESSTKHADS
FT                   WWLHWQGWLAERSGATKAAPSKLGNKKYPAGEAAPGTYVHER"
FT   gene            complement(567015..567386)
FT                   /locus_tag="Pmen_0531"
FT   CDS_pept        complement(567015..567386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0531"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83301"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPN5"
FT                   /protein_id="ABP83301.1"
FT                   /translation="MPIPSAIKLHKASRTLELRYGEQSYRLSAEFLRVHSPSAEVQGHG
FT                   KPILQTGKLNVGLSSLEPAGNYALKLCFDDGHDSGLYTWDYLYQLATQQEQLWADYLAQ
FT                   LSAAGQSRDPNESVVRLML"
FT   gene            complement(567468..568808)
FT                   /locus_tag="Pmen_0532"
FT   CDS_pept        complement(567468..568808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0532"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83302"
FT                   /db_xref="GOA:A4XPN6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPN6"
FT                   /protein_id="ABP83302.1"
FT                   /translation="MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPADLRQ
FT                   EVTPKNILMIGPTGVGKTEIARRLAKLANAPFLKVEATKFTEVGYVGRDVESIIRDLAD
FT                   AAVKMLREQEMTKVRHRAEDAAEERILDALLPPARQAFGDEPVRSEDSNTRQLFRKRLR
FT                   EGQLDDKEIDIEVAESPMGVEIMTPPGMEEMTSQLQNLFAGLGKGKKKSRKLKVADALK
FT                   LVRDEEAARLVNEEELKARALEAVEQHGIVFIDEIDKVAKRGNTGGADVSREGVQRDLL
FT                   PLIEGCTVNTKLGMVKTDHILFIASGAFHLAKPSDLVPELQGRLPIRVELKALSPQDFE
FT                   RILTEPHASLTEQYAALLKTEGLNIEFAEEGIKRLAEIAWQVNEKTENIGARRLHTLLE
FT                   RLLEEVSFSAGDLAGQQSGEPIRIDAAYVNGHLGELAQDEDLSRYIL"
FT   gene            complement(568848..569378)
FT                   /locus_tag="Pmen_0533"
FT   CDS_pept        complement(568848..569378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0533"
FT                   /product="HslV component of HslUV peptidase, Threonine
FT                   peptidase, MEROPS family T01B"
FT                   /note="PFAM: 20S proteasome, A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83303"
FT                   /db_xref="GOA:A4XPN7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPN7"
FT                   /protein_id="ABP83303.1"
FT                   /translation="MTTIVSVRRHGKVVMAGDGQVSLGNTVMKGNAKKVRRLYHGQVLA
FT                   GFAGATADAFTLFERFEGQLEKHQGHLVRAAVELAKDWRTDRSLSRLEAMLAVANKDAS
FT                   LIITGNGDVVEPEEGLIAMGSGGNFAQAAARALLMKTDLSALEVAQTALGIAGDICVFT
FT                   NHHQTIEELDAAE"
FT   gene            complement(569475..570149)
FT                   /locus_tag="Pmen_0534"
FT   CDS_pept        complement(569475..570149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0534"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83304"
FT                   /db_xref="GOA:A4XPN8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPN8"
FT                   /protein_id="ABP83304.1"
FT                   /translation="MAARKKPAPKRGASRYQAPAKKPVPGWIWLACGLVVGGFFMFLFS
FT                   LEPGRDEIKRDRGEQARTTKPEPKPAPAEPARPKYDFYTLLPESEVILPQALEETPPAP
FT                   PAQKPVTPEEAAKIDAARAQAALNGEVPPPPPPVIASAPVTTQFFLQAGSFRKRDDADS
FT                   LRAQIILLGQNVRVETGKVREETWHRVLVGPFASREQLAAAQKTLAGNGFSNLLLQQRQ
FT                   VR"
FT   gene            complement(570150..571889)
FT                   /locus_tag="Pmen_0535"
FT   CDS_pept        complement(570150..571889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0535"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83305"
FT                   /db_xref="GOA:A4XPN9"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPN9"
FT                   /protein_id="ABP83305.1"
FT                   /translation="MKDSIRHLIQQALDRLTADGVLPAGLTPAIQVENTKDKSHGDFAS
FT                   NIAMMLAKPAGMKPRDLAEKLIAALPADAGIAKVEIAGPGFLNFFQNSDALAQRLEAAL
FT                   ADAQLGVHKNGPAQRVVVDLSAPNLAKEMHVGHLRSTIIGDGVARVLEFLGDTVIRQNH
FT                   VGDWGTQFGMLLAYMQENPAAAESELADLEGFYRAAKKRFDESPEFADRARELVVQLQA
FT                   GDAECLRLWHRFNDISLSHCQALYDRLGVKLSMADVKGESAYNDDLPQVVADLAAKGLL
FT                   TEDNGAQCVFMDEFKNAEGNPLPLIVQKAGGGYLYATTDLAATRYRAGVLKADRVLYFV
FT                   DQRQALHFQMVFACARLAGFVPASMELEHMGFGTMNGPDGRPFKTRDGGTVKLVQLLDE
FT                   AEQRAYELVKSKNPELAEDELRRIARVVGIASVKYADLSKHRASDYSFNFDLMLSFEGN
FT                   TAPYLLYAYTRVAGVFRKLGKGIDEIGGRIALVAEQEQALAAKLAQFGELLASVADKGT
FT                   PHMLCSYLYDLAGLFSSFYENCPILAAEDEATRDSRLRLTALTGRTLKQGLELLGLETL
FT                   ERM"
FT   gene            complement(572061..574292)
FT                   /locus_tag="Pmen_0536"
FT   CDS_pept        complement(572061..574292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0536"
FT                   /product="replication restart DNA helicase PriA"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: helicase
FT                   domain protein; type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83306"
FT                   /db_xref="GOA:A4XPP0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPP0"
FT                   /protein_id="ABP83306.1"
FT                   /translation="MEARVPDLILRLALPSPLRRLFDYRAPAGVPRSALQPGVRLRVPF
FT                   GRREIIGILVEVDSQSEVPADKLKPALQLLDARPPLPAPLFKLCLWTAQYYQHSLGDTL
FT                   SWALPVLLRQGEPAETRQERFWLANSGASVDDPRLARAPRQREALKALAQHPHGVAHGL
FT                   LSQLQLNRDSLQLLHEKGLVRVEVRRTQPHAKPAHWLAQPELPLNAEQRAAVNAVASGW
FT                   GQFNAFLLAGITGSGKTEVYLQLIHQCLAAGKQALVLIPEINLGPQTFDRFARRFNARI
FT                   ALLHSAVNDRERLDAWLAARDGEADIIIGTRSALFTPMKNPGLIIVDEEHDASYKQQEG
FT                   LRYHARDLALVRARQENLPIVLGSATPSLESLHNAHSGRYALLKLTQRAGGASQPRFLR
FT                   LDVKSRPLDSGISGPMQQAIAQTLAAGQQVLVFLNRRGFAPTLLCHDCGWLSECPRCDA
FT                   RMTVHQRHQELRCHHCGHVERQPSNCPKCQHVDLRPVGAGTERAEERLAVLFPDYPVLR
FT                   IDRDSTSRKGAMDRLFATINKGEPCILVGTQMLAKGHHFPRVTLVSILDADGGLFSADF
FT                   RASERMAQLIVQVAGRAGRAEEPGKVIIQSHLADHPLLVQLTEQGYFAFAEQALSERRS
FT                   AGLPPFCHLALLRAEAHKPGQAESFLDEACNEAEHLLGELGLSGIELLGPVPAPMERRA
FT                   GRFRAQLLLQGNARAPLHRLLTPWLQALEQMPGGRAVRWSLDVDPIDLF"
FT   gene            574437..574649
FT                   /locus_tag="Pmen_0537"
FT   CDS_pept        574437..574649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0537"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="PFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83307"
FT                   /db_xref="GOA:A4XPP1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPP1"
FT                   /protein_id="ABP83307.1"
FT                   /translation="MKADIHPNYVEIDATCSCGNVIKTRSTIGKNISLDVCSECHPFYT
FT                   GKQKVLDTGGRIDRFKQRFGVFGAK"
FT   gene            574676..575476
FT                   /locus_tag="Pmen_0538"
FT   CDS_pept        574676..575476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0538"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83308"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPP2"
FT                   /protein_id="ABP83308.1"
FT                   /translation="MRHSVILKKASLVGAFFISLLCVDLAQAFCPLRGDLAQVAVRQVV
FT                   DGDTVRLDDGRSVRLIGLNAPELGRKGRPDEPFAVQAKRRLQALVDAGDGRVGLRYGKQ
FT                   RKDRYGRTLAHLYDRQGRNLEAQLLGEGLGFMVAVAPNAELASCHAAAERQARNARLGL
FT                   WRQDQVKLAGQLHGGGFALLGGRVREVQRNRGGLWLELDGGRVLRVAPELLDQFDARAL
FT                   QRLEGRRVEARGWVIDRQSRGGLKNGQARWMLPLTHSAMLEVLP"
FT   sig_peptide     574676..574756
FT                   /locus_tag="Pmen_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.681) with cleavage site probability 0.403 at
FT                   residue 27"
FT   gene            575473..576909
FT                   /locus_tag="Pmen_0539"
FT   CDS_pept        575473..576909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0539"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83309"
FT                   /db_xref="GOA:A4XPP3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPP3"
FT                   /protein_id="ABP83309.1"
FT                   /translation="MMRALTLCLICSWLAGCAVNPATGRTDFVMMSERQELDLGARYNQ
FT                   EILKQYPRYEDAGLQAYIQRVGERVARSSHRNQLNYVFTLVDSPDINAFALPGGYIYIH
FT                   RGLLAYLNSEAELAAVLGHEVGHVTARHSVRQQSQSTAWSLLGHAAAIGTGVGAVGDLT
FT                   NVMGNAFVRGYGRDMELEADGLGAQYLARSGYDPQAMIEVVKVLKNQEDFARAQAARRG
FT                   EAPAAGGYHGLFDTHPDNDRRLQEVIGPARALAVGNQEVGRDAFLQMLDGLVFGDSAAS
FT                   GIRRGRHFYHGELDFTLSYPQGWQLVNRPDVLIGHSADEQAFIAMTLEPADKRLTPAEF
FT                   LRKRAGSQRLVAGEELRLGALQGYTAVLQGQAARRVAVIYRDDNAYLFIAAVRGRASLE
FT                   SEDQRFLEVIRSYRPLKADERKLAEPVRLHLVRAKAGQSLAALAKEVPQQGDGEAQLRL
FT                   LNGLYPDGVPRAGDWLKTLR"
FT   sig_peptide     575473..575547
FT                   /locus_tag="Pmen_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.762 at
FT                   residue 25"
FT   gene            577014..578282
FT                   /locus_tag="Pmen_0540"
FT   CDS_pept        577014..578282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0540"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /EC_number="1.1.1.40"
FT                   /note="PFAM: malic enzyme domain protein; malic enzyme,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83310"
FT                   /db_xref="GOA:A4XPP4"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPP4"
FT                   /protein_id="ABP83310.1"
FT                   /translation="MSDLKTAALEYHAQPRPGKLSVELTKATATARDLSLAYSPGVAEP
FT                   VREIARDAELAYRYTGKGNLVAVISDGTAILGLGNLGPLASKPVMEGKGVLFKRFAGID
FT                   VFDIEVDSESPQAFIDTVKRISITFGGINLEDIKAPECFEIERALIEQCDIPVFHDDQH
FT                   GTAIVTAAGMLNALEIAGKTLEEAKIVCLGAGAAAISCMKLLVSMGAKVENIFMIDRKG
FT                   VIHAGRDDLNQYKAVFAHETDRRTLSDALDGADVFVGLSGANLLSPEDLKRMAANPIVF
FT                   ACSNPDPEIKPELAHETRSDVIMATGRSDYPNQVNNVLGFPFIFRGALDVRATRINEEM
FT                   KIAAALALRDLAKLPVPQDVCDAYGGIKLEFGREYIIPKPMDQRLITVVCDAVAKAAIE
FT                   SGVATLPYPKHYPLQSVDEVFNG"
FT   gene            complement(578348..580759)
FT                   /locus_tag="Pmen_0541"
FT   CDS_pept        complement(578348..580759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0541"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number="2.4.1.129"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83311"
FT                   /db_xref="GOA:A4XPP5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPP5"
FT                   /protein_id="ABP83311.1"
FT                   /translation="MIRLLKFFWWSCVAVFCGLLLSLSGAFLYLSPTLPSVESLRQVQL
FT                   QIPLRVYSSDAKLIAEFGEMRRSPIRFDEIPKEFISALLAAEDDNFANHYGVDVTSLMR
FT                   AATQLLKSGQIQSGGSTITMQVAKNFFLTSERSFSRKATEILLALQIERELSKDEILEL
FT                   YVNKIYLGHRAYGIEAAAQVYYGKSIRDLNLAQMAMIAGLPKAPSRYNPLVNPTRAKER
FT                   RDWILGRLYRLGRIDQASYETALAEEVDARYHVPAPELSAPYIAEMARAEMVGRYGSEA
FT                   YTEGFNVTTTVPSHLQEVANTALREGLIAYDQRHGYRGPESRLPGLTRDAWLAELAKFR
FT                   SIGGLEPAVVTQVEKSGVLVLTRNGEEQAVSWDSMKWARPFLNTNSLGPRPQQPADVAQ
FT                   VGDIIRVQRQADESLRFMQVPAAQSALVSLDPYSGAIQALVGGFSFDQSNYNRAVQAKR
FT                   QPGSSFKPFIYSAALDNGYTASTLVNDAPIILSDDYLTQKWRPKNDNNTFLGPIRMREA
FT                   LYKSRNLVSIRLLQDMGIDRSLRYIERFGFAPQDLPRNLSLALGTASLTPLEIAEGWAT
FT                   FANGGYKIEPYLIERIDDRHGKPLFRANPARVPGSEPSEEIANLAVNATDDLPPEEPRT
FT                   AEQIIDERTAYIMTSMLQDVIKRGTGRRALALGRDDLAGKTGTTNESKDSWFSGYNADY
FT                   VTTVWAGFDQPESLGRHEYGGTVALPIWMNYMGAVLKDRPSHLPKEPKGLLTLRVDPVS
FT                   GRAAAPGTPDAYFELFKSEDSPPPMSEFEPGMGIPGSPLPADEMAPIDLF"
FT   sig_peptide     complement(580673..580759)
FT                   /locus_tag="Pmen_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.463 at
FT                   residue 29"
FT   gene            580941..582005
FT                   /locus_tag="Pmen_0542"
FT   CDS_pept        580941..582005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0542"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83312"
FT                   /db_xref="GOA:A4XPP6"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPP6"
FT                   /protein_id="ABP83312.1"
FT                   /translation="MLGLFTKKANTLLGIDISSTSVKLLELSRSGSRYKVEAYAVEPLP
FT                   PNAVVEKNIAELEGVGQALSRVLAKAKTGVKTAAVAVAGSAVITKTIEMEAGLSEDELE
FT                   NQLKIEADQYIPYPLEEVAIDFEVQGPAARNPERVEVLLAACRKENVEVREAALALAGL
FT                   TAKVVDVEAYALERAYSLLEAQLGGGHDELTVAVVDIGATMTTLSVLHNGRTIYTREQL
FT                   FGGKQLTEEVQRRYGLSVEEAGLAKKQGGLPDDYDSEVLQPFKEAVVQQVSRSLQFFFA
FT                   AGQFNDVDYILLAGGTASIPDLDRLIQQKIGTQTLVANPFADMALSSKVNAGALASDAP
FT                   ALMIACGLAMRSFD"
FT   gene            582005..582577
FT                   /locus_tag="Pmen_0543"
FT   CDS_pept        582005..582577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0543"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83313"
FT                   /db_xref="GOA:A4XPP7"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPP7"
FT                   /protein_id="ABP83313.1"
FT                   /translation="MARINLLPWREQLREERKQRFLVSLVGVLVIAAGLVFLADQFLNA
FT                   AISNQNARNNFIKKEIAVLDARIKEISELKTRRQQLLERMKIIQDLQGNRPIIGRVFDQ
FT                   LVRTLPDGVYFTNVKMTGKSIAIVGAAESNNRVSNLMRNLDGSDWLAAPNLTEVKAVTA
FT                   GALDQANVFQLTVQQTQPDQGKAEAAQ"
FT   sig_peptide     582005..582121
FT                   /locus_tag="Pmen_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.661) with cleavage site probability 0.638 at
FT                   residue 39"
FT   gene            582574..583194
FT                   /locus_tag="Pmen_0544"
FT   CDS_pept        582574..583194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0544"
FT                   /product="Pilus assembly protein, PilO"
FT                   /note="PFAM: Pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83314"
FT                   /db_xref="GOA:A4XPP8"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPP8"
FT                   /protein_id="ABP83314.1"
FT                   /translation="MSIKSSLDGLRSVDLNDLDLNNVGSWPAAVKFIAGLLVLVIVLVL
FT                   GYNFHLKDLQNMLEQRQREEATLKEQFTSKAFQAANLEAYKEQMQEMEVSFGALLRQLP
FT                   SDTEVPGLLEDITRTGLGSGLEFEEIKLLPEVAQQFYIELPIQIKVTGGYHDLATFVSG
FT                   VASLPRIVTLHDFQLAPASTESSSRLNMQIMAKTYRYNDKGAQ"
FT   gene            583191..583718
FT                   /locus_tag="Pmen_0545"
FT   CDS_pept        583191..583718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0545"
FT                   /product="Pilus assembly protein, PilQ"
FT                   /note="PFAM: Pilus assembly protein, PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83315"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPP9"
FT                   /protein_id="ABP83315.1"
FT                   /translation="MMSFSRLVLVAGLSLLAGCGGSGDFSDLRAYMDEVRAKPKGSIEP
FT                   LPTFQPYESFTYRAASLRSPFQPPVKIDVVTRQKGAPEIKPDESRVKQFLEGFNIETFE
FT                   MVGTLRNDRELYALVNGAGGVHRVKVGDYLGRNHGKILVIDDAKIDVMEIVPDGEGGWL
FT                   ERPRSLSLKERS"
FT   sig_peptide     583191..583259
FT                   /locus_tag="Pmen_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.524 at
FT                   residue 23"
FT   gene            583774..585894
FT                   /locus_tag="Pmen_0546"
FT   CDS_pept        583774..585894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0546"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB, short N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83316"
FT                   /db_xref="GOA:A4XPQ0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPQ0"
FT                   /protein_id="ABP83316.1"
FT                   /translation="MNSSLSRLSVAVLATLLSPAILAANLQDLNVASLPGDRVELKLSF
FT                   DEPVTAPRGYTIEQPARIALDLPGVSNKLGAKNRELGVGNARSVTIVEAKDRTRLIVNL
FT                   TSLAPYSTRVEGNDLYVLVGDSSASVTRSSASAPAAVAAVPPKKTYGPQPKAINNIDFQ
FT                   RGEQGEGNIVITLSDASVSPDIQEQGGKIRLDFAKTELPESLRVRLDVKDFATPVQFVS
FT                   ATGSADKTSILVEPVGLYDYLAYQTENKLTLSVKPLTQDDVERRKAERFAYTGEKLSLN
FT                   FQDIDVRSVLQLIADFTDLNLVASDTVAGNITLRLQNVPWDQALDLVLKTKGLDKRQIG
FT                   NVLLVAPADEIAARERQELESQKQIAELAPLRRELIQVNYAKATDMAKLFQSVTSADGT
FT                   PDSRGSITVDDRTNSIIAYQTQERLDELRRIVAQLDIPVRQVMIEARIVEANVDYDKAL
FT                   GVRWGGSVRNGAWDVSGKDGVQGFDKDTGVRAPFVGTDTIGRTTLEDGLARLPFVDMGV
FT                   QNSTSGIAIGYLGSNIVLDLQLSAMEKTGNGEIVSQPKVVTSDKETAKILKGQEVPYQE
FT                   ASSSGATSTSFKEAALALEVTPQITPDNRIIMEVKVTKDAPDFANLVNGVPPLNKNEVN
FT                   AKVLVNDGETIVIGGVFSNTQTNAVEKVPFLGDLPFLGRVFRRDIVRDNKAELLVFITP
FT                   RIMNNQAIAVNR"
FT   sig_peptide     583774..583845
FT                   /locus_tag="Pmen_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.933 at
FT                   residue 24"
FT   gene            585927..586418
FT                   /locus_tag="Pmen_0547"
FT   CDS_pept        585927..586418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0547"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83317"
FT                   /db_xref="GOA:A4XPQ1"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPQ1"
FT                   /protein_id="ABP83317.1"
FT                   /translation="MGAGKSTIGRLLAKELRLPFKDSDKEIEQRTGADIPWIFDVEGEQ
FT                   GFREREQAVIAELSMQDGLVLATGGGAVMRPENRQALHAGGRVVYLHTSVEQQIDRTSR
FT                   DRNRPLLRTANPAQVLRDLMAVRDPLYREVADIVIETDERPPRMVVQEILARLEDLSPR
FT                   "
FT   gene            586594..587697
FT                   /locus_tag="Pmen_0548"
FT   CDS_pept        586594..587697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0548"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83318"
FT                   /db_xref="GOA:A4XPQ2"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPQ2"
FT                   /protein_id="ABP83318.1"
FT                   /translation="MQTLHVELGERSYPIYIGSGLLSRPELLSRHVAGRQVAVVTNETV
FT                   APLYLQTLLKSLEGFNVATVVLPDGEAFKNWETLQLIFDGLLTARHDRRTTVVALGGGV
FT                   IGDMAGFAAACYQRGVDFIQVPTTLLSQVDSSVGGKTGINHPLGKNMVGAFYQPKAVLI
FT                   DTASLDTLPARELSAGLAEVIKYGLICDEPFLGWLEANMAALRSLDQDALTYAIERSCA
FT                   AKAQVVGADERESGVRATLNLGHTFGHAIETEQGYGVWLHGEAVAAGTVMALEMSHRLG
FT                   WISVAERDRGVRLLQAAGLPIVPPRDMTPAQFLEHMAVDKKVLDGQLRLVLLKRLGEAV
FT                   VTADYPREILDATLRSDYVALAQSFNS"
FT   gene            587708..589309
FT                   /locus_tag="Pmen_0549"
FT   CDS_pept        587708..589309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0549"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83319"
FT                   /db_xref="GOA:A4XPQ3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPQ3"
FT                   /protein_id="ABP83319.1"
FT                   /translation="MTSLHADEAFLAHYQFSHDPFAPRVPGFKFFPAQRKPVLGQLHHL
FT                   ARYSQLLLAVVGPQGSGKTLLRQALVASTNKQAVQSVVIAQGVAGSDALLRQVAQGLSV
FT                   AQADVRSILTQVGQLALTGQEVYLLIDDADQLDDAALKSVLALAEGDSEGRPHVFLFAE
FT                   QDLLSRLEALAGGEECYHAIELQPYSEEETRDYLAQRLEGAGQGIDVLSEEQIEEIHLR
FT                   SQGWPGGINQEARELLVEQMLAQRSAGRGAGGGFSLPKKHLLALAVVLVGVAAAWFMQG
FT                   RESSPAPVATNTTLPLQSSAPAVEAGEPAQAPATESRTPAIEFAGASQPLPLPLVGEAQ
FT                   TVIRQPLAEAAGEELDNFEPPASPEPSTVTLPPDPIPAAPAPAPAPAPAPAPAPAPAPA
FT                   PAKQPEPAAPKPVVAPAPAPAPAPAPEPKPAPAQPAAPSSAASNWYAQQPGSRYALQVV
FT                   GSRSESNIQALVREGGSEYRYFKKMHQGQPLYVLTYGSFATRDAAQAAVKTLPAKLQAN
FT                   KPWPRTLASIQQEMSR"
FT   gene            589547..593995
FT                   /locus_tag="Pmen_0550"
FT   CDS_pept        589547..593995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0550"
FT                   /product="glutamate synthase (NADPH) large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: glutamine amidotransferase, class-II;
FT                   glutamate synthase, alpha subunit domain protein;
FT                   ferredoxin-dependent glutamate synthase; glutamate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83320"
FT                   /db_xref="GOA:A4XPQ4"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPQ4"
FT                   /protein_id="ABP83320.1"
FT                   /translation="MKAGLYRPDEFKDNCGFGLIAHMQGEPSHHLLKTAIEALTCMTHR
FT                   GGINADGKTGDGCGLLIQKPDQFLRAIAQEQFGVELPAQYAVGMVFFNQDPAKAEAARE
FT                   NMNREILAAGLQLVGWRKVPIDTSVLGQLALERLPQIEQVFIGGEGLSDQEFAIKLFSA
FT                   RRRSSVANADDADHYICSFSHKTIIYKGLMMPADLQQFYPDLGDERLQTAIAVFHQRFS
FT                   TNTLPKWPLAQPFRFLAHNGEINTITGNRNWAQARRTKFANELIPDLDELGPLVNRVGS
FT                   DSSSMDNMLELMVTGGIDLFRGLRMIIPPAWQNVETMDADLRAFYEYNSMHMEPWDGPA
FT                   GVVLTDGRHAVCLLDRNGLRPARWVTTKNGYITLASEIGVWDYQPEDVIAKGRVGPGQI
FT                   LAVDTETGQVLDTESIDSRLKSRHPYKLWLRKHAQRIKATLEDRDHGSPFYDPDQLKQY
FT                   MKMFQVTFEERDQVLRPLGEQGQEAVGSMGDDTPMAVLSQRVRSPYDYFRQQFAQVTNP
FT                   PIDPLREAIVMSLEICLGAERNIFSESPEHATRVILSSPVISPAKWRALMNLDRPGFDR
FT                   HVIDMNYDESLGLEAAVRNMADQAEEAVRAGKVLLVLTDRHIAPGKLPAHASLVTGAVH
FT                   HRLVEKGLRCDCNILVETATARDPHHYAVLLGFGASAVYPFLAYEVLGDLIRTGEVLGD
FT                   LYEVFKHYRKGISKGLLKILSKMGISTVASYRGAQLFEAVGLADEVTELCFRGVASRIQ
FT                   GARFVDIESEQKLLSFEAWNNRKPIQQGGLLKFVYGGEYHAYNPDVVRTLQEAVQQGNY
FT                   AKYKEYSTLVDTRPVSMIRDLLKVKESATPISLDEVEPLQSIFKRFDAAGISLGALSPE
FT                   AHEALAEAMNRLGGRSNSGEGGEDPARYGTIKSSKIKQVATGRFGVTPEYLVNAEVLQI
FT                   KVAQGAKPGEGGQLPGGKVNGLIARLRYAVPGVTLISPPPHHDIYSIEDLAQLIYDLKQ
FT                   VNPKALVSVKLVAEAGVGTIAAGVAKAYADLITISGYDGGTGASPLTSIRYAGAPWELG
FT                   LAETHQTLRGNDLRGKVRVQTDGGLKTGLDVIKAAILGAESFGFGTAPMVALGCKYLRI
FT                   CHLNNCATGVATQNDKLRKDHFIGTVEMVMNFFTYVAEETREWLAKLGVRSLEELIGRT
FT                   DLLEVLPGETAKQGNLDLSPLLASAHIPADKPQFCQVPKNPPFDEGLLAEKMVDMAKDA
FT                   IAGKTGGEFELNIGNCDRSIGARISGEIARVHGNQGMNDAPITFRFKGTAGQSFGVWNA
FT                   GGLNLRLEGDANDYVGKGMTGGKIVITPPAGSPFATEDSAIIGNTCLYGATGGKLFATG
FT                   TAGERFAVRNSGAHAVVEGTGDHCCEYMTGGFVCVLGKTGYNFGSGMTGGFAYVLDMDN
FT                   GFYDRVNHELVEIQRINNEAMEAYRSHLESVLAEYVEETGSEWGQNLLENLDDYLRKFW
FT                   LVKPKAASLKSLLSSTRANPQ"
FT   gene            594030..595448
FT                   /locus_tag="Pmen_0551"
FT   CDS_pept        594030..595448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0551"
FT                   /product="glutamate synthase (NADPH) small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83321"
FT                   /db_xref="GOA:A4XPQ5"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPQ5"
FT                   /protein_id="ABP83321.1"
FT                   /translation="MTERLNNDFQFIEVGRKDPKKKLLRQRKKEFVEIYDNFKPAQAAD
FT                   QAHRCLGCGNPYCEWKCPVHNFIPNWLKLVSEGNILAAAELSHQTNTLPEVCGRVCPQD
FT                   RLCEGACTLNDGFGAVTIGSVEKYITDTAFAMGWRPDMSKVKPTGKRVAVIGAGPAGLG
FT                   CADVLVRNGVTPVVFDKNPEIGGLLTFGIPEFKLEKSVLSRRREVFTGMGIEFRLNTEI
FT                   GKDVTMQQLLDEYDAVFMGMGTYTYMKGGFPGEDLPGVYDALDFLIANVNRNLGFEKSP
FT                   EDFIDMKGKRVVVLGGGDTAMDCNRTSIRQGAKAVTCAYRRDEENMPGSRKEVKNAKEE
FT                   GVKFLFNRQPIAIVGEDKVEGIKVVETRLGEPDARGRRSPEPIPGSEEIIPAEAVLIAF
FT                   GFRPSPAPWFEQFEIQTDSQGRVVAPEQSQFKHQTSNPKIFAGGDMVRGSDLVVTAIFE
FT                   GRNAAEGILDYLGV"
FT   gene            595567..596634
FT                   /locus_tag="Pmen_0552"
FT   CDS_pept        595567..596634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0552"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83322"
FT                   /db_xref="GOA:A4XPQ6"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPQ6"
FT                   /protein_id="ABP83322.1"
FT                   /translation="MTALKNDRFLRALLKQPVDVTPIWMMRQAGRYLPEYRATRAKAGD
FT                   FVSLMKNPELACEVTIQPLDRYPQLDAAILFSDILTIPDAMGQGLYFETGEGPRFKKAV
FT                   GSLADIEALPVPDPEKDLGYVMDAVRTIRRELNGRVPLIGFSGSPWTLATYMVEGGSSK
FT                   DFRKSKAMLYDNPQAMHALLDKLAQSVTAYLNGQILAGAQAVQIFDSWGGALSAAAYQE
FT                   FSLAYMKKIVDGLIREHDGRRVPVILFTKGGGLWLESMADSGAEALGLDWTCDIGSARA
FT                   RVGSKVALQGNMDPAVLYAKPAAIRAEVARILAAYGAGSGHVFNLGHGITPEVDPAHAG
FT                   AFFEAVHELSAAYHR"
FT   gene            596765..597535
FT                   /locus_tag="Pmen_0553"
FT   CDS_pept        596765..597535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0553"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83323"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPQ7"
FT                   /protein_id="ABP83323.1"
FT                   /translation="MRRVVFNQKGGVGKSSIACNLAAVSAAQGYRTLLIDLDAQANSTH
FT                   YLTGLTGEEIPMGIADFFKQTLSSGPFAKKGKVDIYETPFDNLHVVTATAELAELQPKL
FT                   EQKHKINKLRKLLDELAEDYDHIYLDTPPALNFYTVSALIAADRVLIPFDCDSFSRNAL
FT                   YGLLAEIEELKDDHNEELEVEGIVVNQFQPRATLPQQLLDELITEGLPVLPVNLMSSVK
FT                   MRESHQACTPLIHLDARHKLTQQFVELHDLLNAG"
FT   gene            complement(597581..598378)
FT                   /locus_tag="Pmen_0554"
FT   CDS_pept        complement(597581..598378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0554"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83324"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPQ8"
FT                   /protein_id="ABP83324.1"
FT                   /translation="MFNHILIAHDLRDTADMALCRATQLAQQHNARLTLLHVLDPSQSS
FT                   EQHEKARQALDRSLTQFAPAGTELRMLSGKPSEVVLQQVQDSGCDLLVLGGHHQRHDFF
FT                   SGTSLDRIARRCTVPLLLVARNDFAPYQRALAAIDFSLCACSALGQAYRLLPEGAELHA
FT                   LHVFEPDKGTPKEVQLQLQTQQGLIDQLLQDEAQNLPEKGPTLSHEVIQGGILRCLQEQ
FT                   IKVRRSELLVLGSHGRSALSQALLGSLAQHFLHKAPCDVFVVR"
FT   gene            complement(598502..598945)
FT                   /locus_tag="Pmen_0555"
FT   CDS_pept        complement(598502..598945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83325"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPQ9"
FT                   /protein_id="ABP83325.1"
FT                   /translation="MPLPVEIARQLTEQQIAFVRRSGLQAEVLEPGFVRLCMPLEGNQN
FT                   HIGSMYAGALFTLAEIPGGALFLTSFDVQRFYPIVKELNLRFRRPASGDIRVEARLSAQ
FT                   EIDDLQARAAREGKAEYLLELQLTGADGEVVAESRGLYQLRLR"
FT   gene            complement(599167..599601)
FT                   /locus_tag="Pmen_0556"
FT   CDS_pept        complement(599167..599601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0556"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83326"
FT                   /db_xref="GOA:A4XPR0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPR0"
FT                   /protein_id="ABP83326.1"
FT                   /translation="MSDPLLIPCPHCNGLNRIPAERLGDAPRCGRCKTEVLPAAPIELT
FT                   QNNFASQLKGDLPLLVDVWASWCGPCQAFAPTFAQAAAQLQGRCRLGKLDSEANPQLSG
FT                   QLGIRSIPSLILFKGGAEVARQSGAMPLPQLLAWLRQQGV"
FT   gene            complement(599660..601450)
FT                   /locus_tag="Pmen_0557"
FT   CDS_pept        complement(599660..601450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0557"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; TrkA-C domain protein;
FT                   TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83327"
FT                   /db_xref="GOA:A4XPR1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPR1"
FT                   /protein_id="ABP83327.1"
FT                   /translation="MPWDSLPLLFVGALLIWVLYAFVREKWSPDIVAAIAVAALLVSQL
FT                   LEPKEVLSVLSNSAPVTIACMFVLSAALERTGCIDALGNWLGNLVGTSPIRVLTGLTLT
FT                   ALVVSACLNNTPVVAILTPVAIALARRAGTLPSKLLIPLSYATILGGTLTMIGTSTNIL
FT                   VDGVARKAGLAPFGIFEITGAGLIMATVGMLYLLTIGRHLLPERETLSRQLRPDLSRTF
FT                   MTELLVPHDSPMIGKTLHEANLNGGSGLQVLKLFREELELTEPGADTLLASGDRLVLHG
FT                   QVKDVVELRESGHLSFNRGDAFETISSHDVILAEAIVGRNSRYSHRPMRDLDLTARYGI
FT                   AVLAVHRQDENVQGNLDDFELQFGDVMLVEGTPAQIKRFADNGELISLNAVQERAFRRD
FT                   KAPIAIGATLAVMLLAAFGVMPIEGLAIIGAVTVLATRCLDVEDAYKAVDWKILSLIFG
FT                   MLAISIAMDKVGLVKLLVENVMGWLPWAGPLLMLSFIYLFTSILTEMLSNNAVAVLVTP
FT                   IAIGMAQHLGVDPRAFVVAVMFAASASFATPIGYQTNTFVYNAGGYRFTDFMKVGIPLN
FT                   LLLWGVATLVIPWFFPLTPV"
FT   sig_peptide     complement(601379..601450)
FT                   /locus_tag="Pmen_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.682) with cleavage site probability 0.610 at
FT                   residue 24"
FT   gene            complement(601741..603204)
FT                   /locus_tag="Pmen_0558"
FT   CDS_pept        complement(601741..603204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0558"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83328"
FT                   /db_xref="GOA:A4XPR2"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPR2"
FT                   /protein_id="ABP83328.1"
FT                   /translation="MKKLDQLTFDNRFARLGDAFSTEVLPEPIEQPRLVVASSDAMALL
FT                   DLDPAEAQREEFAELFAGHKLWGEAEPRAMVYSGHQFGGYTPRLGDGRGLLLGEVVNAA
FT                   GEHWDLHLKGAGQTPYSRMGDGRAVLRSSIREFLASEHLHALGIPSSRALCVTTSDTPV
FT                   WREKQERAAMVLRLAPSHVRFGHFEYFYYTRQHEQLKVLGEHVLANHFPQCLTQDEPWL
FT                   AMFREVLERTAAMIAHWQAYGFCHGVMNTDNMSILGITFDYGPYAFLDDFDANHICNHS
FT                   DDTGRYSFSNQVPIAHWNLAALAQALTPMIEVEKLRETLELFLPLYQAHYLDLMRKRLG
FT                   LTSAEDDDEALVQRLLQLMQQGKATDYSLFFRQLGEQAPADALQVVRNDFVDLAGFDAW
FT                   GRDYLARCEREGQQQDERRARMHAVNPLYILRNYLAQQVIEAAEAGDYGPVRELHAVLS
FT                   RPFDEQPGMQRYAQRPPEWGKHLEISCSS"
FT   gene            complement(603216..606551)
FT                   /locus_tag="Pmen_0559"
FT   CDS_pept        complement(603216..606551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0559"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83329"
FT                   /db_xref="GOA:A4XPR3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPR3"
FT                   /protein_id="ABP83329.1"
FT                   /translation="MPQLRRSLALILFLLCFGLSAAHAEEPPKAADVQQSLDTLADRKL
FT                   PEAEQLALKQTLEQTLRMLKDRDTSEQRLNDLRKQLDGAPRLITEAQRELDRLKASPEV
FT                   AAAERHARTSLAQLEQLLNERSNQLTEWNKAIIEANSLVITAQTRPERAQAEISQNQAR
FT                   SQQINNSLKSGRDDGKPLTPERRALLNAELAQLAAQTQLRRQEMAGNSQLLDLGSAQRA
FT                   LLEERIRRAELERQELQSLINERRRAESEQTVAEQSREAERASSDRLLARESSLNLKLS
FT                   DYLLRSTDRLNSLTEQNLRTRQQLDNLNQANQALDEQIRVLQGSLLLSRILYQQKQALP
FT                   QLQLEDSRLADEIADIRLYQFDLNKQRDEISDPARYVDNLLQGQPSENVTPELRNALLD
FT                   QLKTRRELLERLSRSLNSLLNESITLQLNQRELHSTASNLRATIDEQMFWIPSNKPLDL
FT                   EWLKSAPRRLQQQLDSLPWGVVLSELSAALLERPLVFLPLLLLCALILWRRQYLFGKLG
FT                   NLHADIGHYKRDSQLHTPFALGLNLVLALPVALFLMLCGYALLHDARGQNLYLGRAFYE
FT                   MAEAWLVFYTLHRILAPDGVAVLHFHWPPANVSFFRRHLRHLGMVVMALVAVVSIAEHQ
FT                   PDSLASDVIGICVVLSCYALMAWLMFRLLFNAPQREHTSALRTSVGMLFNVLPLALIGA
FT                   VAFGYYYTALKLTDRLIDTLYLLIIWLIVEAALIRGLSVAARRLAYQRALAKRQAQSKE
FT                   GDGEISIEEPTLDIEQVNQQSLRLIRLALLAGFLVCLYWVWAELIGVFTYLETVSLYEY
FT                   SSGTGDTATMVPISLMDVLGALIIVAITVALARNLPGLLEVLVLSRLKLAQGSAYSTTT
FT                   LLSYVLVGIGIVSTLSTLGVSWDKLQWLVAALSVGLGFGLQEIFANFISGLIILFERPV
FT                   RIGDVVTIGNLSGTVSKIRIRATTITDFDHKEIIVPNKTFITGQLINWSLSDTVTRVTL
FT                   KVGVSYGSDLDLVRKLLLQAAQENPRVLKEPSPIVYFLSFGESTLDHELRIHVRDLGDR
FT                   NPATDEINRFIDREFAKHGINIAFRQVDVYVKNLDAEQHLQKDVIKAAAAGAADKKNPP
FT                   PAAT"
FT   sig_peptide     complement(606477..606551)
FT                   /locus_tag="Pmen_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(606653..608398)
FT                   /locus_tag="Pmen_0560"
FT   CDS_pept        complement(606653..608398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0560"
FT                   /product="potassium/proton antiporter, CPA1 family"
FT                   /note="PFAM: transporter-associated region; TrkA-C domain
FT                   protein; sodium/hydrogen exchanger; TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83330"
FT                   /db_xref="GOA:A4XPR4"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR023729"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPR4"
FT                   /protein_id="ABP83330.1"
FT                   /translation="MDASAINNLFLIGALLVAASILVSAFGTRFGIPILVIFLAVGMLA
FT                   GTDGPGGIVFNNYPLAYLVGNLALAVILLDGGMRTRVSSFRVALWPSLSLATVGVVITA
FT                   GLTGLAAAWLFNLTLLEGLLIGAIVGSTDAAAVFSLLGGRGLNERVSSTLEIESGSNDP
FT                   MAVFLTVTLIAMLASGQTGFSWDLPIQLVQQFGLGALLGLGGGWLLLKLINRMELATGL
FT                   YPLLVVSGGLIIFAITTAVGGSGILAIYLCGLLLGNRPIRSRHGILHMLDGLTWLAQIG
FT                   MFLVLGLLITPHELLPIALPALALALWMILFARPLSIFLGLLPFRAFHDRERIFIAWVG
FT                   LRGAVPIILAVFPLMAGLPNAQLFFNVAFFIVIVSLLLQGTSLPLAAKLMRVTVPPEPA
FT                   PVSRAGLEVHPTSQWELFVYRLGAEKWCIGAALRELNMPEGTRIAALFRGRELLHPSGS
FT                   TRLEAGDLLCVIGHEHDLPALGKLFSQAPKRGQDLRFFGDFVLEGDAELAAVAALYGLK
FT                   LDGLDGHQPLGRFIAHEIGGEPVVGDQVEWQGLTWTVASMEGNKVRKVGVRFPEGSRPG
FT                   PGLFL"
FT   sig_peptide     complement(608321..608398)
FT                   /locus_tag="Pmen_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.733 at
FT                   residue 26"
FT   gene            complement(608561..610429)
FT                   /locus_tag="Pmen_0561"
FT   CDS_pept        complement(608561..610429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0561"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83331"
FT                   /db_xref="GOA:A4XPR5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPR5"
FT                   /protein_id="ABP83331.1"
FT                   /translation="MMLGSRATACLDSLDHLEARSMSETLLSSRNLAFELYEVLDAEAL
FT                   TQRPRFADHNRETFEAAISTARGIAEELFAPHNRKNDEHEPQYVDGGAVLIPEVEPALR
FT                   AFHEAGFLNATRDFEHGGMQLPNLLSQACFAHFQSANIATSSYSMLTMGVANLIEAFGS
FT                   EEQKARYLQPIIDGRFFGTMALTEPHAGSSLSDIRTKAEPHADGSYRIKGNKIFISGGD
FT                   QPISENIVHMVLAKLPDAPPGVKGISLFLVPKFHVNDDGSLGARNDVTLAGLFHKMGWR
FT                   GTTSTALNFGDNGECVGYLVGKPHAGLSYMFQMMNEARIGVGMGAIMLGYAGYLYSLDY
FT                   ARNRPQGRQPDGKDPTSPQISIVEHADVRRMLLTQKAYVEGAFDLGLYAARLFDDTQTL
FT                   ETAEDRTRALELLDLLTPIVKSWPSEFCLKANELAIQILGGHGYTREYPVEQYYRDNRL
FT                   NPIHEGTHGIQSLDLLGRKVSMNGGAALKQLLKLINDCCQRASEYESLTALRQPLEQLL
FT                   ARLQAVTLALLGDLMSGKVNQGLANSALYLKVFGHTVIGWRWLEQAIRAEQGLARTDNA
FT                   EEQAFYRGKLQAARYFLTWEVPSCHHDLAILEARDDTCLGMQDTWF"
FT   gene            complement(610486..611622)
FT                   /locus_tag="Pmen_0562"
FT   CDS_pept        complement(610486..611622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0562"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83332"
FT                   /db_xref="GOA:A4XPR6"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPR6"
FT                   /protein_id="ABP83332.1"
FT                   /translation="MPAKSCHLQLQLSGLRLPCSRTRTEKRSMHLTALLDTDLPLIQAP
FT                   MAGSQDHRLAAAVCQAGGLGSIPCAMLTPAALRQELQAMRELTERPFNLNFFSHVPPEP
FT                   DAAREAGWREALAPYYDELGVDPASIASGPGRLPFNAEAAALVEEFRPAVVSFHFGLPQ
FT                   PELLERVRRSGAKILSSATTLNEALWLQAQGVDAVIAQGLEAGGHRGHFLDHDLSRQLG
FT                   TFALLPQLVDALSVPVIAAGGIADARGVAAAMTLGAAGVQVGSAYLLCPEAATGAIHRA
FT                   ALQSPAAHHTALTNLFSGRPARGIVNRLMRELGPISTHAPEFPLATAAIAPLRAAAEAQ
FT                   GSGDFSPLWAGQNVASCRPMPAAELTRELAQGFEAHLG"
FT   gene            611804..614530
FT                   /locus_tag="Pmen_0563"
FT   CDS_pept        611804..614530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0563"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="TIGRFAM: type I restriction-modification system, M
FT                   subunit; PFAM: N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83333"
FT                   /db_xref="GOA:A4XPR7"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPR7"
FT                   /protein_id="ABP83333.1"
FT                   /translation="MASAKLTLARLENLLLTACDDLRGNMDASEYKEYIFGMLFLKRAS
FT                   DLFDQRRDEIRKEGKAAGLSDDDIKANLEDPDQYSGKYFFVPERARWNDGWVDEKWNVH
FT                   PALKHVKENVGTALNKALEALEEANPEALQDVLKHINFNKKIGQNTLDDDTLVNFIQNF
FT                   EKIPLRDEDFEFPDLLGTAYEWLIKHFADSAGKKAGEFYTPAEVVRICVEICDPQEDMS
FT                   VYDPTVGSGGMLIQARDYLRECGADAAELALYGQEKMGTTWSICKMNMLLHGISHAVIR
FT                   QQDTLREPQHQAEDGNLMRFDRVLANPPFSQNYIKKDIKHPGRFPVWMPEKGKKADLMF
FT                   VQHMLAVLKHDGRMACVMPHGVLFRGAEEREARKYFIDRGYLEAVIGLPSNLFYGTGIP
FT                   ACILVLNKAGAAERKHVLFINGDREYREGKAQNYLRPEDIDKIVHAYRAGLEIPGYAQP
FT                   VPVEAICAEDYNCNIRRYVDNAPPAEPHDVRAHLHGGVPVTEIDALEHFWQNYAGLRES
FT                   CFVPRAVAAAGAAYADFAPALADKREIAAHINAHPGVTQRQAQFMAELQVWWAQHLPLI
FT                   EALAPDAENQQARANNVYAMRATLLDSIERTFAGQHLLNRYQVRGAFANYYKLLAADFK
FT                   SIAASGWGPELIPDEDILHSQFPQVLAELEQQHARLAELQALFAAASEEDFEDSEGTGV
FT                   LPADEVKALKDELKESTAEWKAQLKTLKGAVADLFVEIKVAGKLPKGADKGYYTQGFTA
FT                   KEAQFGNGQRVLDLAISVGHASPIASVVEEAMAQGQQAKNSSGRAEARLATHKALEAEA
FT                   KAVKAAIKSTEAMKDELVAKARLKISDDEARVVIVERLGKVLFDSYRQYLRADQRACIA
FT                   AVENLWGKYAITAKQIEAERDQAAKALQDFLVELGYE"
FT   gene            614523..615770
FT                   /locus_tag="Pmen_0564"
FT   CDS_pept        614523..615770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0564"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83334"
FT                   /db_xref="GOA:A4XPR8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPR8"
FT                   /protein_id="ABP83334.1"
FT                   /translation="MSDWAESSLEQLVTFQKGRKVDTSSFAQDGFAPYLGASGIEGGDD
FT                   GYAATQFAVMSKPTDILMLWDGERSGLVGYGKTGVVASTVSKLSPNDAINPKYLFFALS
FT                   DRFAWIQHRRTGTGVPHVPKDLGRILRLRYPSDPRLQIKIASIFEATDTLIQKSEALIA
FT                   KYQQIKAGMMHDLFTRGVLPNGQLRPPRSEAPELYQDTSIGWIPSMWKLKRCADICTRI
FT                   CVGIVIQPTQYYVESGVPAFRSANIREDGIDPSNLVFISHASNEVVAKSQVKAGDILSV
FT                   RTGYPGTSAVVPVHFDRANCIDILISTPSAQVISEYLCDWINSPFGKEQVLRQQGGMAQ
FT                   QHFNVGEMRELLVALPSREEQGDIRNRIGVVAKKLAAEKALLEKLQYQKLGLMHDLLTG
FT                   KVSVRVDNPASELANA"
FT   gene            615763..616416
FT                   /locus_tag="Pmen_0565"
FT   CDS_pept        615763..616416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83335"
FT                   /db_xref="InterPro:IPR029494"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPR9"
FT                   /protein_id="ABP83335.1"
FT                   /translation="MPNHYPNLNPEKALIWRIVHRDNLVWILDNGLHCASANVQAPNYV
FT                   VIGNVDLISRRRERTVPVAPGGTLSDYVPFYFTPFSPMMYNIHTGRGEVQQRHNEEICI
FT                   LVSSLRRVHELGLGFAFTDRHAYTPLARYFNELDLLEQLDWPLLQARNFSRNPDDPEQI
FT                   ERYQAEALVHRYLPIEGLLGVVCFTQAVKDRLDAQAQAKGLKLDIRVMPQWYFR"
FT   gene            616413..617495
FT                   /locus_tag="Pmen_0566"
FT   CDS_pept        616413..617495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0566"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83336"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPS0"
FT                   /protein_id="ABP83336.1"
FT                   /translation="MIRFTQGNLLEAKVDALVNTVNTVGVMGKGIALMFKERFAENYRL
FT                   YAAACKAKQVETGKMFVTPVQELDGPRWIVNFPTKRHWKAPSKMEWVVEGLTDLRTFIL
FT                   DNHIESIAVPPLGAGNGGLEWMAVREQIEAVLGDLHAEILVFEPTSQYQNVAKRSGVEK
FT                   LTPARALIAELVRRYWVLGMECSFLEVQKLAWFLERGIERFSPADNPLNLQFVAHKYGP
FT                   YANRLEHLLNNLDGSYLHAEKRISDSDPLDVIWFDDERKAYLQAYLNTESKPYLEALER
FT                   TADLIDGFESPFGMELLATVDWLLAKEHVEATVPAVRQALRKWGGGPGAATRKDRLFDD
FT                   RALAIALERLTQSGFSAVAA"
FT   gene            617504..620767
FT                   /locus_tag="Pmen_0567"
FT   CDS_pept        617504..620767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0567"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="TIGRFAM: type I site-specific deoxyribonuclease,
FT                   HsdR family; PFAM: type III restriction enzyme, res
FT                   subunit; protein of unknown function DUF450; SMART:
FT                   DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83337"
FT                   /db_xref="GOA:A4XPS1"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPS1"
FT                   /protein_id="ABP83337.1"
FT                   /translation="MSEYTEVEQPFLQQLQAQGWTVIDQGTVVPQDPMPSLRSSFRQWL
FT                   LPEVFDAAVRSINRTDDGREWLTDKQLDDLRGQLLRQPNRTLLEANEAVQALLFKAQVD
FT                   SNELTGEADPIVRLIDFHTPENNRFHAINQFRIDTPGCVRAFIIPDIVLFVNGIPLVVV
FT                   ECKKGSATCANPMQEAFVQLQRYMRKRKETAAAGLTEGEPRLFHSSLLLIRSCGLEADY
FT                   GTITSGEEHFYGWKTLYPANDAASEGMNAQQRLIAGMLTRHNLLQILRTSSVFMDTDGG
FT                   PRIKVVCRYQQFRAANKIIERLRSGKTAMERGGVVWHTQGSGKSLTMVFLARMLRASRD
FT                   LNDYKVILVNDRQDLEEQLGETATLIGGRVNVIETRQDLRKHLATESSDINMVMVHKFQ
FT                   EHKQTLTNTVAEALGTYLAMPSGKTFGVVNTSDRIILMIDEAHRTQSSDLGENLFEAFP
FT                   NATRIAFTGTPLLTERHGERKTHKRFGEYIDTYRLLDAVNDGATLQILYEGKTADSALT
FT                   EKHAFDQAFEDLFRDRSEEELLAIKKKYGATGDILEAENRINAIARDLVRHYIDNILPN
FT                   GFKAQVVCHSKLACIRYQAGIEAAIAERIEQEQVKTAPDADLLRRLRFLKTAVVVSSDG
FT                   TNEAAFITQARKQAARMGAVENFCRGFDLDDPDKEYSGIAFLIVCDMLLTGFDAPIEQV
FT                   MYIDKKLREHTLLQAIARTNRVKKGKQRGYVVDYIGLANHLTDALTLYAASDELQELHD
FT                   GMQNITSELPVLEERYQRLLQHFTALGVRSIGAFVTGTLSGLEADAAVVHEAVKALKDE
FT                   KLRADFEVYLKKFLMSMDIILPHPSAQPYRVPAKRFGYILQVTKERYKDASLDLSGAGE
FT                   KVKALINDHLISLGINPKVEPVELLAEDFLEKLAAHSGKNVEAKASEMEHAIRKHCTVH
FT                   HDEDPAFFKSLSEKVDALIEKHQDEWDLLVEKLAELRSEAVAGRQKGEEGMSKEATTFY
FT                   AHIIQVGFAGGVVAGGDKDKFKALMEATVDLLQETIGSIDFWQNPDKQKRIRGLLKTEI
FT                   SKTGIDELKQNRERVAIEIMKLAKNRHDELTRVVRAGIA"
FT   gene            620768..621475
FT                   /locus_tag="Pmen_0568"
FT   CDS_pept        620768..621475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0568"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83338"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPS2"
FT                   /protein_id="ABP83338.1"
FT                   /translation="MQLRKVRDIEYQLLPGAERQTTDIVIERNGVVTVRPPVHMTPDQV
FT                   DATVFSKRMWIYRNQADWRDLNATRVTREWVSGESFLYLGSSYRLQLVHEQDEPLKLKD
FT                   GRFCLLRSVVDIGGEESARKAFESFYKDKGLARLNKRVDFFAGKVGVKAGRIQIKDTGY
FT                   RWASCLKSGDLHFHWKCLMAPLTIIDYIVVHELCHLHHRDHSDAFWNEVDKVLPDYRER
FT                   KEWLRVHGAVLDI"
FT   gene            621578..622426
FT                   /locus_tag="Pmen_0569"
FT   CDS_pept        621578..622426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0569"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83339"
FT                   /db_xref="GOA:A4XPS3"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPS3"
FT                   /protein_id="ABP83339.1"
FT                   /translation="MNYRHAFHAGNHADVLKHLVLTRLLALLSRKEAPFAYLDSHAGLG
FT                   LYDLQGDAASRTGEYLEGIGRLWQATQLPDAVEAYLEVVRAMNPDGELRYYPGSPELAR
FT                   LLSREQDRLQLNEKHPEDGRLLKDNMRGDRRVAVHLGEGWLVPRALMPTREKRVLLLID
FT                   PPFEKTDELQRCVEALNEAHGRMRQAIVAIWYPIKDERQLARFYRDLQKSAAPKLLRAE
FT                   LYVHAPDDATRLTGSGLVISNPPWGLEDELKQLLPWLADALGQSQGGWRLDWLIEEKSA
FT                   S"
FT   gene            complement(622503..623756)
FT                   /locus_tag="Pmen_0570"
FT   CDS_pept        complement(622503..623756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0570"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase, HD sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83340"
FT                   /db_xref="GOA:A4XPS4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPS4"
FT                   /protein_id="ABP83340.1"
FT                   /translation="MPAHTPYISPEQLCVGLYVHLDLSWWEHDFAFSSFKIKDEAQISA
FT                   LRALKLKQLRYDPARSDCPPLAQAESTPPPAPAEPTVDPQSQERQQRAERLRQLRTRLA
FT                   DVDRRFIEASQRIKTLNQTLRSRPEDAMRQAGVIVGAMVETLLGAPGVVLHGITGKAAE
FT                   DSYFHALNVTVLSLLLGRQLGLDSEACHSLGLGALLHDIGKLEVPSKVLLKAEPLTRPE
FT                   QQLLQMHSDFGLRMGQKLMLDDEVLRIIHEHHEHCDGSGYPRGLREAAIGRLSRLVAIT
FT                   NHFDNLCNPLDPRQALSPHEALALMFKQQRERFDEVALKAFIRVMGIYPPGSLVQLEDE
FT                   RYALVLGMNPSQALKPTLIVYDAEVAKEEALILDLAQEPKLAIARSLRPAQLPLEVLEY
FT                   LSPRRNLSYHIEPNHKPA"
FT   gene            complement(623840..623974)
FT                   /locus_tag="Pmen_0571"
FT   CDS_pept        complement(623840..623974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83341"
FT                   /db_xref="InterPro:IPR025906"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPS5"
FT                   /protein_id="ABP83341.1"
FT                   /translation="MSLLLLRKTLELQAANITGLVQSAAPASAPSNPPHLGNHIDVMA"
FT   gene            complement(624048..624707)
FT                   /locus_tag="Pmen_0572"
FT   CDS_pept        complement(624048..624707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0572"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83342"
FT                   /db_xref="GOA:A4XPS6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPS6"
FT                   /protein_id="ABP83342.1"
FT                   /translation="MVLRSQILAHKLALPTAEQALPGRAEPLPVAQQHHVNGNPIKPPF
FT                   PAPMQQAVFGLGCFWGAERRFWQQPGVFSTAVGYAGGFTPNPTYEEVCSGLTGHTEVVL
FT                   VVFDPQQTSFDALLKVFWEAHNPTQGMRQGNDQGTQYRSAIYCQDHAQLEAALASQARF
FT                   QAELDKAGLGSITTEICEAPIFYYAETYHQQYLAKNPGGYCGLGGTGVCLPPEPAA"
FT   gene            complement(624759..627482)
FT                   /locus_tag="Pmen_0573"
FT   CDS_pept        complement(624759..627482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0573"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   GAF domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83343"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPS7"
FT                   /protein_id="ABP83343.1"
FT                   /translation="MKSHPDAGTRSAAEVVTQLPVPSRLGMLRFERLNEPSWALLFLDP
FT                   ACERQLGISASDLCALVDAPYASLMEPEARYRLHDAIQQQLLQGPHYLVRYTLHTPQGA
FT                   LTLLEVGEPFKQRNRQLLRGYLLVADESLDRYAATEQELHSQNQQLRSSLQQYQRTQDD
FT                   HLQHLARSRTQQQLIVRLARQRYASSNPQQEAAELITQAACEVYGVARAGIWKLGSHHL
FT                   DSVTLYRRDLDRHEQLPSIDARSFPQYLQALHSGRAIDAHDAQHDPRTCELTASYLQPL
FT                   GICSMLDASIRIEGEVVGVLCLEHVGGPRTWQADEIAFAGELADQFAQVLINQQKRHAT
FT                   SALHLFQRAVEQSASAFLLVDRDGRVEYVNPSFTAITLYSSDEVCGHRLSELPALANLS
FT                   DLLFDARSSLAEHSSWQGEFRSRRKNLEPYWGHLSISKVYGDDGELTHYIGIYEDVTEA
FT                   KLAQQRIERLAYTDNLTNLGNRPAFIRSLEERFAHSPRPPLGLLLVDIDNFKRINDSLG
FT                   HQTGDKLLSALARRLRNSLGAKGTLARFASNEFAILLDGCDQDCGLRVAHQVLQTLDKP
FT                   LFVDNQLISITGSLGLALAPEHGDDPQTLMKHAGLALHKAKANGKHQVQLFTEALNAEA
FT                   NYKLFVENNLRRALTQSELEVFYQPKLCLKNGQLLGMEALLRWHHPEKGMIRPDQFISV
FT                   AEETGLIIPIGKWVVRQACRMSKQIAAIGLGELQVAINLSPKQFSDPDLVGSIAAILHE
FT                   EQLDPRLLELELTESLLLEATEDTRHQLGRLKSLGLTLAMDDFGTGYSSLSYLKKFPID
FT                   VIKIDRSFIKDIPDNQDDMEITSAVIAMAHNLKLKVVAEGIETGAQLGFLRRQKCDVGQ
FT                   GYLFDKPIPGRELIDSLRRYPCRPQGESHHPADQRA"
FT   gene            627618..628151
FT                   /locus_tag="Pmen_0574"
FT   CDS_pept        627618..628151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83344"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPS8"
FT                   /protein_id="ABP83344.1"
FT                   /translation="MQTILTRKLMAMVLGGALFVAMPAVASADDAATLQGAEQVAYLDG
FT                   LKRLYLTDNERQALLAHSNALLDTYALRAGYQVGQAQRQDLLYRISLGAAGELILREES
FT                   RGAEGTAIAVRNQRFSVFGIDPFIRYECPAGGVRCVLINPGDGSPLLTILRDHQGAAEL
FT                   AKALSFLIRNVQKG"
FT   sig_peptide     627618..627704
FT                   /locus_tag="Pmen_0574"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.882 at
FT                   residue 29"
FT   gene            complement(628304..630274)
FT                   /locus_tag="Pmen_0575"
FT   CDS_pept        complement(628304..630274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0575"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="TIGRFAM: pyruvate dehydrogenase complex
FT                   dihydrolipoamide acetyltransferase; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein; catalytic domain of
FT                   components of various dehydrogenase complexes; E3 binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83345"
FT                   /db_xref="GOA:A4XPS9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPS9"
FT                   /protein_id="ABP83345.1"
FT                   /translation="MSELIRVPDLGGEGEVIELLVKVGDRIEAEQSVLTLESDKASMEV
FT                   PSPKAGVVKEIKVKIGDRLKEGDELLVLEVEGAAQAAPAPKAEAAPAQAPQAAAPAAAP
FT                   AAAATGSSVQDVHVPDIGSSAKGKVIEIMVKVGDRIEADQSLLTLESDKASMEIPAPAA
FT                   GVVEQVLVKLDDEIGTGDLILKLKVEGAAPAAAAPAAAPAQAAAPAAAPAPAAAPSGSS
FT                   VQDVRVPDIGSSAKGKVIEIMVKAGDSIEADQSLLTLESDKASMEIPSPAAGVVEEVLV
FT                   KLDDEIGTGDLILKLKVAGSASAPAPAQASQEVHRVPEGAAPEVAAEVRAIASLSAAAA
FT                   EVANAPKRDGAKVHAGPAVRQLARDFGVELADIAGTGPKGRILKEDVQAYVKAMMHKAK
FT                   AAPQAAAAATGGAGIPPIPAVDFSKFGEIEEVAMTRLMQVGAANLHRSWLNVPHVTQFD
FT                   SADITDLEAFRVAQKAVAEKAGVKLTVLPLLLKACAHLLKELPDFNSSLAPSGKALIRK
FT                   KYVHIGFAVDTPDGLLVPVIKNVDQKSLLQLAGEAAALADKARTKKLSADDMQGACFTI
FT                   SSLGHIGGTGFTPIVNAPEVAILGVSKATMQPVWDGKAFQPKLMLPLSLSYDHRVINGA
FT                   AAARFTQRLSQLLADIRTILL"
FT   gene            complement(630286..632931)
FT                   /locus_tag="Pmen_0576"
FT   CDS_pept        complement(630286..632931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0576"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83346"
FT                   /db_xref="GOA:A4XPT0"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPT0"
FT                   /protein_id="ABP83346.1"
FT                   /translation="MQDLDPIETQEWLDALESVLDREGEDRAHYLMTRLGELATRSGAQ
FT                   LPYAITTPYRNTIPVTHEARMPGDLFMERRIRSLVRWNALAMVMRTNLDDPDLGGHISS
FT                   FASSATLYDIGFNYFFQAPTDEHGGDLVFYQGHASPGVYARAFMEGRISEDQMQNFRRE
FT                   VDGKGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLEARGFIPAGKQKVWCF
FT                   MGDGECDEPESLGAISLAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGVFRGAQ
FT                   WNVNKVVWGRFWDPLFAKDKDGALQRRMDEVVDGEYQNYKAKDGAYVRENFFNSPELKE
FT                   MVKDLSDDEIWKLNRGGHDPYKVYAAYHQAVNHSGQPTVILAKTIKGYGTGAGEAKNTA
FT                   HNTKKVDVDSLRQFRDRFDIPVKDEDLEKLPFVKPEPGSPEYKYLHERRNALGGFVPQR
FT                   RQKSFSIPTPPLDTLKAILDGSGDREISTTMAFVRILAQLVKDKELGQRIVPIIPDEAR
FT                   TFGMEGMFRQLGIYSSVGQLYEPVDKDQVMFYKEDKKGQILEEGINEAGAMSSFIAAGT
FT                   SYSNHNQPMLPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRTTLNGEGLQHED
FT                   GHSHMLAATIPNCRTYDPTYGYELAVIIREGIRQMTEEQQDIFYYITVMNESYQQPAMP
FT                   EGIEQGIIKGMYLLEEDKKEAAHHVQLLGSGTILREVREAAKILRDEYNIGADVWSVTS
FT                   FNELRRDGLAVERRNRLHPGQKPQQTYIEQCLSGRKGPVIASTDYMKLFAEQVRQWVPS
FT                   KEYKVLGTDGFGRSDSRKQLRHFFEVDRNWVVLAALEALVDRGEIEAKVLADAIAKFGI
FT                   DADKANPLDC"
FT   gene            633203..636145
FT                   /locus_tag="Pmen_0577"
FT   CDS_pept        633203..636145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0577"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83347"
FT                   /db_xref="GOA:A4XPT1"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPT1"
FT                   /protein_id="ABP83347.1"
FT                   /translation="MSLPSPVELPPSLIPLAERAEQSLQAALLEHEALPAKLAQWPQAR
FT                   REAWRQVTALSDFVSEQAIRDPQMFMALADSGELERSLKPGELRDQLATLLAECADEDA
FT                   LGRCLRRFRNRQQLRIIWRDFSRQAALAETCRDLSDLADACIDLAYHWLYPRHCQQFGT
FT                   PIGRRSGQAQHMVILGMGKLGAHELNLSSDIDLIFGYPEGGETEGVKRPLDNQEFFIRL
FT                   GQKLIKALDAITVDGFVFRTDMRLRPYGSSGALVFSFNALEQYYQDQGRDWERYAMIKA
FT                   RVVGGDQAAGAELLEMLRPFVYRRYLDFSAIEALRAMKLLIQQEVRRKGMSENIKLGAG
FT                   GIREIEFIAQAFQLIHGGRDLSLQQRPLLKVLATLEGQGYLPPAVVAEMREGYEFLRYT
FT                   EHALQGIGDRQTQMLPADARDQARVAAIMGFADWASFHERLMHWRGRIEWHFQQVIADP
FT                   DEDEAAAGSACVGAEWLPLWEAAIDEESAARQLQEAGFVEPLVALKRLGDLRNGPQVRA
FT                   MQRLGRERLDAFVPRLLAETVEHEAPDRVLERVLPLVEKVARRSAYLVLLSENPGALQR
FT                   LISLCAASPWIAEQIARFPLLLDELLNEGRLYHPPLAPELAAELRERLIRIPEDDLEQQ
FT                   MEALRHFKLAHSLRVAASEIAGTLPLMKVSDYLTWLAEAILDQVLALAWQHTVQRHGRP
FT                   FRTDGTPCDPDFIIVGYGKVGGLEFGHGSDLDLVFIHDGDPQAETDGAKPIDGAQFFTR
FT                   LGQRIIHLLTTQTTSGALYEVDMRLRPSGAAGLLVSSLGAFQRYQENEAWTWEHQALVR
FT                   ARVLVGCQRLAGEFARVRGEVLGRQREVAALRTEVSEMRAKMRDNLGTRATAAGTAENA
FT                   FDAAASFDLKQDAGGIVDIEFMVQYAALAWSWQYPQLLEFTDNIRILEGLERVGLMSSE
FT                   DAGLLREVYKIYRSAAHRQALQKQPGVVPGDQFQDERRAVMRLWRELGLS"
FT   gene            636209..637132
FT                   /locus_tag="Pmen_0578"
FT   CDS_pept        636209..637132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0578"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83348"
FT                   /db_xref="GOA:A4XPT2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPT2"
FT                   /protein_id="ABP83348.1"
FT                   /translation="MSMSDRDGVIWYDGELVPWREANTHVLTHTLHYGMGVFEGVRAYN
FT                   TPDGTAIFRLQAHTDRLFDSAHIFNMQIPFSKEEINEAQRTAVRENGLESAYLRPMVFF
FT                   GSEGMGLRASGLKVHVIVAAWHWGAYMGEEALVSGIKVRTSSYTRHHVNISMTRAKANG
FT                   NYINSMLALQEAISGGADEAMLLDPEGYVAEGSGENIFLVKDGVVYTPEVTSCLNGITR
FT                   STILTLAAEHGIKVVEKRITRDEVYIADEAFFTGTAAEVTPIREVDGRQIGIGRRGPVT
FT                   EKLQKAYFDLVTGKTSAHAEWRTLVK"
FT   gene            637193..638236
FT                   /locus_tag="Pmen_0579"
FT   CDS_pept        637193..638236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0579"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83349"
FT                   /db_xref="GOA:A4XPT3"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPT3"
FT                   /protein_id="ABP83349.1"
FT                   /translation="MKILIVGPSWVGDMVMAQTLFQCLKQRHPECEIDVLAPEWSRPIL
FT                   ERMPEVRAALSLPLGHGVLDLATRRRIGKSLAGQYDQAILLPNSLKSALVPWFAGIPKR
FT                   TGWKGEMRYGLLNDIRKLDKARYPLMIERFMALAYEPGAALPQPYPQPRLQIDEASREA
FT                   ALAKFELQLDRPVLALCPGAEFGEAKRWPAEHYAKVAEIKIRAGWQVWLFGSKNDHAGG
FT                   EDIRMRLIPGLREEVSNLSGQTSLAEAIDLMSAATAVVSNDSGLMHVAAALNRPLVAVY
FT                   GSSSPGFTPPLADQVEIVRLGLDCSPCFERTCRFGHYNCLRELKPRPVIEALDRLVGDP
FT                   LALVEGD"
FT   gene            638238..639242
FT                   /locus_tag="Pmen_0580"
FT   CDS_pept        638238..639242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0580"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase I;
FT                   PFAM: glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83350"
FT                   /db_xref="GOA:A4XPT4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPT4"
FT                   /protein_id="ABP83350.1"
FT                   /translation="MRVLIIKTSSLGDVVHTLPALTDAARAIPGIRFDWVVEEGFAEIP
FT                   AWHPAVSQVIPVAIRRWRKHPLRTWRSGEWARFKQRLRETRYDLVIDAQGLLKSAWLTR
FT                   YVQAPVAGLDRDSAREPLASRFYDRRYAVARDQHALERVRQLFAQALDYPLPAGSGDYG
FT                   LNRAAMMDAMAQPYLVFLHGTTWASKHWPEADWRALAERMDELGWAVRLPWGNETEKAR
FT                   AERIAAGLTHAAVLPKLNLAGVAKVIAGASACVSVDTGLGHLAAALDVPNISLYGPTLP
FT                   GKVGAYGRSQIHLCASGPNAGSGDRDKPCFDGLGAERVGLELEALLLAPPGTL"
FT   gene            639252..640376
FT                   /locus_tag="Pmen_0581"
FT   CDS_pept        639252..640376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0581"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83351"
FT                   /db_xref="GOA:A4XPT5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPT5"
FT                   /protein_id="ABP83351.1"
FT                   /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQARGHAIRVYTPIWEGEN
FT                   PGGFDVRVAPVRALFNHRRNEKFTAWLQADLARDPVDRVIGFNKMPGLDVYYAADGCFE
FT                   DKAQTLRNPIYRRWGRYKHFADYERAVFAPESKTEILMISEVQQPLFIKHYNTPLQRFH
FT                   LLPPGIAQDRRAPANAAEIRAEFRREFKLADEDLLLVQIGSGFKTKGLDRSLKALASLP
FT                   RELRKRTRLIAIGQDDPKPFLLQIKALGLSDQVQILKGRSDIPRFLLGADLLIHPAYNE
FT                   NTGTVLLEALVSGLPVLVTDVCGYAHYIADADCGRVLPSPFEQEQLNRTLADMLADPER
FT                   RAFWGRNGLAYADSADLYSMPKKAADVILAEKRA"
FT   gene            640382..641179
FT                   /locus_tag="Pmen_0582"
FT   CDS_pept        640382..641179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0582"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83352"
FT                   /db_xref="GOA:A4XPT6"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPT6"
FT                   /protein_id="ABP83352.1"
FT                   /translation="MLAEPFKSLWAGRDAFEAVEALQGQVYRELEGRRTLRTEVDGRGY
FT                   FVKIHRGIGWGEIAKNLLTAKAPVLGAGQEWQAIARLTEAGVPTMTAVAYGERGANPAS
FT                   QHSFIITEELAPTVDLEQLSLNWAQQPPKPALKWALIREVAQMTGTMHRAGVNHRDCYI
FT                   CHFLLHTDRPIQADDLRLSVIDLHRAQVRSATPRRWRDKDLAALYFSALDIGLTRRDKL
FT                   RFLRSYFQRPLRQVLRDEARLLAWLERKAAKLYERKQRYGDAL"
FT   gene            641179..641913
FT                   /locus_tag="Pmen_0583"
FT   CDS_pept        641179..641913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0583"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83353"
FT                   /db_xref="GOA:A4XPT7"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPT7"
FT                   /protein_id="ABP83353.1"
FT                   /translation="MASWILSTDYQALVDDFGSLEAVFALEGERLTKDPLSEVVRIERD
FT                   GVRYYVKRYWGAGKGLRRYLGRPRVKAEWQNLRYFAKWGIPTAPIVAYGLERRGGSFVR
FT                   GALITRELENTRDMAEMASQGDPRLHDSHWVAAISRQLASHTRTLHDHSFTHNDLKWRN
FT                   LLVNDKAELFFIDCPTGSFWWGPLLRYRIVKDLACLDKVAKYHLSRTQRLRFYLQYRQS
FT                   SRLSRGDKQRVLQILRFFEGRE"
FT   gene            641910..642653
FT                   /locus_tag="Pmen_0584"
FT   CDS_pept        641910..642653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0584"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83354"
FT                   /db_xref="GOA:A4XPT8"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027023"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPT8"
FT                   /protein_id="ABP83354.1"
FT                   /translation="MSDFIAAQDRALLERHGLTSFEALWALQLAAVDEPNTERGGWSTV
FT                   YRLELDDRAFYLKRQSNHLTYSLLRPFGEPTFAREFRNIRRYAELDIPALQAAFFAERK
FT                   VPGERRAILLTRALDGWQDLDSWLARWQTVDAARRTAVLRACGELARCLHQAGQVHGCF
FT                   YPKHIFLREQGDNVEAQLIDLEKTRPLLLGRRDRIRDLEPLLRRVRVWSEAEVRELLAA
FT                   YLGSPAQVDIWWRLLEARQRHKEAR"
FT   gene            642653..644098
FT                   /locus_tag="Pmen_0585"
FT   CDS_pept        642653..644098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83355"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPT9"
FT                   /protein_id="ABP83355.1"
FT                   /translation="MTLHKLSQAGRTPTLPLTLELAGEFLVLERLLRVLPGQRYVGLAR
FT                   WQGRQVLAKVLVGGKAQRHFQRELEGAERMARQGLVTPELLAYGFVEGQGGWLLFEYLD
FT                   GAQSLWQAWREVAQEALLGDGQQGVLAEALGAIGRMHAQGLWQDDLHLDNLLRHEGRLY
FT                   LIDGGGVRWETLGQPLSRARVLENLGVFFAQLPAELDPFLEELLIHYLLANGEHALPLE
FT                   MLQAEIAKVRRWRLRDYLKKAARDCSLFAARIGAFGLRVVRREAEAALQPLLSDLDARI
FT                   EAGHIYKTGGAATVARVELDGRQLVVKRYNVKNWLHWLKRFWRPSRAWHSWIEGNRLEL
FT                   LGIATPRPLAVIERRWCWLRGRAYLITDYCGGQDIIARFEAYKQAVPPESELLALDRLF
FT                   AALLRERISHGDFKGHNLFWDDAQGAWSLIDLDAMRQHHSTRSFARAYARDRARFLRNW
FT                   PADSALHQLLDQRLPQVPGTCPN"
FT   gene            644111..645865
FT                   /locus_tag="Pmen_0586"
FT   CDS_pept        644111..645865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0586"
FT                   /product="Carbamoyltransferase"
FT                   /note="PFAM: Carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83356"
FT                   /db_xref="GOA:A4XPU0"
FT                   /db_xref="InterPro:IPR003696"
FT                   /db_xref="InterPro:IPR031730"
FT                   /db_xref="InterPro:IPR038152"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPU0"
FT                   /protein_id="ABP83356.1"
FT                   /translation="MALTILGLSGALSHDPSAALYIDGKLIAAVEEERFVRDKHAKNRM
FT                   PYESAKFCLEQAGIKPSDVDVVAIPFAPISIFEKARWQYAKRYAYAPDRALDAILFGNR
FT                   RYKRYKKRIEWCLVQLGFDLKKVKIEPVEHHLAHASSAYHCSGFKEKTAILGIDGKGEY
FT                   ATTFFGWGENGKIHKIKEFYDPDSLGGLYGAITEYLGFEMLDGEFKVMGMAPYGDAAKY
FT                   DFSRLAKFENGELIINTEYANVIGFRRYKENGKGYYFSPKLIEWLGPKRQGDIADDPYI
FT                   HYAASMQALFEKLALEMMEYYLGDILKETGKIAFAGGCALNVKLNQKIIARDDVKELFV
FT                   QPASGDAGTAVGAAAYVSHQRGVPVEKMEHVYLGPSYSNEEVIAACAKHPNKPVFKRID
FT                   NTPERIAKIMVDGNPVAWFQGRMEFGPRALGGRSIIGCPSVPGVADRINEQIKFRERWR
FT                   PFCPSMLDTVAPKMLKVDHPSPFMTFTFEVNEEWKERVGEVVHEDGTSRAQVLERQYNP
FT                   RWYDLMLELEKLTGNGVSLNTSLNRRGEPMICSPTDALNMFYGSDLQYLIMEDILVVKD
FT                   GKDWYDHV"
FT   gene            645852..646970
FT                   /locus_tag="Pmen_0587"
FT   CDS_pept        645852..646970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0587"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83357"
FT                   /db_xref="GOA:A4XPU1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPU1"
FT                   /protein_id="ABP83357.1"
FT                   /translation="MTTSDHAHGEPERWVLQFCHGYDGPFLDCARQYAVLFKGTPYKVC
FT                   TVYLTGKPSAEVERGSASDEVIFLDYSSAQVRGLKLGAIRDLRRIAASRDFALCIAHRF
FT                   KPIYVALLGSNLPVIGVHHAFGDYKRRSRQLFANFFRKRLALLGVSNAVRDDMRACLPD
FT                   WPAERIETLYNRIDVEAVQAEQVSREVARDHLGMPQDAWVVGNVGRLHPDKDQATLIRG
FT                   FALALPQLPAGSLLAIMGSGRLEVQLKALAVELGVSEAVRFLGQVPNGRRYFKAFDVFV
FT                   LTSDHEPFGMVLLEAMAAGVPVICSDCGGGREVVMGSGLLVAFAQPSALAMGLQGCAEA
FT                   RIDALSSARRLRLCFSDQAARERFWALGWLSQ"
FT   gene            647007..647879
FT                   /locus_tag="Pmen_0588"
FT   CDS_pept        647007..647879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83358"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPU2"
FT                   /protein_id="ABP83358.1"
FT                   /translation="MTPSICFIIPYFGRWPFWMPLFLESCRSNPDIDWLLFSDCGEPEN
FT                   LPANVRIVDITYSDYCALVSNRLDISFSPINPYKLCDLKPALGLIHEEQLQGYDFWAFG
FT                   DLDLIYGRLRQYFTDERLARYDLYSTHARRVSGHLCLVRNTDRMRQVFKRMPRWQERLG
FT                   DKEHHALDEGAFSRLFLWRKNFPKPLFNLVGRFNPLRRRSEFIEAFSTPDGCIPWTDGS
FT                   FRFPRRWFWRNGSLTNDQDGDRQFPYFHFAIWKRGVWSGLPAPAHETMQALADKHVWVV
FT                   DEEGFSQWE"
FT   gene            647882..649027
FT                   /locus_tag="Pmen_0589"
FT   CDS_pept        647882..649027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0589"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83359"
FT                   /db_xref="GOA:A4XPU3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPU3"
FT                   /protein_id="ABP83359.1"
FT                   /translation="MVRRIKVLQLHPDYNIKAHDFADLGEQIFHALPPERFETVNAFLR
FT                   GRPVSGQPESRAERSVYFEFSDSQLKGMRIRAMWRLFQYCRSERFDVVICNRFKPVNMM
FT                   LMLNRWLKVPLCIGIAHGFGEYDRAYRRQQTARLVSPAWRFVGVSPAVRQYLLDCRCGF
FT                   TERNTVAITNAIDIVQAERLQFSREDARSRLGLEPNVRFVGALGRLVPVKGHIHLVRAF
FT                   AQNAGRHPHAQLAIIGAGREHDRLQQELELLGLQGRVHLLGFRENALRYVRAFDIWAMP
FT                   SLAEGLGLALLEGMSGHLPVIASDVPAMLPLIEGAGGIAVAPADVEGLSRALDEYLSLS
FT                   DEELRLKGERSYNYLKEQHDIEVFRQQYLKLIDSALAEVQK"
FT   gene            649024..649908
FT                   /locus_tag="Pmen_0590"
FT   CDS_pept        649024..649908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0590"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83360"
FT                   /db_xref="GOA:A4XPU4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPU4"
FT                   /protein_id="ABP83360.1"
FT                   /translation="MTEQLPLVTVVIASYNHAPYIEQCILSVVQQTYPHIELLVIDDGS
FT                   TDDSVARIQRLQQEHGFDLRVQQNKGLTRTLNEAIARAKGSLIAPFGSDDIMMPERIAK
FT                   QVSHMQDKPEVGACAGNIELIDSDGQLFPESRQRREIAFRRLDFDDVFMERKPYPPAPT
FT                   LLFRKEVLERVGGFDPTIRLEDLLIELKITHAGYYIDCLGEVLAQYRKHDSNSSKNTPF
FT                   MVDSILRTYALFKDHPQYEFVRARFLSSMFLKCSNRDRDYARQLLRQIPLRRWNKKTWR
FT                   GLGRLLFSPLEKH"
FT   gene            649911..650567
FT                   /locus_tag="Pmen_0591"
FT   CDS_pept        649911..650567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0591"
FT                   /product="Acetyltransferase (isoleucine patch
FT                   superfamily)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83361"
FT                   /db_xref="GOA:A4XPU5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPU5"
FT                   /protein_id="ABP83361.1"
FT                   /translation="MGFWARFRERRAKRAIRKLPKLYRGQARFLLHYPHYSIGVGSYGL
FT                   PIVHDWNEGATLRIGAYTSIAEQVEVFLGGHHRTEWLTTYPFPAMVDEAASIPGYAFSR
FT                   GDVTIGSDVWLCTGAMILSGVTVGDGAVVAAGAVVSRDVAPYSVVAGNPARHIRWRFPE
FT                   PVREALRATKWWEWPEEEVRRISALLCSERVDEFLQYASRRATASSHQSGFSSSA"
FT   gene            complement(650540..652365)
FT                   /pseudo
FT                   /locus_tag="Pmen_0592"
FT                   /note="O-antigen polymerase"
FT   gene            652493..654334
FT                   /locus_tag="Pmen_0594"
FT   CDS_pept        652493..654334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0594"
FT                   /product="lipid A ABC exporter, fused ATPase and inner
FT                   membrane subunits MsbA"
FT                   /note="TIGRFAM: lipid A ABC exporter, fused ATPase and
FT                   inner membrane subunits MsbA; PFAM: ABC transporter,
FT                   transmembrane region; ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83362"
FT                   /db_xref="GOA:A4XPU6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPU6"
FT                   /protein_id="ABP83362.1"
FT                   /translation="MTDTSADPQSSSSLKIYFRLLRYVRPYVGLFLLSLLGFLIFASTQ
FT                   PMLGYILKYFVDGLSNPDASLFAGVPWLLEHAPWLAHLKLLQAVPLLIVLIALWQGIGS
FT                   FLGNYYLAKVSMGLVQDLRVALFNNLLTLPNRYFDNHNSGHLISRITYNVTMVTGAATD
FT                   AIKVVVREGMTVIFLFATLLWMNWKLTLVMVAILPVIGLMVTSTSKKFRKQSKKIQTSM
FT                   GDVTHVTSESIQGYRVVRSFGGEDYERQRFLDASEQNKLKQLKMVKTNAVYTPSLQLVI
FT                   YSAMAVLMFLVLLLRGDASAGDLVAYITLAGLLPKPIRQLSEVSSTIQKGVAGAESIFE
FT                   QLDEEPEVDCGTQERERISGRLEVRDLSFSYPGSEKPVLNNISFVAEPGQMVALVGRSG
FT                   SGKSTLANLIPRFYHHEQGSILLDGVDVEDYRLRNLRRHIALVTQHVTLFNDTVRNNIA
FT                   YGDLAGAPLEAVQQAARDAYAAEFIEKMPQGYDTLVGENGVLLSGGQRQRLAIARALLK
FT                   DAPLLILDEATSALDTESERHIQAALDQVMQGRTTLVIAHRLTTIEKADLILVMDQGQI
FT                   VERGSHAELLAQNGYYARLHAKQFEEGGEPVVVEQDV"
FT   gene            654334..655230
FT                   /locus_tag="Pmen_0595"
FT   CDS_pept        654334..655230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0595"
FT                   /product="Mig-14 family protein"
FT                   /note="PFAM: Mig-14 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83363"
FT                   /db_xref="InterPro:IPR009977"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPU7"
FT                   /protein_id="ABP83363.1"
FT                   /translation="MLSHLRFWRERGWAPISAADYADAWANFGGSVATHPEVVARLADL
FT                   AGIPVRYLGWLADGQLQAAMPTWGRHLALSKDVLKQQGRRGLFDLGNAEVILPIAQNVK
FT                   VAVQHRMRYVSELNAAQISSLREQPEGLALAREPEQYSKKFRYNQRREQRLLEEAGGVI
FT                   RPMLELTAQEQARIYADLFQRRWGFEATGKAHLAEVFTRLRDFMTGSLIYLNDEPVAIQ
FT                   VLYRVEAPRWVSLEYINGGVDPQQREFSPGSVLSFVNTQSEWEQARALGKPLRYSFGRA
FT                   DREYKDRWCHRVPVYQV"
FT   gene            655235..656623
FT                   /locus_tag="Pmen_0596"
FT   CDS_pept        655235..656623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0596"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83364"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPU8"
FT                   /protein_id="ABP83364.1"
FT                   /translation="MNGRKQQLLKRHRRNKRIALLGALLVLVLLGVLVAWWLPPLLLVL
FT                   GWVAHEAWFADHLFYSPRDDYRYDFPADCLSVPARLEQGVLRVDAELDGHDTLILELRL
FT                   EATWLGRWLDPHVLLGGDRQDFERGVAGRRYLNLSGQNVDGLALVPRFCRIHGGLRLHA
FT                   MRNPDYAGQRLLIVAPHADDAELAAFGLYSRAAEVAIVTLTQGEIEAEHYQRLGLEKAA
FT                   AARLKGRLRAWDSLAAPLWGGVSQARCVQLGYYCLQLPAMAAAPEQPFASRESGESDIR
FT                   SVRQYNPLTLPADDDGLPTWRNLVADLGAVLEHFRPEVVLTPHPELDPHHDHVASTQAL
FT                   LEAVAACAWQPQTLLLYANHLHDNDRWPMGPADNGIALPPAIKALPADRLWSPVLDAEQ
FT                   QLDKAMALALQHDLQGPLPLKKRLRRSIQRLLAGRRWPASGEDEFFRKAVRRHELFWVR
FT                   PIGR"
FT   sig_peptide     655235..655342
FT                   /locus_tag="Pmen_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 36"
FT   gene            656685..658106
FT                   /locus_tag="Pmen_0597"
FT   CDS_pept        656685..658106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0597"
FT                   /product="D-alpha,beta-D-heptose 7-phosphate 1-kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="TIGRFAM: cytidyltransferase-related domain; rfaE
FT                   bifunctional protein; PFAM: cytidylyltransferase; PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83365"
FT                   /db_xref="GOA:A4XPU9"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4XPU9"
FT                   /protein_id="ABP83365.1"
FT                   /translation="MKLTLPRYDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVRVEQ
FT                   IEDRPGGAANVALNIAALGAPALLVGVTGEDEAADSLTDSLAAAGVEAHFQRIEDQPTI
FT                   VKLRVMSRHQQLLRMDFEEPFNTDAAAMAREVEALLAGVKVLVLSDYGKGALQNHQVLI
FT                   QAARKKGIPVLADPKGKDFSIYRGASLITPNLHEFETIVGGCADEAELVSKGAKLMREL
FT                   ELGALLVTRGEHGMTLLRPEHAPLHLPARAREVFDVTGAGDTVISTLAASIAAGEELPN
FT                   AVALANLAAGIVVGKLGTAAISAPELRRAVQREEGSERGVLSLDQLLIAIEDARAHGEK
FT                   IVFTNGCFDILHAGHVTYLEQARAQGDRLIVAINDDASVSRLKGPGRPINAVDRRMAVL
FT                   AGLGAVDWVVSFAEDTPERLLKQVQPDVLVKGGDYGIDQVVGADIVQAYGGEVRVLGLV
FT                   ENSSTTAIVEKIRNK"
FT   gene            658257..659537
FT                   /locus_tag="Pmen_0598"
FT   CDS_pept        658257..659537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0598"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83366"
FT                   /db_xref="GOA:A4XPV0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPV0"
FT                   /protein_id="ABP83366.1"
FT                   /translation="MTVDVQGQALSMLSKLAQADWPDRLKLRKPFEKLVYNGSRASFRL
FT                   AAGRAASKPRQARPAADDLFDLSLSDEQQMLVEMLQGFALEVLRPAAHEADAQARVPAA
FT                   LINQARELGLAHYGVGEAQGGLAGERTVLSNALIAESLAQGDFSLAAALLLPLSAANCI
FT                   RRWGSPAQQAAWLPAFVSEAGADAFALAVSEPGVLSDPGRPATRARKRGKHYLLDGEKA
FT                   LVLGGLEASRLIVSAQAGDGPGLFIVDATSKGISRRAEPGMGLRACGLARVRLKGVKVP
FT                   VERRLAAADFDFQAFLDHSALALCALAVGTAQAALDYVTTYCNERQAFGEPISHRQGVA
FT                   FMVADIAIELDAMRLLLWRACTRAEAGLPFRREAYLARLFCAEKAMKIGSDAVQLLGGH
FT                   GFTQEHPVERWYRDLRSVAVLAGGLHL"
FT   gene            659551..660762
FT                   /locus_tag="Pmen_0599"
FT   CDS_pept        659551..660762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0599"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83367"
FT                   /db_xref="GOA:A4XPV1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPV1"
FT                   /protein_id="ABP83367.1"
FT                   /translation="MNLETPKKFRGLQQQAQQVARHYFRPISRKYDKAEHAYPKELDLL
FT                   AALLDGMNEGSPDAVGAGSASKRGAAREQQDGIKNGGNLAALLGVMELCWGDVGLLLAM
FT                   PRQGLGNAAIAAVANDEQLARFGKTWAAMAITEPGCGSDSAAIRTTAVKDGDHYVINGE
FT                   KIYVTSGERADAVVVWASLDRSLGRAAIKSFVVEKGTPGMTVTRLEKKLGIKASDTASI
FT                   SFSDCRVPAANLLGNAEIDVQKGFAGVMETFDNTRPLVAGMAVGVARAALERTRELLSK
FT                   AGCRFDYARPLLSVTHAEATLYRLEAEWEAARLLTLKAAWMADNKLPNSKEASIAKAKA
FT                   GRVASEVTLKCVELAGALGYGEDELLEKWARDSKILDIFEGTQQIQLLIVARRLLGKSS
FT                   SELR"
FT   gene            complement(660813..661538)
FT                   /locus_tag="Pmen_0600"
FT   CDS_pept        complement(660813..661538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0600"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83368"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPV2"
FT                   /protein_id="ABP83368.1"
FT                   /translation="MMTVVRPLALLLTTLLVLSGCSLLQQKPVPLYQLDSGDAVTPTKD
FT                   TGMAVLVGPISVADYLRQQHLLQRQPDGSLVAAPEARWASGLANDIDQQMLRQLAWRLE
FT                   SQRLALAPAAPGFNADAQVMLTITRLDSGPTQPAILEAQWRLLDRNGQLRDSRLIRMEE
FT                   AHGGPLAEQVKAQSALLQRLAAELAVAIQPIAVVEEPVPEPPRKKPPVAKAKPQEPPAA
FT                   GPRIPVAEPIKIDTEVFRF"
FT   sig_peptide     complement(661464..661538)
FT                   /locus_tag="Pmen_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.580 at
FT                   residue 25"
FT   gene            complement(661710..663959)
FT                   /locus_tag="Pmen_0601"
FT   CDS_pept        complement(661710..663959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0601"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83369"
FT                   /db_xref="GOA:A4XPV3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPV3"
FT                   /protein_id="ABP83369.1"
FT                   /translation="MSESLDLSLEGVERRSLADFTEQAYLNYSMYVIMDRALPHIGDGL
FT                   KPVQRRIVYAMSELGLDADAKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRY
FT                   TLVDGQGNWGAPDDPKSFAAMRYTEARLSRYSEVLLSELGQGTVDWVPNFDGTMNEPAT
FT                   LPARLPNLLLNGTTGIAVGMATDVPPHNLREVAAACVRLLDEPGATVEQLCEHIQGPDF
FT                   PTEAEVITPKADLLKIYESGRGSVRMRAVYRVEDGDIIVTALPHQVSGAKVLEQIAAQM
FT                   QAKKLPMVADLRDESDHENPTRIVIIPRSNRVDADELMTHLFATTDLESSYRVNTNVIG
FT                   LDGKPQVKDLRTLLSEWLVYRVGTVRRRLQFRLDKVEKRLHLLEGLLIAFLNLDEVIRI
FT                   IRTEDQPKPVLMEAFGLTEVQADYILDTRLRQLARLEEMKIRGEQDELAKEREKLLALL
FT                   GSEAKLKKLVRKEIIEDAEKYGDDRRSPIVARAEARALSETELMPTEPVTVVLSEKGWV
FT                   RCAKGHDIDATGLSYKAGDGFKAAAPGRSNQYAVFIDSTGRSYSLAAHSLPSARGQGEP
FT                   LTGRLTPPPGATFECVMLPEDSALYVIASDAGYGFVVKGEDLQAKNKAGKALLSLPNGA
FT                   KVVAPKPVTNLEDDWLAAVTTEGRLLLFKVTDLPQLGKGKGNKIIGIPGERVASREEYL
FT                   TDLAVLPSGASLVLQAGKRTLTLKADDLEHYKGERGRRGNKLPRGFQRVDQLLVE"
FT   gene            complement(663967..664491)
FT                   /locus_tag="Pmen_0602"
FT   CDS_pept        complement(663967..664491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0602"
FT                   /product="aspartyl protease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83370"
FT                   /db_xref="GOA:A4XPV4"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPV4"
FT                   /protein_id="ABP83370.1"
FT                   /translation="MSEQAPGRRAGRVMLVLAWGAGLLLATHFFGNWEDRQHNPNRTPQ
FT                   SLHGDGFVEVSLASSRQGHYLVDGQIDGQKVTFLLDTGANQVAVPSAVAERLGLVRGAP
FT                   IVISTANGRATGHRTRLASLRLGDIELRDVAALIAPGMDGDEVLLGMSALKQLEFSQKG
FT                   GTLVLRQSTLQ"
FT   gene            complement(664488..665471)
FT                   /locus_tag="Pmen_0603"
FT   CDS_pept        complement(664488..665471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83371"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPV5"
FT                   /protein_id="ABP83371.1"
FT                   /translation="MRSLFLALGLLAGVVHAEPVVLEELKLQAEYPVEGINGGNLSGLA
FT                   LCGEIMWAVSDRDDDRLYQLQLDGSLLRAEAETFVAPEPPESALPWGLRMRNWAAGLVR
FT                   GGKLDFEGLSCDAQGNRYLVSETRAAVLQVSSNGNAQWLNLPSGLVRQARASGMLLHFN
FT                   QGFEGIAIDPAGERLWLAAEQRRRGLTVMHRRGSGWRCTGGCVLTSESGEEASPEALGG
FT                   HMAPRDFSGLAYFGEKLFTLERQAHRICRRTLGDGEMDICWSFAGEALAEQRRYARSYG
FT                   MAEALWIDKDGAWIGVDNGGQTRADGESRPLVWRLAAPKGGWSRRP"
FT   sig_peptide     complement(665418..665471)
FT                   /locus_tag="Pmen_0603"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 18"
FT   gene            complement(665471..667369)
FT                   /locus_tag="Pmen_0604"
FT   CDS_pept        complement(665471..667369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0604"
FT                   /product="DNA topoisomerase IV subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA topoisomerase IV, B subunit; PFAM: DNA
FT                   gyrase, subunit B domain protein; ATP-binding region,
FT                   ATPase domain protein domain protein; DNA topoisomerase,
FT                   type IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83372"
FT                   /db_xref="GOA:A4XPV6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPV6"
FT                   /protein_id="ABP83372.1"
FT                   /translation="MAQQNAYNADAIEVLSGLDPVRKRPGMYTDTTRPNHLAQEVIDNS
FT                   VDEALAGHAKSIQVILHEDNSLEVIDDGRGMPVDIHPEEGVPGVELILTKLHAGGKFSN
FT                   KNYQFSGGLHGVGISVVNALSTRVVVTVKRDGNEYQMSFADGFKASELEVIGTVGKRNT
FT                   GTSVHFWPDAKYFDSFKFSVSRLKHVLKAKAVLCPGLSVTFEDKAAGEKVEWHYEDGLR
FT                   SYLVDAVSEFERLPAEPFVGSLAGNKEAVDWALLWLPEGGDAVQESYVNLIPTAQGGTH
FT                   VNGLRQGLLDAMREFCEFRNLLPRGVKLAPEDVWERIAFVLSMKMQDAQFSGQTKERLS
FT                   SREAAAFVSGVVKDAFSLWLNAHPETGLALAELAISNAGRRLKAGKKVERKKITQGPAL
FT                   PGKLADCAGQNPLRCELFLVEGDSAGGSAKQARDKEFQAIMPLRGKILNTWEVDGSEVL
FT                   ASQEVHDIAVAIGIDPGSSDLSGLRYGKICILADADSDGLHIATLLCALFVRHFRPLVD
FT                   AGHVYVAMPPLYRIDLGKEIFYALDDAERDGILDRLVAEKRRGKPQVTRFKGLGEMNPP
FT                   QLRETTMDPNTRRLVQLTLDDFEGTREVMDMLLAKKRAGDRKSWLETKGNLAEVLA"
FT   gene            complement(667385..667996)
FT                   /locus_tag="Pmen_0605"
FT   CDS_pept        complement(667385..667996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0605"
FT                   /product="protein of unknown function UPF0227"
FT                   /note="PFAM: protein of unknown function UPF0227"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83373"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPV7"
FT                   /protein_id="ABP83373.1"
FT                   /translation="MTASILYIHGLNSSPASHKACQLSGAMTRLGLAQQLRVPALHHHP
FT                   RQAMLQLQALVAELGAPLLVGSSLGGYYATYLAEQHGLKALLINPAVRPHLRFDGYLGP
FT                   QKNYYSDETWDLTEDHIHALAELEVPPPNDPARYQVWLQTGDETLDYRDAERYYRGCAL
FT                   RIQAGGDHGFQGFAERLPILFAFAGINATLWRDIDFSVSN"
FT   gene            complement(668109..668924)
FT                   /locus_tag="Pmen_0606"
FT   CDS_pept        complement(668109..668924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0606"
FT                   /product="Calcineurin phosphoesterase C-terminal domain
FT                   protein"
FT                   /note="PFAM: metallophosphoesterase; Calcineurin
FT                   phosphoesterase C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83374"
FT                   /db_xref="GOA:A4XPV8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPV8"
FT                   /protein_id="ABP83374.1"
FT                   /translation="MPSLPNPSADSSVLLVQLSDSHLFAEADGKLLGMDTRDSLQRVIE
FT                   RVQQEQAQIDLILATGDLSQDGSQASYQRFRQLTAAIGAPARWLAGNHDETPPMQAACQ
FT                   GSDLLEPVIDLGAWRIVMLDSSIPGAVPGFLADSQLELLERALSEAPQRHHLICLHHHP
FT                   VPIGCKWMAPIGLRNPDALFAVLDRHPQARALLWGHVHQEFDQQRGNLRLLASPSTCVQ
FT                   FAPGSEEFQVGSEAPGYRWLRLHADGTLETGVSRVTGITFEIDYSVKGY"
FT   gene            complement(669071..669517)
FT                   /locus_tag="Pmen_0607"
FT   CDS_pept        complement(669071..669517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0607"
FT                   /product="protein of unknown function DUF1249"
FT                   /note="PFAM: protein of unknown function DUF1249"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83375"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:A4XPV9"
FT                   /protein_id="ABP83375.1"
FT                   /translation="MNLLRERYRVDLVELQAACEANYARLMRLLPNMRTDHQVRRVALS
FT                   QGDHLLGILSLEVLEACPYTTTLRARQEHSLPWLPVPQLEVRVYHDARMAEVVGAENAR
FT                   RLHIRYPYPNAAMHQPDEKSQLNLFLGEWLSHCLACGHEALPVQ"
FT   gene            complement(669514..670113)
FT                   /locus_tag="Pmen_0608"
FT   CDS_pept        complement(669514..670113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pmen_0608"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pmen_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABP83376"
FT                   /db_xref="GOA:A4XPW0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL: