(data stored in ACNUC29543 zone)

EMBL: CP000681

ID   CP000681; SV 1; circular; genomic DNA; STD; PRO; 4659220 BP.
XX
AC   CP000681; AALB01000000-AALB01000131;
XX
PR   Project:PRJNA13393;
XX
DT   21-APR-2007 (Rel. 91, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 5)
XX
DE   Shewanella putrefaciens CN-32 chromosome, complete genome.
XX
KW   .
XX
OS   Shewanella putrefaciens CN-32
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
XX
RN   [1]
RP   1-4659220
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Romine M.F., Fredrickson J.,
RA   Tiedje J., Richardson P.;
RT   "Complete sequence of Shewanella putrefaciens CN-32";
RL   Unpublished.
XX
RN   [2]
RP   1-4659220
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Romine M.F., Fredrickson J.,
RA   Tiedje J., Richardson P.;
RT   ;
RL   Submitted (17-APR-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 6348637e1358b42e78d39b02f55c1c9c.
DR   BioSample; SAMN00623063.
DR   EnsemblGenomes-Gn; EBG00001446893.
DR   EnsemblGenomes-Gn; EBG00001446894.
DR   EnsemblGenomes-Gn; EBG00001446895.
DR   EnsemblGenomes-Gn; EBG00001446896.
DR   EnsemblGenomes-Gn; EBG00001446897.
DR   EnsemblGenomes-Gn; EBG00001446898.
DR   EnsemblGenomes-Gn; EBG00001446899.
DR   EnsemblGenomes-Gn; EBG00001446900.
DR   EnsemblGenomes-Gn; EBG00001446901.
DR   EnsemblGenomes-Gn; EBG00001446902.
DR   EnsemblGenomes-Gn; EBG00001446903.
DR   EnsemblGenomes-Gn; EBG00001446904.
DR   EnsemblGenomes-Gn; EBG00001446905.
DR   EnsemblGenomes-Gn; EBG00001446906.
DR   EnsemblGenomes-Gn; EBG00001446907.
DR   EnsemblGenomes-Gn; EBG00001446908.
DR   EnsemblGenomes-Gn; EBG00001446909.
DR   EnsemblGenomes-Gn; EBG00001446910.
DR   EnsemblGenomes-Gn; EBG00001446911.
DR   EnsemblGenomes-Gn; EBG00001446912.
DR   EnsemblGenomes-Gn; EBG00001446913.
DR   EnsemblGenomes-Gn; EBG00001446914.
DR   EnsemblGenomes-Gn; EBG00001446915.
DR   EnsemblGenomes-Gn; EBG00001446916.
DR   EnsemblGenomes-Gn; EBG00001446917.
DR   EnsemblGenomes-Gn; EBG00001446918.
DR   EnsemblGenomes-Gn; EBG00001446919.
DR   EnsemblGenomes-Gn; EBG00001446920.
DR   EnsemblGenomes-Gn; EBG00001446921.
DR   EnsemblGenomes-Gn; EBG00001446922.
DR   EnsemblGenomes-Gn; EBG00001446923.
DR   EnsemblGenomes-Gn; EBG00001446924.
DR   EnsemblGenomes-Gn; EBG00001446925.
DR   EnsemblGenomes-Gn; EBG00001446926.
DR   EnsemblGenomes-Gn; EBG00001446927.
DR   EnsemblGenomes-Gn; EBG00001446928.
DR   EnsemblGenomes-Gn; EBG00001446929.
DR   EnsemblGenomes-Gn; EBG00001446930.
DR   EnsemblGenomes-Gn; EBG00001446931.
DR   EnsemblGenomes-Gn; EBG00001446932.
DR   EnsemblGenomes-Gn; EBG00001446933.
DR   EnsemblGenomes-Gn; EBG00001446934.
DR   EnsemblGenomes-Gn; EBG00001446935.
DR   EnsemblGenomes-Gn; EBG00001446936.
DR   EnsemblGenomes-Gn; EBG00001446937.
DR   EnsemblGenomes-Gn; EBG00001446938.
DR   EnsemblGenomes-Gn; EBG00001446939.
DR   EnsemblGenomes-Gn; EBG00001446940.
DR   EnsemblGenomes-Gn; EBG00001446941.
DR   EnsemblGenomes-Gn; EBG00001446942.
DR   EnsemblGenomes-Gn; EBG00001446943.
DR   EnsemblGenomes-Gn; EBG00001446944.
DR   EnsemblGenomes-Gn; EBG00001446945.
DR   EnsemblGenomes-Gn; EBG00001446946.
DR   EnsemblGenomes-Gn; EBG00001446947.
DR   EnsemblGenomes-Gn; EBG00001446948.
DR   EnsemblGenomes-Gn; EBG00001446949.
DR   EnsemblGenomes-Gn; EBG00001446950.
DR   EnsemblGenomes-Gn; EBG00001446951.
DR   EnsemblGenomes-Gn; EBG00001446952.
DR   EnsemblGenomes-Gn; EBG00001446953.
DR   EnsemblGenomes-Gn; EBG00001446954.
DR   EnsemblGenomes-Gn; EBG00001446955.
DR   EnsemblGenomes-Gn; EBG00001446956.
DR   EnsemblGenomes-Gn; EBG00001446957.
DR   EnsemblGenomes-Gn; EBG00001446958.
DR   EnsemblGenomes-Gn; EBG00001446959.
DR   EnsemblGenomes-Gn; EBG00001446960.
DR   EnsemblGenomes-Gn; EBG00001446961.
DR   EnsemblGenomes-Gn; EBG00001446962.
DR   EnsemblGenomes-Gn; EBG00001446963.
DR   EnsemblGenomes-Gn; EBG00001446964.
DR   EnsemblGenomes-Gn; EBG00001446965.
DR   EnsemblGenomes-Gn; EBG00001446966.
DR   EnsemblGenomes-Gn; EBG00001446967.
DR   EnsemblGenomes-Gn; EBG00001446968.
DR   EnsemblGenomes-Gn; EBG00001446969.
DR   EnsemblGenomes-Gn; EBG00001446970.
DR   EnsemblGenomes-Gn; EBG00001446971.
DR   EnsemblGenomes-Gn; EBG00001446972.
DR   EnsemblGenomes-Gn; EBG00001446973.
DR   EnsemblGenomes-Gn; EBG00001446974.
DR   EnsemblGenomes-Gn; EBG00001446975.
DR   EnsemblGenomes-Gn; EBG00001446976.
DR   EnsemblGenomes-Gn; EBG00001446977.
DR   EnsemblGenomes-Gn; EBG00001446978.
DR   EnsemblGenomes-Gn; EBG00001446979.
DR   EnsemblGenomes-Gn; EBG00001446980.
DR   EnsemblGenomes-Gn; EBG00001446981.
DR   EnsemblGenomes-Gn; EBG00001446982.
DR   EnsemblGenomes-Gn; EBG00001446983.
DR   EnsemblGenomes-Gn; EBG00001446984.
DR   EnsemblGenomes-Gn; EBG00001446985.
DR   EnsemblGenomes-Gn; EBG00001446986.
DR   EnsemblGenomes-Gn; EBG00001446987.
DR   EnsemblGenomes-Gn; EBG00001446988.
DR   EnsemblGenomes-Gn; EBG00001446989.
DR   EnsemblGenomes-Gn; EBG00001446990.
DR   EnsemblGenomes-Gn; EBG00001446991.
DR   EnsemblGenomes-Gn; EBG00001446992.
DR   EnsemblGenomes-Gn; EBG00001446993.
DR   EnsemblGenomes-Gn; EBG00001446994.
DR   EnsemblGenomes-Gn; EBG00001446995.
DR   EnsemblGenomes-Gn; EBG00001446996.
DR   EnsemblGenomes-Gn; EBG00001446997.
DR   EnsemblGenomes-Gn; EBG00001446998.
DR   EnsemblGenomes-Gn; EBG00001446999.
DR   EnsemblGenomes-Gn; EBG00001447000.
DR   EnsemblGenomes-Gn; EBG00001447001.
DR   EnsemblGenomes-Gn; EBG00001447002.
DR   EnsemblGenomes-Gn; EBG00001447003.
DR   EnsemblGenomes-Gn; EBG00001447004.
DR   EnsemblGenomes-Gn; EBG00001447005.
DR   EnsemblGenomes-Gn; EBG00001447006.
DR   EnsemblGenomes-Gn; EBG00001447007.
DR   EnsemblGenomes-Gn; EBG00001447008.
DR   EnsemblGenomes-Gn; EBG00001447009.
DR   EnsemblGenomes-Gn; EBG00001447010.
DR   EnsemblGenomes-Gn; EBG00001447011.
DR   EnsemblGenomes-Gn; EBG00001447012.
DR   EnsemblGenomes-Gn; EBG00001447013.
DR   EnsemblGenomes-Gn; EBG00001447014.
DR   EnsemblGenomes-Gn; EBG00001447015.
DR   EnsemblGenomes-Gn; EBG00001447016.
DR   EnsemblGenomes-Gn; EBG00001447017.
DR   EnsemblGenomes-Gn; EBG00001447018.
DR   EnsemblGenomes-Gn; EBG00001447019.
DR   EnsemblGenomes-Gn; EBG00001447020.
DR   EnsemblGenomes-Gn; EBG00001447021.
DR   EnsemblGenomes-Gn; EBG00001447022.
DR   EnsemblGenomes-Gn; EBG00001447023.
DR   EnsemblGenomes-Gn; EBG00001447024.
DR   EnsemblGenomes-Gn; EBG00001447025.
DR   EnsemblGenomes-Gn; EBG00001447026.
DR   EnsemblGenomes-Gn; EBG00001447027.
DR   EnsemblGenomes-Gn; EBG00001447028.
DR   EnsemblGenomes-Gn; EBG00001447029.
DR   EnsemblGenomes-Gn; EBG00001447030.
DR   EnsemblGenomes-Gn; EBG00001447031.
DR   EnsemblGenomes-Gn; EBG00001447032.
DR   EnsemblGenomes-Gn; EBG00001447033.
DR   EnsemblGenomes-Gn; EBG00001447034.
DR   EnsemblGenomes-Gn; EBG00001447035.
DR   EnsemblGenomes-Gn; EBG00001447036.
DR   EnsemblGenomes-Gn; EBG00001447037.
DR   EnsemblGenomes-Gn; EBG00001447038.
DR   EnsemblGenomes-Gn; EBG00001447039.
DR   EnsemblGenomes-Gn; EBG00001447040.
DR   EnsemblGenomes-Gn; EBG00001447041.
DR   EnsemblGenomes-Gn; EBG00001447042.
DR   EnsemblGenomes-Gn; EBG00001447043.
DR   EnsemblGenomes-Gn; EBG00001447044.
DR   EnsemblGenomes-Gn; EBG00001447045.
DR   EnsemblGenomes-Gn; EBG00001447046.
DR   EnsemblGenomes-Gn; EBG00001447047.
DR   EnsemblGenomes-Gn; EBG00001447048.
DR   EnsemblGenomes-Gn; EBG00001447049.
DR   EnsemblGenomes-Gn; EBG00001447050.
DR   EnsemblGenomes-Gn; EBG00001447051.
DR   EnsemblGenomes-Gn; EBG00001447052.
DR   EnsemblGenomes-Gn; EBG00001447053.
DR   EnsemblGenomes-Gn; EBG00001447054.
DR   EnsemblGenomes-Gn; EBG00001447055.
DR   EnsemblGenomes-Gn; EBG00001447056.
DR   EnsemblGenomes-Gn; EBG00001447057.
DR   EnsemblGenomes-Gn; EBG00001447058.
DR   EnsemblGenomes-Gn; EBG00001447059.
DR   EnsemblGenomes-Gn; EBG00001447060.
DR   EnsemblGenomes-Gn; EBG00001447061.
DR   EnsemblGenomes-Gn; EBG00001447062.
DR   EnsemblGenomes-Gn; EBG00001447063.
DR   EnsemblGenomes-Gn; EBG00001447064.
DR   EnsemblGenomes-Gn; EBG00001447065.
DR   EnsemblGenomes-Gn; EBG00001447066.
DR   EnsemblGenomes-Gn; EBG00001447067.
DR   EnsemblGenomes-Gn; EBG00001447068.
DR   EnsemblGenomes-Gn; EBG00001447069.
DR   EnsemblGenomes-Gn; EBG00001447070.
DR   EnsemblGenomes-Gn; EBG00001447071.
DR   EnsemblGenomes-Gn; EBG00001447072.
DR   EnsemblGenomes-Gn; EBG00001447073.
DR   EnsemblGenomes-Gn; EBG00001447074.
DR   EnsemblGenomes-Gn; EBG00001447075.
DR   EnsemblGenomes-Gn; EBG00001447076.
DR   EnsemblGenomes-Gn; EBG00001447077.
DR   EnsemblGenomes-Gn; EBG00001447078.
DR   EnsemblGenomes-Gn; EBG00001447079.
DR   EnsemblGenomes-Gn; EBG00001447080.
DR   EnsemblGenomes-Gn; EBG00001447081.
DR   EnsemblGenomes-Gn; EBG00001447082.
DR   EnsemblGenomes-Gn; EBG00001447083.
DR   EnsemblGenomes-Gn; EBG00001447084.
DR   EnsemblGenomes-Gn; EBG00001447085.
DR   EnsemblGenomes-Gn; EBG00001447086.
DR   EnsemblGenomes-Gn; EBG00001447087.
DR   EnsemblGenomes-Gn; EBG00001447088.
DR   EnsemblGenomes-Gn; EBG00001447089.
DR   EnsemblGenomes-Gn; EBG00001447090.
DR   EnsemblGenomes-Gn; EBG00001447091.
DR   EnsemblGenomes-Gn; EBG00001447092.
DR   EnsemblGenomes-Gn; EBG00001447093.
DR   EnsemblGenomes-Gn; EBG00001447094.
DR   EnsemblGenomes-Gn; EBG00001447095.
DR   EnsemblGenomes-Gn; EBG00001447096.
DR   EnsemblGenomes-Gn; EBG00001447097.
DR   EnsemblGenomes-Gn; EBG00001447098.
DR   EnsemblGenomes-Gn; EBG00001447099.
DR   EnsemblGenomes-Gn; EBG00001447100.
DR   EnsemblGenomes-Gn; EBG00001447101.
DR   EnsemblGenomes-Gn; EBG00001447102.
DR   EnsemblGenomes-Gn; EBG00001447103.
DR   EnsemblGenomes-Gn; EBG00001447104.
DR   EnsemblGenomes-Gn; EBG00001447105.
DR   EnsemblGenomes-Gn; EBG00001447106.
DR   EnsemblGenomes-Gn; EBG00001447107.
DR   EnsemblGenomes-Gn; EBG00001447108.
DR   EnsemblGenomes-Gn; EBG00001447109.
DR   EnsemblGenomes-Gn; EBG00001447110.
DR   EnsemblGenomes-Gn; EBG00001447111.
DR   EnsemblGenomes-Gn; EBG00001447112.
DR   EnsemblGenomes-Gn; EBG00001447113.
DR   EnsemblGenomes-Gn; EBG00001447114.
DR   EnsemblGenomes-Gn; EBG00001447115.
DR   EnsemblGenomes-Gn; EBG00001447116.
DR   EnsemblGenomes-Gn; EBG00001447117.
DR   EnsemblGenomes-Gn; EBG00001447118.
DR   EnsemblGenomes-Gn; EBG00001447119.
DR   EnsemblGenomes-Gn; EBG00001447120.
DR   EnsemblGenomes-Gn; EBG00001447121.
DR   EnsemblGenomes-Gn; EBG00001447122.
DR   EnsemblGenomes-Gn; EBG00001447123.
DR   EnsemblGenomes-Gn; EBG00001447124.
DR   EnsemblGenomes-Gn; Sputcn32_R0001.
DR   EnsemblGenomes-Gn; Sputcn32_R0002.
DR   EnsemblGenomes-Gn; Sputcn32_R0003.
DR   EnsemblGenomes-Gn; Sputcn32_R0004.
DR   EnsemblGenomes-Gn; Sputcn32_R0005.
DR   EnsemblGenomes-Gn; Sputcn32_R0006.
DR   EnsemblGenomes-Gn; Sputcn32_R0007.
DR   EnsemblGenomes-Gn; Sputcn32_R0008.
DR   EnsemblGenomes-Gn; Sputcn32_R0009.
DR   EnsemblGenomes-Gn; Sputcn32_R0010.
DR   EnsemblGenomes-Gn; Sputcn32_R0011.
DR   EnsemblGenomes-Gn; Sputcn32_R0012.
DR   EnsemblGenomes-Gn; Sputcn32_R0013.
DR   EnsemblGenomes-Gn; Sputcn32_R0014.
DR   EnsemblGenomes-Gn; Sputcn32_R0015.
DR   EnsemblGenomes-Gn; Sputcn32_R0016.
DR   EnsemblGenomes-Gn; Sputcn32_R0018.
DR   EnsemblGenomes-Gn; Sputcn32_R0019.
DR   EnsemblGenomes-Gn; Sputcn32_R0020.
DR   EnsemblGenomes-Gn; Sputcn32_R0021.
DR   EnsemblGenomes-Gn; Sputcn32_R0022.
DR   EnsemblGenomes-Gn; Sputcn32_R0023.
DR   EnsemblGenomes-Gn; Sputcn32_R0024.
DR   EnsemblGenomes-Gn; Sputcn32_R0025.
DR   EnsemblGenomes-Gn; Sputcn32_R0026.
DR   EnsemblGenomes-Gn; Sputcn32_R0027.
DR   EnsemblGenomes-Gn; Sputcn32_R0028.
DR   EnsemblGenomes-Gn; Sputcn32_R0030.
DR   EnsemblGenomes-Gn; Sputcn32_R0031.
DR   EnsemblGenomes-Gn; Sputcn32_R0032.
DR   EnsemblGenomes-Gn; Sputcn32_R0033.
DR   EnsemblGenomes-Gn; Sputcn32_R0034.
DR   EnsemblGenomes-Gn; Sputcn32_R0035.
DR   EnsemblGenomes-Gn; Sputcn32_R0036.
DR   EnsemblGenomes-Gn; Sputcn32_R0037.
DR   EnsemblGenomes-Gn; Sputcn32_R0038.
DR   EnsemblGenomes-Gn; Sputcn32_R0039.
DR   EnsemblGenomes-Gn; Sputcn32_R0040.
DR   EnsemblGenomes-Gn; Sputcn32_R0041.
DR   EnsemblGenomes-Gn; Sputcn32_R0042.
DR   EnsemblGenomes-Gn; Sputcn32_R0043.
DR   EnsemblGenomes-Gn; Sputcn32_R0044.
DR   EnsemblGenomes-Gn; Sputcn32_R0045.
DR   EnsemblGenomes-Gn; Sputcn32_R0046.
DR   EnsemblGenomes-Gn; Sputcn32_R0047.
DR   EnsemblGenomes-Gn; Sputcn32_R0048.
DR   EnsemblGenomes-Gn; Sputcn32_R0049.
DR   EnsemblGenomes-Gn; Sputcn32_R0050.
DR   EnsemblGenomes-Gn; Sputcn32_R0051.
DR   EnsemblGenomes-Gn; Sputcn32_R0052.
DR   EnsemblGenomes-Gn; Sputcn32_R0053.
DR   EnsemblGenomes-Gn; Sputcn32_R0054.
DR   EnsemblGenomes-Gn; Sputcn32_R0055.
DR   EnsemblGenomes-Gn; Sputcn32_R0056.
DR   EnsemblGenomes-Gn; Sputcn32_R0057.
DR   EnsemblGenomes-Gn; Sputcn32_R0058.
DR   EnsemblGenomes-Gn; Sputcn32_R0059.
DR   EnsemblGenomes-Gn; Sputcn32_R0060.
DR   EnsemblGenomes-Gn; Sputcn32_R0061.
DR   EnsemblGenomes-Gn; Sputcn32_R0062.
DR   EnsemblGenomes-Gn; Sputcn32_R0063.
DR   EnsemblGenomes-Gn; Sputcn32_R0064.
DR   EnsemblGenomes-Gn; Sputcn32_R0065.
DR   EnsemblGenomes-Gn; Sputcn32_R0066.
DR   EnsemblGenomes-Gn; Sputcn32_R0067.
DR   EnsemblGenomes-Gn; Sputcn32_R0068.
DR   EnsemblGenomes-Gn; Sputcn32_R0069.
DR   EnsemblGenomes-Gn; Sputcn32_R0070.
DR   EnsemblGenomes-Gn; Sputcn32_R0071.
DR   EnsemblGenomes-Gn; Sputcn32_R0072.
DR   EnsemblGenomes-Gn; Sputcn32_R0073.
DR   EnsemblGenomes-Gn; Sputcn32_R0074.
DR   EnsemblGenomes-Gn; Sputcn32_R0075.
DR   EnsemblGenomes-Gn; Sputcn32_R0076.
DR   EnsemblGenomes-Gn; Sputcn32_R0077.
DR   EnsemblGenomes-Gn; Sputcn32_R0078.
DR   EnsemblGenomes-Gn; Sputcn32_R0079.
DR   EnsemblGenomes-Gn; Sputcn32_R0080.
DR   EnsemblGenomes-Gn; Sputcn32_R0081.
DR   EnsemblGenomes-Gn; Sputcn32_R0082.
DR   EnsemblGenomes-Gn; Sputcn32_R0083.
DR   EnsemblGenomes-Gn; Sputcn32_R0084.
DR   EnsemblGenomes-Gn; Sputcn32_R0085.
DR   EnsemblGenomes-Gn; Sputcn32_R0086.
DR   EnsemblGenomes-Gn; Sputcn32_R0087.
DR   EnsemblGenomes-Gn; Sputcn32_R0088.
DR   EnsemblGenomes-Gn; Sputcn32_R0089.
DR   EnsemblGenomes-Gn; Sputcn32_R0090.
DR   EnsemblGenomes-Gn; Sputcn32_R0091.
DR   EnsemblGenomes-Gn; Sputcn32_R0092.
DR   EnsemblGenomes-Gn; Sputcn32_R0093.
DR   EnsemblGenomes-Gn; Sputcn32_R0094.
DR   EnsemblGenomes-Gn; Sputcn32_R0095.
DR   EnsemblGenomes-Gn; Sputcn32_R0096.
DR   EnsemblGenomes-Gn; Sputcn32_R0097.
DR   EnsemblGenomes-Gn; Sputcn32_R0098.
DR   EnsemblGenomes-Gn; Sputcn32_R0099.
DR   EnsemblGenomes-Gn; Sputcn32_R0100.
DR   EnsemblGenomes-Gn; Sputcn32_R0101.
DR   EnsemblGenomes-Gn; Sputcn32_R0102.
DR   EnsemblGenomes-Gn; Sputcn32_R0103.
DR   EnsemblGenomes-Gn; Sputcn32_R0104.
DR   EnsemblGenomes-Gn; Sputcn32_R0105.
DR   EnsemblGenomes-Gn; Sputcn32_R0106.
DR   EnsemblGenomes-Gn; Sputcn32_R0107.
DR   EnsemblGenomes-Gn; Sputcn32_R0108.
DR   EnsemblGenomes-Gn; Sputcn32_R0109.
DR   EnsemblGenomes-Gn; Sputcn32_R0110.
DR   EnsemblGenomes-Gn; Sputcn32_R0111.
DR   EnsemblGenomes-Gn; Sputcn32_R0112.
DR   EnsemblGenomes-Gn; Sputcn32_R0113.
DR   EnsemblGenomes-Gn; Sputcn32_R0114.
DR   EnsemblGenomes-Gn; Sputcn32_R0115.
DR   EnsemblGenomes-Gn; Sputcn32_R0116.
DR   EnsemblGenomes-Gn; Sputcn32_R0117.
DR   EnsemblGenomes-Gn; Sputcn32_R0118.
DR   EnsemblGenomes-Gn; Sputcn32_R0119.
DR   EnsemblGenomes-Gn; Sputcn32_R0121.
DR   EnsemblGenomes-Gn; Sputcn32_R0122.
DR   EnsemblGenomes-Gn; Sputcn32_R0123.
DR   EnsemblGenomes-Gn; Sputcn32_R0124.
DR   EnsemblGenomes-Gn; Sputcn32_R0125.
DR   EnsemblGenomes-Gn; Sputcn32_R0126.
DR   EnsemblGenomes-Gn; Sputcn32_R0127.
DR   EnsemblGenomes-Gn; Sputcn32_R0128.
DR   EnsemblGenomes-Gn; Sputcn32_R0129.
DR   EnsemblGenomes-Gn; Sputcn32_R0130.
DR   EnsemblGenomes-Tr; EBT00001600692.
DR   EnsemblGenomes-Tr; EBT00001600693.
DR   EnsemblGenomes-Tr; EBT00001600694.
DR   EnsemblGenomes-Tr; EBT00001600695.
DR   EnsemblGenomes-Tr; EBT00001600696.
DR   EnsemblGenomes-Tr; EBT00001600697.
DR   EnsemblGenomes-Tr; EBT00001600698.
DR   EnsemblGenomes-Tr; EBT00001600699.
DR   EnsemblGenomes-Tr; EBT00001600700.
DR   EnsemblGenomes-Tr; EBT00001600701.
DR   EnsemblGenomes-Tr; EBT00001600702.
DR   EnsemblGenomes-Tr; EBT00001600703.
DR   EnsemblGenomes-Tr; EBT00001600704.
DR   EnsemblGenomes-Tr; EBT00001600705.
DR   EnsemblGenomes-Tr; EBT00001600706.
DR   EnsemblGenomes-Tr; EBT00001600707.
DR   EnsemblGenomes-Tr; EBT00001600708.
DR   EnsemblGenomes-Tr; EBT00001600709.
DR   EnsemblGenomes-Tr; EBT00001600710.
DR   EnsemblGenomes-Tr; EBT00001600711.
DR   EnsemblGenomes-Tr; EBT00001600712.
DR   EnsemblGenomes-Tr; EBT00001600713.
DR   EnsemblGenomes-Tr; EBT00001600714.
DR   EnsemblGenomes-Tr; EBT00001600715.
DR   EnsemblGenomes-Tr; EBT00001600716.
DR   EnsemblGenomes-Tr; EBT00001600717.
DR   EnsemblGenomes-Tr; EBT00001600718.
DR   EnsemblGenomes-Tr; EBT00001600719.
DR   EnsemblGenomes-Tr; EBT00001600720.
DR   EnsemblGenomes-Tr; EBT00001600721.
DR   EnsemblGenomes-Tr; EBT00001600722.
DR   EnsemblGenomes-Tr; EBT00001600723.
DR   EnsemblGenomes-Tr; EBT00001600724.
DR   EnsemblGenomes-Tr; EBT00001600725.
DR   EnsemblGenomes-Tr; EBT00001600726.
DR   EnsemblGenomes-Tr; EBT00001600727.
DR   EnsemblGenomes-Tr; EBT00001600728.
DR   EnsemblGenomes-Tr; EBT00001600729.
DR   EnsemblGenomes-Tr; EBT00001600730.
DR   EnsemblGenomes-Tr; EBT00001600731.
DR   EnsemblGenomes-Tr; EBT00001600732.
DR   EnsemblGenomes-Tr; EBT00001600733.
DR   EnsemblGenomes-Tr; EBT00001600734.
DR   EnsemblGenomes-Tr; EBT00001600735.
DR   EnsemblGenomes-Tr; EBT00001600736.
DR   EnsemblGenomes-Tr; EBT00001600737.
DR   EnsemblGenomes-Tr; EBT00001600738.
DR   EnsemblGenomes-Tr; EBT00001600739.
DR   EnsemblGenomes-Tr; EBT00001600740.
DR   EnsemblGenomes-Tr; EBT00001600741.
DR   EnsemblGenomes-Tr; EBT00001600742.
DR   EnsemblGenomes-Tr; EBT00001600743.
DR   EnsemblGenomes-Tr; EBT00001600744.
DR   EnsemblGenomes-Tr; EBT00001600745.
DR   EnsemblGenomes-Tr; EBT00001600746.
DR   EnsemblGenomes-Tr; EBT00001600747.
DR   EnsemblGenomes-Tr; EBT00001600748.
DR   EnsemblGenomes-Tr; EBT00001600749.
DR   EnsemblGenomes-Tr; EBT00001600750.
DR   EnsemblGenomes-Tr; EBT00001600751.
DR   EnsemblGenomes-Tr; EBT00001600752.
DR   EnsemblGenomes-Tr; EBT00001600753.
DR   EnsemblGenomes-Tr; EBT00001600754.
DR   EnsemblGenomes-Tr; EBT00001600755.
DR   EnsemblGenomes-Tr; EBT00001600756.
DR   EnsemblGenomes-Tr; EBT00001600757.
DR   EnsemblGenomes-Tr; EBT00001600758.
DR   EnsemblGenomes-Tr; EBT00001600759.
DR   EnsemblGenomes-Tr; EBT00001600760.
DR   EnsemblGenomes-Tr; EBT00001600761.
DR   EnsemblGenomes-Tr; EBT00001600762.
DR   EnsemblGenomes-Tr; EBT00001600763.
DR   EnsemblGenomes-Tr; EBT00001600764.
DR   EnsemblGenomes-Tr; EBT00001600765.
DR   EnsemblGenomes-Tr; EBT00001600766.
DR   EnsemblGenomes-Tr; EBT00001600767.
DR   EnsemblGenomes-Tr; EBT00001600768.
DR   EnsemblGenomes-Tr; EBT00001600769.
DR   EnsemblGenomes-Tr; EBT00001600770.
DR   EnsemblGenomes-Tr; EBT00001600771.
DR   EnsemblGenomes-Tr; EBT00001600772.
DR   EnsemblGenomes-Tr; EBT00001600773.
DR   EnsemblGenomes-Tr; EBT00001600774.
DR   EnsemblGenomes-Tr; EBT00001600775.
DR   EnsemblGenomes-Tr; EBT00001600776.
DR   EnsemblGenomes-Tr; EBT00001600777.
DR   EnsemblGenomes-Tr; EBT00001600778.
DR   EnsemblGenomes-Tr; EBT00001600779.
DR   EnsemblGenomes-Tr; EBT00001600780.
DR   EnsemblGenomes-Tr; EBT00001600781.
DR   EnsemblGenomes-Tr; EBT00001600782.
DR   EnsemblGenomes-Tr; EBT00001600783.
DR   EnsemblGenomes-Tr; EBT00001600784.
DR   EnsemblGenomes-Tr; EBT00001600785.
DR   EnsemblGenomes-Tr; EBT00001600786.
DR   EnsemblGenomes-Tr; EBT00001600787.
DR   EnsemblGenomes-Tr; EBT00001600788.
DR   EnsemblGenomes-Tr; EBT00001600789.
DR   EnsemblGenomes-Tr; EBT00001600790.
DR   EnsemblGenomes-Tr; EBT00001600791.
DR   EnsemblGenomes-Tr; EBT00001600792.
DR   EnsemblGenomes-Tr; EBT00001600793.
DR   EnsemblGenomes-Tr; EBT00001600794.
DR   EnsemblGenomes-Tr; EBT00001600795.
DR   EnsemblGenomes-Tr; EBT00001600796.
DR   EnsemblGenomes-Tr; EBT00001600797.
DR   EnsemblGenomes-Tr; EBT00001600798.
DR   EnsemblGenomes-Tr; EBT00001600799.
DR   EnsemblGenomes-Tr; EBT00001600800.
DR   EnsemblGenomes-Tr; EBT00001600801.
DR   EnsemblGenomes-Tr; EBT00001600802.
DR   EnsemblGenomes-Tr; EBT00001600803.
DR   EnsemblGenomes-Tr; EBT00001600804.
DR   EnsemblGenomes-Tr; EBT00001600805.
DR   EnsemblGenomes-Tr; EBT00001600806.
DR   EnsemblGenomes-Tr; EBT00001600807.
DR   EnsemblGenomes-Tr; EBT00001600808.
DR   EnsemblGenomes-Tr; EBT00001600809.
DR   EnsemblGenomes-Tr; EBT00001600810.
DR   EnsemblGenomes-Tr; EBT00001600811.
DR   EnsemblGenomes-Tr; EBT00001600812.
DR   EnsemblGenomes-Tr; EBT00001600813.
DR   EnsemblGenomes-Tr; EBT00001600814.
DR   EnsemblGenomes-Tr; EBT00001600815.
DR   EnsemblGenomes-Tr; EBT00001600816.
DR   EnsemblGenomes-Tr; EBT00001600817.
DR   EnsemblGenomes-Tr; EBT00001600818.
DR   EnsemblGenomes-Tr; EBT00001600819.
DR   EnsemblGenomes-Tr; EBT00001600820.
DR   EnsemblGenomes-Tr; EBT00001600821.
DR   EnsemblGenomes-Tr; EBT00001600822.
DR   EnsemblGenomes-Tr; EBT00001600823.
DR   EnsemblGenomes-Tr; EBT00001600824.
DR   EnsemblGenomes-Tr; EBT00001600825.
DR   EnsemblGenomes-Tr; EBT00001600826.
DR   EnsemblGenomes-Tr; EBT00001600827.
DR   EnsemblGenomes-Tr; EBT00001600828.
DR   EnsemblGenomes-Tr; EBT00001600829.
DR   EnsemblGenomes-Tr; EBT00001600830.
DR   EnsemblGenomes-Tr; EBT00001600831.
DR   EnsemblGenomes-Tr; EBT00001600832.
DR   EnsemblGenomes-Tr; EBT00001600833.
DR   EnsemblGenomes-Tr; EBT00001600834.
DR   EnsemblGenomes-Tr; EBT00001600835.
DR   EnsemblGenomes-Tr; EBT00001600836.
DR   EnsemblGenomes-Tr; EBT00001600837.
DR   EnsemblGenomes-Tr; EBT00001600838.
DR   EnsemblGenomes-Tr; EBT00001600840.
DR   EnsemblGenomes-Tr; EBT00001600842.
DR   EnsemblGenomes-Tr; EBT00001600843.
DR   EnsemblGenomes-Tr; EBT00001600845.
DR   EnsemblGenomes-Tr; EBT00001600847.
DR   EnsemblGenomes-Tr; EBT00001600849.
DR   EnsemblGenomes-Tr; EBT00001600852.
DR   EnsemblGenomes-Tr; EBT00001600854.
DR   EnsemblGenomes-Tr; EBT00001600856.
DR   EnsemblGenomes-Tr; EBT00001600859.
DR   EnsemblGenomes-Tr; EBT00001600861.
DR   EnsemblGenomes-Tr; EBT00001600862.
DR   EnsemblGenomes-Tr; EBT00001600864.
DR   EnsemblGenomes-Tr; EBT00001600866.
DR   EnsemblGenomes-Tr; EBT00001600868.
DR   EnsemblGenomes-Tr; EBT00001600870.
DR   EnsemblGenomes-Tr; EBT00001600872.
DR   EnsemblGenomes-Tr; EBT00001600874.
DR   EnsemblGenomes-Tr; EBT00001600876.
DR   EnsemblGenomes-Tr; EBT00001600877.
DR   EnsemblGenomes-Tr; EBT00001600879.
DR   EnsemblGenomes-Tr; EBT00001600882.
DR   EnsemblGenomes-Tr; EBT00001600884.
DR   EnsemblGenomes-Tr; EBT00001600886.
DR   EnsemblGenomes-Tr; EBT00001600888.
DR   EnsemblGenomes-Tr; EBT00001600890.
DR   EnsemblGenomes-Tr; EBT00001600893.
DR   EnsemblGenomes-Tr; EBT00001600895.
DR   EnsemblGenomes-Tr; EBT00001600897.
DR   EnsemblGenomes-Tr; EBT00001600899.
DR   EnsemblGenomes-Tr; EBT00001600901.
DR   EnsemblGenomes-Tr; EBT00001600903.
DR   EnsemblGenomes-Tr; EBT00001600905.
DR   EnsemblGenomes-Tr; EBT00001600906.
DR   EnsemblGenomes-Tr; EBT00001600908.
DR   EnsemblGenomes-Tr; EBT00001600910.
DR   EnsemblGenomes-Tr; EBT00001600913.
DR   EnsemblGenomes-Tr; EBT00001600915.
DR   EnsemblGenomes-Tr; EBT00001600917.
DR   EnsemblGenomes-Tr; EBT00001600920.
DR   EnsemblGenomes-Tr; EBT00001600921.
DR   EnsemblGenomes-Tr; EBT00001600923.
DR   EnsemblGenomes-Tr; EBT00001600925.
DR   EnsemblGenomes-Tr; EBT00001600927.
DR   EnsemblGenomes-Tr; EBT00001600929.
DR   EnsemblGenomes-Tr; EBT00001600930.
DR   EnsemblGenomes-Tr; EBT00001600933.
DR   EnsemblGenomes-Tr; EBT00001600935.
DR   EnsemblGenomes-Tr; EBT00001600937.
DR   EnsemblGenomes-Tr; EBT00001600940.
DR   EnsemblGenomes-Tr; EBT00001600942.
DR   EnsemblGenomes-Tr; EBT00001600944.
DR   EnsemblGenomes-Tr; EBT00001600946.
DR   EnsemblGenomes-Tr; EBT00001600948.
DR   EnsemblGenomes-Tr; EBT00001600950.
DR   EnsemblGenomes-Tr; EBT00001600952.
DR   EnsemblGenomes-Tr; EBT00001600955.
DR   EnsemblGenomes-Tr; EBT00001600957.
DR   EnsemblGenomes-Tr; EBT00001600959.
DR   EnsemblGenomes-Tr; EBT00001600961.
DR   EnsemblGenomes-Tr; EBT00001600962.
DR   EnsemblGenomes-Tr; EBT00001600965.
DR   EnsemblGenomes-Tr; EBT00001600967.
DR   EnsemblGenomes-Tr; EBT00001600969.
DR   EnsemblGenomes-Tr; EBT00001600971.
DR   EnsemblGenomes-Tr; EBT00001600974.
DR   EnsemblGenomes-Tr; EBT00001600976.
DR   EnsemblGenomes-Tr; EBT00001600978.
DR   EnsemblGenomes-Tr; EBT00001600980.
DR   EnsemblGenomes-Tr; EBT00001600982.
DR   EnsemblGenomes-Tr; EBT00001600984.
DR   EnsemblGenomes-Tr; EBT00001600986.
DR   EnsemblGenomes-Tr; EBT00001600988.
DR   EnsemblGenomes-Tr; EBT00001600990.
DR   EnsemblGenomes-Tr; EBT00001600993.
DR   EnsemblGenomes-Tr; EBT00001600995.
DR   EnsemblGenomes-Tr; EBT00001600996.
DR   EnsemblGenomes-Tr; EBT00001600998.
DR   EnsemblGenomes-Tr; EBT00001601001.
DR   EnsemblGenomes-Tr; EBT00001601003.
DR   EnsemblGenomes-Tr; EBT00001601005.
DR   EnsemblGenomes-Tr; EBT00001601007.
DR   EnsemblGenomes-Tr; EBT00001601009.
DR   EnsemblGenomes-Tr; EBT00001601010.
DR   EnsemblGenomes-Tr; EBT00001601013.
DR   EnsemblGenomes-Tr; Sputcn32_R0001-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0002-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0003-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0004-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0005-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0006-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0007-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0008-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0009-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0010-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0011-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0012-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0013-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0014-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0015-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0016-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0018-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0019-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0020-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0021-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0022-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0023-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0024-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0025-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0026-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0027-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0028-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0030-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0031-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0032-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0033-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0034-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0035-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0036-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0037-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0038-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0039-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0040-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0041-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0042-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0043-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0044-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0045-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0046-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0047-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0048-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0049-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0050-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0051-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0052-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0053-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0054-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0055-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0056-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0057-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0058-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0059-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0060-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0061-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0062-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0063-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0064-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0065-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0066-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0067-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0068-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0069-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0070-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0071-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0072-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0073-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0074-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0075-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0076-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0077-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0078-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0079-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0080-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0081-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0082-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0083-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0084-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0085-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0086-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0087-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0088-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0089-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0090-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0091-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0092-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0093-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0094-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0095-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0096-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0097-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0098-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0099-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0100-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0101-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0102-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0103-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0104-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0105-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0106-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0107-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0108-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0109-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0110-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0111-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0112-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0113-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0114-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0115-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0116-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0117-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0118-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0119-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0121-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0122-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0123-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0124-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0125-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0126-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0127-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0128-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0129-1.
DR   EnsemblGenomes-Tr; Sputcn32_R0130-1.
DR   EuropePMC; PMC2944568; 20679508.
DR   EuropePMC; PMC3480492; 23110226.
DR   EuropePMC; PMC3807263; 23759724.
DR   EuropePMC; PMC5574774; 28904412.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00208; snoR72.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; CP000681.
DR   SILVA-SSU; CP000681.
DR   StrainInfo; 493665; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634498
CC   Source DNA and bacteria available from Jim Fredrickson
CC   (Jim.fredrickson@pnl.gov)
CC   Contacts: Shewanella Federation (shewanella.org)
CC             James Tiedje (tiedjej@msu.edu)
CC             Jim Fredrickson (Jim.fredrickson@pnl.gov)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376)
CC   Additional Notes: This genome contains a Tandem repeat. The repeat
CC   unit is 552 bps in length.  Each copy of the repeat unit differs by
CC   3 SNPs. We have resolved this tandem making the assumption that
CC   there are 14 copies.  However, it is unresolved on the number of
CC   copies. The tandem is located from 4171003-4178703.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4659220
FT                   /organism="Shewanella putrefaciens CN-32"
FT                   /strain="CN-32"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:319224"
FT   gene            147..1532
FT                   /locus_tag="Sputcn32_0001"
FT   CDS_pept        147..1532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: shm:Shewmr7_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73737"
FT                   /db_xref="GOA:A4Y1A4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1A4"
FT                   /protein_id="ABP73737.1"
FT                   /translation="MAVSLWQQCIGRLQDELPAQQFSMWIRPLQAEMDGDTLVLYAPNR
FT                   FVLDWVREKYINIINQFFTEQMGSDAPKLRFDIGSRPSAKKFEPAPVATVRAPNTQTKA
FT                   TVGTYFNTQAEPIANANHRSNINPTYQFDNFVEGKSNQLGKAAALQVAENPGGAYNPLF
FT                   LYGGTGLGKTHLLHAVGNGIIKNNPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRS
FT                   VDALFIDDIQFFANKDRSQEEFFHTFNALLEGNHQIILTSDRYPKEIDGVEDRLKSRFG
FT                   WGLTVAIEPPELETRVAILMRKAQESGINLPDEVAFFIAKRLRSNVRELEGALNRVIAN
FT                   ANFTGRPITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKMADMLSKRRSRSVAR
FT                   PRQVAMALSKELTNQSLPEIGDAFGGRDHTTVLHACRKIAQLREESHDIKEDYANLIRT
FT                   LSS"
FT   gene            1553..2653
FT                   /locus_tag="Sputcn32_0002"
FT   CDS_pept        1553..2653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: shm:Shewmr7_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73738"
FT                   /db_xref="GOA:A4Y1A5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1A5"
FT                   /protein_id="ABP73738.1"
FT                   /translation="MKFSIDRDALLKPLQLVCGAVERRHNLPILSNLLVEVSGHSLKLT
FT                   GTDLEVELVGQAVVHGDIEEGRTTVPAKKLLDIVKSLPEQSELKVEQQDNKWLLRSGRS
FT                   RFSLATLPAEEYPNVEAFQAEIEFSLKQGVLKSIIDSTQFSMANQDVRYYLNGLLFETE
FT                   GNMLRAIATDGHRLALSHRVIDAQLPEKQVIVPRKGVMEMARLLESDDLDIAIAIGDNA
FT                   IRATTANTVFTSKLVDGRFPDYRRVLPKGGDKIVIASRNHLKQALTRASILSNEKFRGV
FT                   RIQLENGLLKITANNPEQEEAEEIIDVDYNNQSLEIGFNVSYLLDVLNNLKSDDVRITL
FT                   IDGNSSALIENHLEEDSMYVVMPMRL"
FT   gene            2850..3932
FT                   /locus_tag="Sputcn32_0003"
FT   CDS_pept        2850..3932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: shm:Shewmr7_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73739"
FT                   /db_xref="GOA:A4Y1A6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1A6"
FT                   /protein_id="ABP73739.1"
FT                   /translation="MSLTRLNIEAFRNIQFAQLIPAPGINVIYGQNGSGKTSILEAIYF
FT                   LGMGRSFRSHLSQRVINNDNDKLTLFATLNLARGDSKIGLRRFRSGETEVKIDGEKVKR
FT                   LSTLAETLPIQVITPESFSLLFEGPKSRRQFIDWGAFHADPQFYGAWTNVRRVIKQRNQ
FT                   LLRNGAVYTHIQFWDQEFVRYAEQVTEIRNHYVDSLNGLLKGIIGEFLPSVDVKVSFTR
FT                   GWDSKTDFAELLENQYSRDLATGHTVSGPHKADLRLRVGNLPAQDALSRGQLKLLVCAL
FT                   RIAQGKLLKQQIDKHSIYLVDDLPSELDAQHRQLLLKQLTDTGAQVFVTAIDPAAIVDS
FT                   LHTPPNRMFHVEQGRVTVVE"
FT   gene            3949..6366
FT                   /locus_tag="Sputcn32_0004"
FT   CDS_pept        3949..6366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: son:SO0011 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73740"
FT                   /db_xref="GOA:A4Y1A7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1A7"
FT                   /protein_id="ABP73740.1"
FT                   /translation="MSENSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
FT                   DNSIDEALAGHCSDITITIHVDGSVSVKDDGRGIPVAIHEEEGVSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSRKLQMTIRRAGKVYEQFYTHGVPDAPIKEIGDATK
FT                   TGTEIRFWPSEDTFSDVEFHFEILAKRVRELSFLNSGVGIRLIDERDNKNEFFKYEGGI
FT                   SAFVDYLNRNKTPVNKEVFHFMQERDDGITVEVAMQWNDGYQENIFCFTNNIPQRDGGT
FT                   HLVGFRSALTRNLNNYMENEGYNKKGKTNATGDDAREGLTAVISVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVEQTMGEKLNDYLLENPADAKLIVGKIVDAARAREAARKAREMTRRKGAL
FT                   DLGGLPGKLADCQEKDPGLSEIYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYNPDKTRYHNIIIMTDADVDGSHIRTLLLTFFFR
FT                   QMPELIERGYVYIAQPPLFKVKKGKQEQYLKDEPALTQYLTTQALDGTVVYPTQGAPGM
FT                   SGEPLERLVTQYREVEAIVARLEQRYPTHITNRMLYHPMITNEMLADEGKMKEWIDAFI
FT                   HELVEMESSGVLYSAEPILDPERKVYLPKITIRKHGIDTNYLFTYDFFQSSDYQRIGKL
FT                   GAALDGMIEEGGYVQRGERVKEVGSFLEALDWTISEAKRGLYIQRYKGLGEMNPEQLWE
FT                   TTMDPESRRMLQVTIDDAVGADQLFTCLMGDQVEPRREFIEANALNVANLDV"
FT   gene            6568..7614
FT                   /locus_tag="Sputcn32_0005"
FT   CDS_pept        6568..7614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0005"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: HDOD; KEGG: shm:Shewmr7_0007 putative signal
FT                   transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73741"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1A8"
FT                   /protein_id="ABP73741.1"
FT                   /translation="MIKSIFNKLFNLRENNPIERPKSFSATDLGKPLAISPKNITQQES
FT                   ISANVVYVDLSALFYSLLFPARVNDAGGIANNLERRVMAEIEHALASPQVIAEKVLKLP
FT                   SKVLELDRKLADPQFDIKALLALIERDPLLSVEVLKLCNSPAFKRSDRDITNLQQALVQ
FT                   LGREQLRKFVTTCLVREMLDIKPIYFRRFGAEIWRHSMQVAFLASELSDEDQDTAFLLG
FT                   LLHDVGKLAIFKMLLDAFVQAEPGEQPNSGLFRQVMTTKSLTLSSLLAKHWQLPNTFET
FT                   ELDRLASVNSRPQAGLAAVVWRANVISEISMLHQAGQLSPEILANLLQQVNLEQTQFDG
FT                   LHQKLLQF"
FT   gene            complement(7702..9771)
FT                   /locus_tag="Sputcn32_0006"
FT   CDS_pept        complement(7702..9771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0006"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: she:Shewmr4_0008 glycyl-tRNA synthetase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73742"
FT                   /db_xref="GOA:A4Y1A9"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1A9"
FT                   /protein_id="ABP73742.1"
FT                   /translation="MNFENLLIELGTEELPPKSLRKLAESFLANFTEELTKADLAFSSA
FT                   VWYAAPRRLAINVTELALAQADKVVEKRGPAVSSAFDAEGKPTKAAEGWARGNGITVEQ
FT                   AERLVTDKGEWLVHNAKVEGVETKSLIAAMAQRALDKLPIPKPMRWGNNKTQFIRPVHT
FT                   ATILLGSELIEGELLGIKSARTVRGHRFMGLKQFELAHADHYLADLKEKGKVIADYESR
FT                   KALIKADAEKAAAKIGGTADIEDSLLEEVASLVEWPVVLTASFEEKFLSVPSEALVYTM
FT                   KGDQKYFPVFDNAGKLLPNFIFVANIESKDPAQIISGNEKVVRPRLADAEFFFNTDKKH
FT                   TLESRLPSLETVLFQQQLGTLKDKVNRISALAAFIAEQTGANAVDAARAGLLSKTDLMT
FT                   NMVMEFTDTQGTMGMHYARLDGETEAVAVAMEEQYKPKFSGDTVPSAGVSCAVALADKL
FT                   DTLVGIFGIGQAPKGAADPFALRRAAIGVLRIIVENKLPLDLVTLIAKAQELHGTHLSN
FT                   ANASDEVLEFLMARFRAWYQDKGIGVDVILAVLARRPTRPADFDSRINAVSHFRSLEAS
FT                   GALAAANKRVSNILAKVEGALPTTIDASLLTEAAEQALAAKLNELQPQLAPLFANADYQ
FT                   QALTLLAGLRESVDQFFEDVMVMADDEALKNNRLALLNNLREQFLHVADISLLQ"
FT   gene            complement(9782..10687)
FT                   /locus_tag="Sputcn32_0007"
FT   CDS_pept        complement(9782..10687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0007"
FT                   /product="Glycine--tRNA ligase"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   shm:Shewmr7_0009 glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73743"
FT                   /db_xref="GOA:A4Y1B0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1B0"
FT                   /protein_id="ABP73743.1"
FT                   /translation="MTTKHDVKTFQGFILTLQEYWAQQGCAIVQPLDMEVGAGTFHPQT
FT                   FLRSLGPEPMSSAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDNIQELYLGSLQ
FT                   ALGIDTQIHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECSPVTGE
FT                   ITYGLERLAMYIQGVDSVYDLVWTDGPMGRITYGDVFHQNEVEQSTYNFEHADVDFMFA
FT                   LFDQCEKMCQHLLSLEKPLPLPAYEQVMKASHAFNLLDARHAISVTERQRYILRVRTMA
FT                   KAVAESYYQAREALGFPMCK"
FT   gene            10805..11401
FT                   /locus_tag="Sputcn32_0008"
FT   CDS_pept        10805..11401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0008"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: shm:Shewmr7_0010 DNA-3-methyladenine
FT                   glycosylase I; TIGRFAM: DNA-3-methyladenine glycosylase I;
FT                   PFAM: methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73744"
FT                   /db_xref="GOA:A4Y1B1"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1B1"
FT                   /protein_id="ABP73744.1"
FT                   /translation="MEEIRCGWVSDDPLYREYHDKVWGRPVYDPKELFAKLCLDGQQAG
FT                   LSWITILKKQQNYEQAFANFEPEIIATFDEAKVEELMLNPGIVRNRLKVNSIIKNAKGY
FT                   LAYTADGKDFSAFLWSFVGGKPIVNQITAMSQVPAQTPESEAMSKALKKLGFNFVGPTI
FT                   CYAFMQAVGMVNDHLVECIAYQACVDSCAGLHNHE"
FT   gene            complement(11525..14713)
FT                   /locus_tag="Sputcn32_0009"
FT   CDS_pept        complement(11525..14713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0009"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: peptidase S9B, dipeptidylpeptidase IV domain
FT                   protein; amidohydrolase; WD40 domain protein beta
FT                   Propeller; KEGG: she:Shewmr4_0011 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73745"
FT                   /db_xref="GOA:A4Y1B2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1B2"
FT                   /protein_id="ABP73745.1"
FT                   /translation="MLNAKLTPLYIALILGMNTFTVNATETKESTWHVNAPANAPLEQV
FT                   KVDVNEGTWMNLSVSPDGKHIVFDLLGDIYQIPVTGGEAKPLAQGIAWQMQPVYSPDGK
FT                   HIAFTSDGDGGDNIWIMDADGKKPRTVTKETFRLLNSPAWSPDSQYLVARKHFTASRSL
FT                   GAGEVWLYHVTGGEGVKLTERPNDEKDLGEPAYSPDGRYIYFSQDDTPGKTFHYSKDSV
FT                   NGIYKIKRYDTQTGEIEILIEGTGGAIRPTPSPDGTKLAYIKRDDFQSSLYLLDLKSGE
FT                   TTKLFGELDRDMQETWAIHGVYPTMAWTQDSKDIFFWAKGKINRLNVANKTLTDIPFSV
FT                   KTELAVQPSVRFKQDIDKDVFDVKMLRMAQVSPDGSKVTFEALGKIWLKSLPDGKMSRL
FT                   TELDKNIAELYPQWSRDGKNIVFTTWNDQDQGTVQVISAKGGKPKQLTSEPGKYVEPTF
FT                   SPNGELVVYRKTQGGNLTPRTWSQEPGLYKADLKTKQNKKISSDGYQAQFGANADRVFF
FT                   MNSSEDETPQLSSINLDGFDKRVHYSSKHATEFRVSPDGEQLAFAERFKVWVTPFAKHG
FT                   ETVEIGPNASNLPVSQLSARAGESISWNSKSDQLYWTLGPELYQAKVDTQYRNKDEKAQ
FT                   PSIIDLGFTEKADVPRGTIAFVGGKVITMENDQVIDNGVVIVKDNHIVAVGDANVAIPK
FT                   DAQIINIKGKSIMPGLFDAHAHGPQADDEIVPQQNWALYSGLSLGVTTIHDPSNDTTEI
FT                   FAASEQQKAGNIVGPRIFSTGTILYGANAPGYTSHIDSLDDAKFHLERLKKVGAFSVKS
FT                   YNQPRRNQRQQVIAAARELEMMVVPEGGSLLQHNLSMIADGHTTVEHSLPVGSIYNDIK
FT                   QFWSQTQVGYTPTLVVAYGGISGENYWYDKTDVWAHPRLSMYVPADILQARSMRRPHAP
FT                   ESHYNHFNVANVANELNKLGVHPNIGAHGQREGLAAHWEMWMFAQGGMSNMEVLKTATI
FT                   NPATTFGLEHQLGSIKEGKLADLIVIDGDPLADIRVTDRVTYTMVNGKLFNAETMNKLN
FT                   GDKAQRKPFFFEKI"
FT   sig_peptide     complement(14639..14713)
FT                   /locus_tag="Sputcn32_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.957 at
FT                   residue 25"
FT   gene            complement(14935..15387)
FT                   /locus_tag="Sputcn32_0010"
FT   CDS_pept        complement(14935..15387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73746"
FT                   /db_xref="GOA:A4Y1B3"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1B3"
FT                   /protein_id="ABP73746.1"
FT                   /translation="MPKLLGIAYKTVKNGLMNEVLYANVTQLSGVEKDIFGRPGKRQVT
FT                   VLSKQQWLIACQSINVDLPWTTRRANLFVDGLVFSSADVGKHLQIGELLLEITGETDPC
FT                   KKMEVAHIGLEAALSPDWRGGVTCRVIVGAMIHQGDTVTLVTESLS"
FT   gene            complement(15432..15677)
FT                   /locus_tag="Sputcn32_0011"
FT   CDS_pept        complement(15432..15677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0011"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: shm:Shewmr7_0013
FT                   SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73747"
FT                   /db_xref="GOA:A4Y1B4"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1B4"
FT                   /protein_id="ABP73747.1"
FT                   /translation="MNDAFSNAQHKLDALGLRCPEPVMMVRKTVRQMAAGETLLIIADD
FT                   PATTRDIPSFCEFMDHTLIASETAQTPYQYLIKKGL"
FT   gene            complement(15908..17071)
FT                   /locus_tag="Sputcn32_0012"
FT   CDS_pept        complement(15908..17071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0012"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: son:SO0020 fatty oxidation complex, beta
FT                   subunit; TIGRFAM: acetyl-CoA acetyltransferases; acetyl-CoA
FT                   C-acyltransferase FadA; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73748"
FT                   /db_xref="GOA:A4Y1B5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1B5"
FT                   /protein_id="ABP73748.1"
FT                   /translation="MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKGLLLRNPQL
FT                   DPNLIEDVIWGCVQQTLEQGFNIARNASLLAGIPKTAGAVTVNRLCGSSMDAIHQAARA
FT                   IMTGMGDTFIIGGVEHMGHVPMSHGVDFHPGLANNVAKASGMMGLTAEMLGKLHGITRE
FT                   QQDAFAVRSHQRAYAATVEGRFAKEIYGIEGHDANGALIKVLQDEVIRPETTMESLAAL
FT                   RPVFDPVNGTVTAGTSSALSDGASAMLIMEESKARALGLPIRARIRSMAVAGCDAAIMG
FT                   YGPVPATQKALARAGITVADLDVIELNEAFAAQSLPCVKDLGLADVVDDKINLNGGAIA
FT                   LGHPLGCSGARISTTLINLMEDKDATLGLATMCIGLGQGIATVFERV"
FT   gene            complement(17094..19244)
FT                   /locus_tag="Sputcn32_0013"
FT   CDS_pept        complement(17094..19244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0013"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase / short chain
FT                   enoyl-CoA hydratase"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="4.2.1.17"
FT                   /note="TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   she:Shewmr4_0018 fatty oxidation complex, alpha subunit
FT                   FadB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73749"
FT                   /db_xref="GOA:A4Y1B6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1B6"
FT                   /protein_id="ABP73749.1"
FT                   /translation="MIYQSPTIQVELLEDNIAKLCFNAPGSVNKFDRETLASLDAALDS
FT                   IKQNSNIKALVLTSSKDTFIVGADITEFLGLFAQDDAVLLSWVEQANAVFNKLEDLPFP
FT                   TASAIKGFALGGGCETILATDFRIADTTAKIGLPETKLGIIPGFGGTVRLPRVIGADNA
FT                   LEWISTGNDQRAEDALKVGAVDAVVAPEALEAAAIQMLKDAVAEKLDWQARRNRKLSAL
FT                   TLPKLEAMMSFTTAKGMVFAVAGKHYPAPMAAVSVIEQASTKGRAEALQIEHQAFIKLA
FT                   KTDVAKALIGIFLNDQLVKGKAKKAGKLAKEVKNAAVLGAGIMGGGIAYQSASKGTPIV
FT                   MKDIAQPALDLGLNEAAKLLSAQVARGRSTPEKMAKVLNNITPSLDYAALKHSDVVVEA
FT                   VVEHPKIKAQVLAEVEGYVSEDAIIASNTSTISINLLAKSMKKPERFCGMHFFNPVHKM
FT                   PLVEVIRGEHSSEETIASVVAYASKMGKTPIVVNDCPGFFVNRVLFPYFAGFNGLLAEG
FT                   GDFAAIDKVMEKQFGWPMGPAYLLDVVGLDTGHHAQAVMAEGFPDRMGKSGTDAIDVMF
FT                   ENKRLGQKNGKGFYVYSVDSRGKPKKDVDPTSYGLLKDAFGELKTFEADDIIARTMIPM
FT                   IIETVRCLEEGIVASPAEADMGLVYGLGFPPFRGGVFRYLDTMGVANFVALADKYAHLG
FT                   GLYQVTDAMRTKATNNGSYYQA"
FT   gene            19735..21057
FT                   /locus_tag="Sputcn32_0014"
FT   CDS_pept        19735..21057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0014"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /EC_number="3.4.13.9"
FT                   /note="PFAM: peptidase M24; KEGG: shm:Shewmr7_0017 Xaa-Pro
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73750"
FT                   /db_xref="GOA:A4Y1B7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1B7"
FT                   /protein_id="ABP73750.1"
FT                   /translation="MDQLAHHYRAHIAELNRRVAEILSREALSGLVIHSGQPHRMFLDD
FT                   INYPFKANPHFKAWLPVLDNPNCWLVVNGRDKPQLIFYRPVDFWHKVSDVPDMFWTEHF
FT                   DIKLLTKADKVAELLPKDTVNWAYLGEHLDVAEVLGFTSRNPDAVMSYLHYHRTTKTEY
FT                   ELECMRRANQIAVQGHLAAKNAFYNGASEFEIQQHYLSAVGQSENEVPYGNIIALNQNA
FT                   AILHYTALEHQSPAKRLSFLIDAGASYFGYASDITRTYAFEKNRFDELIAAMNKAQLEL
FT                   IDMMRPGVRYPDLHLATHAKVAQMLLDFDLATGDAQGLVDQGITSAFFPHGLGHMLGLQ
FT                   VHDVGGFSHDERGTHIAAPEAHPFLRCTRILAPNQVLTMEPGLYIIDTLLNELKQDSRG
FT                   LQINWQTVDELRPFGGIRIEDNVIVHQDRNENMTRELGLAD"
FT   gene            21085..21699
FT                   /locus_tag="Sputcn32_0015"
FT   CDS_pept        21085..21699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0015"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   shm:Shewmr7_0018 protein of unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73751"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1B8"
FT                   /protein_id="ABP73751.1"
FT                   /translation="MLDSYLIPSENIQIEEEIKHSRFISFIFHCDSIDKLKLVLTDIKR
FT                   DYPGASHYCYAFIAGAPIDTVLIGSSDDGEPAGSAGRPMLAVLQGANIGEVAAVVVRYY
FT                   GGTKLGVGGLVRAYTSGLRLGLTKLSMQTKQLRYPARLQCDYSQLRDVEYSLQQVDAVM
FT                   INKQFAEVVYIEFEIGKLQQERFSELLMTLSQGSLSAEFEL"
FT   gene            21777..23234
FT                   /locus_tag="Sputcn32_0016"
FT   CDS_pept        21777..23234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0016"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: she:Shewmr4_0021 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73752"
FT                   /db_xref="GOA:A4Y1B9"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1B9"
FT                   /protein_id="ABP73752.1"
FT                   /translation="MQYKTIIRIIGLLIGLFSITMLPPALIAIWYNDGGGTAFIQAFFV
FT                   SLFIGFWLWYPNRRCKEELRTREGFLIVVLFWTVLGSIGSLPFIFSNQPDLSWTDSFFE
FT                   SFSALTTTGATVIVGLDSLPKAILFYRHMLQWLGGMGIIVLAVAILPVLGVGGMQLYRA
FT                   EIPGPVKDSKMTPRIAETAKALWYIYLLLTISCAGAYWLAGMSIFDAICHSFSTIAIGG
FT                   FSTHDASMGYFDSPVINLICVFFLIVSAVNFSVHFAAFSRRGINVKVYFKDTEFKMLVA
FT                   IQLILTAICFLTLYHSGIYESPEETLDQALFQAVSVATTAGFGTDSFHMWPLFLPMLLI
FT                   FSSFIGGCGGSTAGGIKVIRVILLLLQGSRELKRLVHPKAMFSIRIGSKALPDRVVDAV
FT                   WGFFSAYALVFVICMLALMAMGLDDITAFSATAACLNNLGPGLGEVASNYASIGDGAKW
FT                   VLVVAMLFGRLEVFTLLILFTPTFWKN"
FT   sig_peptide     21777..21863
FT                   /locus_tag="Sputcn32_0016"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.771) with cleavage site probability 0.769 at
FT                   residue 29"
FT   gene            23237..23761
FT                   /locus_tag="Sputcn32_0017"
FT   CDS_pept        23237..23761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0017"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: shm:Shewmr7_0020 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73753"
FT                   /db_xref="GOA:A4Y1C0"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1C0"
FT                   /protein_id="ABP73753.1"
FT                   /translation="MQTLIIYSTIDGQTLAICQKIKLFAEQAGENVSLVTLEQAEALSL
FT                   ADFDKVLIGASIRYGKYRPELYQFVNRHHAVLDTKINGFFSVNVVARKPLKNTPETNPY
FT                   MQKFLKLSLWQPQHLAVFAGKIDYPKYSFFDRTMIRFIMWMTKGPTDINGTFEFTDWAK
FT                   VDAFGTDFSHQ"
FT   gene            complement(23811..24119)
FT                   /locus_tag="Sputcn32_0018"
FT   CDS_pept        complement(23811..24119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0018"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG:
FT                   shm:Shewmr7_0021 transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73754"
FT                   /db_xref="GOA:A4Y1C1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1C1"
FT                   /protein_id="ABP73754.1"
FT                   /translation="MQNDIDVDAMVTNAESAAKWLKAIANPYRLMILCLLLDKELSVTE
FT                   LNATVPLSQSALSQHLAVLRAEDLVDTRKSSQIVYYKLKNEQVTQVISILHNRYCAG"
FT   gene            24322..24876
FT                   /locus_tag="Sputcn32_0019"
FT   CDS_pept        24322..24876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0019"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: she:Shewmr4_0024 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73755"
FT                   /db_xref="GOA:A4Y1C2"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1C2"
FT                   /protein_id="ABP73755.1"
FT                   /translation="MIRVLVLYFTRGGHTAKIASAIADQLKNRGAQVDLVDINSAAATR
FT                   INWPDYQVVALGACVLYGTYDKTVFQFIEQHNQALSALPNSFFCVNVVARNPEKRIPEN
FT                   NKYLQKFIALSPWTPADLKIIAGKVDYPSWPWYDRLAIQLIMKMTKGPTDPKSVIDYTD
FT                   WEDVKIYADHLLDLTEVTATT"
FT   gene            complement(24916..26358)
FT                   /locus_tag="Sputcn32_0020"
FT   CDS_pept        complement(24916..26358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0020"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: she:Shewmr4_0025 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73756"
FT                   /db_xref="GOA:A4Y1C3"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1C3"
FT                   /protein_id="ABP73756.1"
FT                   /translation="MLNFRPLLFILGLFLSMLTAFMFIPLLLAAFSGEETVGSFMVSAL
FT                   ATGICASLCLHNGQSKTIHLNIRDMFLLTSLTWLIVSLFAAMPFTLYHGIGYTDAFFET
FT                   MSGITTTGSTVLSGLDTMDHSILIWRSLLQWLGGIGFIVMAVAILPFLNVGGMRLFRTE
FT                   SSDWSDKAVPRTQNMAKHLFFIYILLTIVCCVAYHLAGMTWFQAINHAMTTISTGGYST
FT                   SDSSMAAFSNSAHWVGIVFMAAGGLPLLLFVHTIQQRNLHIWNDAQVRGFLFFLTFVSC
FT                   SIGFWLWQTRDIALSDALRLSSFNVVSVVTTTGYGLTDYGSWGAFANIAFLFLMFVGGC
FT                   SGSTSGGIKIFRFQIAGAIMREQLKQQCHPNGLFRERYNNRIISEDIVRSLITFVLLFM
FT                   LVIVGLSVILVLTGLDPMTSFTGAITAVTNVGPGLGPIIGPAGNFSTLPDVAKWALALG
FT                   MLLGRLEILTVAVLFHPSFWKY"
FT   sig_peptide     complement(26260..26358)
FT                   /locus_tag="Sputcn32_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.506 at
FT                   residue 33"
FT   gene            complement(26379..27788)
FT                   /locus_tag="Sputcn32_0021"
FT   CDS_pept        complement(26379..27788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0021"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: shm:Shewmr7_0024 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73757"
FT                   /db_xref="GOA:A4Y1C4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1C4"
FT                   /protein_id="ABP73757.1"
FT                   /translation="MKIIILGAGQVGGTLAENLVGENNDITIVDSDRSKLRALQDKYDL
FT                   RVVAGHGAHPDVLKEAGAEDADMLIAVTNSDECNMAACQIAYSLFGTPTKIARIRSEPY
FT                   LAMRDKLFIDSETKNSDGRPRGGFVIDELIAPEQLVTAYIQRLVEYPGALQVLEFAEGK
FT                   LSLVAVRAYYGGPLVGNALAALREHMPNIDTRVAAIFRQGRPIMPRGTTIIEADDEVFF
FT                   VADSRHIRAVMSEMQKLDNTYRNIMIAGGGNIGLGLAKRLERTHSVKLIEHKFERAESL
FT                   SEQLENTTVFCGDASDQELLLEEHIDQTDVFIAVTNDDEANIMSALLAKRMGAKKVMVL
FT                   IQREAYVDIVQEANIDIAISPQQATISALLTHIRQGDICNVYSLRRGAAEAIEAIAHGD
FT                   SNTSKVVGKAIGDIKLPPGTTIGAIVRNDEVLMAHDKTVIEQGDHVILFLVNKKFVGEV
FT                   EKLFQPSAFFF"
FT   gene            complement(27804..29093)
FT                   /locus_tag="Sputcn32_0022"
FT   CDS_pept        complement(27804..29093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0022"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: she:Shewmr4_0027 sun
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73758"
FT                   /db_xref="GOA:A4Y1C5"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1C5"
FT                   /protein_id="ABP73758.1"
FT                   /translation="MNLRALAAKAIFEVLEKGVSLSVALPEQQKHLASGKDKALLAELC
FT                   YGVMRTLPQIEKRISECLEKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAEACR
FT                   QLKFEGMVKVVNGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDIIQQS
FT                   HERPPMWLRNNRLSQSRTEYLAALAELDIEASEGSSADAILLAHPKDVATLPRFHEGAA
FT                   SVQDGAAQWAATLLAPQANELILDACAAPGGKSCHLLEVEPNIKLVAVDFDAKRLERVQ
FT                   QNLDRLSLKAELIHGDAANIGSWWQGGLFDRILLDAPCSATGVIRRHPDIKWLRKNHDI
FT                   EELAELQQQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLDRTVDAKLDILAQQN
FT                   SPQDIGWQITPGQDNMDGFYYARLLKATHK"
FT   gene            complement(29096..30052)
FT                   /locus_tag="Sputcn32_0023"
FT   CDS_pept        complement(29096..30052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0023"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: shm:Shewmr7_0026
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73759"
FT                   /db_xref="GOA:A4Y1C6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1C6"
FT                   /protein_id="ABP73759.1"
FT                   /translation="MKSLNIIFAGTPDFAARHLQALLNSQHNVIGVYTQPDRPAGRGKK
FT                   LTASPVKELAIANNIPVFQPGSLRKEPAQQELAALNADIMVVVAYGLILPKVVLDTPRL
FT                   GCINVHGSILPRWRGAAPIQRALWAGDKETGVTIMQMDVGLDTGDMLLKTYLPIEDNDT
FT                   SASLYEKLAEQGPIALLQALEGLTNGTLAAEKQDEALANYAEKLSKEEARLDWNKSAKQ
FT                   LWQEVRAFNPWPVSYFEHQGNTIKVWQAHVSETISTAAPGTIISASKKGIEVATADGVL
FT                   TLLSMQLPGKNPLNVADILNARGEWFSPNTRLANEAE"
FT   gene            complement(30062..30574)
FT                   /locus_tag="Sputcn32_0024"
FT   CDS_pept        complement(30062..30574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0024"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: shm:Shewmr7_0027 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73760"
FT                   /db_xref="GOA:A4Y1C7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1C7"
FT                   /protein_id="ABP73760.1"
FT                   /translation="MALLNVLRFPDERLRIQAKPITEFDAELQTQIDNMFETMYQEKGI
FT                   GLAATQVDYHKQLIVMDLQDEVERPKVFINPEIISSSGDFCNEEGCLSVPGIYAKVDRA
FT                   EFVTVKALDRNGCEFIVEADELFAICIQHEMDHLKGKLFVDYLSPLKRQRIKQKLEKAA
FT                   RLDAKEA"
FT   gene            30700..31824
FT                   /locus_tag="Sputcn32_0025"
FT   CDS_pept        30700..31824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0025"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   shm:Shewmr7_0028 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73761"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1C8"
FT                   /protein_id="ABP73761.1"
FT                   /translation="MDHTMKRLILLVLMTFSCTFVSADTLTLKAGYPESYVVKKGDTLW
FT                   DIATTFLNDPWKWPRLWDVNPQIANPHLIYPGDQLTLIFIDGQPRLVRDSSSAGKPFVK
FT                   KSPEGRIIAKSDAVPAIDLALIKNYLVQNRVVDSNWFSEQPMILAGESPSRHHIIGDVV
FT                   YINNILPLHQKYGVYESGRAFFNKESGEALGQEAILVSTGQVIESGNVSKIKLLSSFRE
FT                   TKAGFKVLPMEDDSLMSAYFTPKPAQLVNHASVLATESAMREAGKLNVVYLDKGTQDGV
FT                   EPGNVFSIYRDGEEIVINHDGSPVPALERTAYDNIIASVSSERSIKMPDVYHGKLMVFK
FT                   VFDKVSLGLIVSTERPVRVDDKLISPDYLAFRGQ"
FT   sig_peptide     30700..30771
FT                   /locus_tag="Sputcn32_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            31903..32925
FT                   /locus_tag="Sputcn32_0026"
FT   CDS_pept        31903..32925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0026"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: she:Shewmr4_0031 DNA protecting
FT                   protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73762"
FT                   /db_xref="GOA:A4Y1C9"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1C9"
FT                   /protein_id="ABP73762.1"
FT                   /translation="MHMEVDDLRQRLEHERQALPLSDHLLHSLVIDYQKVDAALEWQQH
FT                   SSEHYLICFSDPLYPPLLKQLPDPPSILFVKGCLEALVPPYLAIVGSRNASPGGLQVAY
FT                   QLATEMSSLGFGICSGMAMGIDGAAHKACVDHNKRTIAVLGTGIDIVYPRRHRQLYENI
FT                   QQQGCILSEFWPDIGPFAGNFPKRNRIISGLSLGTLVVEACRKSGSLITARLAMEQGRE
FT                   VFAVPGSILGGYHQGCHDLLRDGAKLVETAADIVEELASLTAFHLEELNLCHHIQKSDI
FT                   CHLPFSSLLASVGYETTTIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVRVKRS
FT                   "
FT   gene            32928..33401
FT                   /locus_tag="Sputcn32_0027"
FT   CDS_pept        32928..33401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0027"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   son:SO0035 Smg protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73763"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1D0"
FT                   /protein_id="ABP73763.1"
FT                   /translation="MFDILMYLFENYVHSEVELLVDEDELTKELTRAGFHQSEILKALT
FT                   WLERLAELQEGDKPYLCNHDQHSFRIYTKDEMDKLDVESRGFLLFLEQVKVLNVETREM
FT                   VIDRVMELDEPTLILEDLKWVILMVLFNAPGHESAYEQMEDLIFEQPEGRLHS"
FT   gene            33515..34084
FT                   /locus_tag="Sputcn32_0028"
FT   CDS_pept        33515..34084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0028"
FT                   /product="DNA topoisomerase, type IA, zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase, type IA, zn finger domain
FT                   protein; KEGG: shm:Shewmr7_0031 DNA topoisomerase, type IA,
FT                   zn finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73764"
FT                   /db_xref="GOA:A4Y1D1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1D1"
FT                   /protein_id="ABP73764.1"
FT                   /translation="MIMSKIDEQLFSAHEHALEKEYELCPECGSELSVKHSKHGGFIGC
FT                   NNYPSCNYTRPLVQHESIETQVIDGSVCPECGHELAVKSGRFGIFIGCTQYPSCTHIEK
FT                   QDQGANKPDIPCPECKAGKLEHRTSRFGKSFYACSAYPKCKFIVNYPPVAEVCPSCGFG
FT                   ILVERKGAAGMRLECPQKSCKYKRPL"
FT   gene            34232..34798
FT                   /locus_tag="Sputcn32_0029"
FT   CDS_pept        34232..34798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0029"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC, N-terminal domain; KEGG: son:SO0037
FT                   Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73765"
FT                   /db_xref="GOA:A4Y1D2"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1D2"
FT                   /protein_id="ABP73765.1"
FT                   /translation="MLQLHPSDIKDIVLNGGVIAYPTEAVYGLGCDPDNDTAIQKLLAV
FT                   KQRPWQKGLILVASDFQQLLAYVDESQLTAEQLEFAFSKWPGPFTFVMPIKAQVSKYLC
FT                   GEFDSIAVRVSAHAGVQALCRALNKPLVSTSANLAGEDPALTAAEILADFTGKIDALVL
FT                   GELGEQRQPSTIIDARSGKILRNGQ"
FT   gene            34824..35732
FT                   /locus_tag="Sputcn32_0030"
FT   CDS_pept        34824..35732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0030"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   shm:Shewmr7_0033 coproporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73766"
FT                   /db_xref="GOA:A4Y1D3"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1D3"
FT                   /protein_id="ABP73766.1"
FT                   /translation="MSVPDVAVVKAFLIDLQNRICAGLQALDGQATFAADSWTRAEGGG
FT                   GTSRVLTQGAVFEQAGVNFSHVTGAAMPASATAHRPELAGRSFEAMGVSLVIHPNNPYI
FT                   PTTHANVRFFIAQKEGADPVWWFGGGFDLTPYYPFEEDVREWHQTSKDICAPFGDEVYP
FT                   KYKKWCDEYFFLPHRNETRGVGGLFFDDLNQDGFEQSFSFMQAVGNGFLTAYAPIVERR
FT                   KETEFGERERQFQLYRRGRYVEFNLVYDRGTLFGLQTGGRTESILMSMPPLVRWQYAYT
FT                   PEAGSPEADLYDNYLKPRDWV"
FT   gene            complement(35767..36204)
FT                   /locus_tag="Sputcn32_0031"
FT   CDS_pept        complement(35767..36204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0031"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: son:SO0039 hypothetical globin"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73767"
FT                   /db_xref="GOA:A4Y1D4"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1D4"
FT                   /protein_id="ABP73767.1"
FT                   /translation="MNWLKKIFSKHTPPQDDRDPIQSNAYDLIGGEKVIRAITKCFYQK
FT                   MASSAETTTLLAIHRAPIAESEQKLFEFLSGWLGGPQLYQQKYGHPALRARHMHFAVDE
FT                   AMRDQWLFCMKFAIEENINKPEHRAAIFEAISTLADHMRNQ"
FT   gene            36358..37206
FT                   /locus_tag="Sputcn32_0032"
FT   CDS_pept        36358..37206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0032"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: son:SO0040 shikimate 5-dehydrogenase; TIGRFAM:
FT                   shikimate 5-dehydrogenase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Shikimate dehydrogenase substrate binding,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73768"
FT                   /db_xref="GOA:A4Y1D5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1D5"
FT                   /protein_id="ABP73768.1"
FT                   /translation="MTDKYAVFGNPISHSKSPFIHGQFAAPTQELLTYEAILAPVDGFE
FT                   ASLTAFFNAGGKGANVTVPFKEQAFALCDSLSPEAKLAGAVNTLSLLADGTIRGDNTDG
FT                   LGLVADLIANLGSLQGKRVLLIGAGGAARGCILPLLNAGIAQLTISNRTHTKAQLLVDI
FT                   FTSVDNGAFANRVTAVEMNELVGEFDIIINSTSASLAGELPPVPAHIITPQTVCYDMMY
FT                   GASVTAFNQWALSQGAAKVIDGLGMLVGQAAKSFTLWRGVEPDTQVVLTLLRDKLKAEP
FT                   K"
FT   gene            37212..37487
FT                   /locus_tag="Sputcn32_0033"
FT   CDS_pept        37212..37487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0033"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="PFAM: protein of unknown function DUF1488; KEGG:
FT                   shm:Shewmr7_0036 protein of unknown function DUF1488"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73769"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1D6"
FT                   /protein_id="ABP73769.1"
FT                   /translation="MNQSILFPELQYWDDAHKRVCFIAQSQGMNIKCYISANKLTELND
FT                   FSKQPSTDEAAAILALFDAVRFDAEEMAEELIEAEEFDEFGAVHLG"
FT   gene            complement(37621..38169)
FT                   /locus_tag="Sputcn32_0034"
FT   CDS_pept        complement(37621..38169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0034"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="KEGG: shm:Shewmr7_0037 carbonic anhydrase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73770"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1D7"
FT                   /protein_id="ABP73770.1"
FT                   /translation="MSGPLRTYQGIHPQLGNNVYVDEASVLVGDIALDTDASIWPMVAA
FT                   RGDVNHIRIGKRSNVQDGSILHVTRKSAARPEGHPLIIGDDVTIGHKAMLHGCKVGNRV
FT                   LVGMGAIILDGAILEDDVILGAGSLVPPGKVLQSGYLYVGSPVKQARPLTPAEIAFLPE
FT                   SADNYVRLKNEYLVELQNI"
FT   gene            38748..40282
FT                   /locus_tag="Sputcn32_R0001"
FT   rRNA            38748..40282
FT                   /locus_tag="Sputcn32_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            40660..43552
FT                   /locus_tag="Sputcn32_R0002"
FT   rRNA            40660..43552
FT                   /locus_tag="Sputcn32_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            43783..43898
FT                   /locus_tag="Sputcn32_R0003"
FT   rRNA            43783..43898
FT                   /locus_tag="Sputcn32_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            43935..44011
FT                   /locus_tag="Sputcn32_R0004"
FT   tRNA            43935..44011
FT                   /locus_tag="Sputcn32_R0004"
FT                   /product="tRNA-Asp"
FT   gene            44241..44495
FT                   /locus_tag="Sputcn32_0035"
FT   CDS_pept        44241..44495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0035"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   son:SO0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73771"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1D8"
FT                   /protein_id="ABP73771.1"
FT                   /translation="MNCRLGCGACCIAPSISSVIPGMPNGKAAGERCVQLSDDNLCLIF
FT                   GSPARPAVCSDFDASLDACGNTNEEAFWLITNLESQTSH"
FT   gene            44518..44973
FT                   /locus_tag="Sputcn32_0036"
FT   CDS_pept        44518..44973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0036"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: putative transcriptional regulator, Rrf2
FT                   family; PFAM: protein of unknown function UPF0074; KEGG:
FT                   she:Shewmr4_0041 transcriptional regulator, BadM/Rrf2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73772"
FT                   /db_xref="GOA:A4Y1D9"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1D9"
FT                   /protein_id="ABP73772.1"
FT                   /translation="MQLTRYTDFGVRTLMYLAVQPDRTTLFRIAEITQVFDLSPNHVSK
FT                   IVHHLGKLGYLETIRGKMGGFRLGKPACEINLGQLVRVLENSLAPIDCSKPYCRFTPAC
FT                   KLKGVLAHAVDAYLNVLDQYSLQDIVSNRDELLVLLPDLSISVLQLD"
FT   gene            complement(44959..45702)
FT                   /locus_tag="Sputcn32_0037"
FT   CDS_pept        complement(44959..45702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0037"
FT                   /product="protein of unknown function DUF610, YibQ"
FT                   /note="PFAM: protein of unknown function DUF610, YibQ;
FT                   KEGG: shm:Shewmr7_0040 protein of unknown function DUF610,
FT                   YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73773"
FT                   /db_xref="GOA:A4Y1E0"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1E0"
FT                   /protein_id="ABP73773.1"
FT                   /translation="MRLFYIFIVFILYVAPSYATKIALIIDDIGYRQTDEAVLSLPHTV
FT                   TLSVLPHTPLGENLAKVGHRKGHEIMLHLPMQAINGKALGPGGLTKGMDEAEIRANVSS
FT                   AIANIPFAKGANNHMGSLLTQLDSHMLWVMECLKQNQLYFVDSMTTPFSKAGEKADQLG
FT                   IPSLKRQLFLDNNVSKKALEKQFNLMISNAHMQGSLVVIAHPYPETIRFLQANLPLLEA
FT                   EGIDLVPVSDLLPIDIAQENRLIQL"
FT   gene            complement(45712..46920)
FT                   /locus_tag="Sputcn32_0038"
FT   CDS_pept        complement(45712..46920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0038"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: she:Shewmr4_0043 carboxyl-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: PDZ/DHR/GLGF
FT                   domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73774"
FT                   /db_xref="GOA:A4Y1E1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1E1"
FT                   /protein_id="ABP73774.1"
FT                   /translation="MKHVFRDIGCVGLGLVLGLSISLSSKENTKSSLNNFDYPLLQDVI
FT                   ETVETYYVKTVSKEELVQAAIKGIFEHLDPYSSFLNHQEFLDLKDANRGEYFGFGFEVA
FT                   SNKNQISIIAPFANSPAEKAGIRAGDTIIKLNNTLSTEANLSDILAEIKQHSLRNQPID
FT                   LTLKHLNDSTEFKVSLRPSMIIMQSVSSTLLKGNIGYIRLSSFQENSTKDVLHSLSQWQ
FT                   STELTGLILDLRNNPGGLLDQAIKIADIFLAKGRIVSTSGRFFDANSDYYASPQTMFNK
FT                   VPILVLINKGSASAAEVLAAALQENGRAKLLGETSFGKGTVQSLIPILNDGNAVKLTIA
FT                   QYNTPKGGNIHEIGIVPDVKVNPETSSNKENMAIIDANSTPSDVAHDYIVNSAIAWIQH
FT                   HDE"
FT   sig_peptide     complement(46843..46920)
FT                   /locus_tag="Sputcn32_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.752 at
FT                   residue 26"
FT   gene            complement(46950..48083)
FT                   /locus_tag="Sputcn32_0039"
FT   CDS_pept        complement(46950..48083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0039"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: shm:Shewmr7_0042
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73775"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1E2"
FT                   /protein_id="ABP73775.1"
FT                   /translation="MSTRLLVKASIIAGFMMLSFSANASDLQKRQSELKSIQAQINQQQ
FT                   SALKSTSKQREKLLSLLRSDEEAIAAAAKKVNNTKNSLKQIDNKLAELKQRQDELETLK
FT                   ISQQKTLSKQLSSAYLAGNHDYTKMMLNQQSPATIERMLAYYQYLNKARMKSINELKQT
FT                   LTELDDIKASQISKQQQLTKLIAEQQVQSKRLSQEQSQRQLTLNELQRTLNTKGAELEQ
FT                   LQIEEASLKRVVEQALRAMKDSPSMEGFGKQGGKLKWPTKGRVSASFGSPRSGQVVWKG
FT                   TMLSAPEGQNIHAISGGKVIYADWLKGFGMVMVIDHGKGYMSLYGHAQTLLKSPGDMVK
FT                   SGDAIALVGRSGGQTEPGLYFEIRHKGQAVDPAKYCR"
FT   sig_peptide     complement(48009..48083)
FT                   /locus_tag="Sputcn32_0039"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(48094..49638)
FT                   /locus_tag="Sputcn32_0040"
FT   CDS_pept        complement(48094..49638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0040"
FT                   /product="phosphoglycerate mutase"
FT                   /note="KEGG: son:SO0049 phosphoglycerate mutase; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73776"
FT                   /db_xref="GOA:A4Y1E3"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1E3"
FT                   /protein_id="ABP73776.1"
FT                   /translation="MTTTKRPIALLILDGWGYRENTHMNAIFHAKTPVLDRLNAQYPHG
FT                   LISGSGLDVGLPDGQMGNSEVGHINLGSGRIVYQELTRISKAISDHEFETNPALCDAVD
FT                   SAINAGGAVHIMGLLSPGGVHSHEEHIEAMCRMAVARGATKVYLHAFLDGRDTPPRSAK
FT                   ASLSHFDDLFTTLGHGRVASIIGRYFAMDRDNRWDRVSQAYELITQGKAKFQYDNAVTA
FT                   LEAAYARDENDEFVSSSAITDVDGKVATLQDGDALIFMNFRADRARQITRSFIHPDFDG
FT                   FERAVVPKMHFVTLTEYAGDITAPIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHV
FT                   TFFFNGGKEEPFEGEDRILINSPKVATYDLQPEMSSTELTDKLVAAIESTKYDVIICNY
FT                   PNGDMVGHTGNFDAAVKACEAVDTCIGRVVEALAKVGGECIITADHGNAEQMTDETTGQ
FT                   AHTAHTSELVPFIFVGRDATIDKGGKLSDVAPTILQLIGETIPAEMTGKPLIHIKE"
FT   gene            49905..50339
FT                   /locus_tag="Sputcn32_0041"
FT   CDS_pept        49905..50339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0041"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   shm:Shewmr7_0044 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73777"
FT                   /db_xref="GOA:A4Y1E4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1E4"
FT                   /protein_id="ABP73777.1"
FT                   /translation="MQEYIEFFKAHSMLSLAWVGLFVVLVISVIKSSFSKIKNISHQEL
FT                   TIMVNRQDAKVVDVRSSDEFRKGHIVDALNVTLADIKNNQTSALEKFKASPIILVCNAG
FT                   MTSSQAAQLLSKQGFENLYNLKGGMGEWQAANMPVSKSKR"
FT   gene            50598..51083
FT                   /locus_tag="Sputcn32_0042"
FT   CDS_pept        50598..51083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0042"
FT                   /product="protein translocase subunit secB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: she:Shewmr4_0047
FT                   protein-export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73778"
FT                   /db_xref="GOA:A4Y1E5"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1E5"
FT                   /protein_id="ABP73778.1"
FT                   /translation="MAEVANNEQQAPQFNIQRVYTKDVSFETPNSPAVFQKEWNPEVKL
FT                   DLDTRSAKLADDVYEVVLSLTVTAQNGGETAFLCEVQQAGIFSISGLTEPQLAHSLGAY
FT                   CPNILFPYAREAVGSLVGRGTFPQLNLAPVNFDALFAQYVQQRQAAATAPAAEEANA"
FT   gene            51088..52104
FT                   /locus_tag="Sputcn32_0043"
FT   CDS_pept        51088..52104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0043"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; Ketopantoate reductase
FT                   ApbA/PanE, N-terminal domain protein; KEGG: son:SO0053
FT                   glycerol-3-phosphate dehydrogenase (NAD(P)+)"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73779"
FT                   /db_xref="GOA:A4Y1E6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1E6"
FT                   /protein_id="ABP73779.1"
FT                   /translation="MKNSADITVLGAGSYGTALAISLASNGHKTLLWGHDPVHMQTLAQ
FT                   DKCNQAFLPDIAFPDCLQIEADLAKALAASNNVLVVVPSHVFGTVLEQAKPLLRSDARI
FT                   VWATKGLEPETGRLLQDVARDVLGEQYPLAVLSGPTFAKELAMGLPTAISVAGTCPQFT
FT                   EDLVELLHSPKRLRVYANDDFTGLQLGGAVKNVIAIGAGMSDGIGFGANARTALITRGL
FT                   VELTRLGEALGASTATFMGMAGLGDLVLTCTDNQSRNRRFGLALGKGCDVMTAQAEIGQ
FT                   VVEGYRNTKEVFTLAKRLGVEMPITEQIYQVLYQGKSPVDAAKELLGREKKSETPTQ"
FT   sig_peptide     51088..51171
FT                   /locus_tag="Sputcn32_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.710) with cleavage site probability 0.407 at
FT                   residue 28"
FT   gene            52525..53709
FT                   /locus_tag="Sputcn32_0044"
FT   CDS_pept        52525..53709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0044"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG:
FT                   she:Shewmr4_0049 HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73780"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1E7"
FT                   /protein_id="ABP73780.1"
FT                   /translation="MKHHDVIIIGAGAAGLMCAATAGYRGRDVLVLDNAKQAGRKILIS
FT                   GGGRCNFTNLKVEPANFICSNPHFVKSALARYPSQQFIELVERHGIEYHERDHGQLFCN
FT                   DSAKEIVTMLLTECEWAGVSIKLRTDILAVKKTEVGRFELNTSNGELSCDSLVVATGGL
FT                   SMPKLGATPYGYQLAEQFGLKVLPTHAGLVPFTWHSEDKIRFEPLSGIAVPSRITAKDG
FT                   TSFSEALLFTHRGLSGPAILQISNYWKAGETIEINLLPNMDLAQTLEQQLAAHPKQSLR
FT                   NTLSQWLPKRLVEVLFDEALLNKALNQLVHAERAKLVDDLHRWTVLMNGTEGYRTAEVT
FT                   LGGVDTHELSSKTMEASKVPGLYFIGEVMDVSGWLGGFNFQWSWASGVAAGQVV"
FT   sig_peptide     52525..52593
FT                   /locus_tag="Sputcn32_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.755) with cleavage site probability 0.575 at
FT                   residue 23"
FT   gene            complement(53783..54247)
FT                   /locus_tag="Sputcn32_0045"
FT   CDS_pept        complement(53783..54247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sde:Sde_2764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73781"
FT                   /db_xref="GOA:A4Y1E8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1E8"
FT                   /protein_id="ABP73781.1"
FT                   /translation="MSKIEYLFFDQVKPEDFISIINEDSLRIHLIEHPYFDATSVRVWM
FT                   EDKIKLDATNGCRIRAVYIDGMLAGWCGIQPDDNGFELAIVIAKRFWGFGISIFKTLIC
FT                   WARELGHKEVIFHLLDSRPAYKTLNKIAMKVHKTELAGRYFTTYHIPVSQ"
FT   gene            complement(54548..55912)
FT                   /locus_tag="Sputcn32_0046"
FT   CDS_pept        complement(54548..55912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0046"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: shm:Shewmr7_0049 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73782"
FT                   /db_xref="GOA:A4Y1E9"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1E9"
FT                   /protein_id="ABP73782.1"
FT                   /translation="MVQWHPSIMAIEHHPRSDRKLFGAPPFILSVSFALLIILGTCLLK
FT                   LPIATEAPITWLQSLFTATSAVTVTGLVVVDTGTVFTPFGQIVIALLIQCGGLGLMTFA
FT                   IVTLIALGGKIGFLQQTVAKEAFNQTDTSTLVSTAKAVLLFSLLVEAIGMLILSVHWSN
FT                   ELGWQTSLFHGFFYTISAFNNAGFALSADSLMPYVADPVINLTITGLFIIGGLGFSVWI
FT                   DLRRNKCWSKLTVYSRMMITGTILINAVAVIAIYLIEYNNPNTLAPLSELGKWLASWFQ
FT                   AVTPRTAGFNTLAIDQLEDGSTLLMLVLMFIGGGSLSTASGIKVVTFMVLILATYGYLR
FT                   RDEAVYVFKREIPKDTISKALALTMISIGVTWLAIFALVLTEKAPLVDIVFEAVSALGT
FT                   VGLSRGLTGSLSDMGLGIIIFMMYMGRLGPLMLAYFLANPRVKKLRYAETKLAIG"
FT   gene            complement(55914..56612)
FT                   /locus_tag="Sputcn32_0047"
FT   CDS_pept        complement(55914..56612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0047"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: shm:Shewmr7_0050
FT                   TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73783"
FT                   /db_xref="GOA:A4Y1F0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1F0"
FT                   /protein_id="ABP73783.1"
FT                   /translation="MAHFTVIGLGRFGVAASLELIHLGHTVTGVDSDPKMVEKYVENLT
FT                   EAVICDCSDEASLRELDLNNSEAVLVAIGEDMQSSLLCTLALKNLGVQTIWVKASTKAH
FT                   HTIVSKLGVARIIHPEEEMGIRVAQSLNYPMVNNFLAIGDGLYIVEIHIKPHLDKTTVA
FT                   QLLGSVQDGFSDELTNIKRNPKGKVAAIMVKRDLAVFSKIDGSFVLQANDALLLCGSRS
FT                   ELKYLAPRLV"
FT   gene            complement(56655..57344)
FT                   /locus_tag="Sputcn32_0048"
FT   CDS_pept        complement(56655..57344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0048"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO0059 transcriptional
FT                   regulatory protein KdpE"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73784"
FT                   /db_xref="GOA:A4Y1F1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1F1"
FT                   /protein_id="ABP73784.1"
FT                   /translation="MAYKVLVVDDEAQIHTFMRISLEAEGFEYIGASSITTALAQYRGQ
FT                   QPHILILDLGLPDGDGIELLQTLRRNDKIPVLVLTARDQEEEKIRLLDAGANDYLSKPF
FT                   GIRELIARIKVLVRDLVDESSLSDVLHFATLKLQKSTHQLWINKQEIALTKKEFALMET
FT                   LMSPPGQLVKQTVLLRKIWGETHQEDSHYLRILVSQLRKKLNDNNEQQLIKTEAGLGYR
FT                   LTDINQQ"
FT   gene            complement(57345..58391)
FT                   /locus_tag="Sputcn32_0049"
FT   CDS_pept        complement(57345..58391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0049"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: shm:Shewmr7_0052 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73785"
FT                   /db_xref="GOA:A4Y1F2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1F2"
FT                   /protein_id="ABP73785.1"
FT                   /translation="MTSSIAVPMTQYWRSHPSSFTFVVLVIAIFSSFFIDLLSGSTIAV
FT                   LLILQLAVVVVALQCNAHYAYFTAVYEAASYNFLFTTPRYSLQMFNLEDILNLAVFLLV
FT                   ALTTSKLAELYRRQQDALEQAQLRNSILLSVSHDLRTPLATIIGTLTTLKEYMPKLSPS
FT                   QKDELIDSAAAESHRLHQYIENLLQATKLQHGALKFSLNEDSITHVLHQAIARFPATQP
FT                   RIVIKSESELPTVMICSSLIEQAIFNVLDNALCYSPQDEKVTVKVYRYENMLRLDIQDQ
FT                   GCGIATADMEAIFELFYRQHPSTDGGAGLGLAVAKGIITAHQGQISAEPVTKGSLIRIA
FT                   LPIKKDCE"
FT   gene            complement(58629..59552)
FT                   /locus_tag="Sputcn32_0050"
FT   CDS_pept        complement(58629..59552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0050"
FT                   /product="Pirin domain protein domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Pirin
FT                   domain protein; KEGG: shm:Shewmr7_0053 pirin domain protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73786"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1F3"
FT                   /protein_id="ABP73786.1"
FT                   /translation="MNEQQAQFFGGPRECPIENGRIQVQRIAAKISDVGGIPVARAIPQ
FT                   KDRRLIGPWCFLDHIGPVTDGPLLNVGQHPHIGLQTFTWMLEGEIMHRDSLGSAQVIRP
FT                   KQVNLMTAGHGIAHTEESVKGKSTMHAAQLWIALPLEHKDTTPRFDHYPELPTWHEAGV
FT                   DFTLLIGTWQHKQAPTLHFSPIVAMDIYAVNSTKLTLRLDPSFEYALMPLEGRFQIEDE
FT                   SFDNNDLAYLGMLRETITVELEAGCRILLIGGAPLADPVSIWWNFVGHSKEEIAKAQAE
FT                   WEAHSPRFAVVPGYNGERLVPPPIPW"
FT   gene            59840..61030
FT                   /locus_tag="Sputcn32_0051"
FT   CDS_pept        59840..61030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0051"
FT                   /product="putative plasmid transfer protein"
FT                   /note="KEGG: eca:ECA0549 putative plasmid transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73787"
FT                   /db_xref="InterPro:IPR032811"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1F4"
FT                   /protein_id="ABP73787.1"
FT                   /translation="MKKSVIALSVLASISNATWANSFDARKDAMGGVGVASAHYSAATP
FT                   VNPALVAKYNESDDFSFVLPSIGAQGTDKDKLIDNIDNIKDAYDAFRIGANSATANKLA
FT                   SELAAVDGKLAMVNVGVNVQVAVPNKLVSLGFMANGYASAMVGADVAQSDLDYLQDVID
FT                   GTSAADPSRSLNSQALGVVALVQDYGVALAHQFELMDMPLYVGVTTKVQKVETYNYSAT
FT                   ITDYDDSDLSDDQYRSSDSGFNADLGLALDAGNMTYGLAVRNLVSRDVDTATVNGVTYT
FT                   YQISPVATLAAAYRTDWLTAVIELDVNKSKAWLGKDESMFAAVEESQFAAVGVEFNAFD
FT                   WAQLRAGFRSDIAGEQPDLFTAGFGLSPWSVFHLDLAGQVGSDKAVGAALTMSYTF"
FT   sig_peptide     59840..59902
FT                   /locus_tag="Sputcn32_0051"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 21"
FT   gene            61217..61681
FT                   /locus_tag="Sputcn32_0052"
FT   CDS_pept        61217..61681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0052"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: shm:Shewmr7_0059
FT                   NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73788"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1F5"
FT                   /protein_id="ABP73788.1"
FT                   /translation="MKILLIVILALGLGACASAPEPKPVVKQVEPVSVWDDSNIAELHS
FT                   EWRGVPYRLGGGTKKGIDCSAFVSVAYQKMLGMVLPRTVEEQQTLGRPVPRDQLRRGDL
FT                   VFFKTGWSTHHVGIYVGDDNFLHVSTSQGVKISSLLNSYWASKYWNARRI"
FT   sig_peptide     61217..61270
FT                   /locus_tag="Sputcn32_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.589 at
FT                   residue 18"
FT   gene            61972..62505
FT                   /locus_tag="Sputcn32_0053"
FT   CDS_pept        61972..62505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0053"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: shm:Shewmr7_0066
FT                   molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73789"
FT                   /db_xref="GOA:A4Y1F6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1F6"
FT                   /protein_id="ABP73789.1"
FT                   /translation="MSKAKIGIVTVSDRASAGIYEDISGKAIIDTLNDYLTSEWEPIYQ
FT                   VIPDEQDVIEATLIKMADEQDCCLIVTTGGTGPAKRDVTPEATEAVCDRMMPGFGELMR
FT                   AESLKFVPTAILSRQTAGLRGDSLIVNLPGKPKSIRECLDAVFPAIPYCIDLMEGPYLE
FT                   CNEAVIKPFRPKAK"
FT   gene            complement(62578..62826)
FT                   /locus_tag="Sputcn32_0054"
FT   CDS_pept        complement(62578..62826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73790"
FT                   /db_xref="GOA:A4Y1F7"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1F7"
FT                   /protein_id="ABP73790.1"
FT                   /translation="MEKEYILMVIMVTFIIGFSATEMFKHYLKARQLGVNPTGDKQLED
FT                   KVTQLSLQNQVLIERVQVLEKIVTESEYELKQQISQL"
FT   gene            complement(62906..64045)
FT                   /locus_tag="Sputcn32_0055"
FT   CDS_pept        complement(62906..64045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0055"
FT                   /product="transport protein, putative"
FT                   /note="KEGG: son:SO0069 transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73791"
FT                   /db_xref="GOA:A4Y1F8"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1F8"
FT                   /protein_id="ABP73791.1"
FT                   /translation="MNKIIAMVRKELIDAARDKRSVMAGLYYAIGTPLIMCGLFMVLIG
FT                   QLTSPDDLKITITNPDNAPDLVRFLSNKGISSGEVKDSELKAIELIISTDYAEQMNQGK
FT                   AAEITIVADNSEEKLQNSIRRLEKQLQAYSAEMGSLRLIARGIDPRVVQPLKVNVQDQA
FT                   TPDSKGGMILGIAIFTMIYSVFISGMNLAIDTSAGERERNSLALLLSHPLTTRQLVLSK
FT                   IIAVGLFALLGLVLILLVSKIAYTFVPWQELGFSVNITSEFIALMLIVGIPVALMAACL
FT                   QLFVSFMAKTFKEAQSYLTIVLFVPLALSMAASYNIAPDMLQWLPVSGQQQALMDFIKG
FT                   KDLPMLQLLVSTLGTLAIAILLAFGMERSLKSEKVIFGL"
FT   gene            complement(64128..64862)
FT                   /locus_tag="Sputcn32_0056"
FT   CDS_pept        complement(64128..64862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0056"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: son:SO0070 ATP-binding transport protein NatA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73792"
FT                   /db_xref="GOA:A4Y1F9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1F9"
FT                   /protein_id="ABP73792.1"
FT                   /translation="MIKVSNLSKRIGEVQALNDLSFVAQNGQITGLLGPNGAGKTTCLR
FT                   TIFGLLKPDNGKAEIEGIDVTIDPIGAKQQLGLFPDPFGLYERLTPREYIRYFAELSGL
FT                   SAREAKEATSQVIAKLRLEDISDRRCKGFSQGQRMKTALAQAIVHCPSNIILDEPTRGL
FT                   DVMSTRLLRDILIDLKNQGHCVLFSSHVMQEVAALCDQVIVMAQGRVVAIGSPTELCIQ
FT                   TGKDSLEEAFIQLIGTDEGIAA"
FT   gene            complement(64866..66506)
FT                   /locus_tag="Sputcn32_0057"
FT   CDS_pept        complement(64866..66506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0057"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP domain protein;
FT                   KEGG: she:Shewmr4_0074 TAP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73793"
FT                   /db_xref="GOA:A4Y1G0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1G0"
FT                   /protein_id="ABP73793.1"
FT                   /translation="MIDSMTHRKLSKTAQPLSPTRPWHSTKATCYSAMLSTWSLSQKRL
FT                   SISALILAITSTATWANEVKNQDIQAASKSNTCYVEGVSDRLNCGFVTVPENPNKPDGK
FT                   QIQVHYVVLPAVKNANHEEALLAIAGGPGQSAIDNAAGFDAMLSKVRQQRDILLIDQRG
FT                   TGRSNLLTCDESANPLSLDDDSIDPSAETQKCLDKIDADVSQYGSLNAVKDFEAVRAHL
FT                   GYKKLHIYGISYGTRMAQLYMRLYPEQLATVTLDGVVPMQQSVLEIGSAIDRGFELLFK
FT                   DCQENTVCKQQFPQLKAEFEQVANTLAKGAITENVFDPVTGEKNQLIITRGKFYGAIRM
FT                   ALYQTNVRALVPHAIHQAANNHFQPLLGLYALTVDNAGIAMGMHTSVVCGEDIHRITPA
FT                   MREKAASSYVGQTMLDSMEKTCAIWKVPAVDNSFSEPISSNIPTLLLSGEIDPATPPSW
FT                   GELAMEKLTNAKHFIAPYATHGVAYQSCANGLVADLVRTGSINDLDGECLNKDVRRSFY
FT                   LNASSVEPLNATSTKTTTTNNNASTGAKE"
FT   sig_peptide     complement(66321..66506)
FT                   /locus_tag="Sputcn32_0057"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.993 at
FT                   residue 62"
FT   gene            66600..66971
FT                   /locus_tag="Sputcn32_0058"
FT   CDS_pept        66600..66971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0058"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG: son:SO0072
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73794"
FT                   /db_xref="GOA:A4Y1G1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1G1"
FT                   /protein_id="ABP73794.1"
FT                   /translation="MLELLNVNPSSGEPIYKQLHEQIVRLIVGGQLQVEDVLPSVRQIA
FT                   EHLAVNPMTVSRAIQQLVDQGWLERRRGQATKVALRTETMASGISLLEPQLDALLSQAK
FT                   QLGVSLPELQQLLNERWQD"
FT   gene            67014..67877
FT                   /locus_tag="Sputcn32_0059"
FT   CDS_pept        67014..67877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0059"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: son:SO0073 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73795"
FT                   /db_xref="GOA:A4Y1G2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1G2"
FT                   /protein_id="ABP73795.1"
FT                   /translation="MDQERTPILEFNQVNKVFRGKNASEKWALKDLSLTLSAGMVVGLL
FT                   GQNGAGKSTLMRCALGILTPDAGSITTLGEAPNDLSSQAKERIGYVPQQPFGYEGFTIE
FT                   RALDLHRSFYPNWDMQLEQDWLVRFELDVTQQVQRLSVGQRQSLALIMAMAYRPELLIL
FT                   DEPVASLDPIVRRKFMVDLFDLALESGSAVLFSSHITSDIERVASHVALIKQGELVLFK
FT                   EIDALREEVRLLTLAPETILPEPITVLSRVGDSVLVDLGEHCAPIAGVLKNEALNLEQL
FT                   FMELHR"
FT   gene            67874..69190
FT                   /locus_tag="Sputcn32_0060"
FT   CDS_pept        67874..69190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73796"
FT                   /db_xref="GOA:A4Y1G3"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1G3"
FT                   /protein_id="ABP73796.1"
FT                   /translation="MSAAHHKQIQVAKGKRTSQRMHPFMGILRLWCFDIGSISFLGTGL
FT                   LSLVLGGVAGWFGQKDSLELFLSMGVVSVSAAIAWQFIRLMASECSQLIPNYRRNIFIQ
FT                   SGLILSSVIGILSILCVSFGFVASLPILVLALVISLGFIGLCLLAAQWFYAAFLLFMLM
FT                   PFISLIERHIPLWLSLSVLLIMGIVIIYQCRTLPWRGDARVVYLNGLEMGWFWLPNLQS
FT                   MRILSRFERYLHPTNFFIGPMLTILLLLLPIFTLGLGALSLQLQWDFPILLLLAQFSVI
FT                   SCSLVHWSRVQRSRATETLLLMPGFNGRQGLINAFYHGQQRLLNVIAGMIFVCSLLLGW
FT                   INGDVSLLLVAHLTLSTYCACALILGFGCMCRRVLHVTLTMMIVAGHSLWVSISLASLR
FT                   GGSNLTDWLLWDLLLSLVAQVVLVWGKKTLWKSDIMGAN"
FT   gene            69383..71179
FT                   /locus_tag="Sputcn32_0061"
FT   CDS_pept        69383..71179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0061"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   she:Shewmr4_0078 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73797"
FT                   /db_xref="GOA:A4Y1G4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1G4"
FT                   /protein_id="ABP73797.1"
FT                   /translation="MSLEQYHVIQLLRQQSASLKDAIALEGFEMAAPWHQVSWQAFDHT
FT                   SSKIAQVLIELGVQVQDRCVILSQNCPQWTCADIGTLKSRAIVVPIYPTSTIEQASFIV
FT                   NDAAAKVIFVDDAKQYAMACELQTICPSLEHVIVFDSSVTLAADKGNQHWHLDTLLAGG
FT                   YTQEAELNQRLEAANLDDLLTLIYTSGTTGDPKGVMLDYRNMASTIRQHDQKLAFSSGD
FT                   VSLAFLPLSHVFERSWSFYVLCRGGHNVYLQNTQRVKEAISAVRPHTLCVVPRFLEKVY
FT                   SAVQDKVAKSPESRKKMFAWAMRVGERQFEVGQRRAKGSLWLSLQWQLANKLVYSKLQA
FT                   VLGGRLKFMPCGGAALDLNVGSFFHAIGIPVLCGYGMTETNATVTCNTLDNRVPGSNGQ
FT                   PLLETEIKLGKDDEILVRGATVMRGYYNRPEDTAAAFEDGWLKTGDAGRFDANGNLFIT
FT                   DRIKELMKTSNGKYIAPQRVEGTVGRCPFIEQVAIIADARNYVTALIVPAFESLEAWAK
FT                   EKGLKYESSLELLRHSHVVEHFEQRLKQLQHELAGFEQIKKFTLLPEAFSMEAGLITPT
FT                   LKLRRKMIYHKYAHEINAMYSN"
FT   gene            71323..73779
FT                   /locus_tag="Sputcn32_0062"
FT   CDS_pept        71323..73779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0062"
FT                   /product="MORN variant repeat protein"
FT                   /note="KEGG: she:Shewmr4_0079 MORN variant repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73798"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1G5"
FT                   /protein_id="ABP73798.1"
FT                   /translation="MELSIRNLFAAVSAVLLSLLTVIPVADAEDYDKIVHGPVDLPNGQ
FT                   WLNFYQKDHKVWSEMLYGDAPGVRVDDYGAAEIVAVFYLDFDKGGTKEVVVMLRDADGQ
FT                   HLRGYGFEGDELTKLPRLQIVLDEVAPTLTSFTVGSVRKVLSQIPPQQYRMTYDVEAVE
FT                   DPAIKAIVDGSTKLKPTLVGYRNSEGSPVDVKTAVEYKLRYPLTRKDKDAQGNDRQYSL
FT                   VTTFDRSGYSEEDASFVLVSVAFEADDFDWLKSGGAVIPKTGPSYDFMSMGMGSTWAGL
FT                   ASESHYAQGVLDGPYAAYDGRNGSVVYSGNYKQGKKVGKWMETENQAIYWEGEYLDGKK
FT                   QGKWIAQSMFDEADSFGFAHYNQDVLDGPYEVYEPDYDSSTEGDKRLVAKGIYLNGVKD
FT                   GEWLEADGSKGQYQKGVKQGPWVDKVTSGHFRDQVGEGAYLAGKRTGPWVFKAEDGTRT
FT                   EVSYVNGLRQGESRSFDKNNLMFNVRHYEQGRLNGQSIWYSSPNVVVDIANYRQGEFDG
FT                   QQMRFNPQNGELTELTSYQFNAAVTLKPSHDECIMRENPYSDDCEGVINGKNEASSSIK
FT                   HGEQREYYSSGTLYKLAYYTNGAVDKEYQFDSNGRLLNLKTYKAGKEYGPSISYSTDGG
FT                   YSLSRYGHQVNNRVSGPHYSFYPNGQLRSLWNYCQQEGEMWNGEPYYWDNAIARCGIQR
FT                   EYFDNGAVSCIEDLDSNYAVDKVCYDINGKIANEMLRIDEQHVIHKRYINGVIYSEEPG
FT                   FADYSHITKGRKIYHLENPKTHGVYKSYKNGKLEYEKKYDMGKAGCLKKYDANGKQTPE
FT                   TASCQF"
FT   sig_peptide     71323..71409
FT                   /locus_tag="Sputcn32_0062"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.965 at
FT                   residue 29"
FT   gene            73905..74315
FT                   /locus_tag="Sputcn32_0063"
FT   CDS_pept        73905..74315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0063"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   shm:Shewmr7_0078 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73799"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1G6"
FT                   /protein_id="ABP73799.1"
FT                   /translation="MSATEYSLEINPRFTETDGLGHINNTVIPVWCEAARTPIFEIFNP
FT                   ELDLHQWNLIVAGFTVTFIAPTYYGKSVTVKTYVSRIGNSSFELTQTCWQSGNKTAEVK
FT                   TTLVHYDYSSEKSRPIPEDIREMLANLNGESA"
FT   gene            74439..74987
FT                   /locus_tag="Sputcn32_0064"
FT   CDS_pept        74439..74987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0064"
FT                   /product="HPP family protein+B94"
FT                   /note="PFAM: HPP family protein+B94; KEGG: shm:Shewmr7_0079
FT                   HPP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73800"
FT                   /db_xref="GOA:A4Y1G7"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1G7"
FT                   /protein_id="ABP73800.1"
FT                   /translation="MRFYFTRMRSKDICPPRQPLKKIVWSWIGAFCGIHLVASLANYMS
FT                   ENLVGTMFVIGSFGASAVLVYGAPLAEFSQPRNLIGGSVLSALIGVAVYQVCGDYVVLA
FT                   SALAVSLSIAFMYLTRTLHPPGGATALIAVIGGENVHQLGFLYALMPVFLGSVLLLLVA
FT                   LVVNNLSTDPKRHYPVYWI"
FT   gene            complement(74984..75250)
FT                   /locus_tag="Sputcn32_0065"
FT   CDS_pept        complement(74984..75250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73801"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1G8"
FT                   /protein_id="ABP73801.1"
FT                   /translation="MSDNENIEIAIEHQQDRQRFIIPVDGYEAVLEYQLSGQDIDFSRT
FT                   FVPNELRGKGLAERLVRHGLKWAKSQDLAIQASCWYVQKFLKN"
FT   gene            complement(75320..75760)
FT                   /locus_tag="Sputcn32_0066"
FT   CDS_pept        complement(75320..75760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0066"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   shm:Shewmr7_0081 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73802"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1G9"
FT                   /protein_id="ABP73802.1"
FT                   /translation="MDNAMEKFLAQHPIVTEIPVAWGEMDALQHVNNVVYFRYFETARI
FT                   DFFNRLFPLDSLYKSGIGPVISENQARYKRPVTFPDTLLVSVSISDIHSDRFTMHYQAF
FT                   SKQQQAVTTLGTSVAVMFNFKTGKKAELPAELLAILKQHEVA"
FT   gene            75872..76267
FT                   /locus_tag="Sputcn32_0067"
FT   CDS_pept        75872..76267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0067"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating,
FT                   GFA; KEGG: shm:Shewmr7_0084 glutathione-dependent
FT                   formaldehyde-activating, GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73803"
FT                   /db_xref="GOA:A4Y1H0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1H0"
FT                   /protein_id="ABP73803.1"
FT                   /translation="MIKQVGNTLIQPKHRASCHCGAVVLELSLPNGIENPRRCDCSICR
FT                   RKGAIVGSVPLAGIKILKGEDALKLYEFNTKTAKHYFCSNCGIYTHHQRRSNPHEYGYN
FT                   IGCLEGVNPFELENVPTNDGVNHPADR"
FT   gene            76603..77727
FT                   /locus_tag="Sputcn32_0068"
FT   CDS_pept        76603..77727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_0075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73804"
FT                   /db_xref="GOA:A4Y1H1"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1H1"
FT                   /protein_id="ABP73804.1"
FT                   /translation="MECKIIMNLIGYIGSARQYLRKLSLPSLSEIRLGLGKLWRHLSQG
FT                   LSRLSFAQKLYLIALILAFSSDAMGVVAVIAVIAMAIEFWPVFERVWHNLAGKAVLLLF
FT                   YAIIANFALGWSGAIVNEVVGVSASDLDYTHNLAILLYMPAWFLMVSAIVLLALQLIIP
FT                   IYLVLIFLLKPLGVKSLQLTSHTSFRKTTFLIRIVLASVVLYHLSLLIDLETRIETSFG
FT                   DLVTTTQQASEHAPSEPKSVRIPDATDVLTVPIAELTQAALDTQDDKQTSEQMASNAED
FT                   LKEEEERKKAYASVRTQYQHLVRQWLATFAFTLEANSRSRCEKPAESNVIELNDYEILQ
FT                   ITPDKSADYGYRFEVKRCISAAFPLAGKDIGLGE"
FT   gene            complement(77797..78477)
FT                   /locus_tag="Sputcn32_0069"
FT   CDS_pept        complement(77797..78477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0069"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: son:SO0084 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73805"
FT                   /db_xref="GOA:A4Y1H2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023943"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1H2"
FT                   /protein_id="ABP73805.1"
FT                   /translation="MGIRAIVVDTAGTTTDLNFIQDVLFPYSVKALPDFLEQNQHNVLV
FT                   ENCICDTKDIALEPEADLARVTEILQQWVNEDRKATPLKTLQGLIWKQGYAHGEFKGHI
FT                   FPDFIEAVKRFSTQNLRIYSFSSGSVDAQKLLFSHSDGGDLTEMFNGHFDTRTGNKLDK
FT                   QAYCNILNTISLSPKQVLFVSDVIEELKAADAAGMMTCQMVRDSKQRTGDFRKISSFDE
FT                   LQIE"
FT   gene            78858..79286
FT                   /locus_tag="Sputcn32_0070"
FT   CDS_pept        78858..79286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73806"
FT                   /db_xref="GOA:A4Y1H3"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1H3"
FT                   /protein_id="ABP73806.1"
FT                   /translation="MKYLPALGFGALLAVLSFTSFALVASAGYMLDLLKAIPNITDNNF
FT                   AYLWLAAHDASLLILLSGLVLYCYHRFFPRLPYDWFAAVFIQMPLGLAVLVLDGISLNL
FT                   LSFKGFALTLTTFTASFGVLIIFWLLQRSVKRKHTNNA"
FT   sig_peptide     78858..78926
FT                   /locus_tag="Sputcn32_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.288 at
FT                   residue 23"
FT   gene            complement(79288..81111)
FT                   /locus_tag="Sputcn32_0071"
FT   CDS_pept        complement(79288..81111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0071"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: csa:Csal_2061 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73807"
FT                   /db_xref="GOA:A4Y1H4"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1H4"
FT                   /protein_id="ABP73807.1"
FT                   /translation="MLYPEHNYWRDTLAVIRLRGRKLIEFELLFTLVSAGLIVPAFSWL
FT                   LRHLIAQTGNVTITNYDLMAFAMSPYGLLFMVITLFSSFSVFFTQRAGVTILAASGLYD
FT                   IPIGPVRALIFAAGRLPIFIRLGSSYAACLLLLSVPFIGCGYLAFSLFLQGHDINYYLY
FT                   YKPIEWYFALTSIIVLALIYALIALYLWARTAFSLTIIVSETISVLNALKRSWQLSAGN
FT                   ERRIMWHAAGWWLRIGALVYPLILLISWGADILLDKVSLTLSAELAILAFVSALILMLS
FT                   AAWSLLGMFGEAFIILLLYRQLGEKPAGLERLGRQTVKRTSELSVYTISGVLVGTFLIM
FT                   FGLGIYALNTEPQRDEILITAHRAGAARAPENTLAALRLAIAEKADYAEIDVQTAADGT
FT                   LVVLHDADLMRIAGDPRRVANLTVTEMQRLDVGRWHSVAFAGEFVPTLAQMLNEARNKI
FT                   GLNIELKYNQADPSLAQAVVSLLQQEQMTQQVVITSLEARAIEEVQRLDPSIRTGLIVT
FT                   QSIGDPSRANTQFLAVNQAMANEKFIARAHKGGKQIHVWTVNNPRQMLRMLALGADVLI
FT                   TDYPKEAVDIREQWLALTPVEQTALRLRYIL"
FT   gene            81271..81615
FT                   /locus_tag="Sputcn32_0072"
FT   CDS_pept        81271..81615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73808"
FT                   /db_xref="GOA:A4Y1H5"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1H5"
FT                   /protein_id="ABP73808.1"
FT                   /translation="MPYRGANLYNPDGCRDNRLIGTMSKFFWVLMAFSLLAVLIVLNST
FT                   GVIIHIPTSRVLNNIAHIASPLLLVISIVVANIVGIGIFIYFKHWVYVVVSTLMVIPSI
FT                   LFLWVIFNMF"
FT   gene            81838..82374
FT                   /locus_tag="Sputcn32_0073"
FT   CDS_pept        81838..82374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO0090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73809"
FT                   /db_xref="GOA:A4Y1H6"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="PDB:3GXG"
FT                   /db_xref="PDB:3GXH"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1H6"
FT                   /protein_id="ABP73809.1"
FT                   /translation="MRNAVLSSFVLALFLGAPLANANIESIENLQGIRALQQQAPQLLS
FT                   SGLPNEQQFSLLKQAGVDVVINLMPDSSKDAHPDEGKLVTQAGMDYVYIPVDWQNPKVE
FT                   DVEAFFAAMDQHKGKDVLVHCLANYRASAFAYLYQLKQGQNPNMAQTMTPWNDELAIYP
FT                   KWQALLTEVSAKYGH"
FT   sig_peptide     81838..81906
FT                   /locus_tag="Sputcn32_0073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.982 at
FT                   residue 23"
FT   gene            82489..82845
FT                   /locus_tag="Sputcn32_0074"
FT   CDS_pept        82489..82845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73810"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1H7"
FT                   /protein_id="ABP73810.1"
FT                   /translation="MDITPFLGKPEPVKSWIDKCISNRGLGYWLVYEDTPQNDDIQLTT
FT                   TLLPIVGNTNNFSDQEFDEFENSLFKSGYCYFLNMDQIEDVIDNYTMQKAQWTDSELLE
FT                   AILFYFERDAFICL"
FT   gene            83012..83443
FT                   /locus_tag="Sputcn32_0075"
FT   CDS_pept        83012..83443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0075"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG:
FT                   shm:Shewmr7_0090 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73811"
FT                   /db_xref="GOA:A4Y1H8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1H8"
FT                   /protein_id="ABP73811.1"
FT                   /translation="MSLSLGETLHRLVHAYKKQLRADINAQEINLPVTHIRALKGICRN
FT                   PESTAQSIALRMQRDKAQITRVLNELQQSGLITKIDNPKDGRSQLLRPTTEGEKLMTQI
FT                   NAAERQTVAHITQALSPDDINTFIRLANIISDSVDNPEC"
FT   gene            83522..84277
FT                   /locus_tag="Sputcn32_0076"
FT   CDS_pept        83522..84277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0076"
FT                   /product="Siderophore-interacting protein"
FT                   /note="PFAM: Siderophore-interacting protein; FAD-binding
FT                   9, siderophore-interacting domain protein; KEGG:
FT                   shm:Shewmr7_0091 FAD-binding 9, siderophore-interacting
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73812"
FT                   /db_xref="GOA:A4Y1H9"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="PDB:2GPJ"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1H9"
FT                   /protein_id="ABP73812.1"
FT                   /translation="MMNKPAPRELEVIRSTYITPHMLRITLGGAGLAGFPADQESAYIK
FT                   LLFPQAGERPLMRTYTIRQQRDDEIDVDFVLHDTDGPASSWAKTAQVGELIQIGGPGLK
FT                   KLINFEADWFLLAGDMTALPAISVNLAKLPNNAVGYAVIEVLSEADIQPLVHPEHVELH
FT                   WVINPEADPEGRPLVERIAQLPWLAGEPAVWIACEFNSMRALRRHFKQAHALPKSHFYT
FT                   SSYWKIGCNEGEHKLVKQEDEQLENGASV"
FT   gene            complement(84375..85601)
FT                   /locus_tag="Sputcn32_0077"
FT   CDS_pept        complement(84375..85601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0077"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: shm:Shewmr7_0092 imidazolonepropionase;
FT                   TIGRFAM: imidazolonepropionase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73813"
FT                   /db_xref="GOA:A4Y1I0"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1I0"
FT                   /protein_id="ABP73813.1"
FT                   /translation="MSWDQVWIDVNLATMDPSVSAPYGAITNAAIAVKDGKIAWLGPRS
FT                   ELPAFDVLSIPVYRGKGGWITPGLIDAHTHLIFAGNRANEFELRLQGASYEDIARAGGG
FT                   IISTVKACREADEAELFELGRQRLNALAKEGVTTVEIKSGYGLDTETELKILRVARELG
FT                   KHHHVDVKTTFLGAHAIPPEYKDNSDSYVDLIINKMLPAVIAENLADAVDVFCENIAFN
FT                   LEQTERVLSAAKAAGLEIKLHAEQLTNMGGSALAARLGAKSVDHIEYLDEAGVKALSES
FT                   GTCAVLLPGAFYFLRETQKPPIDLLRQYGVPMVLASDFNPGSSPICSTLLMLNMGCTLF
FT                   RLTPEEALTGLTLNAAKALGIEDTVGSLVVGKQADFCLWDIATPAQLAYSYGVNPCKDV
FT                   VKNGKLVHQ"
FT   gene            85836..86543
FT                   /locus_tag="Sputcn32_0078"
FT   CDS_pept        85836..86543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0078"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="TIGRFAM: histidine utilization repressor; PFAM:
FT                   regulatory protein GntR, HTH; UbiC transcription
FT                   regulator-associated domain protein; KEGG: she:Shewmr4_0098
FT                   transcriptional regulator, histidine utilization repressor,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73814"
FT                   /db_xref="GOA:A4Y1I1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1I1"
FT                   /protein_id="ABP73814.1"
FT                   /translation="MATPKFAEIKQYIISSIESGEWEEHARVPSENQLADLFTCSRMTA
FT                   RRALTELTDSGVLERSQGLGTFVAGCKSQSSMLAIRNIADEIKDRGHGYSVQQWVLEQV
FT                   AASQSIAISLGLEHGAAVFHSILVHCEQGLPLQVEERYVNPELVPDYLLQDFTQQTPHE
FT                   YLSQVAPLTEAHHTIEAIIASEELQQRLEIPATEPCLQILRRTWSRQGVVSFAKLVHPG
FT                   SRFKLGGHLTFSK"
FT   gene            86685..88352
FT                   /locus_tag="Sputcn32_0079"
FT   CDS_pept        86685..88352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0079"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: son:SO0097 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73815"
FT                   /db_xref="GOA:A4Y1I2"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1I2"
FT                   /protein_id="ABP73815.1"
FT                   /translation="MDKRHDPSRRIIAPHGTQLSCKSWLTEAPMRMLMNNLHPDVAERP
FT                   EDLVVYGGIGRAARDWDCYDKIIEVLQRLEDDETLLVQSGKPVGVFRTHADAPRVLIAN
FT                   SNLVPHWANWEHFNELDKLGLAMYGQMTAGSWIYIGTQGIVQGTYETFVSVAKQHFEGI
FT                   SKGKWILTGGLGGMGGAQTLAGTMAGFSVLACEVDETRIDFRLRTRYVDKKATSLDEAL
FT                   AMIEAANQAGKPVSVGLLANAADVFAELVKRGVTPDVVTDQTSAHDPLNGYLPQGWTMA
FT                   EAAAMRKTDEAAVIKAAKASMAVQVQAMLDLQTAGAATLDYGNNIRQMAFEMGVENAFD
FT                   FPGFVPAYIRPLFCEGIGPFRWVALSGDPEDIYKTDAKVKELIPDNPLLHNWLDMARER
FT                   IAFQGLPARICWVGLKDRARLALAFNEMVKNGELSAPVVIGRDHLDSGSVASPNRETES
FT                   MLDGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHSGVVIVCDGTDAAAKRV
FT                   GRVLWNDPATGVMRHADAGYEIAKNCAKEQGLDLPMQD"
FT   gene            88405..89946
FT                   /locus_tag="Sputcn32_0080"
FT   CDS_pept        88405..89946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0080"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: shm:Shewmr7_0095 histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73816"
FT                   /db_xref="GOA:A4Y1I3"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1I3"
FT                   /protein_id="ABP73816.1"
FT                   /translation="MKSVNHLVLTPGSLSLAQLREISRHKLTLELAPEAITDINTSAQI
FT                   VQKVLDEGRTVYGINTGFGLLANTKIAPEDLQLLQRSIVLSHAAGTGQYMQDATVRLMM
FT                   VLKINSLSRGFSGIRLEVINFLINLVNAEVYPCVPEKGSVGASGDLAPLAHMCLPMLGE
FT                   GEMSYRGELISAAEGLEIAGLKPIDLAAKEGLALLNGTQASTALALEGLFHAEDLFAAS
FT                   SVIGAMSVEAAMGSRSPFDPRIHAARGQKGQIDSAMVFRHLLGEESEISLSHVNCEKVQ
FT                   DPYSLRCQPQVLGACLTQIRHAAEVLGTEANGVTDNPLVFQDSGDIISGGNFHAEPVAM
FT                   AADNLAIAIAEMGSIAERRIALLIDSSLSKLPPFLVKNGGVNSGFMIAQVTAAALASEN
FT                   KTYAHPASVDSLPTSANQEDHVSMATFAARRLRDMSENTRGVLAIELLAAAQGLDFRAP
FT                   LAPSAAVAKAKAELREVVAYYDKDRYFAPDIEAATDLLYTASFNGYLPAGTLPSL"
FT   gene            complement(90072..91319)
FT                   /locus_tag="Sputcn32_0081"
FT   CDS_pept        complement(90072..91319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0081"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   shm:Shewmr7_3942 gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73817"
FT                   /db_xref="GOA:A4Y1I4"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1I4"
FT                   /protein_id="ABP73817.1"
FT                   /translation="MTLIKNLSEDAAKAALTLALLDEHLKNTVLLDMARSIREKSYEIQ
FT                   SANLIDLQRATADNISPAMLDRLTLNPARVEAMAQGIETIAALPDPIGNERYIGQRPNG
FT                   LSISKMRVPLGVVCMIYEARPNVTADAGALCFKSGNAVILRGGKEALHTSKVIATILQN
FT                   VLAQYGLPKALISMVPDPDRALMLELMQQREFIDVIIPRGGEGLINYVTENSSIPVIQH
FT                   FKGVCHLYIDKDADQTMALDLLLNGKTQRTGVCNALEALLVHQDIAPQFLPKVAKALAE
FT                   HQVKINACSKAAAYFEACTEMVEEDFGQEYLDLEIAIRQVEDFDAAAKHIARFGSHHTE
FT                   VICTNNEVTAAKFQRSIDASVVMVNASSRFSDGSELGLGAEIGIATTKLHAYGPMGLES
FT                   LTAEKYLVSGTGQIRA"
FT   gene            complement(91337..92437)
FT                   /locus_tag="Sputcn32_0082"
FT   CDS_pept        complement(91337..92437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0082"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="KEGG: shm:Shewmr7_3941 glutamate 5-kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73818"
FT                   /db_xref="GOA:A4Y1I5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1I5"
FT                   /protein_id="ABP73818.1"
FT                   /translation="MTNSPRKRIVVKVGSALIAPHKQGCSSHYLLGIAQFITYCRAQGI
FT                   QVVLVSSGSVAAGWHHFNVEANPSVTVKKAMAAAGQADMMATWNKLFDFPTAQLLLTHG
FT                   DLRNRERYISIKETIFCLLEHGLMPIINENDAVTADKLKVGDNDNLSAMVAAAADADTL
FT                   IICSDVNGLYTQNPHENPNAELIKQVTEINADIYAMAGGASSNVGTGGMRTKIQAAEKA
FT                   ISHGIETFIINGFVADSFSQLLKGQNPGTLFIPDEKPMQEHLHWMKHTSQAQGEVIVEN
FT                   HFNVALDVHSEQFTSDDVVEVKGDFSVGDTILVRKDDGTKLAKAKSNYSSCLLNFITEQ
FT                   EDRQFANEFQQKTGPIISGKNIAILE"
FT   gene            complement(92446..93942)
FT                   /locus_tag="Sputcn32_0083"
FT   CDS_pept        complement(92446..93942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0083"
FT                   /product="sodium/proline symporter"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   sodium/proline symporter; PFAM: Na+/solute symporter; KEGG:
FT                   shm:Shewmr7_3940 sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73819"
FT                   /db_xref="GOA:A4Y1I6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1I6"
FT                   /protein_id="ABP73819.1"
FT                   /translation="MNSLSYVSLGIYFIAMLAIGLFAYRKSTSDVSGYILGGRKVSPQV
FT                   TALSAGASDMSGWMLMGLPGAMFLVGFETIYIALGLLIGALINYLVVAPKLRVYTEVAN
FT                   NALTIPEFFAKRFGNANSSIRIIAAVIIVIFFTLYTSAGLVAGGKLFESAFGLNYNIGL
FT                   VVTLSVVVSYTLLGGFLAVSLTDFVQGCIMFVALVLVPVVAYQEFTSADRMMNFAYQSI
FT                   PHFSDAMQNVTFLGLISSLSWGLGYFGQPHIIVRFMAIRSVADIKMARRIGISWMTVTI
FT                   VGALATGLVGIAYANKFGMKLNDPETIFIVFSELLFHPLISGFLLAAILAAIMSTISSQ
FT                   LLVSSSSLTEDIYQVVSKKESSEKDMVKMGRYGVAGVGIVATLLALDRSNSILSLVSNA
FT                   WAGFGAAFGPLVLFSLYKANLTHKAAIAGIVSGALTVLFWIYAPVLADGKALTSIVYEM
FT                   IPGFIVSSAVIWLVSFLDTEPSAKTTKMFHKAGRVLAEEG"
FT   gene            complement(94554..95909)
FT                   /locus_tag="Sputcn32_0084"
FT   CDS_pept        complement(94554..95909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0084"
FT                   /product="NADPH-glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="TIGRFAM: glutathione-disulfide reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: shm:Shewmr7_3938
FT                   glutathione-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73820"
FT                   /db_xref="GOA:A4Y1I7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1I7"
FT                   /protein_id="ABP73820.1"
FT                   /translation="MAQHFDYICLGAGSGGIASANRAAIRGAKVLLIEAKQVGGTCVNV
FT                   GCVPKKVMWYGAHIAEAMNLYAKDYGFDVTVNKFDWNTLVNNREAYIGRIHDAYGRGFA
FT                   NNKVTLLNGYGRFVDGNTIEVNGEYYTADHILIATGGAPTIPNIPGAEYGIDSDGFFAL
FT                   REQPKRVAVIGAGYIAVEVAGVLHALGSETHLLVRKHAPLRNFDPILVDALVDAMATDG
FT                   PTLHTHSVPKAVVKNADDSLTLSLENGESITVDCLIWAIGRSPATANIGLENTDVQLDS
FT                   KGYVITDAQQNTTHKGIYCVGDIMAGGVELTPVAVKAGRLLSERLFNGMTDAKMDYSLI
FT                   PTVVFSHPPIGTMGLTEPEARTQYGDDNVKAYTSTFTSMYTAVTSHRQACKMKLVCAGK
FT                   DEKVVGIHGIGFGMDEILQGFGVALKMGATKADFDAVVAIHPTGAEEFVTMR"
FT   gene            complement(96040..96594)
FT                   /locus_tag="Sputcn32_0085"
FT   CDS_pept        complement(96040..96594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73821"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1I8"
FT                   /protein_id="ABP73821.1"
FT                   /translation="MLAHYFDIIRSIFFLVSAMLFVVTHPVQARQTGEPELTLETLSQP
FT                   PKNPQLPLGTLLDNNGQPIHIPNQRQSALEYSTPTVSLTETQKSQTNAPSKKTKSKKLN
FT                   RKQQLTSRAQVANDPNCRWLDKRMQQLEALSSSKQNKPAQYQLDELSARQKEWQCLKCG
FT                   AEGPNQNDYSRCQYRRETITR"
FT   sig_peptide     complement(96505..96594)
FT                   /locus_tag="Sputcn32_0085"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.987 at
FT                   residue 30"
FT   gene            complement(96810..97508)
FT                   /locus_tag="Sputcn32_0086"
FT   CDS_pept        complement(96810..97508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4700 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73822"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1I9"
FT                   /protein_id="ABP73822.1"
FT                   /translation="MATPTVIFSHILCTLGVLCLNQTVLANESLIQTESISSQQQPNQD
FT                   AAPLALTLDLGWDSKYISQGRDNLKYGGIYWANASIQYNNLTTYALVGRGDSQTYTEWN
FT                   IGFEYTFNVVEQLEANLGYQRIEGFSDNRCQDNELFGELAYTATPWLIPSVSYVYSTEA
FT                   EGSFVEVSLHSYWNITDQFTLTPYITQGFDFKYRTEKNNGRNHLQLGLEASYQITSEIN
FT                   LSGHISHSIA"
FT   sig_peptide     complement(97428..97508)
FT                   /locus_tag="Sputcn32_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.971 at
FT                   residue 27"
FT   gene            97818..99857
FT                   /locus_tag="Sputcn32_0087"
FT   CDS_pept        97818..99857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0087"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B, thimet/oligopeptidase
FT                   F; KEGG: son:SO4699 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73823"
FT                   /db_xref="GOA:A4Y1J0"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1J0"
FT                   /protein_id="ABP73823.1"
FT                   /translation="MSNPLLSGAKLPLFSQIKPEHIQVAVEHAIAQCRAKIDEVLQNQG
FT                   PFTWDNLVAPLEQVDDELSQIWSPVSHMNSVTSTDEWRAAHDACLPLLSEYGTYVGQHQ
FT                   GLYQAYKALRASNEFAQLSQAQQMVIEHSLRDFELSGIGLDDTQKVRYGEIVKRLSELT
FT                   SGFSNQLLDATQAWTKLIADEAELAGLPESAKAAAKAMAQGRELEGWLFTLDFPSYLPV
FT                   MTYSENRSLREECYRAFVTRASDQGPNAGEFDNSPLMDEILALRHELALLLGFDSFADK
FT                   SLATKMAETPAQVMAFLNELALRSKDQAKAELAELKAFAEAEYGVTEMASWDLSFYAEK
FT                   LQQHKYEISQEILRPYFPEDKVLSGLFYTVSRLFGLKIVEQKDFDRWHNDVRFFDIFDE
FT                   TDEHRGSFYLDLYARTGKRGGAWMDDCRVRRQTANGLQKPVAYLTCNFNGPVDGKPALF
FT                   THDEVTTLFHEFGHGIHHMLTKIDVAGVSGINGVPWDAVELPSQFMENWCWQEEALAEI
FT                   SGHFETGEPLPKALLDKMLAAKNFQSGMMMLRQLEFSLFDFRMHHEYDPAKGARIQETL
FT                   DEVRRQVAVLTPPDFNRFQHGFAHIFAGGYAAGYYSYKWAEVLSADAFSRFEEEGIFNP
FT                   ETGRRFLHNILEMGGSAEPMDLFKQFMGREPNIDALLRHSGIAA"
FT   gene            100033..100563
FT                   /locus_tag="Sputcn32_0088"
FT   CDS_pept        100033..100563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73824"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1J1"
FT                   /protein_id="ABP73824.1"
FT                   /translation="MNLYFRLFWLLFWRTRHCRKIDFLGTSRITYRALPSDCDINFHLT
FT                   NSRYPAFMDLARTYMLAEMGLLKRFLKLKWMPIVNAAEFTYIRDIKPLKTFEIETKVVG
FT                   WDEKYFYIEQRFVSERGLHCIVHVRGVFVCKGKQVPLDVLVKEAGYTDPAPELPPEVVK
FT                   WKAFLQLKKERNM"
FT   gene            complement(100589..101236)
FT                   /locus_tag="Sputcn32_0089"
FT   CDS_pept        complement(100589..101236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0089"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: she:Shewmr4_3840 glutathione S-transferase,
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73825"
FT                   /db_xref="GOA:A4Y1J2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1J2"
FT                   /protein_id="ABP73825.1"
FT                   /translation="MELFYHPLSRYSQKVLIALYEKQANFYPRITDLGDPLSRKAFHQF
FT                   YPPAKLPLLKTQDGQLIPESSIIIEYLDRHFNNSTQLLPPEPQRNLQVRLFDRIIDNDI
FT                   NNPLFQLEKLKHIEDSNEFEIKQLEKQLLTQFQRLDAQLTQHHWVCGDSFTLADCALIP
FT                   CLSYSFQHLNLLDLDDVVRYWQQAQLRGAWMLVQEEVLQAEMEETTGVRGIP"
FT   gene            102007..103152
FT                   /locus_tag="Sputcn32_0090"
FT   CDS_pept        102007..103152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0090"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   she:Shewmr4_3837 efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73826"
FT                   /db_xref="GOA:A4Y1J3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1J3"
FT                   /protein_id="ABP73826.1"
FT                   /translation="MRQTIKLASVISVALWMAACSPQEETAQTGAGPQSMEVGILNVVA
FT                   KPQVIQVELPGRSKAFLEAEVRPQVNGIITKRSFVEGGNVKQGESLYQIDSATYKTALV
FT                   SANADLARANASLASAKAKAARYQQLVKTNAISKQDFDEAEAAYKEALASVTVAEAAIN
FT                   TAKINLQYTEVLAPISGRIGKSSVTAGALVTANQSQTLATIQQLDPINVDIAQSSAQLL
FT                   RLKAKLKQGKLQVVDNADVQLVLEDGTIYGHLGKLQFTEVSVDENTGSVILRAEFPNPD
FT                   GILLPGMYVRAVLNAGTDPEAIMVPQKAISRNSKGEAVAMVVNDQGVVEAKTVTTAEAI
FT                   GHEWRITEGLAAGDKLIVEGLQKIRPGAPVTPKVISETQAQ"
FT   sig_peptide     102007..102081
FT                   /locus_tag="Sputcn32_0090"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.461 at
FT                   residue 25"
FT   gene            103162..106296
FT                   /locus_tag="Sputcn32_0091"
FT   CDS_pept        103162..106296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0091"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   son:SO4692 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73827"
FT                   /db_xref="GOA:A4Y1J4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1J4"
FT                   /protein_id="ABP73827.1"
FT                   /translation="MARFFIDRPIFAWVIALIIMLAGILSIRSLPVSQYPSIAPPTVVI
FT                   SANYPGASAKIVEDSVTQVIEQRMTGIDHLRYITSTSDSFGNASITLTFNAEADPDIAQ
FT                   VQVQNKLQGAMTLLPQEVQSQGVNVNKSSSGGFLLLLGFVSTDGSLDKSDIADYVGSNV
FT                   QDPMSRVPGVGEIQLFGAQYAMRIWLDPLKLTQYNLTSIDVVSAIRSQNAQVSSGQLGG
FT                   TPSVAGQELNATVSAQSRLQTPEEFRKIILKSDTSGAIVFLGDVARIELGSESYSVVSS
FT                   YNGKPATGLAIKLATGANALDTAEAVRAKIAEMKPFFPQGLDVVYPYDTTPFVEKSIEG
FT                   VVHTLIEAVVLVFLIMYLFLQNFRATLIPTIAVPVVLLGTFAILSATGFSINTLTMFAM
FT                   VLAIGLLVDDAIVVVENVERVMSEEGLSPLEATRKSMDQITGALVGIGLTLSAVFVPMA
FT                   FMSGSTGVIYRQFSVTIVSAMALSVMVALILTPALCATMLKPLKKGHGHIETGFFGWFN
FT                   RGFDKLTNRYESSVASIIKRGFRVMMIYVALVVAVAWIFMRMPTAFLPDEDQGILFTQA
FT                   ILPTNASQESTIKVLDKVSEHFMAEDGVRSVFSVAGFSFAGQGQNMGIAFVGLKDWSER
FT                   ESGMDVQSIAGRAMGAFSQMKDAFVFAFVPPAVIELGKANGFDMFLQDKNGQGHEKLVA
FT                   ARNQLLGMAAQNPNLVGVRPNGQEDAPIYQLHIDHAKLSALGIEIGNVNSVLATAWGGS
FT                   YVNDFIDRGRVKKVYVQGDAQYRMQPGDLDSWYVRNNNGDMVPFSAFARGTWEYGSPRL
FT                   ERFNGLPAMNIQGATAAGFSTGAAMDIMEDLVKQLPPGFGIEWNGLSYEERLSGNQAPA
FT                   LYALSILVVFLVLAALYESWSVPFAVVLVVPLGIIGALLAMNGRGLPNDVFFQVGLLTT
FT                   VGLATKNAILIVEFAKEYYEKGAGLVEATLHAVRVRLRPILMTSLAFGLGVVPLAISTG
FT                   VGSGSQNAIGTGVLGGMMSSTFLGIFFVPLFFVIVERIFSKRERKAKDEKPTSAE"
FT   gene            106425..106712
FT                   /locus_tag="Sputcn32_0092"
FT   CDS_pept        106425..106712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73828"
FT                   /db_xref="GOA:A4Y1J5"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1J5"
FT                   /protein_id="ABP73828.1"
FT                   /translation="MMSEVDNVKPDKLAKLEASLARGKWYFILVIGVLYWGSVTSLLVA
FT                   GFQYFTSEISFWQALKVALYIYPVSGVLFGWTLWMQLNHRRDKLRGKSRP"
FT   gene            106745..107065
FT                   /locus_tag="Sputcn32_0093"
FT   CDS_pept        106745..107065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73829"
FT                   /db_xref="GOA:A4Y1J6"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1J6"
FT                   /protein_id="ABP73829.1"
FT                   /translation="MSSVSSLITKQFVVAIICHGIAIGILAYGAYEFYLEQLVVPELTR
FT                   SLAVAVFFIGMGLEPNVFFTPLSQVMIQVDDKSPKAKLQALVFNLGVFLLICSFLMEWL
FT                   YD"
FT   gene            complement(107146..108681)
FT                   /locus_tag="Sputcn32_0094"
FT   CDS_pept        complement(107146..108681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0094"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: C4-dicarboxylate anaerobic carrier; AbgT
FT                   putative transporter; KEGG: she:Shewmr4_3833 AbgT putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73830"
FT                   /db_xref="GOA:A4Y1J7"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1J7"
FT                   /protein_id="ABP73830.1"
FT                   /translation="MRFLNIVERLGNLLPHPITLFALFCVAVILISGIAGYFELTVADP
FT                   RPVGSHGRSADGLIHVVSLMNAEGLRMIVSNLVTNFTGFTPLGTVLVALLGVGIAERSG
FT                   LLSAAMRALVMGASKRLVTVTIVFAGIMSNTAAELGYVVLIPMAAMIFHSLGRHPLAGL
FT                   AAAFAGVSGGYSANLLLGTVDPLLSGITEAAARMIDPDYSVGPEVNWYFMFVSTFVITF
FT                   LGAFVTEKIVEPKLGKYQDGDADETVLQSMESVSAIEKRGLKWAGLSVLILAIMLALLV
FT                   VPEGAPLRHPDTGLVSGSPFLKGIVAFIFICFAIPGFVYGKVVGSINNDRDVINAMSHS
FT                   MSTMGLYIVLVFFAAQFVAFFNWSNLGAVLAVLGADALQSIGLTGPILFLFFIMLCGFI
FT                   NLMLGSASAQWAITAPIFVPMLMLVGYAPETIQAAYRIGDSVTNLVTPMMSYFGLILAV
FT                   ACRYQKNLGIGTLIATMLPYTLVFFVGWTAFFFLWVFGFGLPVGPGAATYYTP"
FT   gene            109245..109808
FT                   /locus_tag="Sputcn32_0095"
FT   CDS_pept        109245..109808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0095"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: son:SO4662 lemA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73831"
FT                   /db_xref="GOA:A4Y1J8"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1J8"
FT                   /protein_id="ABP73831.1"
FT                   /translation="MDKFLLGLSLVFIVAYLWYVSLVKKRNTALEALSGIDAQLTSRNE
FT                   FIYRVLEIAGQHKHDELLFKEINELLTTSASAYRMFDPQEVKVHFINAEQLNHKMAKLV
FT                   ANIDDYPDLKSDNTMLEAIQNYSEAESDIANASRFYNLAVSELNTAVEIFPGSIIASMA
FT                   SIKVMPLFELIEVPKVPMDAVDYL"
FT   gene            109915..110664
FT                   /locus_tag="Sputcn32_0096"
FT   CDS_pept        109915..110664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0096"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   son:SO4660 transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73832"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1J9"
FT                   /protein_id="ABP73832.1"
FT                   /translation="MYRLLMHRTDIQLSALFKWPSNLWLLGICLLLLSSAVMANNAQDA
FT                   HSKPRIVARYSETGILSREGQEKFKVYQYQQANGVTVFSDKAPSNNQYQILLYECFACR
FT                   PDSNIDWNAIRLFSANYDALIAQAAHKHQLEPALIRAVIHAESAFNSRAVSRSGAMGLM
FT                   QLMPETAKEMGVINAFLPEENILGGSKYLAQMLKQFNGDIALACAAYNAGPTTVTQYNG
FT                   IPPYPETQAYVERVQILLKRYREQNRA"
FT   sig_peptide     109915..110034
FT                   /locus_tag="Sputcn32_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.954 at
FT                   residue 40"
FT   gene            complement(110661..110825)
FT                   /locus_tag="Sputcn32_0097"
FT   CDS_pept        complement(110661..110825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_1960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73833"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1K0"
FT                   /protein_id="ABP73833.1"
FT                   /translation="MAPEGRVATRFILRSRLSTEHHYAFKPSPCLKRVELPLNEQIFNT
FT                   IGINAQSYS"
FT   gene            complement(110989..111834)
FT                   /locus_tag="Sputcn32_0098"
FT   CDS_pept        complement(110989..111834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0098"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   shm:Shewmr7_3922 protein of unknown function DUF519"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73834"
FT                   /db_xref="GOA:A4Y1K1"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1K1"
FT                   /protein_id="ABP73834.1"
FT                   /translation="MLSYRHGYHAGNYADVLKHAILLQTLQLMHKKDKPLVYIDTHAGA
FT                   GGYALSDEFAQKTGEYLDGVAKLWDKSDLPKALQDYVEAVRHFNEDNPEELNFYPGSPA
FT                   IIDMALGPKDRMVLHELHSTDYVLLDDYFCEDRQVKVIKGDGLKGLIAAVPPLERRALV
FT                   LIDPSYEMKTDYQDVAETLFKAHKRFATGVFMLWYPVVNRAQTEGMLSRLANSGIKRQL
FT                   RIEQAIKPDSNEFGMTAAGLWIINPPWQLDEIATELMDYLGKTLGQAGGNVTVKWEVGE
FT                   "
FT   gene            complement(111971..114235)
FT                   /locus_tag="Sputcn32_0099"
FT   CDS_pept        complement(111971..114235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0099"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; KEGG: pat:Patl_2246 diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73835"
FT                   /db_xref="GOA:A4Y1K2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1K2"
FT                   /protein_id="ABP73835.1"
FT                   /translation="MFQWLKGFLFIREQDFLNPDRELLKTSLLRIILLSGAILTTSIVL
FT                   HSSLMAYQLNLSFVIIITVSFLSVLISALWFTRRYLMLSSISLLAMVVAACICILLFVP
FT                   DFNLSQAGIIFLYTLPLMALFLFGAKAAIIMMFFNVLPFLLLLQNRNLPTIIDIDISMP
FT                   ATHAYLNGLLFTFFNICIPLSAMRLLKTQKIHSQQMIKHHEALQHTLEQYTEIFENNGT
FT                   ASFFCNEDGLILNLNDAAKNIANDVRVNQTRLSDIFELAEDTPINLFAASFPTHLKNNP
FT                   KAKYLLQKASLQHHDTLLFHCHDVTEQANHAIELSRLKKHHISTHFYDLVTSLPNENHW
FT                   YNPAPSVIHQKMTVAIVKIDNLSQINAAFGIQIGDALLKIFANELKQRFGQHAKIYRFR
FT                   GASFALEFTSLPLISPENLAQQLRERIPTNLQLKQKRQVEYHLECRVGCSSGTKASPQQ
FT                   AAEQCLIAIKQTTQASPVMVYYIGLINNLLEASSQKARIRDALKYNRLEMWLQPQVMAN
FT                   GHIISFEALARMFDEDGTMIMPNTFIPIIESSQLQAIFAIKVFRQLLQLIRSWPKNVPP
FT                   VKIAFNLSGQDILSDRFFKVLIQTYMNHPELIPLLEIEITETSVFSTYKETGRRLNTLA
FT                   RMGVSIAIDDFGTGHASLSQLIDISADTIKIDRYFISQLGISERHTQIVNAAILLAKSL
FT                   KLNVIAEGIETEAQLSQLTALGCKQFQGYLFGKPAPANLWLKTFQMQTPMHWFPDKKSA
FT                   N"
FT   gene            114456..115235
FT                   /locus_tag="Sputcn32_0100"
FT   CDS_pept        114456..115235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0100"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   shm:Shewmr7_3921 protein of unknown function DUF548"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73836"
FT                   /db_xref="GOA:A4Y1K3"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1K3"
FT                   /protein_id="ABP73836.1"
FT                   /translation="MTAILLVRRQPVTPIFFNQQYPTLVDICARWQLIYDANAPFELRF
FT                   ESDSLTLHKRDEPKLDGILVDFVTGAVAHRRKFGGGRGQSIAKAVGLKQGVTPSVVDGT
FT                   AGLGRDAFVLASLGCTVTMVERHPVVAALLEDGLRRAYQDAEIGDWMHERMQLFHGSSL
FT                   EALSKLEQEVDVVYLDPMYPHRDKSALVKKEMRVFQSLVGADLDADGLLAPALALATKR
FT                   VVVKRPDYAEDLDGVKPSMVIDTKKNRFDVYVKAAMK"
FT   gene            115816..116181
FT                   /locus_tag="Sputcn32_0101"
FT   CDS_pept        115816..116181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73837"
FT                   /db_xref="GOA:A4Y1K4"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1K4"
FT                   /protein_id="ABP73837.1"
FT                   /translation="MDVGQFKLSKKFMMIMLFSLVAFGLYSSLDLVVRVGDFNSVMELS
FT                   RPLDTRPEKHTENLEVLKARIQLLETQLEAQSSYQTMTQKIESRVWILYAIFQFMFILL
FT                   IYNFFISKEKLSNSNVT"
FT   sig_peptide     115816..115899
FT                   /locus_tag="Sputcn32_0101"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.679) with cleavage site probability 0.398 at
FT                   residue 28"
FT   gene            116375..116800
FT                   /locus_tag="Sputcn32_0102"
FT   CDS_pept        116375..116800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73838"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1K5"
FT                   /protein_id="ABP73838.1"
FT                   /translation="MKLSDSQDELKKRLGQSIDIITPRRALEVMLAFYGEQRFDDVEIN
FT                   EDGDMLLYEWGICNSRQFSLSVTRQFIITDEDEPYQLHLRQYFPLTDALRQLNGGNEWC
FT                   HSPDELPVFRQSIESSAPFRALIDDQPLKVELYFEQC"
FT   gene            116931..117221
FT                   /locus_tag="Sputcn32_0103"
FT   CDS_pept        116931..117221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73839"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1K6"
FT                   /protein_id="ABP73839.1"
FT                   /translation="MQQAALYSMLNASGFSVQVFEDYPSFFGNWRIILKRGQHTYEVVS
FT                   DNREGWLSLWRLLSDQGQKLFEIESTRLTQEQQLTQIAQWLEAVNHIDLNM"
FT   gene            complement(117266..120436)
FT                   /locus_tag="Sputcn32_0104"
FT   CDS_pept        complement(117266..120436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0104"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   csa:Csal_2405 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73840"
FT                   /db_xref="GOA:A4Y1K7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1K7"
FT                   /protein_id="ABP73840.1"
FT                   /translation="MLKFGIKHGTLLTVMVLIFCVLGTAAALRIPVQMIPDLDVRTISV
FT                   TTGWPGATPQDVEKEILLEQERHLRNLPNLQRMTSWADTGSAWIELEFPQSTEISDALI
FT                   RVSNALSQVSAYPENVDQPRLYSSSYSDNAFMYFRLMPIAGNPLGLDIDMMRDFANDHI
FT                   RPQMERVKGVSSVTIQGGAERQIQILLDPAKLAQRGISIMDVRQAIRERNKDTSAGDID
FT                   SGKKRYLLRVIGRFEDLDQLKQLVLKRQGNTNILLQDVAEIKLDHAEIRELSFAEQERT
FT                   LTLAVKRDVGSNVIAIKAAMMPVITQINQNQLAQHAMQLELFSDDVRYVQDSVKNVWFN
FT                   LSLGALLATLVMYLFLRSHRATMIGVLGIPICTLAAFVGLLIFGRTINVISLAGVAFAI
FT                   GMTVDNSIVVLESIEQARRRGRDRIEAAISGIYDVWPAVLASTLTTVLVFVPILFIKQE
FT                   AGQLYSDIAIAIASSIIASMLVAMLIVPAAIARFGFGKINQKSNLDNNNQSSSRILALV
FT                   NQTILSPKRRYTVIVLSLIATLGLAMRLMPPAEYLPEGEEPKAFTSMVAPPGYNLSEMA
FT                   NIAKELTLTLSSRVDAHPLSFDRGEQKIPPLKYYTLSVGVGSIWVMSEPTRHQDMDAMM
FT                   RSLTALFEHYPGMRAYSSRGSIISSNDGGTRAVALDISGPNQASLYRTAEAAYQAAERV
FT                   FAEPQLYSDPSTLSLDQPLWQITPRWHRLVEQNFSGSEFGYAVSALSDGAYVDEFFIDD
FT                   NKVDIFLFSQAGNQQSLAQLALAPIVTPTGNVLPLQALADISEQMDSNSLRRVDGRRTV
FT                   TLYIIPPRNIALETAVTKVREELVPLLYQQGAVAKDVSLDISGAADQLEATRAALSSNF
FT                   IVAVLIIYLLLVAIFNHWGYPLFVLVTIPLGLAGGLVGLETLNAVGYLFQQLSGQGWHQ
FT                   PFDMITMLGFLILLGTVVNNPILIVEQSRKNLQSGHLSVIEAVKAAVENRLRPILMSTA
FT                   TTLFGLLPLVLFPGAGSELYRGVGIVVLSGLMVATLLSLTFLPAILISVLSFTHKADLL
FT                   KGVDRYPD"
FT   sig_peptide     complement(120359..120436)
FT                   /locus_tag="Sputcn32_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.464 at
FT                   residue 26"
FT   gene            complement(120441..121487)
FT                   /locus_tag="Sputcn32_0105"
FT   CDS_pept        complement(120441..121487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0105"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   hne:HNE_2191 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73841"
FT                   /db_xref="GOA:A4Y1K8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1K8"
FT                   /protein_id="ABP73841.1"
FT                   /translation="MRYLIVSLCLLCSAAYATTPVTVALPQLGSANELLPLSGSIKSAR
FT                   VARLSPRTDGLVAQVLVDAGAKVKAGQPLLKLDDTLAVHQLTQRQADMMAATTQLTEKQ
FT                   RLLTEAQTLSSQQLFPETERAMRQAALAEAKANLQNAEAALAYQKEVVARHQLIAPFAG
FT                   VISSKQTETGEWVDVGTEIFTLVSQEQLWLDIQVPQEMFQQITTATQIEIAADMLPTKQ
FT                   FTGQVSALVPVSDHNARSFLMRLTIPDANSQLMPGTSATATFHLQREQHSLVIPQDALV
FT                   RHPDGQFSVFTVQNNIAQRHSVKIGRSSAIGIEILSTLPEGAPVVIRGNENLQDQQAVS
FT                   VINHSVGG"
FT   sig_peptide     complement(121434..121487)
FT                   /locus_tag="Sputcn32_0105"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.818 at
FT                   residue 18"
FT   gene            complement(121532..123718)
FT                   /locus_tag="Sputcn32_0106"
FT   CDS_pept        complement(121532..123718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0106"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: rru:Rru_A1440 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73842"
FT                   /db_xref="GOA:A4Y1K9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1K9"
FT                   /protein_id="ABP73842.1"
FT                   /translation="MPPLSVFIQWRLPLIPVLLCALTVAAQANTDPTPEEKNDTEQIER
FT                   VSVVGTYTRAAMNSATGLSMSLKETPQSVTLITEEMISDKGLVTMESVLNHTPGVTMVG
FT                   DASENSQIFVRGYALDSGVQIDGLITTSSSHVYSGSIDQGLDPVIAERVEVLKGAAGIL
FT                   SGLGEPSATVNFIRKRPTDDTRATISASYGSWDTYRLEADISGWLTDSGSVKGRFVSAV
FT                   KKGNSFIDRYQRDTTVLYGVVETNLATDTSLSFFADYQKSQTDGVYNWNSNPAFYTDGT
FT                   AVDFGRSYSSSQDWTHWDVTQKSVMAEFKHRFDNDWSLVSAYRIANATIDALAFYPGDY
FT                   IVKATGEFVGPWGDTYSAQHDRESDTNSFNLYTTGTFDLFGREHSAVAGFNYGDNVFDN
FT                   INTNSTPQRRYHLNDQGHYPKPSLPDSPSNGQSNEQSQSGVYGTIRINVLDSLKFMLGG
FT                   RVSDWSYEKHDLVGNSADATMEKNGIFIPYYGLVYDVTEIVSVYASRTEIFKPGTYFGE
FT                   DGQLLEPAEGTNIEAGIKMALFDDTLNMSAAIYETNKDNEPEYAGKGQLPSGDYIYQSV
FT                   DGITTKGYEFEIAGRLTDNWDISGGYTHNSAEDKNGLRRQTYLPEDIFKLTTKYNFEDY
FT                   LPGTTAGVSWRWQSSSYYEGTIWGVDGAPNVAYRQEQSAYSLIDLMFGYEITPSISMQV
FT                   NINNIFDKHYNRSLWGYSDFGEPRNATISLRWSL"
FT   sig_peptide     complement(123632..123718)
FT                   /locus_tag="Sputcn32_0106"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.848 at
FT                   residue 29"
FT   gene            complement(124135..125457)
FT                   /locus_tag="Sputcn32_0107"
FT   CDS_pept        complement(124135..125457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0107"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: son:SO0110
FT                   hypothetical protease"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73843"
FT                   /db_xref="GOA:A4Y1L0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1L0"
FT                   /protein_id="ABP73843.1"
FT                   /translation="MEHVMTTGNDNPIQMADTVYSKEKSLFTILAIISGLAWAGLIIGT
FT                   LGAALLYVLAFFIIYLFSHSAFISYLKGTAVAINAEQFPDLHKQYLACCERLEIKEPPR
FT                   AYLLAADGMLNALATRFLGRNYIVLFSSIVDALESDKDALNFYIGHELGHIRRNHIGKV
FT                   PFLLFATWLPLVGAAYSRACEYTCDLHGLRCCNSLRSATNAVAVLAAGVEQWKRMNVDQ
FT                   YIRQTQESSGFWMSLHELNGSYPWLTKRMARVQAKAQGKDYVAPSRSAWAYVFSIFMPR
FT                   LGTTGGGLIILAAIIGVAAAIAVPAYKDYQEKMGASISYDTPNDTPTLMLTVPDASLAM
FT                   AHIDQRHQSLIPITDTLTRYYQTNKAWPTELEVLGLTDEQLETFNLYTDGIVGFVGGEA
FT                   LGDYQDYEVYLSPQVDEQNNITWLCSSNGIPDEYLPVDCRG"
FT   gene            125794..126432
FT                   /locus_tag="Sputcn32_0108"
FT   CDS_pept        125794..126432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73844"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1L1"
FT                   /protein_id="ABP73844.1"
FT                   /translation="MAKLINKMISNRLGFKWYCAAGVVVGALSAGAMAANAPSFDCTKV
FT                   NAGSIEDMVCKDAGLNQLDNQLAKVYSQALEKSKNEQPPTLKAMQRGWVKGRNECWKND
FT                   DKHACIQSSYQTRIAELQAQYRLVEMTGPVSYACDGSPANELVVTYFKTEPATLIAERG
FT                   DQTSLMFVQPSGSGAKYQGRNESLWEHQGEAKVVWGYDTPEMTCKLVTK"
FT   sig_peptide     125794..125898
FT                   /locus_tag="Sputcn32_0108"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 35"
FT   gene            126451..126882
FT                   /locus_tag="Sputcn32_0109"
FT   CDS_pept        126451..126882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0109"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ppr:PBPRA1918 putative
FT                   glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73845"
FT                   /db_xref="GOA:A4Y1L2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1L2"
FT                   /protein_id="ABP73845.1"
FT                   /translation="MKQALVHIALVVRDYDEAIDFYVNKLKFELVEDSYQAEQDKRWVV
FT                   VAPPGSKGASILLARASKPEQFDFIGNQAGGRVFLFLNTDDFWRDYQRMVADGIHFIRE
FT                   PQEQDYGTVAVFEDLYGNLWDLLQLNVQHPMAQRLAYQS"
FT   gene            complement(126879..127505)
FT                   /locus_tag="Sputcn32_0110"
FT   CDS_pept        complement(126879..127505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73846"
FT                   /db_xref="InterPro:IPR021501"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1L3"
FT                   /protein_id="ABP73846.1"
FT                   /translation="MQTSLRLSVLSSLLLLSSSAIAADVARVTLENGAQVRLKDDFTWE
FT                   YVLTETQTAPNVLATETVVNASTTINSATSLTTTSAVSVPVTTLTATAMAKPELLGTTA
FT                   KDGIKVSFTDSQWKGDKLGLTFELASTSNEHVTLVEVEARFFADNGTLLKTDKLEVWEA
FT                   IFRMPETYLRKGEQRKSSIIWVKGIDKALWQKQLIDLKITEINSR"
FT   sig_peptide     complement(127437..127505)
FT                   /locus_tag="Sputcn32_0110"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(127621..128583)
FT                   /locus_tag="Sputcn32_0111"
FT   CDS_pept        complement(127621..128583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0111"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: yps:YPTB1207 putative
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73847"
FT                   /db_xref="GOA:A4Y1L4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1L4"
FT                   /protein_id="ABP73847.1"
FT                   /translation="MTFTKSTEELIAVINNQFIEIRHFVTVAQLGSFTLAAQALGMTGS
FT                   ALSKSIVRLETRLGTKLLHRTTRRVSLTNDGDSYLIDCQNAMAILDNAQSRLGSEQQIP
FT                   SGRVRVDLPVTFGRRYILPTLLSLSQKYPKLELSITFNDRATDLFNDGIDLAVRVGQLG
FT                   DTVDLVARRLGEQRRVICASPAYFGRLGTPQSKEDLSQHQCIVGWPLGQQHRWLLKNED
FT                   GITEAHDIPVRHEIADCEAILAATLAGVGLAQVPIWLVEDYLKTGELVSVLDDLASDDT
FT                   PIHLIWLKTPYLQPKLRVIIEELLELAKAPHSRFKAEIS"
FT   gene            128733..129482
FT                   /locus_tag="Sputcn32_0112"
FT   CDS_pept        128733..129482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0112"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: son:SO2813 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73848"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1L5"
FT                   /protein_id="ABP73848.1"
FT                   /translation="MKSSNNLQGKVAFVQGGSRGIGAAIVKRLASDGAAVAFTYVSSEA
FT                   QSQLLVDEVITHGGQAIAIKADSTEPEAIRRAIRETKAHFGGLDIIVNNAGTLIWDSIE
FT                   NLTLEDWERTINTNVRSVFVASQEAALHMNDGGRIINIGSTNAERIPFVGGAIYGMSKS
FT                   ALVGLAKGLARDLGPRAITVNNIQPGPVDTDMNPDNGDSSEPVKAMGALGRFGKAEEIA
FT                   SFVAFIAGPEAGYITGASLMIDGGFSA"
FT   gene            129778..130188
FT                   /locus_tag="Sputcn32_0113"
FT   CDS_pept        129778..130188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0113"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73849"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1L6"
FT                   /protein_id="ABP73849.1"
FT                   /translation="MMVFTILTLFCLTQNSGILNLLLKESSVQAMSAAPFLGTASANSA
FT                   VNTGSASSNMTSNVDTLLIGSELIKGEPKKCELSEKSIRTCIDAPSTIPLLILLFLIPL
FT                   LPRASRVITLLPILSYQAKPRRIHLTLCRFQE"
FT   gene            130468..132579
FT                   /locus_tag="Sputcn32_0114"
FT   CDS_pept        130468..132579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0114"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: vpa:VP2006 putative suppressor for
FT                   copper-sensitivity B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73850"
FT                   /db_xref="GOA:A4Y1L7"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1L7"
FT                   /protein_id="ABP73850.1"
FT                   /translation="MSTVKSILTRFWMLALIVTSPSLMAASTGWLVNDNHPPAKVRFML
FT                   TGEVDPATNTLPAVLEVQLEGDWKTYWRSPGEGGIAPTIKWDGSHNLQQVDWRWPAPEE
FT                   FSLLGLQTFGYKGNTTFPLTIKVDDIAASTQLRGKVTLSTCTTICVLTDYQMSLDFTPN
FT                   ALQADTDAMLAYNKAVSLVPQKVLTQEGLNPAMTMGWDAAKGQLEVRLNDANWQQPTVI
FT                   IDGDPDTTFKLVSLKPSESEANGQQLIGIFTGQSWLGEPEVLGKSLNMTVADSERALEY
FT                   SAEVKPVVITQEGTSIFGMILLALIGGLILNVMPCVLPVLGMKLSSVVAAPDLKRNQIR
FT                   QQFIASALGILASFWLLAGFILMLKLTGQAIGWGVQFQNPWFIGFMALVTTVFAFNMLG
FT                   VFEINLPSNVQTKLATTGGNNNSGHFLQGMFATLLATPCSAPFLGTAVAFALGADVLSL
FT                   FAVFTALAVGMAFPWLIVAAFPQVAGYFPKPGRWMNTVKVFFSGMLLITSLWLISLLAS
FT                   FIDVLYLWPLAAIIALIFTVFMAQKYGAIALVSCLGVGVVLSAVIAFMTVNQWAKPLPA
FT                   DLAWTPLSQESINQQVAQGKTVFVDVTADWCITCKANKVGVILQDPVYSLLQQPHIVPM
FT                   KGDWTTPSEPITHYLQSHNRFGVPFNVVYGPGAPQGIELPEILSTDLVLAAIVQASASP
FT                   EKSSVAAGK"
FT   sig_peptide     130468..130545
FT                   /locus_tag="Sputcn32_0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            132749..133573
FT                   /locus_tag="Sputcn32_0115"
FT   CDS_pept        132749..133573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0115"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: vfi:VF2492 copper
FT                   sensitivity protein ScsC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73851"
FT                   /db_xref="GOA:A4Y1L8"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041205"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1L8"
FT                   /protein_id="ABP73851.1"
FT                   /translation="MSKFNSLFSSLLKNRKLQMFAVSGVAMAMLVVSLPSLTTSAHAKD
FT                   SSLSAAQQQEVRAIVKDALINDPDLMREAILAWQAREQQGADAAMQASLASHHQAMYET
FT                   KSDPWKGAATPEISMVYFTDFNCPYCKKIEPSLNKLIEEFPQLKIIIKMVPLQGEGSQM
FT                   AVDFAQTVWLNEPEKYLKVKDMLMSSPRGLDAAAIAKVAKLTDTERWVGNTDERVAKMV
FT                   DDNINLMNYLGIGGTPSMIVADTLIPGLVPYEELKAQLEAAIAAKDKTQKIR"
FT   sig_peptide     132749..132880
FT                   /locus_tag="Sputcn32_0115"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.972 at
FT                   residue 44"
FT   gene            133599..134123
FT                   /locus_tag="Sputcn32_0116"
FT   CDS_pept        133599..134123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0116"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: ppr:PBPRB1492
FT                   hypothetical thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73852"
FT                   /db_xref="GOA:A4Y1L9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1L9"
FT                   /protein_id="ABP73852.1"
FT                   /translation="MNAEQVSISLPKRILGWIKQLALWLLIVLVLTSVMDIWRGKDIPR
FT                   DNLPPLQGMTLTGVEVDIAKLSQDQAVLVYFWGTWCPVCNYVSPAVSQMSAYYPVVTVA
FT                   MSSGEDDKLRKYLQHQGYGFDTINDSDSKIARDWSLQATPTIMIVKEGELKHYTTGFTS
FT                   LPGMWWRMLLA"
FT   gene            134168..134560
FT                   /locus_tag="Sputcn32_0117"
FT   CDS_pept        134168..134560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0117"
FT                   /product="protein of unknown function DUF1090"
FT                   /note="PFAM: protein of unknown function DUF1090; KEGG:
FT                   son:SO0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73853"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1M0"
FT                   /protein_id="ABP73853.1"
FT                   /translation="MQIKPVILGLVTGVAFSLPVFADDVPQRGCAAKLEAISQQIEHAK
FT                   TAGNTYKVAGLEKAYKEVMTHCNDDKLYAERLAKIQALEAKLVERQNELTQTVKEGRPM
FT                   DKVSKKQAKVAEVEAELAKAREELER"
FT   sig_peptide     134168..134236
FT                   /locus_tag="Sputcn32_0117"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            134709..135977
FT                   /locus_tag="Sputcn32_0118"
FT   CDS_pept        134709..135977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0118"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   shm:Shewmr7_0112 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73854"
FT                   /db_xref="GOA:A4Y1M1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1M1"
FT                   /protein_id="ABP73854.1"
FT                   /translation="MDQEIRLEISKWLAGFGIDSQPSDGMSTTIIIFACLLLAGIAYFI
FT                   VRRVVIRAVNMVIQRSKVTWDDVFMRHKVLEKLAMVVPAIVLNLLIPIALTEHPLLSGL
FT                   VDRLLSIWLVVLMIRAIYAALDAVDEISDVNLVGRRLPVKSFVQLTKLFLFFVGIIVSI
FT                   SILADQSPVYFLSGLGVATGFVMLVFRDTILGFVAGIQLAANRMVSKGDWIQMDKYGAD
FT                   GAVEEVSLTTVKVRNWDKTITMIPAYALVSDAFRNWRGMSESGGRRIKRAVNIDINSIK
FT                   FLTEDDRNRLSKINCLKEYFPAKINEIRESNAKVSDLDMIVNGRHLTNVGTFRAYLQEY
FT                   LQRHDKVHKDMTLMVRQLAPTTEGLPIEIYIFTNDTRWAFYEAIQADIFDHIFAVLPEF
FT                   GLQAFQAPTGNDIRSLKSVKVEG"
FT   gene            complement(135974..136597)
FT                   /locus_tag="Sputcn32_0119"
FT   CDS_pept        complement(135974..136597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0119"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   shm:Shewmr7_0113 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73855"
FT                   /db_xref="GOA:A4Y1M2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1M2"
FT                   /protein_id="ABP73855.1"
FT                   /translation="MHPDTWLLYLFAIVLIGISPGPIAMLSMSHGIHFGKIRSIATGLG
FT                   SVSAALILMMASAAGLGAVISASDYGFTLLKWCGAAYLVFLGIKLLLTKSHAAPIEVSQ
FT                   LKGKGTPKQLYKQAFLVGISNPKDLLFFAALFPQFIDISAPQVPQLTLLALTWAVVDFG
FT                   FVMIYASMANVLAPTLRASNKLHWFDRTSGGVFLTLAVILISRD"
FT   gene            complement(136618..137181)
FT                   /locus_tag="Sputcn32_0120"
FT   CDS_pept        complement(136618..137181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0120"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   shm:Shewmr7_0114 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73856"
FT                   /db_xref="GOA:A4Y1M3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1M3"
FT                   /protein_id="ABP73856.1"
FT                   /translation="MFTILCRWLLNISGWQIEGQLPDCAKYIVIVAPHTSNWDFIVGVL
FT                   ARGALGTRIHFLGKHQLFIPPWGWFFRAIGGSPVDRRKNNNLVDTAIQLFESKADYKLA
FT                   LAPEGTRSPVTRWKCGFYHIASKAGVPITPVGLDFSRRTVIIRTPLQPCGDITTDMQDI
FT                   LSFYRTIKGRHPKVIPDFVASDKH"
FT   gene            137302..137754
FT                   /locus_tag="Sputcn32_0121"
FT   CDS_pept        137302..137754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73857"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1M4"
FT                   /protein_id="ABP73857.1"
FT                   /translation="MLKKGRLNKLVLQRVLAALLLLVTCHVNAVPTDDITQMLKGQEDA
FT                   WNRGDLNAYMQGYWKNEQLRFVSNGKFSYGWEATLAAYKKNYPNKEALGELKFTIKEIK
FT                   MLSNYAAMVVGRWDLRRAKDAPSGVFTLLVEKIEDRWVITMDHSSD"
FT   sig_peptide     137302..137391
FT                   /locus_tag="Sputcn32_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            complement(137763..138545)
FT                   /locus_tag="Sputcn32_0122"
FT   CDS_pept        complement(137763..138545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0122"
FT                   /product="protein of unknown function DUF833"
FT                   /note="PFAM: protein of unknown function DUF833; KEGG:
FT                   shm:Shewmr7_0116 protein of unknown function DUF833"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73858"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1M5"
FT                   /protein_id="ABP73858.1"
FT                   /translation="MCILFVAINAHPQYPLIICANRDEFHHRPTAPAHYWSPDHNILAG
FT                   KDMQAGGTWFGVNKQGQVAGVTNLRVPQKSPEAMRSRGELITKALSSGSLICPNWLAEH
FT                   SDNYQPFNLVFGQGVHLYCFNSLNKQTIKLSDGFHAISNGALDDIWPKMAKGQQALEAL
FT                   INQSQSIEIPALLQLMKDDSQPLDNELPNTGIGLEWERRLAAIYIRHPDYGTRSTSVLL
FT                   EDVQGSMHFTEVRYDGKGRKLGQQDFHFMLPATTNTGS"
FT   gene            complement(138608..140221)
FT                   /locus_tag="Sputcn32_0123"
FT   CDS_pept        complement(138608..140221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73859"
FT                   /db_xref="GOA:A4Y1M6"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1M6"
FT                   /protein_id="ABP73859.1"
FT                   /translation="MLYLLASCLALLIGPLFYRYFSSGSGLQKGLDGFIFVSLGGLVLI
FT                   HILPELLEHGGILAIVFVILGLWGPTASERLFHRYSEITHNFALFLGISGLLLHTMTDG
FT                   SAMVLAQQEGNSILLALGVILHRLPVGFAVWWILKPHLGIRWTLVIFAAIMVFTGIGYF
FT                   ASEQLLSHTSIDKTVYLQAFVTGSILHVVLHQPHGQHETDKQGKYEYQAGIGSLLGIAL
FT                   LMALLLMDTGGHQHAHHDHSTEQLIPWLLILAPILLLSYTAAAVRFKFGLTPQDNSLTR
FT                   RWFQRLAGPEALIITFLLLGPWFALFQLVVTLIMSVYLSYAQVQITDPHSQLPHRALHF
FT                   GFAHLVDRSAPWILLSLVLVNLIGHPSVPLNHPVLQLIVLLLVFLPMRFCNLGAAVLAL
FT                   ALAYSGWSPLAIILPLIAAPVLNIAQLKLMTWQQRGVLLSLIAIALIASMRLPVWFSLV
FT                   TLPEIINILALLILSALFAASLLRLGPRQFLRRLMLGKAESHQHGHAHNEHSHGHPPVK
FT                   NQSHTHSHGHSKADKDSHHH"
FT   gene            140628..141221
FT                   /locus_tag="Sputcn32_0124"
FT   CDS_pept        140628..141221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0124"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: son:SO0129 conserved hypothetical protein
FT                   TIGR00427"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73860"
FT                   /db_xref="GOA:A4Y1M7"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1M7"
FT                   /protein_id="ABP73860.1"
FT                   /translation="MDIFSAAVMLFLIMDPLGNLPIFASILRHIEPKKRRKVLIRELLF
FT                   ALVIMLAFLYAGEAILSFLNLRSESVSIAGGIILFLIAIKMIFPQPGGVVGLAAGEEPF
FT                   IVPMAIPLMAGPSILAALILLAHTDGSRMGDWTIALVSAWAASAVILMFYKLFTRMLGE
FT                   KGLTAVERLMGMVLVMISVQMFLDGVSNYMKTTG"
FT   gene            141509..144118
FT                   /locus_tag="Sputcn32_0125"
FT   CDS_pept        141509..144118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0125"
FT                   /product="peptidase M6, immune inhibitor A"
FT                   /note="PFAM: PKD domain containing protein; peptidase M6,
FT                   immune inhibitor A; KEGG: shm:Shewmr7_0119 peptidase M6,
FT                   immune inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73861"
FT                   /db_xref="GOA:A4Y1M8"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1M8"
FT                   /protein_id="ABP73861.1"
FT                   /translation="MRGKLKMRSINDITAFVLMLALMSGASIAAPNHTPADAGVINKER
FT                   ILYWLIERGEVSVDASESVKQAAVEAYIHRATLAQPKAPRIEVEAEHARLQQSKSSKLM
FT                   RSPAQRLVADADVTKTVKVLAVLIDFPNLKYNNNGLKTGDTEMFYPSYPVAHYKDLLFS
FT                   TSGFKGPQGQTFDSGYQYYQAVSGKTFFFTGDVKGWYTASQNAEYYGANDAQTDSDANV
FT                   TELIKEAVSQAVADMSAAELASYDVEDPYDLNNNGNLDEPDGIIDHVMIFHSSIGEEAG
FT                   GGKLGANAIWSHRYFVDQRTRGYAIPNSTKKLFGYTIQPIDAGTGVCTHEFGHDLGLPD
FT                   EYDTSSNTNKDGSPVGLWSLMSGGSWAGSIAGAQPSGFSPYARSYLQEKYKGKWLNERE
FT                   ITLASIPKSGMELTLNEAVNHQAVNQISIPLPAAPIPFKAPYQGRYQYYSGQGNMLNNS
FT                   MSFAVNLPTVTSDKLTLTMKASWSMEPDYDYMQVKVRGTAIPGNYTKSVNAMNSARHII
FT                   TGESSAIPQAEGNDAWVTLEYDLSGFSGTAVPIEINYVTDEYASESGVTIDNISIKQNT
FT                   TELYADNAEVAGKVTLNGYSRIQDARPGAPSRYLVQLRSHNGVDAGLRVAGFDPGVLLW
FT                   LENLSYYDNNVSAHPGYSLIGVIDADQNMIGTRSTDEQIRDAAFSTVRQTAFAGDSHLN
FT                   AVSLFDDSLDYSAPLQPQSGMVLQKLGLTMEVLSQASNNSTAVVRLANANSAVIVPLTV
FT                   SFTKTVNQLAVNFVSNTQGAVGAVTYAWDFGDGTTSTAAAPTHTYTAAGTYTVTLTVTD
FT                   TQNTTASSSSTVTVTASVTPPVTPPSSEGSGGGGGSLGWLSLAFLGLFAWRRQLHAY"
FT   sig_peptide     141509..141598
FT                   /locus_tag="Sputcn32_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(144195..144755)
FT                   /locus_tag="Sputcn32_0126"
FT   CDS_pept        complement(144195..144755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0126"
FT                   /product="chorismate lyase"
FT                   /EC_number="4.1.3.-"
FT                   /note="PFAM: Chorismate lyase; KEGG: son:SO0131 putative
FT                   chorismate--pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73862"
FT                   /db_xref="GOA:A4Y1M9"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1M9"
FT                   /protein_id="ABP73862.1"
FT                   /translation="MNVTSLSFPYGESIQWFCADRTDKLPPSPLKEWLLAPGSLTKKLK
FT                   TCCNQFEVKVLGEGQLAPFKDEYPQQGSVWVREVLLCLDNVPWVFARTLIPLSLLSERE
FT                   ADFLGLGSRPLGELLFSQDNFIPGRIEVASFDTGSRLAHLAASLDQRVEHLLWGRRRYF
FT                   HHGQDEMIVSEIFLPAAERAICQ"
FT   gene            144870..145292
FT                   /locus_tag="Sputcn32_0127"
FT   CDS_pept        144870..145292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0127"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: she:Shewmr4_0127 flagellar basal body-associated
FT                   protein FliL"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73863"
FT                   /db_xref="GOA:A4Y1N0"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1N0"
FT                   /protein_id="ABP73863.1"
FT                   /translation="MKKLLTACLMVFGVVFSVYAADEKETPPATPPVANYAYYGFDPEI
FT                   VTNYISNRKKLGFVKISVELMVKNPEDLLILQRHDPLLRAALVEILGNQSEEKVKSLIG
FT                   REEIRRECFDMLNNLIIKESGKSIILNLLFTSYLYD"
FT   sig_peptide     144870..144932
FT                   /locus_tag="Sputcn32_0127"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            145349..146422
FT                   /locus_tag="Sputcn32_0128"
FT   CDS_pept        145349..146422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0128"
FT                   /product="protein of unknown function DUF890"
FT                   /note="PFAM: protein of unknown function DUF890; KEGG:
FT                   shm:Shewmr7_0122 protein of unknown function DUF890"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73864"
FT                   /db_xref="GOA:A4Y1N1"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="InterPro:IPR016909"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1N1"
FT                   /protein_id="ABP73864.1"
FT                   /translation="MPKPPRSTQILSCNAPNGKPKTQHPSARAKVKRTPVNTRSIAEIK
FT                   KALHPRNVHINGYDFNALIKAFPRLNAFVRPTSFGGLSIDFADPEAVKTLNTALLKHHY
FT                   GIDFWDIPKGALCPPIPGRVDYLHYLADLLAEGDHHLVMDRVSVLDIGTGANGIYPILG
FT                   CQVFGWHFVASDINSISLANVQGIIAQNPALHGRLNLRLQGDESAIFKGVIQPQERFEL
FT                   TLCNPPFHASLAEAAEGSLRKVRNLQLNRGRTAKPVAKLNFGGQGAELWCQGGEPQFLA
FT                   TMIDESQAFADQCLWFTSLVSKKENLKPCYQALAKLAVDTVKTIEMQQGNKMTRILAWS
FT                   FQSAAKRKIWRNAHLSD"
FT   gene            complement(146543..147205)
FT                   /locus_tag="Sputcn32_0129"
FT   CDS_pept        complement(146543..147205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73865"
FT                   /db_xref="GOA:A4Y1N2"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1N2"
FT                   /protein_id="ABP73865.1"
FT                   /translation="MDSQNSVFDRSTTNDTIIGAGLYNLVIGLTLVWGFAVNYWMVTNI
FT                   DPNTIASINPWIFFIGYFASCFFGIYLFQKSSNPVVSFIGYNFVVVPFGLIINMVVSQY
FT                   DPELVTEAIRITGLVTVAMMCLGTLFPAFFQKIAGALTIALLLVIVVELIEIFIFNTHH
FT                   GILDWIVVLIFCGYIGYDWGRANQIPKTIDNAIDSAAALYMDIINLFLRILRILGRK"
FT   gene            complement(147273..148031)
FT                   /locus_tag="Sputcn32_0130"
FT   CDS_pept        complement(147273..148031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0130"
FT                   /product="[molybdopterin synthase] sulfurylase"
FT                   /note="TIGRFAM: molybdopterin synthase sulfurylase MoeB;
FT                   PFAM: UBA/THIF-type NAD/FAD binding protein; MoeZ/MoeB
FT                   domain protein; KEGG: son:SO0137 molybdopterin biosynthesis
FT                   MoeB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73866"
FT                   /db_xref="GOA:A4Y1N3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1N3"
FT                   /protein_id="ABP73866.1"
FT                   /translation="MNDQVDILSDSELLRYSRQISIKAMDIDGQERLKQAKVLMIGAGG
FT                   LGCAASQYLTVAGIGELTLVDFDMVELSNLQRQVLHQDANIGQPKVASAKQTLSQLNPH
FT                   VAINTINAVLDDHEFDALIADHNIVLDCTDNVSVREQLNLCCFKHKVPLISAAAIRMEG
FT                   MVTVFDYQVETPCYHCFSALFGEQQLSCVESGILAPVVGMIGCLQAVEAIKVITGMGKT
FT                   LAGRILMIDAMTMEFREMKLPKQPHCKICQ"
FT   gene            complement(148044..149297)
FT                   /locus_tag="Sputcn32_0131"
FT   CDS_pept        complement(148044..149297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0131"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV; KEGG:
FT                   shm:Shewmr7_0126 molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73867"
FT                   /db_xref="GOA:A4Y1N4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1N4"
FT                   /protein_id="ABP73867.1"
FT                   /translation="MSVKADPCSQPSLMHPDQAIPLLLEQVSPVSDTEVVPLPHALGRV
FT                   LAEDLASCIDLPPFDNSSMDGYAFRFADLNTQTNRTSLRLIGSAFAGHGFEGKAKANTC
FT                   VRIMTGAPVPVGYDTVQMQEETEVQGELILINHPKGKGANVRCKGEELTQGTKVLTAGT
FT                   QIGAAELGVLATIGVSQVRVYRQLKVAFFSTGDELRPVGSELAPGQIYDSNRYSIQGLL
FT                   SRANVEWIDLGVIADDPEAIRQAFRTAASQADMVLTSGGVSVGEADFTKQILDEEGQIT
FT                   FWKLAIKPGKPFAMGRIGKAVFCGLPGNPVSSMVTFYKLVWPILNKMQGLTPVTPLMLD
FT                   AILTTPVRKHPGRVEYQRGVLSRNTQGELEVAITGSQGSGMLTSMSLANCFVILEQSQG
FT                   DTPAGSKVTVEPFNTVLC"
FT   gene            149639..150175
FT                   /locus_tag="Sputcn32_0132"
FT   CDS_pept        149639..150175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0132"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG: son:SO0139
FT                   ferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73868"
FT                   /db_xref="GOA:A4Y1N5"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1N5"
FT                   /protein_id="ABP73868.1"
FT                   /translation="MLSAAMIDKLNEQINMEFFSSNLYLQMSAWCEDQGFEGAAKFMRE
FT                   HADEEMGHMRRLFTYVSETGGLPLLGAIEAPQSQFSSLLALFELTYEHEQLITRQINAL
FT                   AHAAFANQDYSTFNFLQWYVAEQHEEEKLFKSIVDKIRLVGEDGKALFFIDKDLAKLAS
FT                   KGGESIMNGQSQPQA"
FT   gene            complement(150238..153471)
FT                   /locus_tag="Sputcn32_0133"
FT   CDS_pept        complement(150238..153471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0133"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: shm:Shewmr7_0128 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase,
FT                   HAMP region domain protein; PAS fold-3 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73869"
FT                   /db_xref="GOA:A4Y1N6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1N6"
FT                   /protein_id="ABP73869.1"
FT                   /translation="MPSTLHHLSLKQKLILFSLLPLLMMGFFVLTRMYVLAKEYRAADH
FT                   SHLAIQTTAQVTDLLYQLQNEYSLSVNGSQAATPSDETELQQQQTNTKKALTHLLTSTS
FT                   FATLIDALTGAQPASEQLQAQRDAIALSSHNLASARQGVSDKQPQALIELYFQLNKQLL
FT                   QLLQLLQLQTNDINQSRAYTDLLNLITVQELAVKERNVINQMLLSKELNITDYRTISTV
FT                   IYEYGQAILHASNASISTKQSLIHQVQTSPESLQILKISQQIEQQLRISTLAKTINAHL
FT                   GYGGLIDSFQDYRLTGTDAAQQKFNATLSIIRLNLAELNHEIRHLPELATPVNVVENTI
FT                   EQYAFYMGKLHELKQQQRPLEDINGLLNIKKTQLNEAMGKLLMPPHPVTSQLWWKLTTD
FT                   RINKLHAISKEMTQSMALQSEYLKTKALTLLGLYLFSAFLTATITLWLGRKIISNFMEK
FT                   ITRIANGMQQMAADPTLNININISGSDELARMARAMNRMISERQKASHALSRAAAVFNY
FT                   SAEGIVVTDAENHIELINPAFTQITGYTLNEIKGHNPSILSAKRHQPHFYTAMWQSLQK
FT                   EGKWEGEIWNKRKDGEVYPEYLAITVVKNEQGEIIQHIGLFMDISKRKQYEQDLWYQAN
FT                   FDSLTGLPNRKLFNERLQHEIQLAQHDSRKLAILLIDLDQFKYINDVQGHATGDLLLQD
FT                   VAKRLESIGGQNDFIARIGGDEFVLILPRLTNELAIEHMATRIIETLATPFSLNEREIQ
FT                   ISASFGIGVYPEDGLDVSSLTRNTEMAMYQAKDAGRNNFKYFTSGMNQAMFARMELEQR
FT                   LRRAVAQNEFALHYQPIVDMKTGQVCSVEALIRWQDPDLGLIPPDHFIGIAEETGLIEP
FT                   MGEWVLNQAMSDLRQWQKSGLNINVAINVSGRQCINTRGMSFDQVLQECFNRHHINPRN
FT                   VHIEITESMLMGDASHCLSTLNAIRQLGSQIYIDDFGTGYSSLSYLKKYPISVIKIDRS
FT                   FVEHALESTSNANLVKAIVMMGQSLEMKLVAEGIETPAQWNFLKDLGCDFAQGYLISKP
FT                   LPFDDVTPLLKQKYQIRLDSDGEAECSNF"
FT   sig_peptide     complement(153358..153471)
FT                   /locus_tag="Sputcn32_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.987 at
FT                   residue 38"
FT   gene            complement(154012..154665)
FT                   /locus_tag="Sputcn32_0134"
FT   CDS_pept        complement(154012..154665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0134"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   KEGG: shm:Shewmr7_0129 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73870"
FT                   /db_xref="GOA:A4Y1N7"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1N7"
FT                   /protein_id="ABP73870.1"
FT                   /translation="MNQSLLAPFGTAIERVEAGLNALRQGQGVLVVDDEDRENEGDLIF
FT                   AAQTLTNTQMAMLIRECSGIVCLCLPDEKVKALELPPMVENNSSQYGTAFTVSIEAKVG
FT                   VTTGVSAADRVTTIKAAIADGAKPSDLARPGHVYPLRAQPGGVLTRRGHTEGTIDLMQL
FT                   AGLKPAGVLCEVTNPDGTMARLPEIIAFGAQHNIPVLTIEDIVLYRKSLLANVG"
FT   misc_binding    complement(154858..155085)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 56.54"
FT   gene            155253..157388
FT                   /locus_tag="Sputcn32_0135"
FT   CDS_pept        155253..157388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0135"
FT                   /product="Oligopeptidase B"
FT                   /EC_number="3.4.21.83"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein; peptidase S9A, prolyl oligopeptidase
FT                   domain protein beta-propeller; KEGG: she:Shewmr4_0136
FT                   oligopeptidase B"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73871"
FT                   /db_xref="GOA:A4Y1N8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1N8"
FT                   /protein_id="ABP73871.1"
FT                   /translation="MRSLLLTLGITMLLSGCSTQKGQIPAPIAEKIPHVMTLHGVTRTD
FT                   DYYWLRDDERKDPKVLAYLNAENRYTAAYFKPLKPLQDGLYKELTERLVADESSVPYQW
FT                   HQHSYYRRYQEGSEYPLISRKGADGVEQVMLDVNERAKGHEFYGLGGASVSPDETMLAF
FT                   GEDVLSRRVYHIYFKDLASGDMITDVLENTEGRVVWGNDNRHVFYIAKDLKTLLGYQVY
FT                   RHELGTPQSRDILVYEEQDDSYYLSLGKTLDESQIVLFHENTTTSEVSVLDANDPLGLF
FT                   KPVLPREEGHEYSVSKLGDTYYILTNWQATNFRLMKVAIKDAADKSKWQEVVAHNPYAR
FT                   LEDELVLKDYLIIQTRENGLTRIKVMPFNGQKPFELSFDEPAYVLGLDVNAQQDSDKLR
FT                   VFYSSLTTPEAIYEYHLTNPDRRDLLKQEQVLGGFDASQYRAERLFVTARDGAKVPVSL
FT                   VYRKDKFKKDGTNPLYQYGYGSYGYTVEPDFSSSVISLLDRGFVYAIAHVRGSEMLGRP
FT                   WYDAGKLLNKKNTFNDFIDVTTALTEQGYGDKNKVVASGGSAGGLLMGAIANMAPEKYF
FT                   AIAAHVPFVDVVTTMLDESIPLTTNEYDEWGNPNEKTYFDYMLSYSPYDNVTEHEYPHL
FT                   LVTTGLHDSQVQYFEPAKWVAKLRDVQNKWYKFDDKVLLLDVNMDAGHGGKSGRYRQYQ
FT                   DTAQEYAFFLNLLGITK"
FT   sig_peptide     155253..155321
FT                   /locus_tag="Sputcn32_0135"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.390 at
FT                   residue 23"
FT   gene            157399..157842
FT                   /locus_tag="Sputcn32_0136"
FT   CDS_pept        157399..157842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0136"
FT                   /product="Excinuclease ABC, C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC, C subunit domain protein;
FT                   KEGG: shm:Shewmr7_0131 excinuclease ABC, C subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73872"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1N9"
FT                   /protein_id="ABP73872.1"
FT                   /translation="MTDLAIETANPDHLASSEQRASQAQAVNNAQLSCKSEALGAEQAV
FT                   TSEQGATSEIVQASTWYLYLIRCANGHLYTGITTDVARRFNEHQSSSPKAAKYLRGKGP
FT                   LTLMYQEQVSTRSDALRREIAVKKLSRNQKLALIESERGLLER"
FT   gene            158259..159137
FT                   /locus_tag="Sputcn32_0137"
FT   CDS_pept        158259..159137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_2140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73873"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1P0"
FT                   /protein_id="ABP73873.1"
FT                   /translation="MHGVCKLCNQEAKLELSHFIPKFIGKWLKKTSITGYLRDGNQVSK
FT                   RQQDIAKEYWLCGACEDLFSTWERTFSVKIFHPYMKNSSLVAVYGNWLSKFAASLSWRT
FT                   LTYVRSKNSHETKPQEYLEMLAKAEEGLANFLLCKSSNLYEFEQHIFPLDVIESTNFDN
FT                   LPTNINRYFLRAIAMDIVGNSQGTYIYTKLPSFIVIGVIKSKQSKQMRSSRVAISGGTI
FT                   SPRQYVFPDGFDGYIRDAANKISELYEQIPEEQLAKIEKYVIDNVDKVVGSKLFEAIVH
FT                   DYERFGRKSLR"
FT   gene            complement(159624..160316)
FT                   /locus_tag="Sputcn32_0138"
FT   CDS_pept        complement(159624..160316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73874"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1P1"
FT                   /protein_id="ABP73874.1"
FT                   /translation="MDISSFKKYIKLAPENVSEWQKWENSLPTFDSILPILDYIYNAEW
FT                   QQDDWKAIMAFIRKGYFEQNKSSELVDGIKHVNIFNSNVINVKVDVAISLNCSIARSLE
FT                   SINLCSDAVESLSVSHASKLSEITGNTQRLSYLSLNKCQKLDFFSIISTLDSVKILDLS
FT                   GNPQLSSIDALRGNKNIFALYLVETNVIKTKETIDILTSMPNLKKIWIKANKKELELLR
FT                   EALPGIVN"
FT   gene            complement(160379..160621)
FT                   /locus_tag="Sputcn32_0139"
FT   CDS_pept        complement(160379..160621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73875"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1P2"
FT                   /protein_id="ABP73875.1"
FT                   /translation="MGEIPPISLEKTILQIQHEHASLATHQLNLLIAKRILREFSHHQD
FT                   AIHITMHYLTKAEALAPLSKSDLRFKALVSSNKRE"
FT   gene            complement(160649..160849)
FT                   /locus_tag="Sputcn32_0140"
FT   CDS_pept        complement(160649..160849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73876"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1P3"
FT                   /protein_id="ABP73876.1"
FT                   /translation="MDQFSEYQKAIELLSLSDNPRQIMEGLGDICFDGESLYHNGNKAL
FT                   AIHIFKHIYALDAHSDYFSHA"
FT   gene            complement(161124..161897)
FT                   /locus_tag="Sputcn32_0141"
FT   CDS_pept        complement(161124..161897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0141"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: shm:Shewmr7_0138 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73877"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1P4"
FT                   /protein_id="ABP73877.1"
FT                   /translation="MPLRPFIFILAFILVFTAGVSLTGCIINVNAAGMPDLDHQQRELT
FT                   LDSQGLQGLIAETGAGNLEIIGVEGLSQIKLIADIYTNDDSKIILTLEKKANKARLKAT
FT                   FEQSSFTNNSSYMDIKLQVPAHLTLDIDDGSGAILISKITADINVKDGSGELIINGGHN
FT                   VSIDDGSGDIDVSQMSGNLAIVDGSGAIKVTDIQGNIVIDDGSGSIAVANVLGAVTITD
FT                   GSGDINVVNTKGLTILAAGSGNVNFDKIDGPVSMK"
FT   sig_peptide     complement(161802..161897)
FT                   /locus_tag="Sputcn32_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.948 at
FT                   residue 32"
FT   gene            162172..162939
FT                   /locus_tag="Sputcn32_0142"
FT   CDS_pept        162172..162939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0142"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: shm:Shewmr7_0139 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73878"
FT                   /db_xref="GOA:A4Y1P5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1P5"
FT                   /protein_id="ABP73878.1"
FT                   /translation="MDYLTTNKTAWDARTRVHLTSDFYDVEGFLSGNTSLREIELNELA
FT                   VAGKSLLHLQCHFGLDTLSWARMGAKVTGVDLSEVAIVEAQKLAQRTQLAAEFICSDVY
FT                   SVASKVEPHDIVFTSYGAIVWLPDLTLWAQTIARCLKPGGQFYMAEFHPAQQLFDGYSY
FT                   FNRGEPDIEQEGTYTENAGDDQQTLMCWSHSLSEVINALLQAGLELAFFHEFDFSPYNC
FT                   FAGLEAQTDGRYVLTHQGQNVPLVYSISARKPA"
FT   gene            complement(162965..164956)
FT                   /locus_tag="Sputcn32_0143"
FT   CDS_pept        complement(162965..164956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0143"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /note="PFAM: peptidase M14, carboxypeptidase A; KEGG:
FT                   she:Shewmr4_0145 peptidase M14, carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73879"
FT                   /db_xref="GOA:A4Y1P6"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1P6"
FT                   /protein_id="ABP73879.1"
FT                   /translation="MGFFMRLFSLSVIAIACLSANHVSFANEVNTVTPETVVTSAPQEV
FT                   VPLKAIENTQTIETQKNVAVNTAGATEGTQPAPIPERAKTFVNDAILPPNITWHGASEA
FT                   LMLSIDNEWATPFEQSNGIESPSYDDTILWLDRLAAETTSLQKVSLGKSPQGRDIWMYI
FT                   ASSEGISESASLKQNTKPTILVQAGIHAGEIDGKDAGMMLLRDIVKGNKSDLLEKANLL
FT                   FVPIFSVDAHERSGEFNRVNQRGPVNMGWRTTTNNLNLNRDYAKADTLEMQHMLRAINV
FT                   WQPDLYIDVHVTDGIDYQYDVTFGYNLAQGLSPASYRWLENSYRPAIEAALTEQGHIPG
FT                   QLIFAVDNADITKGMSLWNPSPRFSNGYGDARHLPTILVENHSLKPFKQRVLGTYVMLE
FT                   QTLKTVGEQATKLKSAIQEDKYRASPLITLTWKSAPLEKGWDFKGIDYKLEKSPISGAD
FT                   VVRWTGEPKLYPNLPVMAETVPDLKVTRPSAYYIPAQWTQVIDRLNLHGIRMTALKKPT
FT                   ELKLQQYQLSHTVFSAKDFEGRQTVKVVSELTKLTTVLPEGTIKVSTDQPLGDLAVLLL
FT                   EPQSPDSLLQWGFFNPIFTRTEYIEDYAVEPLAAKMLKEDPKLQTEFDKALTNPEFAAD
FT                   PDARLRWFYERSPYYDNQYLKYPVYRSR"
FT   sig_peptide     complement(164876..164956)
FT                   /locus_tag="Sputcn32_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(165116..166231)
FT                   /locus_tag="Sputcn32_0144"
FT   CDS_pept        complement(165116..166231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73880"
FT                   /db_xref="GOA:A4Y1P7"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1P7"
FT                   /protein_id="ABP73880.1"
FT                   /translation="MSVFAPATPFADFIYRHFRSIHALKLGLALLIAVTINAIWAPPHF
FT                   IWSMVTIVIIMMSLPQVGGAIEKSLQRAIGTCLGSAYGVMLVATVDSYWLMMSLLILAV
FT                   SLICFISAGRYSYAYLVAGFTIIIVVGDANHDTSEALWRTANILSGCVIAILVSLFIFP
FT                   IQAKQDWRSQLTHAIENMANVLTKHLKAPANHSLDFRTELEAAMKAVLTQKKLFFSLEW
FT                   ESKTLKKHKVLLAQLVNKQVRLITLLELLPLTRWQEEDKDAYHQINSIAAELALYLQQL
FT                   AEFIAGNTPQLPTLPEHLELQLQQRLQLTLPMASGMASPDITPLSHQAPQGFALTGYSW
FT                   LIYQLAIAVEALYEDISIIDSAYNKPPAKSN"
FT   gene            complement(166470..167720)
FT                   /locus_tag="Sputcn32_0145"
FT   CDS_pept        complement(166470..167720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0145"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   she:Shewmr4_0147 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73881"
FT                   /db_xref="GOA:A4Y1P8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1P8"
FT                   /protein_id="ABP73881.1"
FT                   /translation="MKNKSLLGNIGVQVVIAMMLGALVGFIMGDSASVFAPLGTIFIHL
FT                   VKMLVIPLVLVSIISGAASLGDSPSAGKIGVGTFGFFIVTSGFAVVLALVMGNLFKPGA
FT                   GVDFTAHSSTGLMEVTKEQGALPGVMDTFIGMIPTNVFESLNGGNILQILVFSIFFGIA
FT                   LTKVKGDGAKPILAALNTVVDAFVWMINCVMIIAPIGVFGLMADSVGTFGFDALEVVFK
FT                   LFAVFVAAILIYGFIFFPLVVQLFSRVSALQFISAMKKPQVMALSTASSMATLPVNMET
FT                   CEVDLKVSKATTAFVLPLGATINMSGNAIYYGLVAMFFAQMYNVDLSITAYAAIIFTST
FT                   LGAIGQAGVPGPSFLVVAVLLAAGIPIDGLPLLFALDRVFDMIRTALNITGDAACALVM
FT                   DKYTDGEVEADNGRSFS"
FT   sig_peptide     complement(167622..167720)
FT                   /locus_tag="Sputcn32_0145"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.713) with cleavage site probability 0.387 at
FT                   residue 33"
FT   gene            complement(168175..168672)
FT                   /locus_tag="Sputcn32_0146"
FT   CDS_pept        complement(168175..168672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73882"
FT                   /db_xref="InterPro:IPR020354"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1P9"
FT                   /protein_id="ABP73882.1"
FT                   /translation="MRFIMQVDSTQTVDLLISHSQIIVRSREFNEDLSQWGRGNITQGA
FT                   LLHRDYLLFDPIVEGAFGANVILSICHEFKMDPACQRCILAPFCVVDKDQLEVASAAEK
FT                   FKIYLPLNDELYSVYYEVCEGEEVFYKLTFTPSTHVVTPQYLLADHWGGEKGKKIIAGF
FT                   AE"
FT   gene            complement(168674..170233)
FT                   /locus_tag="Sputcn32_0147"
FT   CDS_pept        complement(168674..170233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0147"
FT                   /product="AbgT putative transporter"
FT                   /note="PFAM: AbgT putative transporter; short chain fatty
FT                   acid transporter; KEGG: son:SO0160 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73883"
FT                   /db_xref="GOA:A4Y1Q0"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Q0"
FT                   /protein_id="ABP73883.1"
FT                   /translation="MVNHKSATGFQRFLNTVETVGNKLPDPAVLFAMFLGLVWLISWWL
FT                   SGVSFDEIDPRSGNPIQIVNMLDGAALTAFTSTMVSTFVTFPPLGVVLVAMLGLGVAEH
FT                   TGFINAGLRSILSVTPKMLLTPVLIAVGILSHVAVDAGYVLVIPLGAVIFYAAGRHPLA
FT                   GIASAFAGVSGGFSATVGVPSSLDPMLAGLTQAAARLSADPAAADLTINPLNNIFFTSA
FT                   SALLIILVGWFITDKIIEPRLKNTTVNGDPATLPTLDELQPHERRGLRFAMASMLFCAL
FT                   ALVLTAYGDHSAWRGEDGALTSASAPLMRSIVAIIFVFFLIPGIVYGYAAGTANNHRAI
FT                   IQGMSKSMSGMGYYIVMAFFCAQFIYAFGQSNLGALMAIKGALALKELALPMGVTLVGI
FT                   VFLTALVNLLVGSASAKWALIGAIMVPMLMELGVSPDLTQAAYRVGDSSTNIITPLMPY
FT                   FPLIVVFCQKYVKESGIGTLVALMLPFSISFLLLWSGFLLGYWALGLPLGIGSSLTFPA
FT                   LP"
FT   gene            170535..172130
FT                   /locus_tag="Sputcn32_0148"
FT   CDS_pept        170535..172130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73884"
FT                   /db_xref="GOA:A4Y1Q1"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Q1"
FT                   /protein_id="ABP73884.1"
FT                   /translation="MNIKRLFVRKVIKLNMVLLSSLMVLSGCNSDSEDTHPTPIEPTGR
FT                   WLKGDLHVHTAVSQDARETQSDILKWAFDDFNLDYVALSNHMRDNSQDNDDNDLGGLLF
FT                   YDALVQYENPGLKASMSKYAGKLAYSSFEWDMPTHEHFNIGILGDESEVLAAIKTFEYR
FT                   FSSKNSIEDFNAKDVAAWEAAGDTRQNQTHQDAIAALTWLEAHYPDSSYGMLNHPRRYL
FT                   TSYTIKDVRELNDAAPNVFFLVEGLVGGQFSGNRGDYAERSSGVYGGVDPVVAQVGGWW
FT                   DALLGEGRQIWNMGNSDIHFKTRPPYASSYYPGEYAKSYTWVDGNDTKALLDGLRSGNS
FT                   FSVFGDLIDALDFKLESSSNNSVTMGQTLVAKAGDKLTLTIRFKSPTMNNKESDIGNEI
FT                   YAGVNPGVHHIDLIAGNVGPRAEAGTTAYEKETNDSTLVVKTFTSADWQKDADGYYSMS
FT                   YSFIADKHQYFRLRGTNLDYNQANLTEKGNPLKSAVINKEDDESVQAWYNKINDRNYDD
FT                   LWFYSNPVFVNTGK"
FT   sig_peptide     170535..170633
FT                   /locus_tag="Sputcn32_0148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.652 at
FT                   residue 33"
FT   gene            complement(172225..175374)
FT                   /locus_tag="Sputcn32_0149"
FT   CDS_pept        complement(172225..175374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0149"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: son:SOA0153 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73885"
FT                   /db_xref="GOA:A4Y1Q2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Q2"
FT                   /protein_id="ABP73885.1"
FT                   /translation="MLKYIIEASIRQRLMVLIIAIMITVWGVQELRKTPLDALPDLSDV
FT                   QVIIKTSYPGQAPKLVEEQVTYPLSTAMLAVPGAKTVRGFSMFGDSYVYVIFEDGTDIY
FT                   WARSRVLEYLNQISSRLPQGVQPSLGPDASGVGWVYEYALVDRSGSLDLSQLKSLQDWY
FT                   LKLELQSVAGVSEVATVGGMEQTYQIVLEPDKMAIYKLDIASIKDAIEKSNSEAGGSVI
FT                   EMAEAEYMVRAKGYRQTLEDFREIPLGITSPSGTGLLLKDVATVRKGPASRRGIAELDG
FT                   EGEVVGGIIVMRYGENALSTIDAVKAKLEELKAGLPDGVEIIPTYDRSQLILKSVDNLF
FT                   SKVVEEMLVVGLVCLLFLLHARSTLVAIITLPLSILIAFIVMNKMGVNANIMSLGGIAI
FT                   AIGAVVDGAIVMIENLHKHLEQFHTEHNREPDTKEHWRIVTEASIEVGPALFFSLIIIT
FT                   LSFVPVFALEAQEGRLFAPLAYTKSFAMAASALLAITLVPVLMGYFIRGKIPSEHKNPI
FT                   SRVLIALYKPSLNLVLRFPKITLALALIALVSAWYPMTRMGSEFMPELEEGDLLYMPTA
FT                   LPGLSAGKAAEVLQQTDRLIKTVPEVARVFGKVGRAETATDPAPLTMLETTIMLKPHEE
FT                   WREGMTLDGIIAQLQQTVKVPGITNAWVQPIKTRIDMLSTGIKTPVGIKITGADVNELQ
FT                   SLGAEIEAILSRVPHTKSAYAERSGGGRYIDITPKLDVAARYGMSLQDIQDVVRYAIGG
FT                   MDIGESIQGAERYPINLRYPRELRDNIEKLRELPVITKSGNYLPLRNLADIEITDGAPM
FT                   LTSENGRLISWVFIDIEGTSIGEYITTAKQALTAELKVPPRYSYTFAGQYEYMQRVDAK
FT                   LKQVIPMALGVIFILLMMTFGSTLQASIIMLSLPFALVGSTWLLYLLDYNISVAVAVGM
FT                   IALAGVAAEFGVIMLIYLNNAIKHRQDKNNYHTVTDLKEALIEGAVMRIRPKAMTVATI
FT                   FFGLLPIMWGAGSGNDVMQKIAAPMVGGMVTAPILSLFVLPALYLLIYSRQLKKEAAPI
FT                   S"
FT   gene            complement(175384..176913)
FT                   /locus_tag="Sputcn32_0150"
FT   CDS_pept        complement(175384..176913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0150"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: son:SOA0154 heavy metal efflux protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73886"
FT                   /db_xref="GOA:A4Y1Q3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Q3"
FT                   /protein_id="ABP73886.1"
FT                   /translation="MNQFNRVKKQAPKAVLLLSSLLMGTPWLSHAQLANTQAETAATSP
FT                   ANESKNNPLKQVKTYTCPMHPEVISHEPGRCPKCNMFLVEQQDDANSAEHVGHQAADHQ
FT                   ASEHGQTLAAKASSPVFDTPTPKADSLVKTQNNVTTIKYVCPMHAHIISDVPGTCPICG
FT                   MNLEKVETGGNTQEINIQVSGSMQQALALKVAQVERDTLWKFVETVGQVDYNESQITHI
FT                   HARVTGWVEKLMVKSMGDTVKKGQLLYELYSPDLVNAQDDYLLALDTAKTSGNPRYQDL
FT                   VRRAGLRLSFLGFNDEQIKQLAQSRQTQYRVPFYAQQDGVVETLSIRDGMYIEPSTEAM
FT                   SLVDLSKVWVIADVFENEQSWIAKGQKAEVAVPAMNIRGIEGTIDYIYPELDPVTRSLR
FT                   VRVVLNNTNVDLRPKTLAKVSLFGGPNRDVLVIPQEALIQTGKENRVIVKQDDNSFAAK
FT                   VVTVGMMSQGKAEIVSGLTEGERVVISGQFLLDSEASLKGSLMRLSSGHQH"
FT   sig_peptide     complement(176818..176913)
FT                   /locus_tag="Sputcn32_0150"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.750 at
FT                   residue 32"
FT   gene            complement(176935..177195)
FT                   /locus_tag="Sputcn32_0151"
FT   CDS_pept        complement(176935..177195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0151"
FT                   /product="copper-transporting ATPase domain protein"
FT                   /note="KEGG: she:Shewmr4_3781 copper-transporting ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73887"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Q4"
FT                   /protein_id="ABP73887.1"
FT                   /translation="MKTLTNLALVAFLMTSTSVFATATPHEHHHNNANPQQQAQTYICP
FT                   MHPEVTGTQGDTCPKCGMNLEPKATEVKTAEGTTHKAHEHH"
FT   sig_peptide     complement(177130..177195)
FT                   /locus_tag="Sputcn32_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            complement(177414..177911)
FT                   /locus_tag="Sputcn32_0152"
FT   CDS_pept        complement(177414..177911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SOA0156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73888"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Q5"
FT                   /protein_id="ABP73888.1"
FT                   /translation="MLESSRSLFGILMHHTLGRYFLVIFTLLALVGQSVVSNGHAMVPH
FT                   TMDMSAMPQDMSAMAHHDSTQGMDHAAMMQMNTETPADSHSMADTDCCNDKKLPGAKQH
FT                   CCDGATSCSNDCDHCLTISVAGTLFSPHLWPSVSISDTVMATPMPHFHSISLSSALKPP
FT                   IA"
FT   gene            complement(177983..178408)
FT                   /locus_tag="Sputcn32_0153"
FT   CDS_pept        complement(177983..178408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0153"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="KEGG: cps:CPS_2062 site-specific recombinase, phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73889"
FT                   /db_xref="GOA:A4Y1Q6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Q6"
FT                   /protein_id="ABP73889.1"
FT                   /translation="MVAWNKGKRVGQKKAFKLEDIWRIRIRLELEERLFELALFNLAID
FT                   SKLRSCDLRNLRVQDVSRSGCVMSRTIVKQQKTQQEVHFEITPKTQQTLSQWIIQNALA
FT                   PTDFLVPSPRREGQPISYHYYTTLVNRWDMLEDHPSK"
FT   gene            178519..179223
FT                   /locus_tag="Sputcn32_0154"
FT   CDS_pept        178519..179223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0154"
FT                   /product="site-specific DNA-methyltransferase, type I
FT                   modification"
FT                   /note="KEGG: neu:NE0385 site-specific
FT                   DNA-methyltransferase, type I modification"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73890"
FT                   /db_xref="GOA:A4Y1Q7"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Q7"
FT                   /protein_id="ABP73890.1"
FT                   /translation="MNQQEQQFLKELESKLWTAADKLRSTLDAAQYKYAVLGLIFVKYV
FT                   SDAFKLRQEEIKADLANPDHEYYLDPADFSEEELAAEIAVELEQRDFYTEKNVFWLPTE
FT                   SRWQFLQDNGPRVIGGADLEIDGKVKKITSVGHLIDNALEGIERDNPKLKGVLNKSYSA
FT                   LKIDQAKLNELINLIATIPFDHKSLNSKDILGHVYEYMLGQFALAEGKKGGQFYIMSSL
FT                   FFTNESHLKKPA"
FT   gene            complement(179220..180854)
FT                   /locus_tag="Sputcn32_0155"
FT   CDS_pept        complement(179220..180854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0155"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: bps:BPSL3342 putative
FT                   bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73891"
FT                   /db_xref="GOA:A4Y1Q8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Q8"
FT                   /protein_id="ABP73891.1"
FT                   /translation="MSDVKGKNMTKKKPVLKRFNYRLNKLHVKNLKGIKDFTLNFEKDK
FT                   LVTGIVGINGSGKSTLIHALACAFKPIGKATSKDFNRLSHFFTPNKDASWEGSEFEIEF
FT                   EFDELTIKPNSEPTKKLINHTEVYSKKQGKKVSRWLPIYGRRHERESAYIGLHDLATLS
FT                   EDKNAGRYKEYETEDLAHEASDKIKEDLVYILGRNYNRLTTCLVKQKDKVHTLFGLVFN
FT                   GVEYSEHSMGAGEKRLLTILSALHNPKLAKGGLLLIDEIDVLLHGMAFKRLIERIIKRA
FT                   NENKIEVIFSTHRETIIDFKNDLLIYGVLNTGKGVIPMPHTHPQVMQQLTGVRTVPIEI
FT                   YVEDDLATSVIETLLYQKHATHYVNITKFGTWSNAFAILAGKILMDSDISETLCVLDGD
FT                   VCNTIEERTSECQRHLNGDDKNEHRQSMLNHIVEFKLANIAPQGSGGSPEYNIKIMFES
FT                   IESDDPRVVELQRYSREMQGLEDWHVYFDILAETSGIRTARDKVLEAISETGQWNDYIV
FT                   EISNWLDEKLKIYLPVRVQEEENLVTV"
FT   gene            complement(180847..181659)
FT                   /locus_tag="Sputcn32_0156"
FT   CDS_pept        complement(180847..181659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0156"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   yps:YPTB3878 putative predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73892"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Q9"
FT                   /protein_id="ABP73892.1"
FT                   /translation="MSKQAVAAEIRTTTNERGVFTYGNDTIHYDVIRKTKPSENAKKTA
FT                   RKVIIKVHPDQRVVATVPHDASDDAIQDAMHKRARWIWQSIDEFAKQKDTVLPKCYESG
FT                   ETQFYLGKRYVLKVIVDAKQVPNVKLSRGKLNVTIKHEVSKDIDDRLVKIKPLIDKWYQ
FT                   HKAKAIFHERLAELLPKATWVTGIPSFRVMAMKKQWGSCSTKGNLMLNPHLVKAPKECI
FT                   DYVILHELCHIAEHNHSERFWRLLTQVMPNWKEVKAKLDDMAEMYLNE"
FT   gene            complement(181665..184955)
FT                   /locus_tag="Sputcn32_0157"
FT   CDS_pept        complement(181665..184955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0157"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: yps:YPTB3879 possible type I restriction
FT                   enzyme (restriction subunit); TIGRFAM: type I site-specific
FT                   deoxyribonuclease, HsdR family; PFAM: type III restriction
FT                   enzyme, res subunit; protein of unknown function DUF450;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73893"
FT                   /db_xref="GOA:A4Y1R0"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1R0"
FT                   /protein_id="ABP73893.1"
FT                   /translation="MTTTVNFQEEFSAKVPALTLLTNLGYTFIPPSKCEALRGNSLVSE
FT                   KKSTHQVVLLPIMRAFLAKQTFSFAGKQHTLSEAAIDKVMHELTPAMNLGLKAANEKIY
FT                   NALMYGVSVTEFIDGKKASPTIKLVDWHDLDNNQFHFTEELVVQNAEGTGNRIPDIVCF
FT                   VNGLPLVVIEAKRPDSNKEGKSTNAEAISQHIRNQGQAEIPHLYAYSQLLLAVNGHEGL
FT                   YATCGTPEKFWAKWKEEQITEAEFVRLKNHKLSNEQIGGLFNHRPAKAKDDYLSLVAAG
FT                   DLTVTDQDRLIVSLLRPERLLDMTRLFTLFDKKAGKIVARYQQVFGIKALIERINTFDD
FT                   SGAREGGVIWHTTGSGKSFTMVFLSKALTWLEELAQCRVIIVTDRVDLEDQLSRTFASG
FT                   GVLTDRDKKDAMATTGKRLAEQIGKGNERVIFSIINKFGSAIKYKECYNDSPNIIVLVD
FT                   EGHRSQNGENNIRMQQTLPKAAYIAFTGTPLLKDDKTENKFGKIIHSYTMQQAVEDKTV
FT                   TPLLYEERIPELNVNDKAIDAWFARSTSKLSDKQKTDLKKKFSQKGQIYQTEGRIELIA
FT                   YDIADHFQNFKQQGLKGQLACDSKASAIRYKKALDKIGTVTSVVAMSAPDTREGHEAVD
FT                   QESKDIVQNWWKANVNKMDEKAYTKAIIEEYGRDDGPDIMIVVDKLLTGFDEPKNTVLY
FT                   IDKPLKEHNLIQAIARVNRLHSKKQFGYLIDYRGILKELDTTIEKYQDLAERTQGGFDI
FT                   DDLKGLYNRMDTEYKKLPGLHSDLWAIFDTVKNKQDGPALRQALAPKVNDVDGKLVDTN
FT                   LKKRDDFYSALTAFSNCMKVALQSATYFEDKSFDNKRDLYKRDLKAFVDLRKQVREDAD
FT                   ETINYDEYAEDIRSLLDKHIAGIEVKEPDGAYLVGNLGKDVKPQDMSDDEARNQTDKIT
FT                   GRITKMIEQDLADDPYAQEYFSKMLKKAIEDAKAMFDAPVKQYILFADFEQEVKERNVA
FT                   DVPNGFVDDSGKLNKHAQAYFGLFKHLFDAEFLNDKALDNDKLVALAFSIDDVVNTAVA
FT                   EYSINPAEIENAIHMKLLPLLFADLGLENAQKLIEEVLKITRLGLARG"
FT   gene            complement(184966..186303)
FT                   /locus_tag="Sputcn32_0158"
FT   CDS_pept        complement(184966..186303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0158"
FT                   /product="KAP P-loop domain protein"
FT                   /note="PFAM: KAP P-loop domain protein; KEGG: vpa:VP2903
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73894"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1R1"
FT                   /protein_id="ABP73894.1"
FT                   /translation="MEIQNLKFEDRDEFKRKSIAAKVISVLQADIDISPMVIDGSWGTG
FT                   KTEFCHKLINLMHVSDTHHLIYVDAFKADHADEPLMTVLAEVIKVLPDDDSKQSFMKKA
FT                   LPAVRYGLKTIAKAGVSHLLRQDIADVADDFDKQIQGAADKAIDATVESVLKDHVKADK
FT                   NLKALQVALADIAAIKPIVLFIDELDRCRPNFAVDMLEIIKHTFDVDGVKFVLITNTQQ
FT                   LKASINHCYGLSVDAQRYLDKFVKFTIALPETVDTNAHRESIAAIEHYKNLVRSSHVLV
FT                   DMKLYECGSIRTIEQIIIANRLSLREVETVVRHIEIYVTLAQSNNLQSNTIFGYKVLTI
FT                   LAIAIYSIQPEVALSILQKKLDAKDIGNCLGISSLSNNIQGRPDEQELICYMLGYTALH
FT                   NKEHFTPTEDVDVWKQESAQYFRGAHWRTDDFASICAEAIQTLTMC"
FT   gene            complement(186313..187701)
FT                   /locus_tag="Sputcn32_0159"
FT   CDS_pept        complement(186313..187701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0159"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /note="KEGG: dra:DR1808 deoxyguanosinetriphosphate
FT                   triphosphohydrolase-related protein; TIGRFAM: putative
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase, HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73895"
FT                   /db_xref="GOA:A4Y1R2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1R2"
FT                   /protein_id="ABP73895.1"
FT                   /translation="MGSLEQRRLEQDKRPDDVRDEYDRDEARLIHSAAFRRLQSKTQVL
FT                   GLGESDFYRTRLTHSMEVAQIGRGIVQYLSKNKKFAEYHEHLPNTSLITAICLAHDIGH
FT                   PPFGHGGEVALNYCMREHGGFEGNGQTLRILGKLDKYTGEHGLNPTRRMLLGILKYPVA
FT                   YSELVNEKAYEQVPDKNAPYWLFEARMQKPPKCYHDCDQEIVDFIFDGFAREELAKFTQ
FT                   TEQPIDKDEPEKPLHKKSLYKSLDCTIMNLADNISYSLHDFEDALSLGMITQRHWREHF
FT                   EGKEALFNDLAKQLVRNDLNFDLITVNLFHKESHCRKEAIGSLVNLMITNAIIEKNQSG
FT                   CENPLLSLEVKLAPQIEKLRQHIFDLVCEQVIFDENVQQLEFKGQKLVIELFQTLAKDP
FT                   NRFLPKPTRERLKKAGEGLEGEHKKSAQLRVICDFVSGMTDDYATKFYEKLFTPSKGSI
FT                   FDRL"
FT   gene            complement(187701..188900)
FT                   /locus_tag="Sputcn32_0160"
FT   CDS_pept        complement(187701..188900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0160"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: tde:TDE0368 type I
FT                   restriction-modification system, S subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73896"
FT                   /db_xref="GOA:A4Y1R3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1R3"
FT                   /protein_id="ABP73896.1"
FT                   /translation="MVPNGWKDGRVRDLIKSLNAGVSVNSEDDGNLNSSYKILKTSCVS
FT                   KGVFDPNETKSVVEEIEISRLKEPVLGDSIIISRMNTPALVGANGYIENGIDNTYLPDR
FT                   LWQAKPKSNDVNMKWLGYWFASSHTRYTLSSTATGTSGSMKNITKSDVLNIKIDIPPLP
FT                   EQRKIAKILSTWDKAISTTERLIDNSKQQKKALMQQLLTAKKRLLDDSGKPFEGEWTKV
FT                   ELGKLLDYKQPTPYLVKSTDYSNEYSIPVLTAGKTFILGYSNENFGIFEEELPAIIFDD
FT                   FTTASKFVDFPFKAKSSAMKILVAKQGVSIKFVYEAMQVLNYPVGGHQRHWISIFANLV
FT                   IGLPSLLEQQKIASVLTNADKEIELLEQQLADLKQEKKALMQQLLTGKRRVKIDDKEVA
FT                   "
FT   gene            complement(188890..190410)
FT                   /locus_tag="Sputcn32_0161"
FT   CDS_pept        complement(188890..190410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0161"
FT                   /product="type I restriction-modification system, M
FT                   subunit"
FT                   /note="TIGRFAM: type I restriction-modification system, M
FT                   subunit; PFAM: N-6 DNA methylase; KEGG: dvu:DVU1709 type I
FT                   restriction-modification system, M subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73897"
FT                   /db_xref="GOA:A4Y1R4"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1R4"
FT                   /protein_id="ABP73897.1"
FT                   /translation="MTSTNQINQDDINKAVWAACDTFRGVISADTYKDFILTMLFLKYI
FT                   SDVYKDEYKKLVAQYGDNPELIHAMMSKQRFVLPEGASFWDLYEKRYEAGNGERIDKAL
FT                   HAIEEANGSKLKNVFQDISFNTDRLGQEKQKNDLLRHLLEDFGKDILNLSTERVGSLDI
FT                   IGNAYEYLIKHFAAGSGATAGEYYTPPEVSTLLATALEPVEGDQICDPCTGSGSLLLKC
FT                   GAMVRKNSGSKKYALFGQEAIGSTWALAKMNMFLHGEDNHRIEWGDTIRNPLLKEKDGN
FT                   GLLHFDVVTANPPFSLDKWGHDDASNDPYGRFRRGIPPKTKGDYAFITHMIETLKPETG
FT                   RMGVVVPHGVLFRASSEGKIRKQLIEENLLDTVIGLPEKLFFGTGIPAAILIFKKHKTD
FT                   KNVLFIDASREFKPGKNQNQLTDENIQKIIDTYKARESVDKYAYLASFDEIKENDFNLN
FT                   IPRYVDTFEEEAEIDLVAVRTERVQLKNELQTLESQMEGYLKELGYGA"
FT   gene            complement(190451..191065)
FT                   /locus_tag="Sputcn32_0162"
FT   CDS_pept        complement(190451..191065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_1208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73898"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1R5"
FT                   /protein_id="ABP73898.1"
FT                   /translation="MNTKMRQAVQELRLSDIANIRLGHPFRGTVKQYDNGDVNVVQVRD
FT                   TEPTGEINQYTMVETVLKTKKQPDWLENGDVLFVAKGAKHYSVLVEQVLERTVCSPHFF
FT                   MLRLKPEFKDVIVPDFLCWQLNQQPAQRYFKATAEGSMYLSIRRQVLENVPIKVLNFEK
FT                   QKQLAAMHRCAVREQKVLQKLIENRQQQIEAIAIHALESIG"
FT   gene            191300..191968
FT                   /locus_tag="Sputcn32_0163"
FT   CDS_pept        191300..191968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73899"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1R6"
FT                   /protein_id="ABP73899.1"
FT                   /translation="MSGNYPKVVKQTVNLGSLPYVSSVDEEGQRTIAFHEDHIIERFPR
FT                   VLSLVRIQDTLEINLFLEHRYKGLFMPPKRGGKKNPLGGVSLITVQSLANSMSLFLQWV
FT                   EKNNLDWHEVYAVSDSDKAKYWLPVYRYRKHLIEQVIAKDIDRDTANLYINHVRQFYEW
FT                   ARKQRRIDKVPFKYKTKVIKKKRKDGGLDLLFTDYGSEEKGFAITTTDLLIPKCSGSQT
FT                   "
FT   gene            complement(192103..192444)
FT                   /locus_tag="Sputcn32_0164"
FT   CDS_pept        complement(192103..192444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr8025 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73900"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1R7"
FT                   /protein_id="ABP73900.1"
FT                   /translation="MSEKIQWQPISMLPLLVQMVEEVHSSTQQQTLNLEKAKGNPFLFS
FT                   ACELIRTERAYQEQLGSLSLFQQQCERWLAEDIQPENEVMVMDTLERLLEMDIMTKTVL
FT                   TQLKSFVGT"
FT   gene            complement(192454..193425)
FT                   /locus_tag="Sputcn32_0165"
FT   CDS_pept        complement(192454..193425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0165"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: psp:PSPPH_B0059 ExeA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73901"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1R8"
FT                   /protein_id="ABP73901.1"
FT                   /translation="MQLEVMEHYGIIKYFRDADYFETEHQRRIFNQLKKVIPEGQLIAL
FT                   SGVVGSGKTTTLSRLQDLLAKEKKVIVAKSLSVEKTKTNLGTLITALFYDVSGDKDYRV
FT                   PKLGEKRERELRDLIQDVKKPVVLLVDEAHDLHHRTLTGLKRLMEVIRDGGGKLSILLA
FT                   GHPKLKNDLKGPTMEEVGYRTIVVSLDAMQGNLREYVYWLLDNCTDDKTKPTDVIEEQA
FT                   IDYLVERLTTPLQIEQHLSLALEEGFNVGVKPITVDVLDLTLSRRINDIEPRLIRHGYS
FT                   EKVLVDQFHYKPAELRKFFKGELDANRVKEITQDLREAGLPI"
FT   gene            complement(193415..195076)
FT                   /locus_tag="Sputcn32_0166"
FT   CDS_pept        complement(193415..195076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0166"
FT                   /product="putative integrase protein"
FT                   /note="KEGG: stm:PSLT044 putative integrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73902"
FT                   /db_xref="GOA:A4Y1R9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1R9"
FT                   /protein_id="ABP73902.1"
FT                   /translation="MNSAKRGIAQEVLIDLYHRLEGLPPRCAQRRDIIAQATALYGISE
FT                   SSLYRHLRNLYQPKSIRRSDAGKPRAIPQAELEQYCEIIAALKIRTMNKNGRHLSTANA
FT                   IALLERTGVGSDYGFIKVPVGRLNKATVNRYLQQWGFNPKQVLRDTPAVRFQATYSNEC
FT                   WQFDLSPSDLKHVQEPLWFDPQKGRPLLMLYSVVDDRSGVCYQEYRNVYGEDTPAALLF
FT                   LFNAMSAKSDSEFPFRGIPKTIYLDNGPIAKSRVFRNVMVFLGVELKVHEPASATDRRK
FT                   TARSKGKVERAFRTVKECHEVLYHLREPKNEVEANDMLREYLKQYNDHSHRLETHSRME
FT                   DWQLNIPPSGIQSMCSWERFCAFAREPEQRTVGIDARISVDGTVYEISPELAGERVVLW
FT                   WGLFDDELFVEHEGKRYGAYLPVSGPIPLYRYRKFKKTQAEKKLDKLETLAKSLSLRDI
FT                   GDEQNVAILKTMLKTVNVIADKPFADPDPYNDLSYSSVLKAKLAIADYLGKPLALLSQT
FT                   DRDFIEAILDETLEKSVVMARLKSYFHPKGDSTHAT"
FT   gene            complement(195081..195671)
FT                   /locus_tag="Sputcn32_0167"
FT   CDS_pept        complement(195081..195671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0167"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein; KEGG: xac:XACb0071 Tn5045
FT                   resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73903"
FT                   /db_xref="GOA:A4Y1S0"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1S0"
FT                   /protein_id="ABP73903.1"
FT                   /translation="MIFGYCRISTKGQSFDLQEDALKNAGCERVFRDIASGAKTKRPGL
FT                   DDLLGQLRAGDIIVVYKLDRLGRSLQHLVHLMNQLTEQQIGLRSLNDPVDTTTPQGRLI
FT                   TNVFASIAEFERDLIRERTKAGLASARARGRNGGRPAGLSKDAQNVAIAAEALYKQGSL
FT                   SAQQIAAQLNISKTTLYKYLRLQGVGIGSVGLR"
FT   gene            complement(195909..197561)
FT                   /locus_tag="Sputcn32_0168"
FT   CDS_pept        complement(195909..197561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0168"
FT                   /product="mercuric reductase"
FT                   /note="TIGRFAM: mercuric reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase;
FT                   glucose-inhibited division protein A; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; HI0933 family protein; FAD dependent
FT                   oxidoreductase; Heavy metal transport/detoxification
FT                   protein; KEGG: sfr:Sfri_3488 mercuric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73904"
FT                   /db_xref="GOA:A4Y1S1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR021179"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1S1"
FT                   /protein_id="ABP73904.1"
FT                   /translation="MLLLSIKGMTCPSCVSHIKDALDATEGVNNVEISYANASAAVTTN
FT                   GKVSVADLVKAVKTLGYAAQVNPEPQTCFDNTNLSNTENISPQQVVIIGSGSGAFACAI
FT                   KAADGGAKVTLIEGADVIGGCCVNVGCVPSKILIRAAQLAQQQRNNPFIGLANHSPQLN
FT                   RALLAEQQTALVEELRVAKYQNILDINPALSLIKGWATFKNANTLIVSKSDGSQQEIHA
FT                   DKVLIATGSSPTIPPIEGLSETPYWTSSEALFATELPEHLVIIGSSVVALEIAQAYRRL
FT                   GSDVTLLARHTLLYRDEPLLGEKLTDCFENEGIRVLNHTEASHVSHDGRQFTLKTNAGT
FT                   LRCDKLLICTGRHANTASLNLDAVGIRTDKHGAIIVNEMMETSVPGVYAAGDCSTMPQF
FT                   VYVAAAAGSRAGMNMTGGESKLDLSSMPAVIFTDPQVATVGLTEVEARQQGIHTDSRVL
FT                   DMKNVPRALANFETDGFIKLVIEKTTGRLIGAQLLAHEGGEMIQTAALAIRNRMTITEL
FT                   ADQLFPYLTMVEGIKLCAQTFHKDVNELSCCAG"
FT   gene            complement(197674..197949)
FT                   /locus_tag="Sputcn32_0169"
FT   CDS_pept        complement(197674..197949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0169"
FT                   /product="mercuric transport protein periplasmic component"
FT                   /note="TIGRFAM: mercuric transport protein periplasmic
FT                   component; PFAM: Heavy metal transport/detoxification
FT                   protein; KEGG: sfr:Sfri_3490 mercuric transport protein
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73905"
FT                   /db_xref="GOA:A4Y1S2"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR011795"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1S2"
FT                   /protein_id="ABP73905.1"
FT                   /translation="MKKITLLFLLTLTSLSAIAETKTVTLEVPTMNCVTCPFTVKKALQ
FT                   NVEGVSKAEVTFDTKLAVVTFDDEKTTVKALTEATTNAGYPSTVKE"
FT   sig_peptide     complement(197890..197949)
FT                   /locus_tag="Sputcn32_0169"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            complement(198002..198349)
FT                   /locus_tag="Sputcn32_0170"
FT   CDS_pept        complement(198002..198349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0170"
FT                   /product="Mercuric transport protein MerT"
FT                   /note="PFAM: Mercuric transport protein MerT; KEGG:
FT                   sfr:Sfri_3491 mercuric transport protein MerT"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73906"
FT                   /db_xref="GOA:A4Y1S3"
FT                   /db_xref="InterPro:IPR003457"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1S3"
FT                   /protein_id="ABP73906.1"
FT                   /translation="MSIKESNLPVIGGIVAAIGAGVCCAGPFVLLLLGVSGSWIGHLTM
FT                   LEPYRPIFILLVLTSFGFAGWKVYRPTDMCAPGTVCAVPQVRKRRQVIFWLSALTALML
FT                   VTSNYWIVWFA"
FT   sig_peptide     complement(198272..198349)
FT                   /locus_tag="Sputcn32_0170"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.907) with cleavage site probability 0.902 at
FT                   residue 26"
FT   gene            complement(198429..198833)
FT                   /locus_tag="Sputcn32_0171"
FT   CDS_pept        complement(198429..198833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0171"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Hg(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein, MerR; KEGG:
FT                   sfr:Sfri_3492 transcriptional regulator, MerR family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73907"
FT                   /db_xref="GOA:A4Y1S4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1S4"
FT                   /protein_id="ABP73907.1"
FT                   /translation="MDVTLYTIGQLANAAVVNVETIRYYERRGLVEQPGKPTQGFRRYP
FT                   VTTLNRLRFIKRAQELGFTLEEIHHLLTLNDTPCQGVQDVATLKLANVRSKIADLQSLE
FT                   LVLHHLLSQCASNPDQTHCPIIESLQPHNN"
FT   gene            complement(199130..199786)
FT                   /locus_tag="Sputcn32_0172"
FT   CDS_pept        complement(199130..199786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0172"
FT                   /product="UMUC domain protein DNA-repair protein"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   son:SOA0012 umuC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73908"
FT                   /db_xref="GOA:A4Y1S5"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1S5"
FT                   /protein_id="ABP73908.1"
FT                   /translation="MFALVDANSFYCSCEQVFRPDWRKKPVVVLSNNDGMVVAANRQAK
FT                   EAGIPKFVPYFQIRDLCQKNGVIALSSNYELYADLSAKMMQIIGRFAPEQYVYSIDESF
FT                   LSFARCYPAITCLKTHAQAIRRTVWKEARLPVCVGIGSTLTLAKIANHAAKQIPGYAGV
FT                   CVIESEQQRLAILQQMPVGEVWGIGRRLSAKLTLIVVARKHNTASLITSGFSDSD"
FT   gene            complement(199833..200648)
FT                   /locus_tag="Sputcn32_0173"
FT   CDS_pept        complement(199833..200648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0173"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: vpa:VP1787
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73909"
FT                   /db_xref="GOA:A4Y1S6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1S6"
FT                   /protein_id="ABP73909.1"
FT                   /translation="MVAVLQVSRSGYYAWRKTGLTPSPRAAKRAKRDVLIKKAFDDSKA
FT                   RNGSRRIQVDLAEHGKKPDIKTILNSMERQGLVAKAARKFKVTTDSKHSLPVAPNLLEQ
FT                   DFSATGPNQKWVGDITYLMTSEGWLYLAVIIDLYSRAVIGWSMSNRMTADLVCSALNMA
FT                   LFRRGFPKSVIVHSDRGSQYCSHDYRDLIKKHQLLQSMSRKGNCWDNAVAESFFHSLKV
FT                   ETLQDEPIMDRETMRQHVFEYIEVDYNKTRRHSALGYLSPENFELKNSA"
FT   gene            complement(200699..200983)
FT                   /locus_tag="Sputcn32_0174"
FT   CDS_pept        complement(200699..200983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0174"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   vpa:VP1788 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73910"
FT                   /db_xref="GOA:A4Y1S7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1S7"
FT                   /protein_id="ABP73910.1"
FT                   /translation="MSTKKIRKTHTAEFKAEALKLADKIGVAATARELKLHESQLYNWR
FT                   TAAEKKSTTSERESELAAEVARLKRQLAEQAEDLAILKKAATYFAKNQK"
FT   gene            complement(201013..201438)
FT                   /locus_tag="Sputcn32_0175"
FT   CDS_pept        complement(201013..201438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0175"
FT                   /product="putative prophage repressor"
FT                   /note="PFAM: peptidase S24, S26A and S26B; KEGG:
FT                   son:SOA0013 umuD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73911"
FT                   /db_xref="GOA:A4Y1S8"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1S8"
FT                   /protein_id="ABP73911.1"
FT                   /translation="MRVIPIPAHAGITGFESPAAEYTQLGLSLDELLITHPNASFLCLA
FT                   EGDSMQDVGIYDGDVLIVDRHETARNGDVIVANFNGLFVCKLIDTQRRLLLSCNEQYQP
FT                   VSVHEYDEFSIEGVVTRSIRCHRPSPFDPYQHFWTLC"
FT   gene            complement(201597..201944)
FT                   /locus_tag="Sputcn32_0176"
FT   CDS_pept        complement(201597..201944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0176"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_A0095 plasmid stabilization system
FT                   protein, RelE/ParE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73912"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1S9"
FT                   /protein_id="ABP73912.1"
FT                   /translation="MSVVKLEYTKTFEDTVNSAISHYSQWNEEIAVIERIEAVIDAFEV
FT                   SVMQNPLSHSLCQELVELGVTQVRHAIKEDFRILYEVSYVSGEVLITVLLFLSQRQSIQ
FT                   NQLINHCLVYK"
FT   gene            complement(201946..202203)
FT                   /locus_tag="Sputcn32_0177"
FT   CDS_pept        complement(201946..202203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0177"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   vpa:VP1886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73913"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1T0"
FT                   /protein_id="ABP73913.1"
FT                   /translation="MNIETISFLKKNAANLPLDEPMIITQNGVPAYVIESVADRNRRDE
FT                   AIALLKMVSFAKSDQQNGRTMSSSTFKERLADRKFALKDK"
FT   gene            complement(202826..203458)
FT                   /locus_tag="Sputcn32_0178"
FT   CDS_pept        complement(202826..203458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0178"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   jan:Jann_1536 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73914"
FT                   /db_xref="GOA:A4Y1T1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1T1"
FT                   /protein_id="ABP73914.1"
FT                   /translation="MQNPDIAPEMRLFTPDGERLYLTAEERRRFLDASALESPSDRMFC
FT                   HMLHYTGCRPSEALAILPRHVMVEDAAIVIRSLKKHKTDPHGRLKQAQYRSVPVPPFLI
FT                   EHLDLVFGLRAQLRRELNADSVLWPMSRPTAYRLVKRVMYRAGIVGAQATGKGLRHGFG
FT                   VAMVTANPPVPLHVISQLMGHSDSKTTEIYLQVLSEERHSLVMNAWG"
FT   gene            complement(203703..204530)
FT                   /locus_tag="Sputcn32_0179"
FT   CDS_pept        complement(203703..204530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73915"
FT                   /db_xref="GOA:A4Y1T2"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1T2"
FT                   /protein_id="ABP73915.1"
FT                   /translation="MELCETSKDYELLTQKIYRAIIESEGVENIDVQHDVKIKGKSGVE
FT                   HQIDVFWEYRYAGVSHKVLIECKYYSKPVSLIHARNMLGLLSDIPNSQGLIVTTQGYQS
FT                   GVIDFCGHYEINLKRIRPPQGSDWDGYIQIITVNGELYQNQYLDMKLAFDGYDCDTKAY
FT                   FDKHGSQISFNVYDSSIEEGGVVSFVGKWLDSKIVANLGELNTPKTEVIEPENAFVVLP
FT                   TKEKLKIKNFFVLWELSRQELSISVDAMDFVHAVLEDFGSGNIEYTLNKEHNK"
FT   gene            complement(204634..205059)
FT                   /locus_tag="Sputcn32_0180"
FT   CDS_pept        complement(204634..205059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73916"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1T3"
FT                   /protein_id="ABP73916.1"
FT                   /translation="MKHRIVSLFFCFVFSCWTVAATAAGRDYKCVVERVSSASGDNGSL
FT                   HQFYVDNYVGRDFSVDRASGVMAGALKNSYVTEPQVIDFGSSENAYKVVATMRVDQGAG
FT                   AGSNVYALTIEEFESGPEKPFVFLMNATVFFGKCEHY"
FT   sig_peptide     complement(204988..205059)
FT                   /locus_tag="Sputcn32_0180"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.956 at
FT                   residue 24"
FT   gene            205738..206073
FT                   /locus_tag="Sputcn32_0181"
FT   CDS_pept        205738..206073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SOA0069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73917"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1T4"
FT                   /protein_id="ABP73917.1"
FT                   /translation="MSHAIEFVETSIFTRQIKELATDDELKDLQAELIAQPDKGDIIKG
FT                   TGGLRKVRMAVGNKGKSGSIRVLYVLALADKIYLVLAYPKSVKESLTAEEKAKLKQIVQ
FT                   SLKGESK"
FT   gene            206070..206357
FT                   /locus_tag="Sputcn32_0182"
FT   CDS_pept        206070..206357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0182"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: son:SOA0068 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73918"
FT                   /db_xref="GOA:A4Y1T5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1T5"
FT                   /protein_id="ABP73918.1"
FT                   /translation="MSIFNELQASLEEAVEIHHGLKKPARVTRYEVADVKSIREDLLKV
FT                   TQAEFAATMGVSLDTVKSWEGKRRNPAGLAAKVLATIQQDPKIYAVLAAH"
FT   gene            complement(206732..207031)
FT                   /locus_tag="Sputcn32_0183"
FT   CDS_pept        complement(206732..207031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73919"
FT                   /db_xref="GOA:A4Y1T6"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1T6"
FT                   /protein_id="ABP73919.1"
FT                   /translation="MFLMDKVSLNAFWAHALPCVIISSCMLGFAWLAIQESDVTLSSQY
FT                   LVAASVSFTFTLIGYWGYCKYFASKKPHSALYAVVYTVLFPLFYLPSAFFRRRR"
FT   gene            complement(207047..207349)
FT                   /locus_tag="Sputcn32_0184"
FT   CDS_pept        complement(207047..207349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73920"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1T7"
FT                   /protein_id="ABP73920.1"
FT                   /translation="MNNKVKGIPFAEVKAAALANPAVLEAYLREQATVSNRVDVEMFIT
FT                   KLMAALSDLPQKDIEVCDLANEIGIAIASLAGSEKHIERECLSGIKHGFSMIREA"
FT   gene            207856..208014
FT                   /locus_tag="Sputcn32_0185"
FT   CDS_pept        207856..208014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA2757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73921"
FT                   /db_xref="GOA:A4Y1T8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1T8"
FT                   /protein_id="ABP73921.1"
FT                   /translation="MLRFAMSVMSVRLSDEIEQKRVQLAQLTGRTKSWLAKQATQDYLA
FT                   LEAWQIG"
FT   gene            208506..209996
FT                   /locus_tag="Sputcn32_0186"
FT   CDS_pept        208506..209996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0186"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: sfr:Sfri_0790 sulphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73922"
FT                   /db_xref="GOA:A4Y1T9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1T9"
FT                   /protein_id="ABP73922.1"
FT                   /translation="MIQTMKKEWFSNIRGDLLAGIVVALALIPEAIAFSIIAGVDPKVG
FT                   LYASFCIAVVIAFTGGRPGMISAATGAMALLMVTLVKEHGLEYLLAATLLTGVLQIAAG
FT                   YLKLGSLMRFVSRSVVTGFVNALAILIFMAQLPELTNVTWHVYAMTVAGLGIIYLFPLI
FT                   PVIGKSVPSPLVCIVGLTLFAVYMGLDIRTVGDMGQLPDTLPIFLWPEVPLTLETLMII
FT                   FPYSAGLAVVGLLESMMTATIVDDLTDTQSDKNRECKGQGIANIGAGLMGGMAGCAMIG
FT                   QSIINVKSGGRGRLSSFAAGVFLLVMVVFLGEWLKLIPMAALVAVMIMVAIGTFSWDSI
FT                   RNLKHHPMSTNLVMVATVVVVVATHNLAIGVFVGVLLASLFFANKVGRFMVVKSTTTAA
FT                   DTGRHYQVIGQVFFASSDKFSNSFDFREVVDKVTIDLSQAHFWDITAVSALDKVVIKFR
FT                   REGTEVELIGLNEASATIVDKFGVHDKPEEVEKMMSGH"
FT   gene            210031..210885
FT                   /locus_tag="Sputcn32_0187"
FT   CDS_pept        210031..210885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0187"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sfr:Sfri_0791 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73923"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U0"
FT                   /protein_id="ABP73923.1"
FT                   /translation="MTNVIACIDGSNVTSAVCDASGWAAFQLNAPVILLHVLDKSAYPI
FT                   ESDLSGNIGLGTREHLLNEMVELEARRGKLALEQGKYMLQDAQTRIVEAQPAVVVKTLQ
FT                   RHGDLVETLLEQESHARLVVMGRQGEQHQDQAQAIGSHLENVIRTVKQPILVVMTEFEA
FT                   PKRFMIAYDGSITAKKALNQVLTSPLLKGLECHLVMVSDAQSQATAELALVTESLMAAN
FT                   FNVVTAVCQGEVQTALEIYQLEHHIDLMVMGAYGHSRIREFFVGSNTTKMISKSHIPLL
FT                   LLR"
FT   gene            210976..211308
FT                   /locus_tag="Sputcn32_0188"
FT   CDS_pept        210976..211308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0188"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="KEGG: sil:SPO2248 DnaK suppressor protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73924"
FT                   /db_xref="GOA:A4Y1U1"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U1"
FT                   /protein_id="ABP73924.1"
FT                   /translation="MNEQLKQQLHLQLQQMLESLLAQIAAQTSDVQVVELDQSRLGRLS
FT                   RIDALQGQQMELETARRKQHQLQVIEGALLRINSDEYGSCFVCGEDIDLNRLMFDPTVT
FT                   RCINCS"
FT   gene            complement(211426..212046)
FT                   /locus_tag="Sputcn32_0189"
FT   CDS_pept        complement(211426..212046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0189"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; KEGG:
FT                   sfr:Sfri_3477 resolvase, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73925"
FT                   /db_xref="GOA:A4Y1U2"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U2"
FT                   /protein_id="ABP73925.1"
FT                   /translation="MSKVGYARVSSTGQSLEVQLGKLHRAECNKIYQEKRSGRTAERSE
FT                   FQSCMSYLREGDTLVVTRLDRLARSVVHLAQIASRFQSEGIDLLVIDQNIDTSTSTGRL
FT                   MFNMLAAIAEFENDLRTERQAEGIAKAHENGVKFGRPVKLTDTLKQAIYDKRAEGATIG
FT                   QLAKEYHLGEASIYRAINSVKQSIVSPYSIDVKELRDYGKYKT"
FT   gene            212216..212476
FT                   /locus_tag="Sputcn32_0190"
FT   CDS_pept        212216..212476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0190"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: sfr:Sfri_3472
FT                   prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73926"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U3"
FT                   /protein_id="ABP73926.1"
FT                   /translation="MNTLSANEAKIHFGDLLLKAQQAPIQINKNGKPVAVVISADAYQS
FT                   IETLKLHLLQSKAVKAITDIKMGNLVDGNTFFDELAAGQYD"
FT   gene            212476..212787
FT                   /locus_tag="Sputcn32_0191"
FT   CDS_pept        212476..212787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0191"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   sfr:Sfri_3471 plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73927"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U4"
FT                   /protein_id="ABP73927.1"
FT                   /translation="MPVTYHLTPDAQSDLIGIHRFTLAQWGTTQSKTYLSGLRQTIQLL
FT                   AETPTLGKNRPEVRMNVFSFPYSSHVIYYIQHEHQFVVFGILHKSMVPLAHLAEREII"
FT   gene            212811..215891
FT                   /locus_tag="Sputcn32_0192"
FT   CDS_pept        212811..215891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0192"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   sfr:Sfri_3470 transposase Tn3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73928"
FT                   /db_xref="GOA:A4Y1U5"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U5"
FT                   /protein_id="ABP73928.1"
FT                   /translation="MKNDVRRLSILSTDEIDELFGLPHFSDDDRRLYFDLSAKERELFD
FT                   NTRTFSVAAHLVLQLGYFKAKRQFFSYEQESSVLNDLDYIAALYFPTKTLSRLKSPSRP
FT                   IRAEQQRAILDLFQYKQCDNEVKVDLEDKAQRVAMLSTQPIFIFRELTQYLALHRIVMP
FT                   SYRYMQEMIGRVVAYERTRIARLLSTCMTSLIDQQLAALLRAESGVFRVSALKHEAKDF
FT                   SYKELRHEVARRQFFQPLHEFAKQFLITAGISNESGKYYASMVKFYTTYKLQRMKKETA
FT                   QLYLLFFAFHRFQQINDNLIEALLHWVDQYEKQAKRAAEEAMNNAVTNAAKNLQAAGHV
FT                   LSLFTDDTITDDTPFSIIKEKAYALLEQERFPLVADYLRNIAFDKTAFEWSHYTKLSAT
FT                   FKRNLRQLFTDLDFAGRVEDSPLLEAIAFLQNLLRTEKSPRQTDPNSFPTEIIPKGLRR
FT                   YLFSKEGKTFKTLDVDRYEFLVYRLLRNSLEAGDVYVKHSNEFRRFEDDLISDLRWQDK
FT                   ERVLQDIGAPILLAPIQDTLAVFHTMLAARYSAINQHISDGVNKHIKVIGAAEKRRWKL
FT                   LYPSSDESVNSDFYSQLPGIGIADLLWFVAGNTGFLNAFTHVLDRYVKHEADPREIFAC
FT                   IVAMGTNMGLAKMAEVSGLSSASMAGTSRNYLRLETLRAANDAISNATSQLPAFHLYDI
FT                   QDTLHSSSDGQRIETQINTLNARYSPKYFGLQKGVSAYTLVANHVPINAKIIGTHEHES
FT                   HYVFDLLHNNTSDIKPERHSTDTHGTNQVNFWILHAFGYHFAPRYRDLHKKMDTLVGSQ
FT                   HPNECGDWLIKPARKTNDELIEREWPNIQRIMASLAQKDVTQATIVRKLSSYSRQNQTK
FT                   KALWELENICRTLYILDFVDDVGLRQCVQKALNRGEAYHRLRRAVAFVNGGKFRVKTEE
FT                   EQQIWNECSRLITNAVIYYNTVLLSRVYEQKQTVGDQNALAQLHSISPVAWQHINMYGN
FT                   FEFSPSTSKIDIDALVARYAEPEYWKQALIENENSSE"
FT   gene            215929..216621
FT                   /locus_tag="Sputcn32_0193"
FT   CDS_pept        215929..216621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0193"
FT                   /product="cointegrate resolution protein T"
FT                   /note="KEGG: pol:Bpro_2488 cointegrate resolution protein
FT                   T"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73929"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U6"
FT                   /protein_id="ABP73929.1"
FT                   /translation="MGKFSHIQSLEEKHTHARQALEHYRESVKTQREQEQHRHDHQVQQ
FT                   LQAELRLSHQALSVKQQECTTLKAQTQQQSAELQHATQSVSKIEQQLLGIQNSQQQTEQ
FT                   KLYRKDTELNRLQKQHEDLQQQYAEAAAKVASLQEKEQAWLQEKAALSASLSTQQQLWQ
FT                   TFSTVNAISTPAQYAKGEDVIVVDADHALYDRIGQVERCVKKGDTVKYSVSFDGETYTL
FT                   PERLLRLA"
FT   gene            complement(216839..217246)
FT                   /locus_tag="Sputcn32_0194"
FT   CDS_pept        complement(216839..217246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0194"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein, MerR; KEGG:
FT                   abo:ABO_1367 transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73930"
FT                   /db_xref="GOA:A4Y1U7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U7"
FT                   /protein_id="ABP73930.1"
FT                   /translation="MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHGE
FT                   GLAFIRRCRILGLSLAEIHELQSYQDDPHQPCTAVNALLDDHISHVRSQITALQALEKQ
FT                   LVSLRASCNDDREVEACGVLAGISEGNMHQQ"
FT   gene            217342..218238
FT                   /locus_tag="Sputcn32_0195"
FT   CDS_pept        217342..218238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0195"
FT                   /product="cation efflux system permease, putative"
FT                   /note="KEGG: abo:ABO_1368 cation efflux system permease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73931"
FT                   /db_xref="GOA:A4Y1U8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U8"
FT                   /protein_id="ABP73931.1"
FT                   /translation="MSKSCGGACGGDATSAADTDIQASSEAPGRWVSVYAVPKMDCPSE
FT                   ERMIRLALNGFEEIRALSFDLSNRRLKVVHDGEVEPVTSKLKTLGLGASLQETVAANPE
FT                   TIKAAEFSAASAKQESGTLRWLLGINALLFVVEMTAGLIAQSTGLIGESLDNFADAAVY
FT                   GLALYAVGHSVKMQVRAAHLAGVLQLILAVGVLVEVVRRFVFGSEPESLVMMAIAFVAL
FT                   IANTSCLLLISKHREGGAHMKASWIFSANDVVINLGVITSGALVAWTGSNYPDLIIGTI
FT                   AGVIVLNGARRILALKD"
FT   gene            218242..218754
FT                   /locus_tag="Sputcn32_0196"
FT   CDS_pept        218242..218754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0196"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="KEGG: bxe:Bxe_C0884 lipoprotein signal peptidase
FT                   LspA; TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8, signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73932"
FT                   /db_xref="GOA:A4Y1U9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U9"
FT                   /protein_id="ABP73932.1"
FT                   /translation="MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTS
FT                   FFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIACSLIL
FT                   GGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKANTN
FT                   AEPDGSD"
FT   sig_peptide     218242..218310
FT                   /locus_tag="Sputcn32_0196"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.673 at
FT                   residue 23"
FT   gene            218776..220065
FT                   /locus_tag="Sputcn32_0197"
FT   CDS_pept        218776..220065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0197"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: bxe:Bxe_C0885 transposase, TnpA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73933"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1V0"
FT                   /protein_id="ABP73933.1"
FT                   /translation="MTELPDNILHLPQYQVLGCKSTDDEMHFQVDVPDPIACEECGVQG
FT                   EFVRFGKRDVPYRDLPIHGKRVTLWVVRRRYTCRACKTTFRPQLPEMVDGFRMTLRLHE
FT                   YVEKESFNHPYTFVAAQTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLNKRY
FT                   RCILTNIEERTLLDLLATRRQNVVTNYLMKLKDRQKVEIVSMDMWNPYRAAVKAVLPQA
FT                   RIVVDKFHVVRMANDALERVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRERLIME
FT                   TWTGAFPQLLAAYEHKERFYGIWDATTRLQAEAALDEWIATIPKGQKEVWSDLVRAVGN
FT                   WREETMTYFETDMPVTNAYTESINRLAKDKNREGRGYSFEVMRARMLYTTKHKKKAPTA
FT                   KVSPFYKKTIGYGLPDFAEELNYGVDLSTI"
FT   gene            complement(220338..221450)
FT                   /locus_tag="Sputcn32_0198"
FT   CDS_pept        complement(220338..221450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0198"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   sec:SC2060 propanediol utilization: propanol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73934"
FT                   /db_xref="GOA:A4Y1V1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1V1"
FT                   /protein_id="ABP73934.1"
FT                   /translation="MSLFTVKTRVYSGADSLTWLRTLHGKKIWIVCDGFLAGSPNLKMV
FT                   TDNIHEDNTVGLFSDIIPDPPVATVAAGIEAMSAIQPDVVIGFGGGSALDSAKAIIFFG
FT                   RKLGIMVENFVAIPTTSGTGSEVTSASVISDPASRIKYPLFDDSLYPDIALLEPRLVLS
FT                   VPPAVTANTGLDVLTHALEAYVAKGATDFTDALAEKAAQLVISFLPVVYRDGNELEART
FT                   RMHNASTLAGIAFSQAGLGMNHAIAHQLGGQLHIPHGLANALLLCHVIRFNSRDLAVRA
FT                   KYARLSKLCGLANFQSADEYCVASLITHLHNLMKQVNVADNLSALNITREQVTTAENAM
FT                   ITAALQDACLSTNPVTVSDTDIRAILRAII"
FT   gene            complement(221466..222860)
FT                   /locus_tag="Sputcn32_0199"
FT   CDS_pept        complement(221466..222860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0199"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: stm:STM2051
FT                   CoA-dependent propionaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73935"
FT                   /db_xref="GOA:A4Y1V2"
FT                   /db_xref="InterPro:IPR012408"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1V2"
FT                   /protein_id="ABP73935.1"
FT                   /translation="MNTTELENMIRNILADNLKGTATAPGNIQHTIFARVEDAITASYD
FT                   AYKKYMAEPLALRTRIITALKEELAPWIKEMSERAAEETGMGNAPDKISKNTAALNNTP
FT                   GIEDLTTSALTGDGGMVLFELSPFGVIGAIAPSTNPTETIINNTISMLAAGNAVYFSPH
FT                   PGAKKVSLWLIEKIEDIIYRVSGIRNLVTTVAEPTFDATREMMSDPRIALLAVTGGPAI
FT                   VNMAMKTGKKVIGAGPGNPPVLVDETACPVKAAKDIVDGASFDHNVLCIAEKCVIVVDS
FT                   IADRLMDNMQKNDAFLVKTPGDIARLRKVVINDKGEANKKLVGKSPAVILQAADLNTST
FT                   APRLIIVEVEQDDPLVMVEQLMPVLPVVRVSDFETGLALALKVENEQHHTAIMHSQNVT
FT                   RLNLAAKTMQTSIFVKNGPSYAGLGIGAEGFTTFTIATPTGEGTTSARSFARKRRCVLT
FT                   NGFSIR"
FT   gene            complement(222857..223366)
FT                   /locus_tag="Sputcn32_0200"
FT   CDS_pept        complement(222857..223366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0200"
FT                   /product="Uncharacterized protein possibly involved in
FT                   utilization of glycolate and propanediol-like protein"
FT                   /note="KEGG: ccr:CC2181 GlcG protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73936"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1V3"
FT                   /protein_id="ABP73936.1"
FT                   /translation="MPEQDIASLISEHRILLEEAVREVIRRYPQSLSPSENFSKHIFSS
FT                   EQLKNIIDTVLAEAWQQSAMVVITLCDEKGECVLTYRMPGTSAEDIAVAGRAAEAAVSF
FT                   AKENKQIIDPTLHNVIGGIDTSRGGCVVYCAGKVIGGIGISGASAEKNHLIALRAVDSL
FT                   KSGSQK"
FT   gene            complement(223399..223677)
FT                   /locus_tag="Sputcn32_0201"
FT   CDS_pept        complement(223399..223677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0201"
FT                   /product="Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml"
FT                   /note="PFAM: Ethanolamine utilization protein
FT                   EutN/carboxysome structural protein Ccml; KEGG:
FT                   ssn:SSO_2069 putative propanediol utilization protein:
FT                   polyhedral bodies"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73937"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1V4"
FT                   /protein_id="ABP73937.1"
FT                   /translation="MQLAKVVGSVVSTQKSASLTGKKLMVVTLVNLDGSTPLFQENTQE
FT                   VAVDSMGAGEGELVLVSRGSSARKIFPEPNQAIDLAIVGIVDTIDRF"
FT   gene            complement(223682..224161)
FT                   /locus_tag="Sputcn32_0202"
FT   CDS_pept        complement(223682..224161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0202"
FT                   /product="propanediol utilization"
FT                   /note="KEGG: sec:SC2056 propanediol utilization"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73938"
FT                   /db_xref="GOA:A4Y1V5"
FT                   /db_xref="InterPro:IPR030992"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1V5"
FT                   /protein_id="ABP73938.1"
FT                   /translation="MLDMIVSRVITLLQGRESRSLRVTQAELAAGLSKTVYLHNAQLIL
FT                   PLPDLAFIQSLVAYDHHHPAVSTVLEAWAYGVRLHLQIHQQLLTALPLRELRRLPVTLT
FT                   DHMSTPVKLAAAAGLSYASVIHWHDCWVLLEKQTLITALAREVMERQNIKLIWQE"
FT   gene            complement(224175..224810)
FT                   /locus_tag="Sputcn32_0203"
FT   CDS_pept        complement(224175..224810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0203"
FT                   /product="Propanediol utilization protein"
FT                   /note="PFAM: Propanediol utilization protein; KEGG:
FT                   sec:SC2055 propanediol utilization"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73939"
FT                   /db_xref="GOA:A4Y1V6"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y1V6"
FT                   /protein_id="ABP73939.1"
FT                   /translation="MDHDLITKLTGQVIAQMRQRTIPLGISNRHVHLSAKDYQSLFPGQ
FT                   TLKIKKPLGQPGQFAAEQTVSLIGPRGQLKNVRILGPLRGQTQVEISYTDARQIGLTAP
FT                   LRLSGDLTGSVSVTLKSEAGEINLTEGVIIARRHIHMSPLDAAIFGVTQGETVKVGIEG
FT                   TDRKLIFDDVCIRVAEDMRLEMHIDTDEANAAGIDGGQAVARLLLTKR"
FT   gene            complement(224815..225681)
FT                   /locus_tag="Sputcn32_0204"
FT   CDS_pept        complement(224815..225681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0204"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: stt:t0828
FT                   putative propanediol utilization protein PduK"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73940"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1V7"
FT                   /protein_id="ABP73940.1"
FT                   /translation="MQHSLGLIEVSGMSLAITVADVMAKTAQIRLIGVERTIGSGWMLV
FT                   KIAGDVAAVRTALSAGEETARAHQGFVACTTIARPAKGTGELVSTTKPPRAEPVQKITV
FT                   LPAVALTASAAHTTTGPESVQEDPDAEKAVPPIREAVEGSTGNIIQVDAINDPVETARE
FT                   ISKPNASAKSPPAEYGEKQSVATVKAFPVMGDIATDLDIPTASARSVAVAQQVKPGISL
FT                   HQFHYQEKPDDETADAGSQQTGETKQAVAISAKLLVTCKICGDPSCPRHKGQPRSRCIH
FT                   NQKSVLR"
FT   gene            complement(225709..225999)
FT                   /locus_tag="Sputcn32_0205"
FT   CDS_pept        complement(225709..225999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0205"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: ssn:SSO_2065
FT                   putative propanediol utilization protein: polyhedral
FT                   bodies"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73941"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1V8"
FT                   /protein_id="ABP73941.1"
FT                   /translation="MNNALGMIETYGLIGAIVGADAMVKSANVQLVGYEKIGSGLVTVM
FT                   VRGDVGAVKASVEAGSAAAAGVGQVKSTHVIPRPHNEVETLLPVYQTATAE"
FT   gene            complement(226071..226898)
FT                   /locus_tag="Sputcn32_0206"
FT   CDS_pept        complement(226071..226898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0206"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel proteins; PFAM: major
FT                   intrinsic protein; KEGG: stm:STM2037 Propanediol
FT                   utilization: propanediol diffusion facilitator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73942"
FT                   /db_xref="GOA:A4Y1V9"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1V9"
FT                   /protein_id="ABP73942.1"
FT                   /translation="MNTTLPTLKQECLAEFLGTGLFLFLGISCLAAMKLAAASFGLWEI
FT                   CIVWGLSVALGVYLTAGISGGHLNPAVTIALWLFGNFSAHKVLPYILCQIMGAFGGAMV
FT                   VYLLYHNLFIDYELAHHIQRGSMDSLAQAGIFTTFPHPEINLLQAFASETIGTLTLMCL
FT                   IMALTDDGNGVPRGPLAPLLIGISVALIGVAIGALTGFALNPARDLGPRLFSYLAGWGS
FT                   NALTGGRAFPYFIIPLVAPIFGACLGAALYRGLTRLPLLPGKGGQGKSLSLPE"
FT   sig_peptide     complement(226785..226898)
FT                   /locus_tag="Sputcn32_0206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.647) with cleavage site probability 0.558 at
FT                   residue 38"
FT   gene            complement(226933..227853)
FT                   /locus_tag="Sputcn32_0207"
FT   CDS_pept        complement(226933..227853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0207"
FT                   /product="glycyl-radical enzyme activating protein family"
FT                   /note="TIGRFAM: glycyl-radical enzyme activating protein
FT                   family; PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; Radical SAM domain protein; KEGG: ecc:c4538
FT                   putative pyruvate formate-lyase 3 activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73943"
FT                   /db_xref="GOA:A4Y1W0"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1W0"
FT                   /protein_id="ABP73943.1"
FT                   /translation="MAEIDYAQTGTVFNIQKFSLHDGPGIRTIVFLKGCYLACKWCSNP
FT                   ESQHTEPEIFYYDRNCIHCGRCVSACPVGAIDASRQGLIDRNACIHCGACAEVCPAGAM
FT                   VQSGKRMSVVEVIDELRKDETHYRRSGGGITLSGGEALAQPAFAAALLAACKARGWHTA
FT                   METTGIASRAVLEKVIPLLDIVLLDIKTFYSERHKEFTGHPNETVLRNALTISELAKNV
FT                   AVRIPVIPGFNDDEQSIEAIARFVTHMKNVSRLHLLPYHNYGQNKYNLLGRTYDMIEIK
FT                   PPEESRMHKYKDIVTSLGIDCVIGG"
FT   gene            complement(227992..230535)
FT                   /locus_tag="Sputcn32_0208"
FT   CDS_pept        complement(227992..230535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0208"
FT                   /product="pyruvate formate-lyase"
FT                   /EC_number="2.3.1.54"
FT                   /note="KEGG: ctc:CTC00936 formate acetyltransferase 2;
FT                   TIGRFAM: pyruvate formate-lyase; PFAM: formate
FT                   C-acetyltransferase glycine radical; pyruvate
FT                   formate-lyase, PFL"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73944"
FT                   /db_xref="GOA:A4Y1W1"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1W1"
FT                   /protein_id="ABP73944.1"
FT                   /translation="MSQLSQAFGEPTDRIRALREQILDTTPCIETDRARLITESYKETE
FT                   SLPMIIRRAKALEKILAELPVTIRAGELIVGSLTVTPHSTQIYPEYSNRWLQDEFDRLN
FT                   LRKGDRFTITDEAKQQLDSVFGYWEGKTTNELATSYMLPETLDCMAENVFTVGNYYFNG
FT                   VGHIAVDYARVLARGYKGIIQDVVAAMASADKKDPAFLKKESFYKAVIISCNAAINFAH
FT                   RYAVKARTLAEQASPVRKKELLKIAEICDKVPENGASNFYEACQSFWFAHAIIQLESNG
FT                   HSISPARFDQYMYPYLEKDSSLSEEQAQELLDCLWLKFNDVNKVRDEGSTKGFGGYPMF
FT                   QNLIVGGQTSGGQDATNRLSFMAMTATAHVRLHEPSLSVRVWSKSPDDLLLKACEVSRL
FT                   GMGIPAYYNDEVVIPALINRGLTLEDAREYGIIGCVEPQRPGKTEGWHDAAFYNMSKVL
FT                   EITLNNGRCGDKQLGPKTGELDSFQSIEDIIEAYRKQNEYFVYHLAMADNSVDLAHMER
FT                   APLPFLSCMVDDCISRGKSVQEGGAHYNFTGPQGVGVANVGDSLMAIKRLVFEEGQLSL
FT                   GHLKEALDANFGVSGGIEKPDTIATESTPKQDATYELVLEAVKKVLGESGALALTSLNS
FT                   NPPEPVKGANAGLTAVRQLLINGAPKFGNDIDEVDMLARTGAEIYCREVEKYTNPRGGL
FT                   FQAGLYPVSANVALGESVGATPDGRLAGQPLPDGVSPSRGMDTKGPTAAANSVAKLDHF
FT                   LASNGTLFNQKFHPAALKGDEGLYHLAALLRGYFDQKGMHVQFNVIDRNTLLAAQKEPE
FT                   KYRDLVVRVAGYSAQFVSLDKSVQDDIILRTEHVF"
FT   gene            complement(230560..231375)
FT                   /locus_tag="Sputcn32_0209"
FT   CDS_pept        complement(230560..231375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0209"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: sec:SC2047
FT                   propanediol utilization: polyhedral bodies"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73945"
FT                   /db_xref="GOA:A4Y1W2"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030984"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1W2"
FT                   /protein_id="ABP73945.1"
FT                   /translation="MSSDNLVENIIAEVLGKVGDLKTPSAASQPGISQQEPAIPRKLCG
FT                   LTEFVGTATGDSIGLVIANVDSALLDAMHLEKKYRSIGILGARTGAGPQIMAADEAVKA
FT                   TNTEVVAIELARDTKGGAGHGSLVLFGGQDVSDVKRAVEVALGELERTFGDIYANAAGH
FT                   VELQYTARASYALEKAFGAPLGRACGVIVGAPAAIGVLMADTAIKSANVDVVAYNSPAK
FT                   GTSFTNEVILIVSGDSGAVRQAVRSARDVGLTLLETMGGKAPSATTPYI"
FT   gene            complement(231372..231674)
FT                   /locus_tag="Sputcn32_0210"
FT   CDS_pept        complement(231372..231674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0210"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: ssn:SSO_2058
FT                   putative propanediol utilization protein: polyhedral
FT                   bodies"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73946"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR020808"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1W3"
FT                   /protein_id="ABP73946.1"
FT                   /translation="MQQEALGMVETKGLTAAIEAADAMVKSANVVLIGYEKIGSGLITV
FT                   LVRGDVGAVKAATDAGCASARQIGDVIATHVIPRPHSDVEKLLPAGLKPSEGVKQ"
FT   gene            complement(232687..233547)
FT                   /locus_tag="Sputcn32_0211"
FT   CDS_pept        complement(232687..233547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0211"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IID subunit; PFAM: PTS system
FT                   mannose/fructose/sorbose family IID component; KEGG:
FT                   bsu:BG10319 PTS fructose-specific enzyme IID component"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73947"
FT                   /db_xref="GOA:A4Y1W4"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1W4"
FT                   /protein_id="ABP73947.1"
FT                   /translation="MSIDNTNKDTTVTENKRLTSGDLRSMFLRSNVLLASANFERVQNL
FT                   GICYIMIPAIKRLYAPGPERIEALKRHLEWFNTQPYCASPILGVAAAMEEEKANGAQIE
FT                   GNSISGVKIGLMGPFAGVGDPIFWGTIRPVLAALGASLALTGNILGPIIFFVLFNAIRL
FT                   ALKYYGLNYGYQKGREILKDLGGDRLQKLTEGASILGLFVIGALVCKWTTINVPIVVSR
FT                   VTQADGHVTVTTLQNIFDQLLPGMLPLALTLLVARLLRKKLSPLLLIMLIFAFGILGYW
FT                   AGILA"
FT   gene            complement(233558..234355)
FT                   /locus_tag="Sputcn32_0212"
FT   CDS_pept        complement(233558..234355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0212"
FT                   /product="PTS system, mannose/fructose/sorbose family, IIC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, mannose/fructose/sorbose
FT                   family, IIC subunit; PFAM: phosphotransferase system PTS,
FT                   sorbose-specific IIC subunit; KEGG: bld:BLi02829 PTS
FT                   fructose-specific enzyme IIC component; RBL00186"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73948"
FT                   /db_xref="GOA:A4Y1W5"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1W5"
FT                   /protein_id="ABP73948.1"
FT                   /translation="METYQIIALVMVAALAGIGSVLDEAQTHRPLVVCTLVGIVLGDIK
FT                   TGIILGGTLEMMALGWMNVGLAMAPDTAIASVISTILVITTHQGIGQGIAIAVALAAAG
FT                   QVLTIFIRTIAVFFVHKADTYAESGNIRGIEFMHISALSLQALRVALPTLAVLMLDVTT
FT                   VQNVLNSIPEVVTKGLQIGGGIVVVVGYAMVVNMMNVRHLMPFLFAGFLIAAFTNFNLV
FT                   GLGGMGLVAAIIYLQVNPRFSAASKAVSSPSKATLSDEDDLDS"
FT   gene            complement(234371..234685)
FT                   /locus_tag="Sputcn32_0213"
FT   CDS_pept        complement(234371..234685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0213"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="PFAM: PTS system sorbose subfamily IIB component;
FT                   KEGG: bsu:BG10317 PTS fructose-specific enzyme IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73949"
FT                   /db_xref="GOA:A4Y1W6"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1W6"
FT                   /protein_id="ABP73949.1"
FT                   /translation="MKASVVTVEKMIKAYHSERYEGVTAFLLFGNPTDVLHLVEGGVKI
FT                   PSVNIGGMIYEEGRKQLTKSVSATPEDIASFKKLHEKGVQLELRQLPSDSAVDFYSKIE
FT                   "
FT   gene            complement(234751..235674)
FT                   /locus_tag="Sputcn32_0214"
FT   CDS_pept        complement(234751..235674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0214"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sgl:SG1040 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73950"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1W7"
FT                   /protein_id="ABP73950.1"
FT                   /translation="MAKQKFKITNWPTYNKALINRGSITFWLDDEAIQAWYESATPSSR
FT                   GRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFTLMNVPLRCPDYTSVSRRAKSVN
FT                   VSFKTFTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRIWRKLHLAVDSNTHEIICA
FT                   DLSLNNVTDSEAFPGLIRQTHRKIRAAAADGAYDTRLCHDELRRKKISALIPPRKGAGY
FT                   WPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETAMYRVKQLFGGSLTLRDYDGQ
FT                   VAEAMALVRALNKMTKAGMPESVRIA"
FT   gene            complement(235737..236078)
FT                   /locus_tag="Sputcn32_0215"
FT   CDS_pept        complement(235737..236078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0215"
FT                   /product="IS1 transposase"
FT                   /note="PFAM: IS1 transposase; KEGG: sec:SC1834 IS1
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73951"
FT                   /db_xref="GOA:A4Y1W8"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1W8"
FT                   /protein_id="ABP73951.1"
FT                   /translation="MPRHRTHYGHWSQPHFPPFKKLRPQSVTSRIQPGSDVIVCAEMDE
FT                   QWGYVGAKSRQRWLFYAYDRIRRTVVAHVFGERTMATLERLLGLLSAFEVVVWMTDGWP
FT                   LYESRGFVE"
FT   gene            complement(235997..236272)
FT                   /locus_tag="Sputcn32_0216"
FT   CDS_pept        complement(235997..236272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0216"
FT                   /product="Insertion element protein"
FT                   /note="PFAM: Insertion element protein; KEGG: sec:SC062
FT                   transposition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73952"
FT                   /db_xref="GOA:A4Y1W9"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR024431"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1W9"
FT                   /protein_id="ABP73952.1"
FT                   /translation="MASVSVCCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLTFTY
FT                   TASQPGTHQKIIDMAMNGVGCRATARIMGIGLNPIFRHLKNSGRSQ"
FT   gene            236424..237026
FT                   /locus_tag="Sputcn32_0217"
FT   CDS_pept        236424..237026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0217"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   ecc:c0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73953"
FT                   /db_xref="GOA:A4Y1X0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1X0"
FT                   /protein_id="ABP73953.1"
FT                   /translation="MKTSPWNKDCIIGQKRPLQISHIWGIRIRLELEGKTRDLALFNMA
FT                   LDSKLRGCDLVKLKVSDVAYGSSVSSRATVLQQKTGSPVQFEITKGTREAVAALIKLGN
FT                   LHSKDFLFRSRVGTCQHISTRQYNRIFHGWIAKLGLENSLYSTHSMRRTKPYLIYKKTK
FT                   NLRVIQLLLGYKKLESTVRYLGIEVDDALEISESIEV"
FT   gene            237269..238300
FT                   /locus_tag="Sputcn32_0218"
FT   CDS_pept        237269..238300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0218"
FT                   /product="IS630 ORF"
FT                   /note="KEGG: sbo:SBO_P069 IS630 ORF"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73954"
FT                   /db_xref="GOA:A4Y1X1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1X1"
FT                   /protein_id="ABP73954.1"
FT                   /translation="MPIIAPIPRDERRLMQKAIHKTRDKNYARRLTAMLMLHRGERVSH
FT                   VARTLCCARSSIGRWINWFTLSGAEGLKSLPSGRGRRWPFEHICALLRELVKHSPGDFG
FT                   YQRSRWSTELLAIKIRDVTGCPLHASTIRRWLPAAGLVWRRAAPTLRIRDPHKEEKMVA
FT                   IHEALAKCSAENPVFSEDEVDIHLNPKIGADWQLRGQQKRVVTPGQNEKYYLAGALHSG
FT                   TGKVSYVGGNSKGSSLFIRLLKHLKATYRRAKTITLIVDNYIIHKSRETLRWLKANQKF
FT                   RVIYQPVYSPWVNHVERLWQALHETITRNHQCRSMWQLLKKVHHFMDTVSPFPGGKHGL
FT                   AKV"
FT   gene            complement(238827..239708)
FT                   /locus_tag="Sputcn32_0219"
FT   CDS_pept        complement(238827..239708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0219"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: stm:STM2036 Propanediol utilization:
FT                   transcriptional regulation, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73955"
FT                   /db_xref="GOA:A4Y1X2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1X2"
FT                   /protein_id="ABP73955.1"
FT                   /translation="MRNAHDILDNIVYDFANATGLGSVAVDLNGKEISPWYNFTSFCQQ
FT                   VRQIAAYHPYCQQCDRCGGFESTKAKQIQCYRCHAGLVDFSIPIFINGNLTGFVSCGQA
FT                   RVAENLPLPKIVENDKNLPTESKLIELYHEVPELSLMKIKSAAQLLNLIIENYLSKEYN
FT                   LRIVKNVSPVKNQKLETLGRHQATMEMILNHINQNFSDNLNLEQMASKANLSMFYFSRT
FT                   FKELTGTGFTAYLINKRMTEAHCLLEQTNWSIEKIARSVGYNDVHYFSRLFKKTFNRSP
FT                   SEFRNHSSGFSM"
FT   gene            complement(239957..240364)
FT                   /locus_tag="Sputcn32_0220"
FT   CDS_pept        complement(239957..240364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0220"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein, MerR; KEGG:
FT                   abo:ABO_1367 transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73956"
FT                   /db_xref="GOA:A4Y1U7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U7"
FT                   /protein_id="ABP73956.1"
FT                   /translation="MRIGQLAQLVGVETQTIRFYEQQGLLPPPDRQDNGYRVYTEKHGE
FT                   GLAFIRRCRILGLSLAEIHELQSYQDDPHQPCTAVNALLDDHISHVRSQITALQALEKQ
FT                   LVSLRASCNDDREVEACGVLAGISEGNMHQQ"
FT   gene            240460..241356
FT                   /locus_tag="Sputcn32_0221"
FT   CDS_pept        240460..241356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0221"
FT                   /product="cation efflux system permease, putative"
FT                   /note="KEGG: abo:ABO_1368 cation efflux system permease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73957"
FT                   /db_xref="GOA:A4Y1U8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U8"
FT                   /protein_id="ABP73957.1"
FT                   /translation="MSKSCGGACGGDATSAADTDIQASSEAPGRWVSVYAVPKMDCPSE
FT                   ERMIRLALNGFEEIRALSFDLSNRRLKVVHDGEVEPVTSKLKTLGLGASLQETVAANPE
FT                   TIKAAEFSAASAKQESGTLRWLLGINALLFVVEMTAGLIAQSTGLIGESLDNFADAAVY
FT                   GLALYAVGHSVKMQVRAAHLAGVLQLILAVGVLVEVVRRFVFGSEPESLVMMAIAFVAL
FT                   IANTSCLLLISKHREGGAHMKASWIFSANDVVINLGVITSGALVAWTGSNYPDLIIGTI
FT                   AGVIVLNGARRILALKD"
FT   gene            241360..241872
FT                   /locus_tag="Sputcn32_0222"
FT   CDS_pept        241360..241872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0222"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="KEGG: bxe:Bxe_C0884 lipoprotein signal peptidase
FT                   LspA; TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8, signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73958"
FT                   /db_xref="GOA:A4Y1U9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1U9"
FT                   /protein_id="ABP73958.1"
FT                   /translation="MSIFGKHLSPYALLSISGLLAASDQAVKWLVQQSMAYGESISVTS
FT                   FFNWVHVWNTGAAFSLFANGGGWQRYFFIGIAVVVSIFLIKLILENRHKGEAIACSLIL
FT                   GGAMGNLIDRVFRGYVVDSFDFYWRDWHWPAFNLADIAIVLGALLLVSSSLLGKKANTN
FT                   AEPDGSD"
FT   sig_peptide     241360..241428
FT                   /locus_tag="Sputcn32_0222"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.673 at
FT                   residue 23"
FT   gene            241894..243183
FT                   /locus_tag="Sputcn32_0223"
FT   CDS_pept        241894..243183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0223"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: bxe:Bxe_C0885 transposase, TnpA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73959"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1X6"
FT                   /protein_id="ABP73959.1"
FT                   /translation="MTELPDNILHLPQYQVLGCKSTDDEMHFQVDVPDPIACEECGVQG
FT                   EFVRFGKRDVPYRDLPIHGKRVTLWVVRRRYTCRACKTTFRPQLPEMVDGFRMTLRLHE
FT                   YVEKESFNHPYTFVAAQTGLDEKTVRDIFNARAEFLGRWHRFETPRILGIDELYLNKRY
FT                   RCILTNIEERTLLDLLATRRQNVVTNYLMKLKDRQKVEIVSMDMWNPYRAAVKAVPPQA
FT                   RIVVDKFHVVRMANDALERVRKGLRKELKPSQSRTLKGDRKILLKRAHEVSDRERLIME
FT                   TWTGAFPQLLAAYEHKERFYGIWDATTRLQAEAALDEWIATIPKGQKEVWSDLVRAVGN
FT                   WREETMTYFETDMPVTNAYTESINRLAKDKNREGRGYSFEVMRARMLYTTKHKKKAPTA
FT                   KVSPFYKKTIGYGLPDFAEELNYGVDLSTI"
FT   gene            243253..243663
FT                   /locus_tag="Sputcn32_0224"
FT   CDS_pept        243253..243663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_0608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73960"
FT                   /db_xref="GOA:A4Y1X7"
FT                   /db_xref="InterPro:IPR022172"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1X7"
FT                   /protein_id="ABP73960.1"
FT                   /translation="MNKKIKHEYQLSIRSAQEAEEINDLDNAFKSLERAHILGQRYFIP
FT                   HIATHWQMLRIGLKRNDNREVIGQIVRLIATVPGFIFGWVPRGNPGGANISALKPVPLP
FT                   ADLQPLLADSPIWRDVLIRLTIYAVIVLIVLA"
FT   gene            complement(243729..246851)
FT                   /locus_tag="Sputcn32_0225"
FT   CDS_pept        complement(243729..246851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0225"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: sde:Sde_1955 cation
FT                   efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73961"
FT                   /db_xref="GOA:A4Y1X8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1X8"
FT                   /protein_id="ABP73961.1"
FT                   /translation="MIESMLRLAIARRYLFLTLTLLIIAIGSWSYQQLPIDAVPDITNV
FT                   QVQINTAAPGYSPLEAEQRITYPVETALYGLPNLSYTRSLSRYGLSQVTVVFEEGTDIY
FT                   FARNLINTRLGAIKDMLPEGIEPEMGPISTGLGEIFMYTVQAKPGALQQNGSPYDAMAL
FT                   REIQDWIIKPQLAQVKGVVEVNSIGGYNKQYHVLPDPLKLLNYGLSIKDIELALQANND
FT                   NRGAGYIEREGMQLLVRSPGQLTSLDDIANVIITQYDTIPVKLSDVADVAIGKELRTGA
FT                   ATQDGKEAVLGTAMMLIDENSRTVARDVAQKLEQIKSSLPEGIIAEAVYDRTTLVDKAI
FT                   ATVSKNLLEGALLVIVVLFILLGNLRGALITAAVIPLSMLMTITGMVQAGVSANLMSLG
FT                   ALDFGLIVDGTVIIVENAVRRLAQAQHNGRIQPLKERLNTVYLATAEVIRPSLFGVAII
FT                   TIVYMPIFSLTGVEGKMFHPMAATVVIALLSAMVLSLTIVPAAVAVFLNGKISEKESAV
FT                   IRSAKTLYAPLLALALKWRALVIGLASALVGVCLWLATTLGSEFVPQLDEGDIALHAMR
FT                   IPGTGLEQAVAMQEILEQKIKTFAEVDKVFARIGTPEVATDPMPPNVADNFVILKPRSE
FT                   WPNPDKTKAQLVTEMEAALATLPGNNYEFTQPIQMRFNELISGVRADLGIKVFGDDLDQ
FT                   LVTSANQILQAVNKVQGAADTKVEQVTGLPTLSVIPNRTALARYGLNVVELQDWVAAAI
FT                   GGTSAGILYEGDRRFELIVRLPETLRRDLDKLAVLPVPLPNGDFVPLQEVATLDLSPAP
FT                   AQISRENGKRRVVVTANVRGRDLGSFVEEVKAQINRDVTLPAGYWLDYGGTFEQLESAS
FT                   QRLSIVVPVTLLLILGILVMAFASFKDALIIFSGVPLALTGGVLALYLRGMPLSISAGI
FT                   GFIALSGVAVLNGLVMLSFIRDLWREKGDLLLAITEGALTRLRPVLMTALVASLGFVPM
FT                   AINIGTGAEVQRPLATVVIGGIISSTLLTLLVLPVLYHWVHKNDNRKQQTE"
FT   sig_peptide     complement(246759..246851)
FT                   /locus_tag="Sputcn32_0225"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.684) with cleavage site probability 0.612 at
FT                   residue 31"
FT   gene            complement(246861..247907)
FT                   /locus_tag="Sputcn32_0226"
FT   CDS_pept        complement(246861..247907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0226"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: sde:Sde_1956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73962"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1X9"
FT                   /protein_id="ABP73962.1"
FT                   /translation="MKSHLTLAMFIAAWLMPMQVMAANEQEHAHVHAKEQAVKPQSDAK
FT                   KNEEHEKHGENEEHEEHEEHNEHEGHDENDEHEHNETLSSRISDDMATAVNIVTDRADS
FT                   QLLRQHQVVYGKLSADPNRISHVNARFPGLLTSVKFSLGDSVKAGDVLAVVESNESLNT
FT                   YAIKAPIDGVVIQRSANVGEIAQQQTLFSIADFGSLWADFRVYPSQQVAVATGQTVVIM
FT                   AADTEINGVIAHIIPSLTQPYQLARVKLDKRDGKLSSGQLIEGAVISGEFNVELAVKKS
FT                   AIQILDNKSGVFVKNNSEYAFTPLQLGRSDMDYVEVIAGLKPGQWYVTTNSYLLKADIE
FT                   KSEAEHAH"
FT   sig_peptide     complement(247839..247907)
FT                   /locus_tag="Sputcn32_0226"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(247986..249230)
FT                   /locus_tag="Sputcn32_0227"
FT   CDS_pept        complement(247986..249230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0227"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   sde:Sde_1958 aconitate hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73963"
FT                   /db_xref="GOA:A4Y1Y0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Y0"
FT                   /protein_id="ABP73963.1"
FT                   /translation="MRMTLMPPAILAAVFCALPLRAEPQALTLQQAIDKTLQHNPQLHQ
FT                   FKFTQQRLLAERDVQSLKPGYQLGVELEDVAGTGEARGLAGAELTVALSSVIELDNKAQ
FT                   WRAAVVDARLNTLDWQQQAQTLDVLAELTRNYINLLASQQELTLTEEAVELSEALLQSA
FT                   EKRAASGALSDAEIMRAKAQLAQVQIGRDALLQRIERQKIAIARFWGDTSANFNVVAGN
FT                   LFAFGQSRPFAELYQRLQQSPALTIFASERRLKDAEVRLAQSQNRADLSWQVGVRRIQA
FT                   SDDTGLTFGISVPLFAERRNSAAIEAALAERNNVEYRQQDSLLILHERLFDAYSQRQQF
FT                   ITSHQQLAQYVIPNLEQALDLTRDAYQRGRSNYQDWLNAQQELLQAKRQILETATAVLL
FT                   SQATIEQLTAEPVTQ"
FT   sig_peptide     complement(249162..249230)
FT                   /locus_tag="Sputcn32_0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(249282..249647)
FT                   /locus_tag="Sputcn32_0228"
FT   CDS_pept        complement(249282..249647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73964"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Y1"
FT                   /protein_id="ABP73964.1"
FT                   /translation="MLGRTSGLLLLLLIMLNHAVMACDALVMHLPDHAHAYTDLQHEHC
FT                   HSDTLFDVSSEQVTAHNVAHNSEHDADEQSNHAHVTCYIAFFQGMELLNFRDSVIAATQ
FT                   PGLNLISYRPPVPPPNI"
FT   sig_peptide     complement(249579..249647)
FT                   /locus_tag="Sputcn32_0228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(249734..250639)
FT                   /locus_tag="Sputcn32_0229"
FT   CDS_pept        complement(249734..250639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0229"
FT                   /product="cation efflux system permease, putative"
FT                   /note="KEGG: abo:ABO_1368 cation efflux system permease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73965"
FT                   /db_xref="GOA:A4Y1Y2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Y2"
FT                   /protein_id="ABP73965.1"
FT                   /translation="MNPKCCSNDKCSETGNSENSAVDAPDKHAKYAYLSEFRVPKMDCP
FT                   AEERLIRMALETVEPGVLLQFDIPQRQVRVFHTVNANEITPKMHSLGLGASLTKTGPVK
FT                   HEEVTQARQSTASGSQREGLILKWLLGINAVMFAVEFVTGWLAQSTGLIADSLDMFADA
FT                   AVYGVALYAVGRSSKVQLNAAQLAGWLQLALALGVISEVIRRYLFGSEPVSTLMLIMGA
FT                   IALVANVICLSLIHQQKESGAHMKASWIFSANDVIANAGVILAGLLVTWTGSRYPDLVI
FT                   GFIIGLVVLNGARRILQLKA"
FT   gene            250662..251126
FT                   /locus_tag="Sputcn32_0230"
FT   CDS_pept        250662..251126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0230"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional
FT                   regulator; PFAM: regulatory protein, MerR; KEGG:
FT                   sde:Sde_1961 putative transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73966"
FT                   /db_xref="GOA:A4Y1Y3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Y3"
FT                   /protein_id="ABP73966.1"
FT                   /translation="MKPSLNSVVTIESIGSIEMIKIGELAKISGCSVQTIRHYEKEQLL
FT                   AAKLRSDGNFRLYDHADIERLLFIKHCRSLDLSLAEIRQLLSLNDSPMSQCDDVNQMIE
FT                   QHIEQVERRIADLTQLNKQLKALRLSCNLKRTVEHCGILKQLNEAVSQTN"
FT   gene            251158..252066
FT                   /locus_tag="Sputcn32_0231"
FT   CDS_pept        251158..252066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0231"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   tcx:Tcr_1429 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73967"
FT                   /db_xref="GOA:A4Y1Y4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Y4"
FT                   /protein_id="ABP73967.1"
FT                   /translation="MHQHNHSHIKDDSDNRIAMAFFLNVGFTLIEFIGGWLTNSTAIMA
FT                   DAVHDLGDSLSIGSAWLLNRLGRKSANRQFTYGYRRLSLFGALINGLVLIAGSVWVLTE
FT                   AIPRLANPVMPVTEGMLALAVLGVAVNGFAAYRLSKGNTLNEKVLNWHLLEDVLGWVAV
FT                   LVVAIVLQFVDWPILDPLLSIGFTLFILVNVLRNLSTTARLFLQAAPDSKLQNEIQDTL
FT                   LKIDELDSIHHLHLWSLDGEHHVLTAHVVTNASKAFTANHYADIKLRIANALEQFDLAH
FT                   TTIELELTQEDCRDEFPDMVQ"
FT   gene            252041..252394
FT                   /locus_tag="Sputcn32_0232"
FT   CDS_pept        252041..252394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0232"
FT                   /product="protein of unknown function UPF0060"
FT                   /note="PFAM: protein of unknown function UPF0060; KEGG:
FT                   abo:ABO_1373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73968"
FT                   /db_xref="GOA:A4Y1Y5"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Y5"
FT                   /protein_id="ABP73968.1"
FT                   /translation="MNSRIWCSEVTVITTLGLFIITAIAEIVGCYLPYLWLKKGASAWV
FT                   LLPTAISLALFAWLLTLHPTAAGRVYAAYGGVYVTIAIVWLWGVDGIQPHRWDLAGVGL
FT                   MLAGMAVIMFAPR"
FT   gene            252538..252927
FT                   /locus_tag="Sputcn32_0233"
FT   CDS_pept        252538..252927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73969"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Y6"
FT                   /protein_id="ABP73969.1"
FT                   /translation="MEACINQMLSVINSSSVKYDRMIALAEWLVTAIDAIKEPIQFSTS
FT                   EQPVTVDHNACEIRFNRVQIENCFNEDGQQIAPMMINYRYTSEDNLIALKKVFNSDYQL
FT                   IECVVLTNNTADIFIIDSAHWMDAQ"
FT   gene            252957..253367
FT                   /locus_tag="Sputcn32_0234"
FT   CDS_pept        252957..253367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73970"
FT                   /db_xref="GOA:A4Y1Y7"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Y7"
FT                   /protein_id="ABP73970.1"
FT                   /translation="MIQLSSLTLHDVVRNLSGLGFFWALWMIFPYRHNHAIPLLRSGAA
FT                   IAFMAAGLYMLSDKGLVEFHTPAFLALATLLVTTKMDNTNTFPAMVIQNVFLGSTLISL
FT                   FIYGIGTVVITCTSAAIFLYILNKAMPEDIHN"
FT   gene            complement(253541..254446)
FT                   /locus_tag="Sputcn32_0235"
FT   CDS_pept        complement(253541..254446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA1708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73971"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Y8"
FT                   /protein_id="ABP73971.1"
FT                   /translation="MNLIPFGLRSDGVYIDAEDATRGKSCDCTCPSCGIALIARQGDVN
FT                   ASHFAHDSKGASKEDIEACKYSFYVSVRYMLKQLLQGTGLLMMPPLEIDHHGQTHVITK
FT                   SLPITVEPMDITPDSYEQDIMFDLIFTVSGRKLCLYISHPGRPAPIYNNLSRDQHTAVL
FT                   GLDLIPFSKIFNEFYKLKSAQTLLREWLETSIKGKHWIYNPRRNAWFEHQQAKAPAVQE
FT                   QQQQQVLEQTKTTRDRIKEQIAQMDRLNVVAIYRCVFCQLDFEGSALLNYCPKCNDHLS
FT                   VKRKSEIAAQTPPKGKYRYR"
FT   gene            complement(254455..254817)
FT                   /locus_tag="Sputcn32_0236"
FT   CDS_pept        complement(254455..254817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73972"
FT                   /db_xref="InterPro:IPR019648"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Y9"
FT                   /protein_id="ABP73972.1"
FT                   /translation="MKKAIIISLLALSPTLNAKEIHQSSYGESWPFTVESGELGCYEQA
FT                   VFFIANDKEYAVNGVAQSKGYDAIEPIWKEDSSLLEYQKAIAKKENKTLRQVQDEMGVS
FT                   RVNIGPILQEGLKLCK"
FT   sig_peptide     complement(254761..254817)
FT                   /locus_tag="Sputcn32_0236"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(254905..255900)
FT                   /locus_tag="Sputcn32_0237"
FT   CDS_pept        complement(254905..255900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0237"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   ppr:PBPRB0929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73973"
FT                   /db_xref="GOA:A4Y1Z0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Z0"
FT                   /protein_id="ABP73973.1"
FT                   /translation="MSKPLAHLTDADKLRIREITQAKLKHFLENGHRTRRANTWRALMS
FT                   RWAKFESWCLTNNLTPLPATPEVVATFIEYHQASSYTTLSQYAWAINSFHVECGLLSPV
FT                   SSKTVQDKQNEIRIVKLESGGLAQEQATPFRLHHLQMLIESYGESERLLDKRNLALLNI
FT                   AYESLLRESELLRIKVGHLKSTFEGDYVLSVPYTKTNDSGEEEVVNITPLGFKLIQRYI
FT                   QGAGLTKEDYLFQPIGRSNKVSVQAKPMNTRTVDRVFLWAFESLAIDLHSAWSGHSARI
FT                   GAAQDLLAAGYSIAQIQENGRWKSPMMVLRYGKDIKAKESAMAKMLAERR"
FT   gene            complement(255998..256582)
FT                   /locus_tag="Sputcn32_0238"
FT   CDS_pept        complement(255998..256582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_2032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73974"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Z1"
FT                   /protein_id="ABP73974.1"
FT                   /translation="MNDTTSPLKSDSLGPAWTYHALPSDVSSRPKGRTLRLLAASEAAC
FT                   PQVRDLLSRMIGNTFNQIEKTEWFTSQFLNGTPTLTVTFRQLMRETEPTKSKPLPQETA
FT                   LHSLNVCLNSIFSDSGWKLVRRRISQIERLQKTTRPVISKTQYDKLVLFKDTIGAKSVD
FT                   AAIDELLSFYKDEHPAFSADREALGELVNHE"
FT   gene            complement(256659..257336)
FT                   /locus_tag="Sputcn32_0239"
FT   CDS_pept        complement(256659..257336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73975"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Z2"
FT                   /protein_id="ABP73975.1"
FT                   /translation="MQISPSIYLDQATSLLAPLPFLEDNGDADSYYQEYSFYVDTPNPQ
FT                   VKLELAVMVNAEALTDSDHAPIVFTYGINLGQGNGIEDGANFYVEDIEAIKSGDFEPID
FT                   SVELALLQGAIPMLDKIVSALQSNPLVWKVVSLQLSKIVSGIITRPSSPNEPDFLTGAL
FT                   VECDLQIQDLDGTQITIVPAPQGGWTHDSLEALDCDALAGGQAWNAYLLYGVLPQWVGS
FT                   SEI"
FT   gene            complement(257841..258257)
FT                   /locus_tag="Sputcn32_0240"
FT   CDS_pept        complement(257841..258257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73976"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Z3"
FT                   /protein_id="ABP73976.1"
FT                   /translation="MELLGTTQAVAGQFYALQQELVSLKPTLILPCSEKKLPHSALAFD
FT                   LYQGTGYLSIVKQWSQVELSQVFNLFFLSAKYGLIHASELIEPYEQVMTDERVSMLGAN
FT                   KVLVSKAQRHIQSMNYDALYTSCYQNGIKRPFLS"
FT   gene            complement(258257..258649)
FT                   /locus_tag="Sputcn32_0241"
FT   CDS_pept        complement(258257..258649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73977"
FT                   /db_xref="GOA:A4Y1Z4"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Z4"
FT                   /protein_id="ABP73977.1"
FT                   /translation="MLEVTMFAAYLVIGVFVFVAGLIVLLNKGNPLPAAIPRAAPLNII
FT                   PSTIPCVAIQYQDGCDDVDDDTAGFNRRTGAYHDYLINPATGLLTLNGALDVAGNPLGA
FT                   DLTHSGIYSGHDIDHDFGMNHFGSDF"
FT   gene            complement(258732..260468)
FT                   /locus_tag="Sputcn32_0242"
FT   CDS_pept        complement(258732..260468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73978"
FT                   /db_xref="GOA:A4Y1Z5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031339"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Z5"
FT                   /protein_id="ABP73978.1"
FT                   /translation="MSHSVMLAEQGELNFSTAQRVRHLKAEEQDFEWYPSAAFIIDVVR
FT                   RDLVESKFLESYNRESSLLDIGAGDGRVLSALNMPLEDRRGEMSPPFYNLYAIEKSLVH
FT                   CSQLDKKVLVIGTDFNQQTLVDKPVGVIFCNPPYSAFEQWATRVITEANAEVCYLVLPQ
FT                   RWSGSRDIENAIKVREAEAEVIGTFDFQNDCDRETRHSVPVDIIRVNLGYKNHRQCKVD
FT                   PFKAFFDANFDLDLAESDYTAKFQGPSDSTKEKLNELVPGGDMVKAMQSLYDHQMAKLM
FT                   GTYSALAEIDPDLLRELEVSKSSVLESLKLKIKSLKSLFWKELFSKFDALTSRLTSSNR
FT                   KALLELLERHVSVDFTAENAYAIAQWAIKHADALQDDQFKDFYLSMCQAANVVNYVSNQ
FT                   RTFKYDGWRYRELVKNGHISHFKLDYRCVMENVGGIVNGYDYNSYYNQCGLSCRAIEFI
FT                   TDLVTIAGNLGFDTRGTPKAYEFKWASNKAHDFRYIQSNGSSEVLFSVRAFLNGNLHIK
FT                   MNPKLALKLNVVAGKLFGWVRSAEEAAAEMEVPASHVVEVTEMFGHSLSLTHNYQNLLM
FT                   AA"
FT   gene            complement(261081..261644)
FT                   /locus_tag="Sputcn32_0243"
FT   CDS_pept        complement(261081..261644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0243"
FT                   /product="ISSod10, transposase OrfB"
FT                   /note="KEGG: son:SO2875 ISSod10, transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73979"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Z6"
FT                   /protein_id="ABP73979.1"
FT                   /translation="MATILNTPGHVALDRIDVWFQDEARFGQQNTTTRIWAEKGTRPRA
FT                   VKQQQFESAYLYGAVCPATGATQAIIAPHANSEYMNEHLKLISTATTFGRHALVIMDGA
FT                   GWHQQDLADDFDNLTLLKLPPYSPELNPIEQVWQWLRQNVLANRCFSGYDDIVEQCSIA
FT                   WNTFIEKKARVIELCTRPWTILTS"
FT   gene            complement(261628..262107)
FT                   /locus_tag="Sputcn32_0244"
FT   CDS_pept        complement(261628..262107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0244"
FT                   /product="ISSod10, transposase OrfA"
FT                   /note="KEGG: son:SO4533 ISSod10, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73980"
FT                   /db_xref="GOA:A4Y1Z7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Z7"
FT                   /protein_id="ABP73980.1"
FT                   /translation="MNHPHIAALVKSEKSARKRMRYLALLHFTEGHSRTAIASMLKVSR
FT                   TSVNRWVTAYLTHGLTGLDDAPNPGRPATLSIAQQAKLKAFVQHRSLSEQGGRLMAKDV
FT                   GLFIQSEFGVTFKQANIYRLLHQLGFSWITTRSRHPKQSEAIQEAFKKLPDGNDP"
FT   gene            262227..262676
FT                   /pseudo
FT                   /locus_tag="Sputcn32_0245"
FT   gene            complement(262745..263848)
FT                   /locus_tag="Sputcn32_0246"
FT   CDS_pept        complement(262745..263848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0246"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   plu:plu3796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73981"
FT                   /db_xref="GOA:A4Y1Z8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Z8"
FT                   /protein_id="ABP73981.1"
FT                   /translation="MLKHLDNITDCRSHINQEHDVIDICFLVLSAVISGAQSWSACHEF
FT                   GTLELEWLRKYRPFTNGIPSQQSIGRIFRGVSKQSLLDALMSWVNEYRVNTGQSSIAID
FT                   GKVLKGAKASASSAALHMVTAYDTGSGLVFSAKSGASKKSELKLVQELLTCLDLKSELL
FT                   TFDALHCQSQTLDYIAKEGGDCILQVKGNQPKLYEALQAQFTDYIENNPDAECFTETNK
FT                   GHGRVEKRITFQCPLNLPAEIKMKWSQLKTLIAVERHRKVGNKTSIDTHFYVSSAVLTS
FT                   EAFGRAIRAHWQTENNQHWLLDKLFQEDKQKMYDEDGASILAILRRWALNLVKLHPAKT
FT                   SQTQKFNRACWSDDFREEIIFGTGQKV"
FT   gene            264071..264493
FT                   /locus_tag="Sputcn32_0247"
FT   CDS_pept        264071..264493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73982"
FT                   /db_xref="GOA:A4Y1Z9"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y1Z9"
FT                   /protein_id="ABP73982.1"
FT                   /translation="MQYFSLLLFDNHWRYILRRIHLIMMFVLLTFVGQTFASVIMPGTM
FT                   PMNSMTTSNMPAENGKACHDASMQMNMNMDMSDGADDSCCAQACHCPVGSCLSVALTMA
FT                   MPTLKSEVNLVNAATMFTSALIPQYRSSLYRPPIFA"
FT   sig_peptide     264071..264184
FT                   /locus_tag="Sputcn32_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.933) with cleavage site probability 0.930 at
FT                   residue 38"
FT   gene            264630..265145
FT                   /locus_tag="Sputcn32_0248"
FT   CDS_pept        264630..265145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0248"
FT                   /product="protein of unknown function DUF411"
FT                   /note="PFAM: protein of unknown function DUF411; KEGG:
FT                   sfr:Sfri_1968 protein of unknown function DUF411"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73983"
FT                   /db_xref="GOA:A4Y200"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y200"
FT                   /protein_id="ABP73983.1"
FT                   /translation="MSALYRNSISFFRVIGTIFILQTMGGILIARAAEPGTTEPLLTVY
FT                   KDANCGCCEKWLTHISERGFSVSAHNINNLYEFKQSKGIPASMQSCHTAVSSQGYVFEG
FT                   HVPAKFISRFLATPPKDAIGLTVPAMPVGSPGMEYQDKFMPYQVLLLKKDGSSEVYAQV
FT                   NSLEESVQ"
FT   sig_peptide     264630..264728
FT                   /locus_tag="Sputcn32_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.830) with cleavage site probability 0.826 at
FT                   residue 33"
FT   gene            265142..267160
FT                   /locus_tag="Sputcn32_0249"
FT   CDS_pept        265142..267160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0249"
FT                   /product="copper-resistance protein, CopA family"
FT                   /note="TIGRFAM: copper-resistance protein, CopA family;
FT                   PFAM: multicopper oxidase, type 1; multicopper oxidase,
FT                   type 2; multicopper oxidase, type 3; KEGG: sfr:Sfri_1969
FT                   copper-resistance protein, CopA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73984"
FT                   /db_xref="GOA:A4Y201"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y201"
FT                   /protein_id="ABP73984.1"
FT                   /translation="MKSQYMIKPMIQMTNSELNNSRRRFVFGASAMLALMSIPFPKNAV
FT                   ANALSQSLSQLSGKVFDLSIDYKMVNFTGKSARATVVNQLLPAPLLRWKEGETVTLRVK
FT                   NNLDHDSSIHWHGIILPTEMDGVPGFSFDGIKPGETFEYQFTVQQSGTYWYHSHSGYQE
FT                   QTGLFGAIVIDPATPDPVIYDRDYVIMLSDWSDEAPENIYAKLKKQADYYNYRERTVMD
FT                   FFSDVNKNGLANTWNARSMWNNARMSDRDISDVTGSTYTYLMNGNPPQQGWQGLFEQGE
FT                   KVRLRFINSSAMTIFDVRIPGLKMSVVASDGQNIQPVSVDEFRIGVAETYDVVIEPEVD
FT                   NAYCIFAQSIDRTGFTVGNLTSDASLHAPIPPMDPRPVLGHSDMGMDMSDMDMSGMDHS
FT                   KMDMGAGDMSGMDHSKMAMGGGDMSGMDHSKMAMDGGDMSGMDHSKMAMGSGDMSGMDH
FT                   SKMAMGGGDMSGMDHSKMAMDAAKATVSGLGLAGFGSNNEIKHIDTEFGPQVDMRADAP
FT                   KSGLHDPGIGLRDHQQQFNRKVLTYGDIKGLHPTYDTRQPSREIQLHLTGNMNRYMWSV
FT                   NGVKFMDAAPLEFEYGERLRITLVNDTMMTHPMHLHGMWSELETGDPDFIPRKHTVLVQ
FT                   PGSKISYLVTADAKGQWAYHCHLLFHMPGMFRKVVVK"
FT   sig_peptide     265142..265282
FT                   /locus_tag="Sputcn32_0249"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.961 at
FT                   residue 47"
FT   gene            267172..267885
FT                   /locus_tag="Sputcn32_0250"
FT   CDS_pept        267172..267885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0250"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor; KEGG:
FT                   sfr:Sfri_1970 copper resistance B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73985"
FT                   /db_xref="GOA:A4Y202"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y202"
FT                   /protein_id="ABP73985.1"
FT                   /translation="MNKTNLVALGLLSLSASLASSAVFAGGNDDPLLTKVMLDQFEKGV
FT                   DPQDPTQFSAQAWLGYDLNKLWLKTEGEYSNSDKQDLEIQALYSKPIAPYWDVQFGIKT
FT                   DIKPTPNRNWAVIGVQGLAPYFFDIDAALFIGEQGRTAMRLSAEYELLITQKLILTPEV
FT                   EVNLFGKDDAELGIGSGLSDVSAGLRLRYEIVREFAPYIGVDWRQKLGNTADYARSEGE
FT                   DTQETQFVIGFSAWF"
FT   sig_peptide     267172..267249
FT                   /locus_tag="Sputcn32_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 26"
FT   gene            268001..268423
FT                   /locus_tag="Sputcn32_0251"
FT   CDS_pept        268001..268423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0251"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   sfr:Sfri_1971 copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73986"
FT                   /db_xref="GOA:A4Y203"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y203"
FT                   /protein_id="ABP73986.1"
FT                   /translation="MKLFNNVLVVTSLFLSASAFAHVGLSSSMPPNGAMLSQAPTTLEL
FT                   TFTAPVRLVKLTMQDEKQQSVPLTLPSSAASQAEFSFALPALNAANYTVNWMIMGDDGH
FT                   KMKGNMSFMLHDSGMNTRSAPPMTMEHETSEHTAHQ"
FT   sig_peptide     268001..268066
FT                   /locus_tag="Sputcn32_0251"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            268438..269334
FT                   /locus_tag="Sputcn32_0252"
FT   CDS_pept        268438..269334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0252"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   sfr:Sfri_1972 copper resistance D domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73987"
FT                   /db_xref="GOA:A4Y204"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y204"
FT                   /protein_id="ABP73987.1"
FT                   /translation="MILTVFEISVLISKWVIYLSVAAVIGGTLMQYLIKGQLNLSISVA
FT                   KYTGLGAVLGLIAVSINYFAQVGAFAENGLMGIFDAQMHAFLWPTQVGQTVLWRLIGFG
FT                   LMLVASGLLLHKNRYIKTFSAVLAILSCLLIAVTFTFIGHSTELGLLAQGLILIHVLII
FT                   GSWIGAFYPLWKLCCTDDHIVIKNVMDTFGRLGIVIVILVLLSGMGMVWMLFDSPTELI
FT                   SSDYGIAVTIKLCLVAIILLIAAWHKLVLVPKLTIANTLLAKQKLQKSIGLEALIAVLI
FT                   LATTAVLSSVLGPMSLG"
FT   gene            269410..269853
FT                   /locus_tag="Sputcn32_0253"
FT   CDS_pept        269410..269853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0253"
FT                   /product="putative orphan protein"
FT                   /note="KEGG: sfr:Sfri_1973 putative orphan protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73988"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y205"
FT                   /protein_id="ABP73988.1"
FT                   /translation="MSAGQSSLSFAHGDETHPIEQKAFIGVDSAEGNVVKQFHAALQTG
FT                   NEAIVRQSLAANVQIYEGGKVERSLTDYANHHMLADMAYLKGLTITPKEHQITITGDIA
FT                   ISTSISHAQGEYKGKSIDSMTMETLVLIKQADGHWKITHVHWS"
FT   gene            complement(270036..270587)
FT                   /locus_tag="Sputcn32_0254"
FT   CDS_pept        complement(270036..270587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0254"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oih:OB3301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73989"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y206"
FT                   /protein_id="ABP73989.1"
FT                   /translation="MIKKHILLALIVAYSSQSYATIINAETFKNLDYKSAVTTAHTLYK
FT                   NNEGIMIKVLPNRIVATFSDGKSSSVAIPKDQFFLSIAPYINSSHPCTNHVLTGCTGEI
FT                   KNQVMKVVMIDTDTGETLIDKQVTTQRDGFIDFWVPKDKNLAFNIYHKAKDGSERVARE
FT                   VLSTFNNDRTCITTMQLIES"
FT   sig_peptide     complement(270525..270587)
FT                   /locus_tag="Sputcn32_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.989 at
FT                   residue 21"
FT   gene            271015..272235
FT                   /locus_tag="Sputcn32_0255"
FT   CDS_pept        271015..272235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0255"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin; KEGG: wsu:WS0983
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73990"
FT                   /db_xref="GOA:A4Y207"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y207"
FT                   /protein_id="ABP73990.1"
FT                   /translation="MFKYNKYVLVLLAMSNNALSNDDIESFSEWIHNGNVGGTARSYYF
FT                   EQDFDDSNTENSSIWVNGGNVTFNTSEFNGFKLGGEVQGSYVSNINDDDDTTAGDMNAQ
FT                   GLVLSEAFLKYQFGDTVFSGGRQHFSSPLIANSGTRLINESFEMYQVSSSHFDGTDISI
FT                   GYVTKYQTRTDKSFYVDNEFVDFDFNGSGSPGDFYKIGNDGVFFVQVNKRIAKKFKVNS
FT                   QYANVINEVQALYADVEYTLPTNFNSYIAMQYYKTKWDKNELVDNDLLGFKVGFSQGGV
FT                   DFFAGYTLAGGNEGENRVFRGIGQGAYYQFTATTKTAGVGAFESGTNSYQLGLGSAISN
FT                   LKGKIFYTSFDNPIVGKDLNEWTVNLAYQFDGKLENIGISIDFSILDYENNQKDATDLR
FT                   TKFIYSF"
FT   sig_peptide     271015..271077
FT                   /locus_tag="Sputcn32_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.981 at
FT                   residue 21"
FT   gene            272702..272983
FT                   /locus_tag="Sputcn32_0256"
FT   CDS_pept        272702..272983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO2129 transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73991"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y208"
FT                   /protein_id="ABP73991.1"
FT                   /translation="MLSFSYREHKSMYLEAFTSHFNSIADSRQSAKVTYPLHDVLFVTL
FT                   CGVIAGAEGWSEIHDYAVGHHNWFKEKGILTEGVPVRGKHNLYFHFHN"
FT   gene            complement(273165..274640)
FT                   /locus_tag="Sputcn32_0257"
FT   CDS_pept        complement(273165..274640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0257"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: ecs:ECs0608
FT                   putative 2-component sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73992"
FT                   /db_xref="GOA:A4Y209"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y209"
FT                   /protein_id="ABP73992.1"
FT                   /translation="MHSKPSRHPFSLSLRLTFFISLSTILAFIAFTWFMLHSVENHFAE
FT                   QDVSDLQQISTTLNRILQSPEDPDEKKVSKIKESIASYRNVALLLLNPRGEVLFSSAQG
FT                   AALRPAVNSADFSEHSHARDVFLWTVEDPARPMDTGSEMKMETYRIIASSGQAIFQGKQ
FT                   QNYVMLTGLSINFHLHYLDALKKNLIAIAVVISLLIVLIIRIAVRQGHLPLRNVSNAIK
FT                   SITSENLDARLEPTRVPIELEQLVISFNHMIGKIEDVFTRQANFSADIAHEIRTPITNL
FT                   VTQTEIALSQDRTQKELEDVLYSSLEEYNRMTKMVSDMLFLAQADNNQLIPDRVRFDLR
FT                   AEVMKVFEFFEAWAEERNITLKFNGMPCLVEGDPQMFRRAINNLLSNALRYTPEGQAIT
FT                   VSIREQESFFDLVIENPGKPIPEEHLSRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVE
FT                   AHHGRVQVESDVRSTRFILSVLRLEQRIPEPQH"
FT   sig_peptide     complement(274524..274640)
FT                   /locus_tag="Sputcn32_0257"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.969) with cleavage site probability 0.842 at
FT                   residue 39"
FT   gene            complement(274633..275313)
FT                   /locus_tag="Sputcn32_0258"
FT   CDS_pept        complement(274633..275313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0258"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein; KEGG: ssn:SSO_0522 putative 2-component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73993"
FT                   /db_xref="GOA:A4Y210"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y210"
FT                   /protein_id="ABP73993.1"
FT                   /translation="MKILIVEDEIKTGEYLSKGLREAGFVVDHADNGLTGYHLAMTAEY
FT                   DLVILDIMLPDVNGWDIIRMLRTAGKGMPVLLLTALGTIEHRVKGLELGADDYLVKPFA
FT                   FAELLARVKTLLRRGNTMITESQFRVAGLSIDLVSRKVSRAGNRIVLTSKEFSLLEFFI
FT                   RHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRAKIDNDYETKLIQTVRGVGYMLE
FT                   VPDA"
FT   gene            275503..276888
FT                   /locus_tag="Sputcn32_0259"
FT   CDS_pept        275503..276888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0259"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: ecs:ECs0610 putative copper efflux system
FT                   outer membrane protein CusC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73994"
FT                   /db_xref="GOA:A4Y211"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y211"
FT                   /protein_id="ABP73994.1"
FT                   /translation="MFKLKLLSISTIFILTGCVSLAPEYQRPAAPVPQQFSLSRNSLTP
FT                   AVNGYQDTGWRNFFVDPQVTRLIGEALANNRNLRMAALKVEEARAQFNVTDADRYPQLN
FT                   ASSGITYSGGLKGDKPTTQEYDAGLELRYELDFFGKLKNLSDADRQNYFASEEARRAVH
FT                   ILLVSSVSQSYFSQQLAYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQARGQI
FT                   ESTRAEIAKREGDLAQANNALQLVLGTYRALPPEKGMKGGEIAPVKLPSNLSSQILLQR
FT                   PDIMEAEYQLKAADANIGAARAAFFPSITLTSGLSASSTELSSLFTPGSGMWNFIPKID
FT                   IPVFNAGRNKANLKLAEIRQQQSVVNYEQKIQSAFKDVSDTFALRDSLSQQLESQQRYL
FT                   DSLQITLQRARGLYASGAVSYIEVLDAERSLFATQQTILDLTYSRQVNEINLFTALGGG
FT                   WVE"
FT   sig_peptide     275503..275568
FT                   /locus_tag="Sputcn32_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.817) with cleavage site probability 0.765 at
FT                   residue 22"
FT   gene            276917..277270
FT                   /locus_tag="Sputcn32_0260"
FT   CDS_pept        276917..277270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0260"
FT                   /product="periplasmic copper-binding protein"
FT                   /note="KEGG: ecj:JW0562 periplasmic copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73995"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y212"
FT                   /protein_id="ABP73995.1"
FT                   /translation="MRNSLKAVLFGAFSVMFSAGLHAETHQHGDMNAASDASVQQVIKG
FT                   TGVVKDIDMNSKKITISHEAIPAVGWPAMTMRFTFVNADDAINALKTGNHVDFSFIQQG
FT                   NISLLKSINVTQS"
FT   sig_peptide     276917..276988
FT                   /locus_tag="Sputcn32_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            277384..278676
FT                   /locus_tag="Sputcn32_0261"
FT   CDS_pept        277384..278676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0261"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: ecj:JW0563 copper/silver efflux system,
FT                   membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73996"
FT                   /db_xref="GOA:A4Y213"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y213"
FT                   /protein_id="ABP73996.1"
FT                   /translation="MASLKIKYAAIIISSLLAGGLISVTAWQYVNSSQKTVQTEQKAPE
FT                   KKVLFWYDPMKPDTKFDKPGKSPFMDMDLVPKYADESGDKSNGGIRIDPTQVQNLGLKT
FT                   QKVTRGMLNYSQTIPANVSYNEYQFVIVQARSDGFVEKVYPLTTGDHVKKGTPLIDITI
FT                   PEWVEAQSEFLLLSGTGGTPTQIKGVLERLRLAGMPEEDIQRLRSTRTIQTRFTIKAPI
FT                   DGVITAFDLRTGMNISKDKVVAQIQGMDPVWISAAVPESIAYLLKDTSQFEISVPAYPE
FT                   KTFHVEKWNILPSVDQTTRTLQVRLQVSNKDEFLKPGMNAYLKLNTKSQEMLLIPSQAV
FT                   IDTGKEQRVITVDDEGKFVPKQIHVLHESQQQSGIGSGLNEGDTVVVSGLFLIDSEANI
FT                   TGALERMRHPEKTESSMPAMSDQPVNRHSGH"
FT   sig_peptide     277384..277470
FT                   /locus_tag="Sputcn32_0261"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.474 at
FT                   residue 29"
FT   gene            278687..281833
FT                   /locus_tag="Sputcn32_0262"
FT   CDS_pept        278687..281833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0262"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: ecp:ECP_0606 putative
FT                   cation efflux system protein CusA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73997"
FT                   /db_xref="GOA:A4Y214"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y214"
FT                   /protein_id="ABP73997.1"
FT                   /translation="MIEWIIRRSVANRFLVMMGALFLSIWGTWTIINTPVDALPDLSDV
FT                   QVIIKTSYPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGFSQFGDSYVYVIFEDGTDLY
FT                   WARSRVLEYLNQVQGKLPAGVSSEIGPDATGVGWIFEYALVDRSGKHDLSELRSLQDWF
FT                   LKFELKTIPNVAEVASVGGVVKQYQIQLDPVKLTQYGISLPEVKQALSSSNQEAGGSSV
FT                   EIAESEYMVRASGYLQTIDDFKNIVLKTGENGVPVYLRDVARIQMGPEMRRGIAELNGQ
FT                   GEVAGGVVILRSGKNAREVITAVRDKLDTLKASLPEGVEIVTTYDRSQLIDRAIDNLSY
FT                   KLLEEFIVVAVVCALFLWHVRSALVAIISLPLGLCIAFIVMHFQGLNANIMSLGGIAIA
FT                   VGAMVDAAIVMIENAHKRLEEWDHQHPGEQIDNATRWKVITDASVEVGPALFISLLIIT
FT                   LSFIPIFTLEGQEGRLFGPLAFTKTYSMAGAAILAIIVIPILMGFWIRGKIPAETSNPL
FT                   NRLLIKAYHPLLLRVLHWPKTTLLVAALSIFTVIWPLSQVGGEFLPKINEGDLLYMPST
FT                   LPGVSPGEAAALLQTTDKLIKTVPEVASVFGKTGKAETATDSAPLEMMETTIQLKPEDQ
FT                   WRPGMTIDKIIEELDRTVRLPGLANLWVPPIRNRIDMLSTGIKSPIGIKVSGTVLSDID
FT                   VTAQSIEAVAKTVPGVVSALAERLEGGRYIDVDINREKASRYGMTVGDVQLFVSSAIGG
FT                   AMVGETVEGVARYPINIRYPQDYRNSPQALREMPILTPMKQQITLGDVADIKVVSGPTM
FT                   LKTENARPASWIYVDARGRDMVSVVNDIKTAISEKVKLRPGTSVAFSGQFELLEHANKK
FT                   LKLMVPMTVMIIFILLYLAFRRVDEALLILMSLPFALVGGIWFLYWQGFHMSVATGTGF
FT                   IALAGVAAEFGVVMLMYLRHAIEAHPELSRKETFTPEGLDEALYHGAVLRVRPKAMTVA
FT                   VIVAGLLPILWGTGAGSEVMSRIAAPMIGGMITAPLLSLFIIPAAYKLIWLRRHKKSVS
FT                   "
FT   gene            281929..282360
FT                   /locus_tag="Sputcn32_0263"
FT   CDS_pept        281929..282360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0263"
FT                   /product="protein of unknown function DUF411"
FT                   /note="PFAM: protein of unknown function DUF411; KEGG:
FT                   mca:MCA0560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73998"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y215"
FT                   /protein_id="ABP73998.1"
FT                   /translation="MVLMALALGLSLPAMASEKVIDMYKSENCGCCSLWGKAMEKDGFE
FT                   VRTHVMNDQALSALKEKHAIPAGLRSCHTAVAGNLIIEGHVPATTIHKAMQSGSGIYGL
FT                   ATPGMPAGSPGMEMGARKEAYDVIAFSPDGSKKVFQRIE"
FT   sig_peptide     281929..281979
FT                   /locus_tag="Sputcn32_0263"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.995 at
FT                   residue 17"
FT   gene            282487..284934
FT                   /locus_tag="Sputcn32_0264"
FT   CDS_pept        282487..284934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0264"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: sal:Sala_2544 heavy metal translocating P-type
FT                   ATPase; TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; YHS domain
FT                   protein; E1-E2 ATPase-associated domain protein; SMART:
FT                   TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABP73999"
FT                   /db_xref="GOA:A4Y216"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y216"
FT                   /protein_id="ABP73999.1"
FT                   /translation="MKNDNAVQHNNQTASEQTLSPDEGHVLHKVRDPVCGMAILPDRAH
FT                   SSIRYQDHQLYFCSASCESKFKAHPDRYLTEDASEHSHHHHHDHHEVSPDQIKQPHHQA
FT                   EKENSEGVWTCPMHPEIRRSGPGSCPVCGMALEPLVATASTGPSDELHDMTRRFWLGLL
FT                   LAFPVLVLEMGSHLFPDLRNTVPPQYNTWLQLLLASPVVLWCGWPFFARAGMSLRNRSL
FT                   NMFTLVAMGTGVAWVYSVIATVFPSWFPASFRNMDGLVAVYFEAAAVITVLVLLGQVLE
FT                   LRAREQTSGAITALLNLAPKTARRLDHDGHETDINAEDVLPGDKLRIRPGESIPVDGIV
FT                   IEGKTTVDESMVTGESMPVTKTKGDPVIGGTINQTGSLIIRAEKVGDETMLSRIVQMVA
FT                   DAQRSRAPIQRMADSVSGWFVPLVILIAVVAFVIWSVWGPEPRMAHGLIAAVSVLIIAC
FT                   PCALGLATPMSIMVGVGKGAQAGVLIRNAEALERLEKVDTLVVDKTGTLTEGSPTVTGI
FT                   ISLNPGGEASLLRVAAAVEKGSQHPLGMAVVRAAQHRGIMIPAVSDFNAPSGKGVSGDV
FT                   EGQRVVIGNELAMQENSIVIDNQKAVADTLRMEGATVIYVATDGYLAGLIAISDPVKAT
FT                   TPDALKALRQAGIRIVMLTGDNQLTAEAVARKLGIDEVEAGVLPDGKKAVITRLKASGH
FT                   VVAMAGDGVNDAPALAAADVGIAMGTGTDVAIESAGVTLLKGDLMILNRARHLSEITMK
FT                   NIRQNLFFAFIYNALGVPVAAGLLYPVYGILLSPVIAAAAMALSSVSVIVNALRLKSVR
FT                   LGK"
FT   gene            284975..285172
FT                   /locus_tag="Sputcn32_0265"
FT   CDS_pept        284975..285172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cvi:CV3215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74000"
FT                   /db_xref="GOA:A4Y217"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y217"
FT                   /protein_id="ABP74000.1"
FT                   /translation="MKSTTYALIAVAAIAAFALLREHWSHVAGYWPYLLLLVCPLMHLF
FT                   HGHGGHGDHQHHGSENDKKN"
FT   sig_peptide     284975..285031
FT                   /locus_tag="Sputcn32_0265"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.937) with cleavage site probability 0.584 at
FT                   residue 19"
FT   gene            complement(285206..285943)
FT                   /locus_tag="Sputcn32_0266"
FT   CDS_pept        complement(285206..285943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0266"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: stm:STM1890 putative
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74001"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y218"
FT                   /protein_id="ABP74001.1"
FT                   /translation="MYSTDVVKENACLSATRSGLESNEIATLQRSLPSRFNLRHLKKNE
FT                   SLKLVLQKKAGKSRVVAYKFTSGSFNYTAYRISDKKFYNLSDTSGKGSLDYPLPATARL
FT                   SSPFNPARLNPVSGKVSPHNGIDYSMPMNTKIVSVIDGKITRAEYNSTMGYFVEVTGKA
FT                   GVKTRYLHLNKILVTKGARVTRGGAIALSGNSGRSSGPHLHYELVINNNPVNSLAFRAA
FT                   APADNKLEQHAFAHARDYERYLD"
FT   gene            complement(286232..286681)
FT                   /locus_tag="Sputcn32_0267"
FT   CDS_pept        complement(286232..286681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spt:SPA2166 possible copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74002"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y219"
FT                   /protein_id="ABP74002.1"
FT                   /translation="MNILITTTAFTALFCGAAFAQSSDIAHEAHRFVNNASAVSHVNSS
FT                   THENLPDRINKNSTPSFSEMNEHERAIVAHSFMNNSPSYAHQKMIEEHKKMLSESGENS
FT                   KTFSSSFNELNAGEKAALVHEQVNNAGAEAHQTQARKLRGLYSSR"
FT   sig_peptide     complement(286619..286681)
FT                   /locus_tag="Sputcn32_0267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.987 at
FT                   residue 21"
FT   gene            286910..287089
FT                   /pseudo
FT                   /locus_tag="Sputcn32_0268"
FT   gene            complement(287569..287919)
FT                   /locus_tag="Sputcn32_0269"
FT   CDS_pept        complement(287569..287919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0269"
FT                   /product="likely secreted protein containing plastocyanin
FT                   domain"
FT                   /note="KEGG: sfr:Sfri_0213 likely secreted protein
FT                   containing plastocyanin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74003"
FT                   /db_xref="GOA:A4Y220"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y220"
FT                   /protein_id="ABP74003.1"
FT                   /translation="MLINLLCIALIGFIIWWFWLYKPANDSSVDASTLILVKDGVYTPA
FT                   RIKISANRPTEITFLRQDKSGCSATVLLPYLEISQDLALDKTTTIALPALEKGEYPFHC
FT                   QMQMYKGVLIVE"
FT   gene            complement(287930..290176)
FT                   /locus_tag="Sputcn32_0270"
FT   CDS_pept        complement(287930..290176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0270"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: sfr:Sfri_0212 copper-translocating
FT                   P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74004"
FT                   /db_xref="GOA:A4Y221"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y221"
FT                   /protein_id="ABP74004.1"
FT                   /translation="MTKTGYTTIQLNILGAGCASCVGKIEKAINCVQGVDSAEMNFADR
FT                   TVLVSGNASAELIIKAVESAGYNATQIQAESAEDAMNEKEQADLQHYKSLLRHTIIALS
FT                   VGIPLMIYGLFIGEMTVSTLLEQTVWGLVGVVTLAIMLISGRHFYIGAWKSFLNHNANM
FT                   DTLIALGTGTAWVYSMLIVSFPQLFPEMARHVYFEATAMIIGLINLGLALEVKARGKTS
FT                   EAIKRLIGLQAKTARVIRDGKDLDIDIAHVLLNDHVKVRPGEKIPVDGVVFEGNSTIDE
FT                   SMLTGEPMPVEKVIGDDVFTGTLNKSGSIIFKATRVGKDTALARIISMVKRAQNSKPPI
FT                   GRLADVIAAYFVPAIMIIAIVSAMVWFNFGPEPSSVFAIVSATTILIIACPCALGLATP
FT                   MSVMVGVGKAAESGVLIRNGEALQTASKITAMIIDKTGTITEGKPQVTDIILVNADSEE
FT                   QVLALSAGIESHSEHPLAQAIVESANDRGIEAIDTEHFNAISGKGVEAEVDGQTLLFGN
FT                   LKLMLDKHIDIGLHEAKAQVLAENAKTPMYLALAGQLLAIIAVSDPIKPDSIEAIARLK
FT                   LNGIKVIMLTGDNKATAAAVAKKVGIDDFFAEVMPEDKANKVAELQQQNEVVGMTGDGI
FT                   NDAPALALADVGFAIGTGTDVAIESADVTLMRGSLHGLADAIAISKATLRNIKQNLFGA
FT                   FIYNVAGIPLAAGVLFPVFGILLNPVIAGAAMAFSSLTVVSNANRLRLFKAKEH"
FT   gene            complement(290176..290646)
FT                   /locus_tag="Sputcn32_0271"
FT   CDS_pept        complement(290176..290646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0271"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: sfr:Sfri_0211
FT                   transcriptional regulator, MerR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74005"
FT                   /db_xref="GOA:A4Y222"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y222"
FT                   /protein_id="ABP74005.1"
FT                   /translation="MKVAQLANKLGVSADTVRFYTRIGLLNPSKSPNNGYKTFNHKDMV
FT                   RMQFILSARNLGFSVEDIKVIFSKTDLGDSACQLVRELIKVKLLETEQQFNEMVKLRSK
FT                   LSKEVQDWSQMPDNIPTGNMICHLIENTNQEDIVSEELGVPHYVDKASMEIK"
FT   gene            complement(290767..291201)
FT                   /locus_tag="Sputcn32_0272"
FT   CDS_pept        complement(290767..291201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0272"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74006"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y223"
FT                   /protein_id="ABP74006.1"
FT                   /translation="MKKFIAITLLSLASTVSMAATITLPDYLIFTSVDGQSVANKGQID
FT                   IEPGQHLLELQFYDDYSTGADDTNFVKSDALYWSLNLTKNEDIQVRAKDIFTTKSARKF
FT                   IDSPQITIDTASLKGESVKLVNHAELMSIIMKQHSKMMNH"
FT   sig_peptide     complement(291142..291201)
FT                   /locus_tag="Sputcn32_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(291293..291637)
FT                   /locus_tag="Sputcn32_0273"
FT   CDS_pept        complement(291293..291637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74007"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y224"
FT                   /protein_id="ABP74007.1"
FT                   /translation="MIKILLNLAVILTLITQLLVPSNAMSSDISESSMQSNSMSHSVMM
FT                   DNDCDDDNYNCCAEDSSHCISHCHVVANAFVLSSGSNLINNPFTSSKVDSTLWISTPVS
FT                   LGSQNPPPIA"
FT   sig_peptide     complement(291557..291637)
FT                   /locus_tag="Sputcn32_0273"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.913 at
FT                   residue 27"
FT   gene            complement(291863..292153)
FT                   /pseudo
FT                   /locus_tag="Sputcn32_0274"
FT   gene            complement(292164..293228)
FT                   /locus_tag="Sputcn32_0275"
FT   CDS_pept        complement(292164..293228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0275"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron, maturase-specific domain
FT                   protein; KEGG: sme:SMb21045 putative reverse
FT                   transcriptasematurase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74008"
FT                   /db_xref="GOA:A4Y225"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y225"
FT                   /protein_id="ABP74008.1"
FT                   /translation="MTTTAIPKKSGGERILGIPTIQDRVAQMVVKLSFEPLVEPHFLND
FT                   SYGYRPNRSAIDAVGVTRKRCWYQDWVLEFDIKGLFDNISHELLMKAVRKHTDCKWLLL
FT                   YIERWLKAPMVKDNNEVIERNMGTPQGGVISPVLANLFLHYVFDKWMHKNHPGVKWCRY
FT                   ADDGLVHCNSEEQAQKMRAELEKRFKDCGLEMHPTKTKIVYCKDGTRKGQYENTAFDFL
FT                   GYTFRPRLCRNRHTQGTFISFTPAVSKDAQKGMIKKIRMLAIRKRTDLSLEQIARRINP
FT                   IINGWINYYGSFCRSELYRVFRQINKALIWWARHKYKKLQRRKTRAGQFMEKVADTHRH
FT                   LFAHWRIGMRGSMV"
FT   gene            complement(293225..294058)
FT                   /locus_tag="Sputcn32_0276"
FT   CDS_pept        complement(293225..294058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0276"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: vch:VCA0791
FT                   transposase OrfAB, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74009"
FT                   /db_xref="GOA:A4Y226"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y226"
FT                   /protein_id="ABP74009.1"
FT                   /translation="MLCHVFNVNRSSYRYWASSELVATPEQRLLECEIKAIHAESKESA
FT                   GARSIATIASERGFTLSRYRATRLMKKLGLVSCQQPKHRYKKAENEHVTIPNLLKRQFA
FT                   VVEPNTVWCGDVTYIWAGNRWCYLAVVLDLFSRKAIGWAMSFSPDTELTVKALEMAFES
FT                   RGKPKNLIFHSDQGCHYTSLKYRQRLWKYQITQSMSRRGNCWDNAPMERFFRSLKTEWL
FT                   PTQGYKSFSEAKQDVTDYIIGYYCEVRPHHYNAGLSPNESERRFWEDSKVVAKFN"
FT   gene            complement(294097..294408)
FT                   /locus_tag="Sputcn32_0277"
FT   CDS_pept        complement(294097..294408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0277"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   vch:VCA0792 transposase OrfAB, subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74010"
FT                   /db_xref="GOA:A4Y227"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y227"
FT                   /protein_id="ABP74010.1"
FT                   /translation="MNKSKRARYSAAIKLETAQLVVDQGYTQEAAAKAMNVGKSTVSKW
FT                   VTQLQVERQGHAPKASPMTPEQIEIRALKREIERINLEKEILKKATALLMSDSLNNSR"
FT   gene            complement(294467..295090)
FT                   /locus_tag="Sputcn32_0278"
FT   CDS_pept        complement(294467..295090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74011"
FT                   /db_xref="InterPro:IPR040508"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y228"
FT                   /protein_id="ABP74011.1"
FT                   /translation="MQEHQQKIYALRKRIVAIEGFDQADWITIGDATDCQHIIENHPRL
FT                   LRALNFGDPDYPSAVGDVLKSMFTYHRNSLDDVTYFLDINHPLTNNVSVSTAPTESTKS
FT                   IVFTPNIFQIPGTEVESDLVSIMMPFAGFDDVHQGIVRACEQAGYRCQRADDIWEHSTI
FT                   LQDIFSLIYRSKIIIADFSGRNPNVMYEVGIAHTLGKIVIVVAH"
FT   gene            complement(295147..295320)
FT                   /locus_tag="Sputcn32_0279"
FT   CDS_pept        complement(295147..295320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfi:VFA1085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74012"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y229"
FT                   /protein_id="ABP74012.1"
FT                   /translation="MQCPECEDNFGWDWIEDECIEPNEEFDCPSCGVTLRYTIDEGTYY
FT                   GAQHMTVEVVDN"
FT   gene            complement(295331..295531)
FT                   /locus_tag="Sputcn32_0280"
FT   CDS_pept        complement(295331..295531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0280"
FT                   /product="site-specific recombinase, phage integrase
FT                   family"
FT                   /note="KEGG: cps:CPS_2062 site-specific recombinase, phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74013"
FT                   /db_xref="GOA:A4Y230"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y230"
FT                   /protein_id="ABP74013.1"
FT                   /translation="MTDIGLDKTQYGTHSLRRTKASLIYAKTKNLRAIQLLLGHAKLES
FT                   TIEYLGVEIEDALRISESCEA"
FT   gene            295616..296953
FT                   /locus_tag="Sputcn32_0281"
FT   CDS_pept        295616..296953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74014"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y231"
FT                   /protein_id="ABP74014.1"
FT                   /translation="MRDNSQDNDDNDLGGLLFYDALVQYENPGLKASMSKYAGKLAYSS
FT                   FEWDMPTHEHFNIGILGDESEVLAAIKTFEYRFSSKNSIEDFNAKDVAAWEAAGDTRQN
FT                   QTHQDAIAALTWLETHYPDSSYGMLNHPRRYLTSYTIKDVRELNDAAPNVFFLVEGLVG
FT                   GQFSGNRGDYAERSSGVYGGVDPVVAQVGGWWDALLGEGRQIWNMGNSDIHFKTRPPYA
FT                   SSYYPGEYAKSYTWVDGNDTKALLDGLRSGNSFSVFGDLIDALDFKLESSSNNSVTMGQ
FT                   TLVAKAGDKLTLTIRFKSPTMNNKESDIGNEIYAGVNPGVHHIDLIAGNVGPRAEAGTT
FT                   AYEKETNDSTLVVKTFTSADWQKDADGYYSMSYSFIADKHQYFRLRGTNLDYNQANLTE
FT                   KGNPLKSAVINKEDDESVQAWYNKINDRNYDDLWFYSNPVFVNTGK"
FT   gene            complement(297048..300197)
FT                   /locus_tag="Sputcn32_0282"
FT   CDS_pept        complement(297048..300197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0282"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: son:SOA0153 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74015"
FT                   /db_xref="GOA:A4Y232"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y232"
FT                   /protein_id="ABP74015.1"
FT                   /translation="MLKYIIEASIRQRLMVLIIAIMITVWGVQELRKTPLDALPDLSDV
FT                   QVIIKTSYPGQAPKLVEEQVTYPLSTAMLAVPGAKTVRGFSMFGDSYVYVIFEDGTDIY
FT                   WARSRVLEYLSQISSRLPQGVQPSLGPDASGVGWVFEYALVDRSGSLDLSQLKSLQDWY
FT                   LKLELQSVAGVSEVATVGGMEQTYQIVLEPDKMAIYKLDIASIKDAIEKSNSEAGGSVI
FT                   EMAEAEYMVRAKGYRQTLEDFREIPLGITSPSGTGLLLKDVATVRKGPASRRGIAELDG
FT                   EGEVVGGIIVMRYGENALSTIDAVKAKLEELKAGLPDGVEIIPTYDRSQLILNSVDNLF
FT                   SKVVEEMLVVGLVCLLFLLHARSTLVAIITLPLSILIAFIVMNKMGVNANIMSLGGIAI
FT                   AIGAVVDGAIVMIENLHKHLEQFHTEHNREPDTKEHWRIVTEASIEVGPALFFSLIIIT
FT                   LSFVPVFALEAQEGRLFAPLAYTKSFAMAASALLAITLVPVLMGYFIRGKIPSEHKNPI
FT                   SRVLIALYKPSLNLVLRFPKITLALALIALVSAWYPMTRMGSEFMPELEEGDLLYMPTA
FT                   LPGLSAGKAAEVLQQTDRLIKTVPEVARVFGKVGRAETATDPAPLTMLETTIMLKPHEE
FT                   WREGMTLDGIIAQLQQTVKVPGITNAWVQPIKTRIDMLSTGIKTPVGIKITGADVNELQ
FT                   SLGAEIEAILSRVPHTKSAYAERSGGGRYIDITPKLDVAARYGMSLQDIQDVVRYAIGG
FT                   MDIGESIQGAERYPINLRYPRELRDNIEKLRELPVITKSGNYLPLRNLADIEITDGAPM
FT                   LTSENGRLISWVFIDIEGTSIGEYITTAKQALTAELKVPPRYSYTFAGQYEYMQRVDAK
FT                   LKQVIPMALGVIFILLMMTFGSTLQASIIMLSLPFALVGSTWLLYLLDYNISVAVAVGM
FT                   IALAGVAAEFGVIMLIYLNNAIKHRQEKNNYHTVTDLKEALIEGAVMRIRPKAMTVATI
FT                   FFGLLPIMWGAGSGNDVMQKIAAPMVGGMVTAPILSLFVLPALYLLIYSRQLKKEAAPI
FT                   S"
FT   gene            complement(300207..301745)
FT                   /locus_tag="Sputcn32_0283"
FT   CDS_pept        complement(300207..301745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0283"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: son:SOA0154 heavy metal efflux protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74016"
FT                   /db_xref="GOA:A4Y233"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y233"
FT                   /protein_id="ABP74016.1"
FT                   /translation="MNPFKTVKKQAPNAVLILSSLLLGLPLSHAQLSSEKVFASGTAGT
FT                   TDHSPKSTELNQVKTYTCPMHPEVLSHEPGRCPKCNMFLVEKEGTDTNSADPHAEHQHT
FT                   DHLATDHAHTSTTKAASQVFDTPTSKANNLVKKTSEETTTKYICPMHAHIISDVPGTCP
FT                   ICGMNLEKVETGGNTQEININVSGSMQQALALKVAKVERDTLWKFVETVGQVDYDESQI
FT                   THIHARVTGWVEKLMVKSMGDTVKKGQLLYEIYSPDLVNAQDDYLLALDTAKTAGNQRY
FT                   QDLVRRAGLRLSFLGFTEQQIKQLADSRQTQYRVPFYAQQDGVVETLSIRDGMYIEPST
FT                   EVMSLVDLSKVWVIADVFENEQSWIVKGQQAEVAVPAMNLSGIKGTIDYIYPELDPVTR
FT                   SLRVRVVLNNTHVSLRPKTLAKVSLFGGPNKDTLVIPQEALIQTGKENRVIVKQDDNSF
FT                   AAKVVTVGMMSQGKAEIVSGLTEGERVVISGQFLLDSEASLKGSLMRLSSGHQH"
FT   sig_peptide     complement(301653..301745)
FT                   /locus_tag="Sputcn32_0283"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.967 at
FT                   residue 31"
FT   gene            complement(301767..302027)
FT                   /locus_tag="Sputcn32_0284"
FT   CDS_pept        complement(301767..302027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SOA0155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74017"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y234"
FT                   /protein_id="ABP74017.1"
FT                   /translation="MKILTNLVLIALLVMSTNSFATTTPHEHHHGNANPQEQAHTHVCP
FT                   MHPDVTGGKEDTCPQCGMNLEPKAAEAKPAEGAVKNAHKHH"
FT   sig_peptide     complement(301962..302027)
FT                   /locus_tag="Sputcn32_0284"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(302279..302719)
FT                   /locus_tag="Sputcn32_0285"
FT   CDS_pept        complement(302279..302719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SOA0156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74018"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y235"
FT                   /protein_id="ABP74018.1"
FT                   /translation="MHQTLSRYLFVIFTLLALVGQSVVSNGHAMVPHTMDMSAMNHKMP
FT                   SHGMDHAAMMQMNTENTSDAHSIANADCCNDETLPGEQQHCCDGTTSCSNDCGHCLTIS
FT                   VAGTLFSPHLWPSVSISDTAMATPMPHFHSISLSSAFKPPIA"
FT   sig_peptide     complement(302636..302719)
FT                   /locus_tag="Sputcn32_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.944) with cleavage site probability 0.454 at
FT                   residue 28"
FT   gene            303207..303770
FT                   /locus_tag="Sputcn32_0286"
FT   CDS_pept        303207..303770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0286"
FT                   /product="NapC/NirT cytochrome c domain protein"
FT                   /note="PFAM: NapC/NirT cytochrome c domain protein; KEGG:
FT                   son:SO4591 tetraheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74019"
FT                   /db_xref="GOA:A4Y236"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y236"
FT                   /protein_id="ABP74019.1"
FT                   /translation="MNWRALFKPSAKYSILALMVVGIVIGVVGYFATQQTLHATSTDQF
FT                   CMSCHSNHSLKDEVLASAHGGGRAGVTVQCQDCHLPHGPVDYLIKKIIVSKDLYGFLTI
FT                   DGFNTQAWLDENRKEQADLALKYFRSNDSANCQHCHTRIYENQPETMKPMAVRMHTNNF
FT                   KKDPEARKTCVDCHKGVAHPYPKG"
FT   sig_peptide     303207..303305
FT                   /locus_tag="Sputcn32_0286"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.923) with cleavage site probability 0.677 at
FT                   residue 33"
FT   gene            complement(303844..304119)
FT                   /locus_tag="Sputcn32_0287"
FT   CDS_pept        complement(303844..304119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0287"
FT                   /product="protein of unknown function DUF1145"
FT                   /note="PFAM: protein of unknown function DUF1145; KEGG:
FT                   son:SO4588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74020"
FT                   /db_xref="GOA:A4Y237"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y237"
FT                   /protein_id="ABP74020.1"
FT                   /translation="MSLLINLGKTITLVAWLMMFYNLIMPFDGNVAIVLNIIFGITCMM
FT                   HCFQVAIFHMLFKKLLPLRKTDYLQVFIFGIFSLLVYRQRVMAQAS"
FT   gene            complement(304103..304768)
FT                   /locus_tag="Sputcn32_0288"
FT   CDS_pept        complement(304103..304768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0288"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM: conserved
FT                   hypothetical protein 95; KEGG: she:Shewmr4_3775 putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74021"
FT                   /db_xref="GOA:A4Y238"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y238"
FT                   /protein_id="ABP74021.1"
FT                   /translation="MVNHRTVKNNVTKGQTAKNKPGSGQVRIIAGQWRSRRLPIQDLEG
FT                   LRPTTDRVRETLFNWLANDIVNARVLDCFGGSGALALEALSRYASFAQIIELQRGAAIQ
FT                   LRENLQTLKCDKAEVLNADTLVVLQRGCEQGFDVVFIDPPFRKGLAEKTIQLLDTQGWL
FT                   NDGALIYIEIESELTQLAIPSRWHALKEKNAGQVSYRLYQYQQADTAEIKEENHVLAD"
FT   gene            304982..306430
FT                   /locus_tag="Sputcn32_0289"
FT   CDS_pept        304982..306430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0289"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: son:SO4586 cell division protein FtsY;
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54, G-
FT                   domain; GTP-binding signal recognition particle SRP54,
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74022"
FT                   /db_xref="GOA:A4Y239"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y239"
FT                   /protein_id="ABP74022.1"
FT                   /translation="MAKKGFFSWFRKDKSQDEVVAETPVVTPTQDTADATERLAQQEQA
FT                   EVQLAIEVEAHAHAEKQAAEQLTAEQAQAKTEAEQFAVEHARIEALDFAKQQAEATRLA
FT                   TEQLRAEKHAAEDLAVAQLAAEQRIVEQLAAQQLAAEKAAAEQLAQAETAQAVEPAAEL
FT                   QPEPQERPVKEGLFARLKRGLMRTSENIGSGFIGLFRGKKIDDDLFEELEEQLLIADVG
FT                   VETTTRLINKLTEHASRKQLKDAEALYDLLRDELQKTLDPVAIPLVPNNANGPFVILMV
FT                   GVNGVGKTTTIGKLAKQYQSQGKSVMLAAGDTFRAAAVEQLQVWGQRNDITVVAQHTGA
FT                   DSASVLFDALQAAKARKVDVLIADTAGRLQNKAHLMEELKKVVRVMKKLDPEAPHEVML
FT                   TLDASTGQNAISQAQLFQEAVGVTGLTISKLDGTAKGGVVFAIADKFNIPIRYIGVGEQ
FT                   IDDLRTFNSKEFIDALFTQEKADN"
FT   gene            306434..307150
FT                   /locus_tag="Sputcn32_0290"
FT   CDS_pept        306434..307150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0290"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: shm:Shewmr7_3846 cell division ATP-binding
FT                   protein FtsE; TIGRFAM: cell division ATP-binding protein
FT                   FtsE; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74023"
FT                   /db_xref="GOA:A4Y240"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y240"
FT                   /protein_id="ABP74023.1"
FT                   /translation="MIDFQQVSKIYPGGQMALEDVNFHLQQGEMAFLTGHSGAGKSTLL
FT                   KLITVIERATTGRVAINGHDIAKISAKHVPYLRRNIGMIFQSHHLLMDRSVFDNVALPL
FT                   VIEGFSHGEIRKRVAGALDMVGLYGKERHNPIMLSGGEQQRVGIARAIVNKPPLLLADE
FT                   PTGNLDPKLSMDILRLFETFNDAGTSVLIATHDLGLIARMKYRTFTLKQGRMLGSQELH
FT                   HSVHTRSKPTVKGDGQ"
FT   gene            307147..308112
FT                   /locus_tag="Sputcn32_0291"
FT   CDS_pept        307147..308112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0291"
FT                   /product="cell division protein FtsX"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   she:Shewmr4_3772 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74024"
FT                   /db_xref="GOA:A4Y241"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y241"
FT                   /protein_id="ABP74024.1"
FT                   /translation="MSNTAKLTRSKLPLSGRIVMFFIRHVQQAMASMGELWRNPVSSVM
FT                   TMAVLGVSLSLPAALQVLVKNAETITSSWNSAAEISLFIDENRSDQTIQSLLTRIRLYS
FT                   EVDKVQYIDRNQALEEFQRLSGFGEALAYLDKNPLPAVITVTPTPRYSTPIGARELLTK
FT                   LEREPEISFGRLDIEWLERLQAVVRLLERTVMAIAALLVLAVVLVIGNTIRLAIMNRRT
FT                   EIEVMKLVGATESFIQRPFLYTGIWYGVIGGILAWIIINLLVLYLDSALAELLGLYGSQ
FT                   LEMKSLTLLELLQLVGLASFLGWLGSYLSVRQHLRAIEPS"
FT   gene            308360..309217
FT                   /locus_tag="Sputcn32_0292"
FT   CDS_pept        308360..309217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0292"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; PFAM:
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; KEGG: shm:Shewmr7_3844 RNA polymerase, sigma 32
FT                   subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74025"
FT                   /db_xref="GOA:A4Y242"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y242"
FT                   /protein_id="ABP74025.1"
FT                   /translation="MTFQTQSMALTVPQGSSSLEAYIHSVTSISMLDAEAEYELAKRLQ
FT                   ETGDLQAAKQLIMSHLRFVVHVAKGYSGYGLPQADLIQEGNIGLMKAVKRFDPDVGVRL
FT                   VSFAVHWIKAEIHEYVLKNWRIVKVATTKAQRKLFFNIRKAKKRLGWFSDEEVTMVAEN
FT                   LGVSKADVTEMESRMAAQDPAFDLTSDNDDEQDFAPVHYLEDHSSDLAENIENDNWESN
FT                   AQGRLLSAIKTLDERSQHILRARWLDDDKTTLQELAETYQVSAERIRQLEKNAMNKLKA
FT                   CMEA"
FT   gene            310518..311060
FT                   /locus_tag="Sputcn32_0293"
FT   CDS_pept        310518..311060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0293"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: bam:Bamb_2833 fimbrial
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74026"
FT                   /db_xref="GOA:A4Y243"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y243"
FT                   /protein_id="ABP74026.1"
FT                   /translation="MKILILAMAVSALFTVSFAKSAQHNTITFFGAISQQTCEVSINGD
FT                   SANPVVLLPAVAASELVAPRSVAKETAFTLGLTGCDGSAFSSYTLFTGNNVGDYGTLKN
FT                   LATDGALHVGFQLKNMLGGYEIDVTNFQYASREPGVRLNAGQTEGSWDYAVQYISIEGG
FT                   ATPGRVLGSVQYAVVYE"
FT   sig_peptide     310518..310577
FT                   /locus_tag="Sputcn32_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.972 at
FT                   residue 20"
FT   gene            complement(311228..311531)
FT                   /pseudo
FT                   /locus_tag="Sputcn32_0294"
FT   gene            311981..313354
FT                   /locus_tag="Sputcn32_0295"
FT   CDS_pept        311981..313354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74027"
FT                   /db_xref="GOA:A4Y244"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR011228"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y244"
FT                   /protein_id="ABP74027.1"
FT                   /translation="MLKKLIIGFILCNIIFPAFSYCIRNPQNTDSIPPEWQPFVFDDES
FT                   GITQPWGAFITGNGPIGLPASINLLSNDIQPIGSIIHDTGPLPAETYGRYLTPFSPEQV
FT                   LFICTPNEEGQLFEGYIANSDSDAYKHKILHPDVSENTYSTRTKQIGWRAKNLDTGNYI
FT                   TDRWQLRPLTHLDKDKFGRILVKAKNFSRYQLELIKVPYPAPTQYGAYTPGFVTTFGGF
FT                   DPFVYIYFISRSGETSTYYIPNCVGGALLSSCAPSSINVPHLFAGLGNKYPGGETSVTT
FT                   TKGCAIRQVTPSVMFEPISVNELNNGVSRTGIVQVEYACSNGAVFGTGTANNAIGFRVP
FT                   ASSATLAENFGFKNPLGTGVSKLVADNYPDPASAKGVAIEIFPKNDPIALNWLTSSLKG
FT                   GGHPNGWYKPNGILQNSESDSVLIYKVEYEVKLSKMSPSENVRPGQVNASAEVLIIVQ"
FT   gene            313743..314063
FT                   /locus_tag="Sputcn32_0296"
FT   CDS_pept        313743..314063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74028"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y245"
FT                   /protein_id="ABP74028.1"
FT                   /translation="MLKDIVFGVATFALAGVLFVTPVKSEGMIIFQGMIVEPSCELNIN
FT                   SVQCLETGTSSIHHSFAYFSIDNQGLLVGESKRLLGVTKKIDKIDIVRFDRDEYMVTAN
FT                   YF"
FT   sig_peptide     313743..313820
FT                   /locus_tag="Sputcn32_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.765) with cleavage site probability 0.642 at
FT                   residue 26"
FT   gene            314187..315530
FT                   /locus_tag="Sputcn32_0297"
FT   CDS_pept        314187..315530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0297"
FT                   /product="fimbrial subunit"
FT                   /note="KEGG: pau:PA14_59750 fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74029"
FT                   /db_xref="GOA:A4Y246"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR011228"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y246"
FT                   /protein_id="ABP74029.1"
FT                   /translation="MRILLVIFFVAWVSGAQATCYRISYNNVLADKNSPYYINPDFGTN
FT                   AIWNGASDSNFGYIGLLNVIGITNTYLQPIGTLIAKSPNTPMFQYGQPGGFNPEQVLYR
FT                   CDAEDEGELFESYATNSDNYLSGRSLVTEAGVPPHTYMLNSPDIGFRIWNDTTQEYVTR
FT                   NWRYRALTNLDRDDKNKILVKAKNFSSMSVELIRISSPAITDGPYQPSTSYSSTYSYNQ
FT                   PLGYTTFIGPGVPGCNEGLLGTCYTGFHSSWPGNISITNNLMIRRTQLCAFKNVTPHVT
FT                   FPPITATALRRGEKVKAQFYLDYSCGKGALIGDTTANMNAVGFKINNEARQAAINEGLI
FT                   VVGSMTGVTKLLSRGYGVDPNIAVGVGIEIESENGDRVNWLTDENTIIQGPNYLNGWHP
FT                   LRGEPTPGGPLDNQYSERFNVYLSANGGAITPSPGKVYATAEVFIRVM"
FT   sig_peptide     314187..314243
FT                   /locus_tag="Sputcn32_0297"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.609) with cleavage site probability 0.504 at
FT                   residue 19"
FT   gene            315969..316511
FT                   /locus_tag="Sputcn32_0298"
FT   CDS_pept        315969..316511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0298"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: bam:Bamb_2833 fimbrial
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74030"
FT                   /db_xref="GOA:A4Y247"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y247"
FT                   /protein_id="ABP74030.1"
FT                   /translation="MKKITLALAASGLLLGSSAAMAAGPNTITFMGEVTDQTCEVEING
FT                   NAANPVVLLPTATTAELAAAGSTAKETTFTLGVTGCDGTALTSKTVFVGNVVDVDGNLT
FT                   NTATSGAANVALQLLAVPGSQASAIDLNTTTPVAGVVLAAGETEGTVDYAVQYISVAGG
FT                   ATAGPVLGSVQYAVSYQ"
FT   sig_peptide     315969..316037
FT                   /locus_tag="Sputcn32_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            316590..317318
FT                   /locus_tag="Sputcn32_0299"
FT   CDS_pept        316590..317318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0299"
FT                   /product="pili assembly chaperone"
FT                   /note="PFAM: pili assembly chaperone; KEGG: ypn:YPN_0086
FT                   fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74031"
FT                   /db_xref="GOA:A4Y248"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y248"
FT                   /protein_id="ABP74031.1"
FT                   /translation="MWYRFLLVIAVLLCCQNVQASVVMTGTRIIYPADAKEKSIQLVNN
FT                   DNFPNVVQLWTDIDNPQSAPESADGPFVVLPAIAKVKANSGQTIRLIYTGEALPSDRES
FT                   VFYLNFLQIPPAEKASSNENKMLIMLRNRLKIFYRPEGLNVSVAEVPSLIDFSVKSQAN
FT                   GLQVEVANASPYFASFTRGSLNYQGREVVLPVEMVAPFSKVSWAVDNIKLVPQTQATIN
FT                   FTLVNDLGASIKQEQAVVIR"
FT   sig_peptide     316590..316652
FT                   /locus_tag="Sputcn32_0299"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            317329..319881
FT                   /locus_tag="Sputcn32_0300"
FT   CDS_pept        317329..319881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0300"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: pae:PA2130 probable fimbrial biogenesis
FT                   usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74032"
FT                   /db_xref="GOA:A4Y249"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y249"
FT                   /protein_id="ABP74032.1"
FT                   /translation="MPWINLFMDKKIKLRLLPLLLLSAPLYADDMEYTFDEALLLGPGY
FT                   NSDYLQRLANGPDILPGQYQVDLFINGRFVSRELLQFIELSDNKVEPCIEEAIWTKAGV
FT                   RPEFMAPAPITGGCSLGYTVKGNNFSFDSGSLRLELTVPQAYMDNKPRGYISPDEWDSG
FT                   ETALFVNYSGNYYRSESSYGRRSTSESGYLGLSSGFNLGLWRIRNQSTYQYRDSGFGSD
FT                   SQFDSLRTYATRALPFWQSELSLGELYTRSTVFGSISFKGFQIQSDTRMLPVSQRGYAP
FT                   TVTGIAQTTAKVVIKQNGREIYQTTVAAGPFEINDLYPTNYQGDLLVEITEADGRVSSF
FT                   TVPFSAVPGSMRAGQSQYALSMGKSIDTGEDGYFTDFTYELGLSNAMTFNSGLRIASGY
FT                   VAASAGSVFTTPIGAIGATGVYSHSKLKPELGDVETDSGWRLGLNYSRAFESGTSVTLA
FT                   GYKYSTEGFRELSDIFRQRAYLDNGYDYSSENYLQKAEMVLSMSQHLGDWGSLAVSGSK
FT                   RQYRDGRDDDESYQMGYSNQFGLVSLGVNYSRQYLNQTENSIAGPIPVKTKDDVWSLSL
FT                   SVPLGASSNHAASTGYSNSGDSNNYYAGISGMLDDDRTLSYSLNASRLDDNDFSGNSYS
FT                   ATLNKRMSLASMGLNYSRSDSYQQWGGNIRGAVVVHEGGLTLGQSVGETFAIIEAPGAE
FT                   GAAVKNNWGTYIDSNGYALMPSLMPYRSNDVSLDSANIDEDVELVDSRKTVTPYAGAAV
FT                   KLKYETRKGKAALFIAKLDSGEVAPLGANILGSLGENIGTVGQAGLAYVRLAEPVGKLT
FT                   LKWGERREDSCQIHYDLTEQPTDVRLHRLPTVCTVATN"
FT   sig_peptide     317329..317415
FT                   /locus_tag="Sputcn32_0300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            319895..321265
FT                   /locus_tag="Sputcn32_0301"
FT   CDS_pept        319895..321265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0301"
FT                   /product="fimbrial subunit"
FT                   /note="KEGG: pau:PA14_59750 fimbrial subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74033"
FT                   /db_xref="GOA:A4Y250"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR011228"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y250"
FT                   /protein_id="ABP74033.1"
FT                   /translation="MFKKLVLGLILLNTSTMAFAHCARTPAYSGEWPTEWPPFDNTTGI
FT                   MKNWNQIDNDGGKLGVPSRLNLASDLIQPIGSVLANGGAAPFTQYGRQYYPFEPEQVLF
FT                   VCSPDEEGQIFEGYVANRNSVYQGNVVTHPDVPENTYTTFVKKVGWRAKNLTTGKYFSN
FT                   TWQLRPLTGLDRDIHGRILVKAKNFSAIEFEYIKVPSPAPIDRNTGSYTAPNTTGFGYW
FT                   DPFGFIFFISQKGDSSPSYIPNCHEGDSLSTCSPGTVSHSHIPAGLSNLAQGGSFSSYK
FT                   GCQVTTVTPSVVFDPISVSEAEAGVKRRGRIDINYRCENGAIQGTATGQNAIGFKVSDA
FT                   AKNIANSFGFKTTGTGVTKLFSENYGAPGVAKGVAIELQPATEIGTMNWLTSSSTGGGN
FT                   VNGWYDPMGYNPNPGEIIELSIYYDVELSKFTPPSLPRDPVTPGIVYATAEVLIVVQ"
FT   sig_peptide     319895..319957
FT                   /locus_tag="Sputcn32_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.891 at
FT                   residue 21"
FT   gene            321427..322161
FT                   /locus_tag="Sputcn32_0302"
FT   CDS_pept        321427..322161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0302"
FT                   /product="pili assembly chaperone"
FT                   /note="PFAM: pili assembly chaperone; KEGG: rme:Rmet_1663
FT                   pili assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74034"
FT                   /db_xref="GOA:A4Y251"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y251"
FT                   /protein_id="ABP74034.1"
FT                   /translation="MRLIYFALAFLLFGFSSAVLAGVIADNTRIIYNIDKKEQSFQVVN
FT                   INDYPVLVQLWVDDGGVDSSPEKASNSPVIPLPAIFKLKSKEAKSIRLVKIDDNIAADR
FT                   ETLYWLTIYEVPPTPDKGDKADAENNTDNNAVLILTMRTQMKLLLRPAALFNQVDTMPT
FT                   NVSFKWVDNSLVLINNSPFYVTIASLRLSDKENESQYSGMLAPFSQETVAWKSAAQPES
FT                   LVMTYIDDNGSQNDFEIKNNSK"
FT   sig_peptide     321427..321492
FT                   /locus_tag="Sputcn32_0302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 22"
FT   gene            complement(322756..326346)
FT                   /locus_tag="Sputcn32_0303"
FT   CDS_pept        complement(322756..326346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0303"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: psb:Psyr_2113 PAS; TIGRFAM: PAS sensor
FT                   protein; PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; Hpt domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74035"
FT                   /db_xref="GOA:A4Y252"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y252"
FT                   /protein_id="ABP74035.1"
FT                   /translation="MKIILSLIFSLFFMLLASIPLKAKEDVPLTLYGHSTVGEVKLDLS
FT                   KEQQDWLQQHGKIRVGITTPDYPPFDMTMDGHSKYYEGLSADYLQILSEILKVKIELHF
FT                   FDSRPKAIDAIKNNDVDMLTTANRYEEFYGLELSQHYVEDIPALYISDKVSPSDTPKRI
FT                   AIPYDYLPNKQISALFPDAELVDYPSRLQAVAAAAFGQTDSVIIDAFSANHLINNIFSK
FT                   QLLLKELLSIDTNGISFAFNPEKQKLKEIINSALKQIPISEHWAIKKRWNGGGITVPSK
FT                   KAYIQFSTDEQTWLAQHKPIRIVVNEFNAPVSYFDQHRNFQGFAADVLEVISLYSGIET
FT                   VIIRTQSFEEMEKYLAYDSADLAILSPTTRLKNKFTFSKEFTSTPFAVVSHSKTNTLYK
FT                   QNITVALPAVHTVNELIPKAMPNAKVIRVENYLEAMNAIAKGKVDATIAPLGVADYYIN
FT                   HYYKNILSIDNLVDGIPPAVLAFAATKDNPQLVSILNKILASIPPDELQALENRWRRNA
FT                   VPGKETWRDYKYTIYTMIAATVMFILAAIYWTWLTRIHYIRRLDAKQEIQNQLLFMQEV
FT                   VDSIPHPIYVRDIDQQLILCNQSYQHIFKATNKEDILHKSIEEGSHRVIEAHELEKEYR
FT                   KAIQENRAISRDREIHIDGKAVNIYHWFQPYKNEHGKICGIVGGWIDVSDRVKLMAQLR
FT                   EAKELADSASKAKTQFLATMSHEIRTPMNAIIGLLELAIKRSHENQFDFNSIRVAHDSA
FT                   KGLLALIGDILDIVKIEAGELTLNPTKIDLKQTISSTIQIFEGIALEKKLPLKLIFDHK
FT                   LPQYVLLDPLRLKQILSNLISNAIKFTNQGMVTVSAEQQLELNEQMYLLLKVSDTGIGI
FT                   SKDDQQKLFRPFAQVQHGADNKGGTGLGLAICSSLCDMMGGELRMISEPEQGTTLSMRL
FT                   PLYPVKDIANTMLSPSLNVDTDPPTVLPQHILIVDDHSANRLLLSQQLRYLGHSVDEAN
FT                   NGLEAIQLFRQHPYRIVLTDCNMPIMDGYEFSRRLRQFEQNNNLPAAVVLGYTANAQLE
FT                   AKQACIDAGMNDCLFKPISLEDLRQKLESYCQKLTLEHPQQAFLPEALTKLTGGNTPLF
FT                   EQLLKELLNANELDLAELQQAVQQEKLCDAKNIAHKIKGAAKIVAATSVVSACEQFEQI
FT                   KSVDEIEEKLNNLTIAINTLADEIKNHLAA"
FT   sig_peptide     complement(326275..326346)
FT                   /locus_tag="Sputcn32_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.981 at
FT                   residue 24"
FT   gene            complement(326343..326966)
FT                   /locus_tag="Sputcn32_0304"
FT   CDS_pept        complement(326343..326966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0304"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: pfo:Pfl_4515 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74036"
FT                   /db_xref="GOA:A4Y253"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y253"
FT                   /protein_id="ABP74036.1"
FT                   /translation="MKRKILIVDDHPVVVLALKIILEQNGFEVIADTNNGVDALKLVKD
FT                   LSPDAVILDIGIPQLDGLEVIERSRKLANPPPILVLTAQPSDHFVVRCIQAGASGFVSK
FT                   QKDMTEVTGALRAILSGHSYFPIFGNNIITQSHQQEAELIKKLSTREMVVLQQLAIGLS
FT                   NKEIADRMLLSNKTISTYKTRLLEKLNAKTLVDLIEIAKRNSII"
FT   gene            327334..328572
FT                   /locus_tag="Sputcn32_0305"
FT   CDS_pept        327334..328572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0305"
FT                   /product="response regulator receiver modulated diguanylate
FT                   phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; response regulator
FT                   receiver; KEGG: pau:PA14_12810 probable two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74037"
FT                   /db_xref="GOA:A4Y254"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y254"
FT                   /protein_id="ABP74037.1"
FT                   /translation="MGKIRVIVLEDHPFQRTVLEYNLASFPCVEVFSFGTAQDALAWLD
FT                   IHHSADIVICDLMMTGVDGLSFLRKAKLSYDIFSVALFSCIDKELRRSVSQMIKMLDFE
FT                   YLGDLGKSPSVDNLQRILDKFSDRKVNKKVSSLSTDICLANFIYEDFELGLKQGNFVGF
FT                   YQPKFDVSQFSLRGAEVLARWVHPQFGLLHPGFFIESLIHHNLLDDLFFQLLEQGCRLQ
FT                   QRLLQSGEQLSLAYNLDISQLNSTKLVYRIVDMVESYHLSPQLVTLEITESGLLSTPAL
FT                   NMENLIRLRMQGFGLAIDDFGAAHSSLARLCDLPFSQIKLDGSFVQKVNIEPRCQAAIS
FT                   SVIGLAEALNLELVIEGIETNSQLSLLQQLGCTIGQGFCFSRPIDEQTFIQRFLPASLD
FT                   KFFDFSMANNNSL"
FT   gene            328682..329380
FT                   /locus_tag="Sputcn32_0306"
FT   CDS_pept        328682..329380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_2113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74038"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y255"
FT                   /protein_id="ABP74038.1"
FT                   /translation="MKLRVSFIISMLSIFLYSSCILAQVEHISLNERLFEVGKLPMVKL
FT                   NIVTTNQDISDLEFILVQENNEEKLIVQQLNQFSLLLMGLDIVTDINAKLIVRQWQPIK
FT                   DIALFDKDYVERHLAALEAKRAQKEVAINKSPLMISQANMVQDSASCLLEYDGNQTLWR
FT                   LGLKYAESWDTSNYTAMLVIFYENPQAFNNGWINGLRKDAVLRCPDDKLLTIYADPVKA
FT                   KTLYNKLSEK"
FT   sig_peptide     328682..328753
FT                   /locus_tag="Sputcn32_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.993 at
FT                   residue 24"
FT   gene            complement(329452..330870)
FT                   /locus_tag="Sputcn32_0307"
FT   CDS_pept        complement(329452..330870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0307"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: son:SO4576
FT                   O-succinylbenzoic acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74039"
FT                   /db_xref="GOA:A4Y256"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y256"
FT                   /protein_id="ABP74039.1"
FT                   /translation="MLFPPTAISPLHQAARDFPQQTAITLAGKSINYQTLSQQVIALGE
FT                   QLTALGIKEGNPVACISINNLEMICLYWACINIGAIFFPISPRFPTTQVQALIDTHQVG
FT                   YYWSPTPDSALRHCSPLELQFNLLSTQSAKSIDFTRPSNVILTSGSSGFPKAAVHCLAN
FT                   HIANAEGARCVIPLEKGDAWLLSLPLFHIGGLAILNRCALVGASVAMPDPVISLNQQIT
FT                   RDKLTHVSLVPAQLIKLLSDENGKLESIKALLLGGGAISTDLLNQLKLRNIASFTSYGM
FT                   TEMGSQITTGSALSDGSSGKLLPKRELKIADGVIWVRGECLFMGYLTADGIQKCVDKAG
FT                   WFYTKDRGEWDANGNLHILGRVDNMFICGGENIQPEEIEAALKQHPLIDDAIVFAEPDA
FT                   QFDHLPAAIVRGKITEDMTTIATELEPFLADKIARFKRPRHYYPWPEDSEQMGLKVNRK
FT                   SIVINVKSNKKTGK"
FT   gene            complement(330872..331966)
FT                   /locus_tag="Sputcn32_0308"
FT   CDS_pept        complement(330872..331966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0308"
FT                   /product="O-succinylbenzoate-CoA synthase"
FT                   /note="KEGG: she:Shewmr4_3769 O-succinylbenzoate-CoA
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74040"
FT                   /db_xref="GOA:A4Y257"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y257"
FT                   /protein_id="ABP74040.1"
FT                   /translation="MILTSLSLYQYRLPLEVLLPVGKQRIDHRAGLVLQAFASANDRDT
FT                   QVEVDIAPLSGIDIEQHDILGFSRENLAQVRSALTALLPQLCGQHIDKLIDFSEQTPYP
FT                   SLAFGLSLLHAKLMGKLATVRPQNSTVPLIYHPTDASKALLANKIAHLGKDVRSVKVKV
FT                   AQTSIEDELSLIYGILSTRPDIKLRLDANRGFSLEQAITFAACLPLEAIEYIEEPCHNP
FT                   RDNPAFYQAIGLPFALDESLNDPEYQFEMYEGLAAIIIKPMLLGSLEKLSQLIDIAQNH
FT                   GVRCILSSSLESSLGIRELAHLATILTPDETPGLDTLNAFSQDLIVSSGKTQCLTLSQL
FT                   ELIAQHTTHAKTNTDNELAEAKGE"
FT   gene            complement(331994..332782)
FT                   /locus_tag="Sputcn32_0309"
FT   CDS_pept        complement(331994..332782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0309"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   she:Shewmr4_3768 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74041"
FT                   /db_xref="GOA:A4Y258"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y258"
FT                   /protein_id="ABP74041.1"
FT                   /translation="MPTMARYGETSLPVLVLLHGFLGTKADWLPLMPVLSQHFHCICVD
FT                   LPGHGDNQDELAPTELEGFSQCVENVIAHLDGLHIGQFHLYGYSLGGRIALHLANTYPQ
FT                   RLLSLTLESCHPGLDDLEEKTTRASNDALWADRLMRLSSKEFLALWYQQAVFADMGTTK
FT                   RQSLIDLRTKALDQHPKQKLQQIYLATSLAKQASLWNVPSQLTCECHFFAGTEDSKFSA
FT                   IAEKWQQQAPILLHSIHGAGHNIHQMAPAALISKIVALLG"
FT   gene            complement(332782..334503)
FT                   /locus_tag="Sputcn32_0310"
FT   CDS_pept        complement(332782..334503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0310"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /note="KEGG: she:Shewmr4_3767
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: thiamine
FT                   pyrophosphate enzyme TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74042"
FT                   /db_xref="GOA:A4Y259"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y259"
FT                   /protein_id="ABP74042.1"
FT                   /translation="MRTENTATLNLIWGALILEELARIGVQHVCMAPGSRSTPLTLAAA
FT                   QQTKLKRHLHFDERGLGFMALGLAKASRAPVAIITTSGTAVANLYPAIVEAWLTHVPLI
FT                   VLSGDRPPELLDCGANQAIVQPGIFAHYAKQINLPTPDAHIAPQALLTTIDEAVANQTR
FT                   PVHINCMYREPLYPSELGVPILDTESPYLKPLQTWLQLSRPYTQYGKYKQVSNPSDDAI
FT                   MRFVHGKGVIVAGTLTPEQDPQQLIALSQKIGWPLLTDAQSQLRQHPAAIGNIDQLLQH
FT                   PKARNLLQEADRVLVFGGRLLSKRLISYLAEQHWHSYWQVLPEQNRLDPSHNAKHVWHA
FT                   NAAQFAALNWYRSSSANWANTLITYNDELHNLFVRNIDHGEFGEAQVVRAIANTRPLEQ
FT                   QLFIGNSLPVRLYDMYAPVSCCTATTYTNRGASGIDGLLATACGLAAHEGKPTSLIIGD
FT                   LSQLHDLNSLAIAKSLASPLVIVILNNDGGNIFNLLPVPNEQVRNDYYRLSHGLEFGYA
FT                   AAMFNLPYNQVDNLADFQDSYNEALDFQGASIIEVNVSQTQASDQIAELNLWVKQS"
FT   gene            complement(334686..335654)
FT                   /locus_tag="Sputcn32_0311"
FT   CDS_pept        complement(334686..335654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0311"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   shm:Shewmr7_3839 transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74043"
FT                   /db_xref="GOA:A4Y260"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y260"
FT                   /protein_id="ABP74043.1"
FT                   /translation="MHISNMDGLDILSLKILVSLYENKSATYVSKALDIPAPKISRSLK
FT                   NLREIFGDELFIRRKYGLFPNEFATHLYPIAKEAIECTDKFQKARMANTRQVKTHVEIA
FT                   APGLIAYAFPKALMQAIKEEQKPMHININPWSMHTTQDIINGDITLGICCNKSAADVAA
FT                   FGDKLLTTELHRMDKLYLIASRHHPIFKREITLETIAEYPYVNTDLGNPSTKLSPYQEF
FT                   CITNGIKLNTEITITSISSLFEYLGESNAVSLLPYRIVYEMVSDIPELHTCQLSQYEAE
FT                   RLYADTEAPTIFLVQKNQPNAINEDLKWLSGEIQKIVDRII"
FT   gene            336066..336542
FT                   /locus_tag="Sputcn32_0312"
FT   CDS_pept        336066..336542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74044"
FT                   /db_xref="GOA:A4Y261"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y261"
FT                   /protein_id="ABP74044.1"
FT                   /translation="MNTSVILSYAFMYFVLFVAVPFVFVMFVMTCIKFFRADPDEAAHH
FT                   EMKLKPVLFDKQSFNFFKSLKTVVEGKYDVCCNVPLDTVFEMDHHDAELNHECRLDYVL
FT                   IDHDSSEVKMVISDFGKETNSPLKKLFSKFNINFIEMNPHKQWDTQSLKQALAV"
FT   gene            336620..337084
FT                   /locus_tag="Sputcn32_0313"
FT   CDS_pept        336620..337084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0313"
FT                   /product="formate-dependent nitrite reductase"
FT                   /note="KEGG: she:Shewmr4_3764 formate-dependent nitrite
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74045"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y262"
FT                   /protein_id="ABP74045.1"
FT                   /translation="MSKRQWLWSLRLGAATLLLSFSAMSAEPANQINSDACMKCHKRNG
FT                   QMLGHHGQDAMKMTCSSCHGEKGDHPKKPNDLVVFGMQDASDMTVQLGACQKCHTKKKL
FT                   GEADWTHNVHAKKVPCAACHKLHSPMDPMAQMTLKVRSELCSSCHTGKQE"
FT   sig_peptide     336620..336697
FT                   /locus_tag="Sputcn32_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            337089..337775
FT                   /locus_tag="Sputcn32_0314"
FT   CDS_pept        337089..337775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0314"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: she:Shewmr4_3763 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74046"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y263"
FT                   /protein_id="ABP74046.1"
FT                   /translation="MENSKRRFLKGTCALLAGASGASLLATVNASGSVKAEADVKYALI
FT                   HDETKCIGCQACEVACREVNNVPEGVSRIEIKREGPFGEYPNQFYHFSRKSCQHCEDAP
FT                   CVNVCPTGAAFIDKETGIVSVDAWKCVGCQYCIAACPYQVRFIHPVTRAADKCDFCRET
FT                   NLAQGKQPACVAACPTKALVFGNLKDPTSEVVQVLRSNPTQRAKVDLGTRPKLFRIVAK
FT                   SGEVTL"
FT   sig_peptide     337089..337181
FT                   /locus_tag="Sputcn32_0314"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.298 at
FT                   residue 31"
FT   gene            337772..338713
FT                   /locus_tag="Sputcn32_0315"
FT   CDS_pept        337772..338713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0315"
FT                   /product="Polysulphide reductase, NrfD"
FT                   /note="PFAM: Polysulphide reductase, NrfD; KEGG: son:SO4568
FT                   formate-dependent nitrite reductase, nrfD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74047"
FT                   /db_xref="GOA:A4Y264"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y264"
FT                   /protein_id="ABP74047.1"
FT                   /translation="MSALHFDTLVWHWPIAIYLFLAGVSAGAMFFAVLLKHFVLKHNAY
FT                   QSGFVQAACIVAPVAVMAGLGILVIDLTKPLDFWKILVFYNPKSVMSMGVLILLIYQVF
FT                   MFMWIGITFRKPVDAWCEKRFPIVLKLTALLARYEATITGLLVIFSLALGAYTGFLLSA
FT                   LPGYPMLKNPVLPLLFLASGLSSGAASSLLGGVLLNGSPNGKEVHFIHKVEIPLILVEI
FT                   VLIFTFFMGLVLTGGQSKIAAFNAIGYGFWGWIFWLGIIGLGLSGPLAMNLFMTATSKR
FT                   KWAYVAGTACISLIGVLLLRNFILYTGQMTIA"
FT   gene            complement(338992..339423)
FT                   /locus_tag="Sputcn32_0316"
FT   CDS_pept        complement(338992..339423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0316"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   son:SO4567 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74048"
FT                   /db_xref="GOA:A4Y265"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y265"
FT                   /protein_id="ABP74048.1"
FT                   /translation="MDKFDTAIINCLRQNARQSVSHIAEQVSLSRSAVAERIKKLEQSG
FT                   VIRGYQVLLSESQKEGVSAYFEIQHQCSRCADVVHVFQAIPEVITCRGISGDMDLLVYV
FT                   QTPSMRRLHEIREYIDAHSDITKIKTHIVMSEWINNLGE"
FT   gene            339673..340935
FT                   /locus_tag="Sputcn32_0317"
FT   CDS_pept        339673..340935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0317"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   shm:Shewmr7_3833 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74049"
FT                   /db_xref="GOA:A4Y266"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y266"
FT                   /protein_id="ABP74049.1"
FT                   /translation="MNAHSGTIGRWQGAGLMATTLLGTGVFILPQITIEKAHSGALVAW
FT                   LLLTLAIIPVALVFGRLASVFPHAAGPAYFVEKAFGRTTGRTIGLIFLLVVPIGAPAAI
FT                   LMTFQFVNALIPLEGWPKVGCEILVILGLFLLNLRGIQVSAKLQFGLTLCIVAVVVMLF
FT                   GASSLQPGQLTSLASHGMPQMSAVMVAAGIAFWSFLGIEAMTHLADDFRRPQQDMIPAM
FT                   MMGTMLVGVIYVACTFLLLLVPTDESVAMIGVFDQLLGGYGAQVIGVLGIASGLATVNV
FT                   YAASAARLIWSFSCDGILPRFFAVKNNHGVPIRALAALLSVMASVMVLTYLTGQELEHL
FT                   IAWSNGVFVVIYLMAMLAAAKLLPKQNLPLVILGCVFCLALGIALGASMAYVLVLVIVV
FT                   APFLWWQKTHISRKQSLVIPD"
FT   gene            complement(340918..341376)
FT                   /locus_tag="Sputcn32_0318"
FT   CDS_pept        complement(340918..341376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0318"
FT                   /product="protein of unknown function DUF1332"
FT                   /note="PFAM: protein of unknown function DUF1332; KEGG:
FT                   shm:Shewmr7_3830 protein of unknown function DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74050"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y267"
FT                   /protein_id="ABP74050.1"
FT                   /translation="MIAKLKRFIQSHTQAVSPEDKAHQLKLAAASMLLEVVFADETLAA
FT                   EEMALLPKLLTDTLSMTDDDANALIDDAKQVQGNATSLFEFTSAINAEFSLEQKQQLLL
FT                   AMWQLAYADGQLSQYEDQIIRRTADLLYLKHSELIQMRNLAMKSVRDN"
FT   gene            complement(341474..342004)
FT                   /locus_tag="Sputcn32_0319"
FT   CDS_pept        complement(341474..342004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74051"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y268"
FT                   /protein_id="ABP74051.1"
FT                   /translation="MKHVITLSLLLGTSIMATPVHAGWLDNLAGTQAKTEQTVATVNAT
FT                   QSNELVGNVMSQLGLNQTQAEGGLGSLLGLAQSSLGSSDYSTLAASIPNAESLLAAAPK
FT                   LDANSGVSGLLSKAGNLGSSLQGGAMVLDAFEKLGISQELAMPMINIAKSYLETNGTEG
FT                   TSDLLMKGLNSLL"
FT   sig_peptide     complement(341936..342004)
FT                   /locus_tag="Sputcn32_0319"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            342194..342901
FT                   /locus_tag="Sputcn32_0320"
FT   CDS_pept        342194..342901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74052"
FT                   /db_xref="GOA:A4Y269"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y269"
FT                   /protein_id="ABP74052.1"
FT                   /translation="MSLSAILTEAYNFFRNHLVQLAMLTVPLLLIQVGIQLWLGAEMSK
FT                   ADLENPQFGAPHMLAMMLLLLTFSVLIAALTLFLELRSQGHHPSAGMVLKASLPFVPPL
FT                   LLAGVFSGLAILAPVMLFAAFGPMWLIGLVISFYLFARLAYVNFMVVVERLTPLEAIKG
FT                   SFSFSGPIVLKTIALLMLYLPLAVISSQLASIAAMGGLPLQMLVDTFMSFIGLFVNLAL
FT                   FRLYMVSKKPTVE"
FT   gene            342936..344390
FT                   /locus_tag="Sputcn32_0321"
FT   CDS_pept        342936..344390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0321"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: she:Shewmr4_3754 Sel1 domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74053"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y270"
FT                   /protein_id="ABP74053.1"
FT                   /translation="MATKVVIKDSDFIQGFSANLVDDYLCAKNYVKDVPTQSLLHIRSF
FT                   THKLTELLGQDKRIEFSSPNLYDRIEQLNQKRLIDVKTTRALHRLRADGNRGAHPEKYH
FT                   LTQEQLLALAQKTIKDVLTLVEHLYPKVAGCVAPRYQYKASDSVTVKDLCYRAVMEDDP
FT                   NAQYLVGISLKTKAFMLKDQALSWADQADDVLATHAELTNNVSAQAADTFAKAAYWFSL
FT                   AAPKNMDALYEHGVALIHGYQGVPDIAKGEQAIAVAAEAGVVNAMALLGYFYLVGSESL
FT                   AQDLELAQQYLQRAADGEQAEAMANLGVLHYQREDLTQAYHFIHKAAQAGYPHAQYHLA
FT                   LMLANGEGCSRDPIASEYWMAEAAEQGQLDAMFMRAQHMLNDDNAFGSDLTQAEHYLRE
FT                   VIKYGHSVPAMIELSMALADGMLGRIDVVGAAALLNLARRYANEKEAEIIEPLWLSLAL
FT                   QVDKVLEMTVDPAEIHSLKRAQTLLA"
FT   gene            complement(344400..344729)
FT                   /locus_tag="Sputcn32_0322"
FT   CDS_pept        complement(344400..344729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74054"
FT                   /db_xref="GOA:A4Y271"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y271"
FT                   /protein_id="ABP74054.1"
FT                   /translation="MIYQQFQQSPMQTRISGPRAWLAMALSVSLICLSLFLLPFVLLFG
FT                   AITLGCLVLFSRIYVARQLAKFNRAHTQTTHTTESTGYSSPHIVREPHATHHQGRTFEH
FT                   QEDER"
FT   gene            345092..346963
FT                   /locus_tag="Sputcn32_0323"
FT   CDS_pept        345092..346963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0323"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   son:SO4557 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74055"
FT                   /db_xref="GOA:A4Y272"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y272"
FT                   /protein_id="ABP74055.1"
FT                   /translation="MNSYSLKQKILISVVIALSLVIGLLSWQSYSSQKSLLLQNSLEQV
FT                   QRLGDQQAERIQEWLSGRQDIVGALASKVEGDTLNTLQQAQASGRFQLTYFGAQTGQML
FT                   DSDPSIDRTGYDPRSRAWYQQAVKERGLILTKPYMDVAYNILVVTMAQAIPTGVVGGDL
FT                   SIASLVDSVNRMKLPANGYAIMIHKDGTVIAYKDPTKAMQPISNIDSNLNHNLPEQSRK
FT                   VGELLSMHFEHEGRDKLVWAVDIPNTDWELVLVLDKETLEEPLTRLLLVQLGLSALVLL
FT                   LSVLAISWLVNVLLGPLSRVSQALARIADGNGDLTQRIEVDTQDEVGVLADSFNRFVGS
FT                   QHQLISHIRHLANELDADAERSLTTTQTSVSELQRQQQEVAMVATAVTEMASATNEIAA
FT                   NAENTATAAQQSAASSLQGKDLVHKTRNSINSLANEVSQATDVIGDLSRHAQSISSILG
FT                   TIQGIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRVLSRRTQDSTQEVHTTIETLQ
FT                   RTTARAVTLMESSQALAGNSVEDANAAAKALEEITQAVNVISDMAGQIATAAEEQTQVT
FT                   GEITQNTVAIKDVTDEITASAMADLAQAKALKARANDLNAQVATFIL"
FT   sig_peptide     345092..345187
FT                   /locus_tag="Sputcn32_0323"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.819 at
FT                   residue 32"
FT   gene            complement(347066..348037)
FT                   /locus_tag="Sputcn32_0324"
FT   CDS_pept        complement(347066..348037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0324"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: son:SO4556 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74056"
FT                   /db_xref="GOA:A4Y273"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y273"
FT                   /protein_id="ABP74056.1"
FT                   /translation="MNLDNLARIDLNLLVILKVLLEEQSVTRAASRLHISQSALSKSLN
FT                   RLRETLDDPLFQRTAHGLKPTAHALNLGQKLPNILQDLYQLTQPPTFNPASSNRQFSFA
FT                   MVESAYETLIPYFIGPLLNTAPNIKLDSYVWTEKSMHDLQQGQIDFGISGRDLHPLSDP
FT                   QIDRLPEGIACQTLFTDEQVCLIREDHPSMAALMSAQWNLSLYLDMAHVQVRCEGSDWW
FT                   ALDYFLADLGHRRKISTTVPDFYGAASVCAHSDLIFTLPSSFARHACQLYPLKQIPLPF
FT                   EFMPMAYVLLWHQRNDEDQGHKWIRETICQSVATLFNPLDIT"
FT   gene            348151..349359
FT                   /locus_tag="Sputcn32_0325"
FT   CDS_pept        348151..349359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0325"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   son:SO4555 drug resistance transporter, Bcr/CflA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74057"
FT                   /db_xref="GOA:A4Y274"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y274"
FT                   /protein_id="ABP74057.1"
FT                   /translation="MRRNLLPILMSMVLLSPLAIDIYLPSMPTMAAEFAVSASEVQSTL
FT                   VLFLFAMGLGQVLIGPLADRYGRRPVALFGVLLYGASSLLAAAAIEFHWLQIARVLQGL
FT                   AACSTSIVVFSAVRDCYTQKEGAKIYSYLNGAICVIPALAPTLGGLLAMQFGWRSTFVF
FT                   MTLYAMLMMLVVGYRLPETRPANTVTTGPLYRWGRYKPVLSNTHFLFYAFACMSAMAAI
FT                   LSYVSYSPVWLIGHLGVSELAFSGLFGLNALVNIVACFAAPVVIRKLGNRPTVILALSL
FT                   LVLSAVFILGAQQFGPSAGMAGAFAFMLPMMLLCIGFALLLGPATSMALSAFGERAGTA
FT                   AAMLGFIQMSGASVLTGLVQQTNLTAPYAVALVMGVFSIGLLLMMALSRFDHWHQEQLH
FT                   HSH"
FT   sig_peptide     348151..348246
FT                   /locus_tag="Sputcn32_0325"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.866 at
FT                   residue 32"
FT   gene            349483..350088
FT                   /locus_tag="Sputcn32_0326"
FT   CDS_pept        349483..350088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0326"
FT                   /product="DTW domain containing protein"
FT                   /note="PFAM: DTW domain containing protein; KEGG:
FT                   son:SO4554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74058"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y275"
FT                   /protein_id="ABP74058.1"
FT                   /translation="MTRHYCVACRYPLNSCLCGSIQPIYPSTRLVVLQHPSEVEHKKNS
FT                   VRVLSLAVPETQIYVGEDEHDFSELRNDLTKHDQPIYLVYPSDNSVSVEAQDISPNCVL
FT                   LLLDGTWRKAFKMLQLNPWLNEYPAVHLTEGYESRYKIRKSSRSDSLSTLEACAYMLSA
FT                   LDPLLNVAPVITAFDAMVEMRIKAMPPEIQVRYREFSE"
FT   gene            complement(350449..352569)
FT                   /locus_tag="Sputcn32_0327"
FT   CDS_pept        complement(350449..352569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0327"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: son:SO4552 sensory box protein; TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74059"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y276"
FT                   /protein_id="ABP74059.1"
FT                   /translation="MIRWQHLLNKLSTDDPVLREKLSLWQTHPDQTPLALIQGFSFISA
FT                   NRATLNYFGTHYDAFVNATPYDFSPRIQSSGRNSVEFAREMILEAIAGNHVEFNWLHLN
FT                   QQGRELPTRINLYRCYLQQQPVVLVELQALNRRNHVREAITDGFAHIPKEILSTTLEES
FT                   AEAVYITDDDNRILAVNKAMCRICGYSAEQLISHTPAMLESRNLSQGEETDCQLAIKQR
FT                   GSWQGETLKKRSNGSTFPAWQSSRRIVVDGETPYHVNIFSDISTQKQLETQLTTRAMYD
FT                   TLTGLPNRFHLKQLLNSALEKLQTDPNLLGALMFLDLNGFKNINDSFGHSMGDRVLQLV
FT                   AARLEAGCIEKADIARMGGDEFTLILQDCSCKEEIQLFAEQILSLFDSPFEIEGQKFFL
FT                   GTSIGIALFPTHSDQATQLISLADTAMYCAKKSPPHLVFYDKSMSQAAEIKLKLINSLR
FT                   HAHSLKQFKLVYQAIVDLHTNQTIAAEALLRWQKSPTEHYEASEFVPLLEETGLIVNIG
FT                   QWVLEQACQQATLWRSQYQSDFKISVNVSPLQLEHVDFVEQVINALEMAALPADALILE
FT                   ITESALLRQPEQARLTLNRIKSLGVSIAIDDFGTGLSSLSRLGTLPIDSVKIDAEFALR
FT                   LNDISGQKLCYAIVQLAQALDIHFVAEGIETQQQKDIMTDMGQGFAQGFLFGYPSAVEH
FT                   FTQTFLVEKHIA"
FT   gene            352876..353229
FT                   /locus_tag="Sputcn32_0328"
FT   CDS_pept        352876..353229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74060"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y277"
FT                   /protein_id="ABP74060.1"
FT                   /translation="MALLKSLIWFVLSLALFLPTANADEQKPQLILEQKADKARIDFLQ
FT                   VEQLQLDKARKAAKETVEREEKVSGTLQTNEWEEQQKIKAKKQFDEMESREQKYLREAK
FT                   DAVAKERKIIPKP"
FT   sig_peptide     352876..352947
FT                   /locus_tag="Sputcn32_0328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            353300..353938
FT                   /locus_tag="Sputcn32_0329"
FT   CDS_pept        353300..353938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0329"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: shm:Shewmr7_3819 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74061"
FT                   /db_xref="GOA:A4Y278"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y278"
FT                   /protein_id="ABP74061.1"
FT                   /translation="MNICPLCHSTELVAYHQDKKRCYDQCQICQLVIVPPEFYLSAEAE
FT                   KAEYDKHENSPYDVGYQRFLNRTLDPLLARFEPSAKGLDFGCGEGMALSLMAKDRGYQV
FT                   ANFDIYYANDPTTLTLQYDFISLTEVIEHVRDAAGLLNQLDNLLKPKGILAVMTKRVYN
FT                   PSAFSTWHYKNDPTHINFYSEATFNWIARKYDWRLELVDKDVVFFHKPC"
FT   gene            354269..356326
FT                   /locus_tag="Sputcn32_0330"
FT   CDS_pept        354269..356326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0330"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: shm:Shewmr7_3798 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74062"
FT                   /db_xref="GOA:A4Y279"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030150"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y279"
FT                   /protein_id="ABP74062.1"
FT                   /translation="MEHRAFKKNIIAAIISSLGVSSAYAAVEAESTEPIEKITVYGEKI
FT                   ERSLKDTTSSVSVIDKDSLDSGQYQSVSDALSEIPNVVVLTGSVPDIRGVSGNGSASGF
FT                   NSFTGGARARVSTLVDGVAEPFVADLTGDTGLWDIQQVEVFRGPQSTINGRNSIGGTVF
FT                   IKTEDPTFDWRGAARLGYRDQNNYVDSAVMVSGPILDDELAFRLSGQNVTGETYNKGLV
FT                   YETNPAPFDLNELITNRWRGKFLWQPSAVEELKVLYSFSYNDEKGDSGRNYFSGDDPWA
FT                   YRPILQRYIETESTTHSVKVDYDLGSGRALDLVVAYMDYDWGSKSYEALVTAQQYVDMK
FT                   DESYTVDGKYSFGLNDRDFNGFIGLAYYERSQDFGSTGSSVYTGDDSSSSLSIYGELTY
FT                   GLAESLWLTVGGRVMRDEQKRNFSMLYRGTQLEEKLDNDSTITLPKLVLQYAITDNTTL
FT                   AASARRGYNSGGGALSLAESEYYYYDEEFVDTYELSARSMFLGGNVNLSANLFYNDFDG
FT                   YQASNQARKITNVDKAVTYGIETELSAMLTANWQVIAGVGLLDSEIKKVDSSYGDIVGN
FT                   QLNSAPHVTANLGVKYWLNDAFSVGVSGNYVGEYFADIDNTESRIAGDYVVARLSVDYQ
FT                   KDNWRISGFINNMFDEQAMTVNEPPSANYVNGYAAIIDPRNLGVSVMYSF"
FT   sig_peptide     354269..354346
FT                   /locus_tag="Sputcn32_0330"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 26"
FT   gene            complement(356420..357403)
FT                   /locus_tag="Sputcn32_0331"
FT   CDS_pept        complement(356420..357403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0331"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   she:Shewmr4_3726 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74063"
FT                   /db_xref="GOA:A4Y280"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y280"
FT                   /protein_id="ABP74063.1"
FT                   /translation="MNKWFKHIGLAIALLFSAVCIANGGDELATQVQQSDAQIWAQLKD
FT                   GATGYTTSQSEFHAQPINTYDLRVLELRSDWLAPALMAALFGMIIIFVLFIKVNGISKL
FT                   HHGFSGKLVHRWSKFDVSIHWLGAIPCLLLILTGLTLLAGRFFFQPWLSAGIWEAIVYG
FT                   AKQIHDVMAIPFMIGWALMTTLWAKNQLPKMYDVKWFMVVGGYINFGPFKGKHPDAGFA
FT                   NAGEKMWFWAFALFGLIISASGMLLLFPNLFEPSRTLSLIALVLHSVSAIVICAFSIVH
FT                   IFMATVMSEGGMECMVSGYCDENWATQHHNLWYDEIKANGTLKYKE"
FT   sig_peptide     complement(357335..357403)
FT                   /locus_tag="Sputcn32_0331"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.696 at
FT                   residue 23"
FT   gene            complement(357483..358052)
FT                   /locus_tag="Sputcn32_0332"
FT   CDS_pept        complement(357483..358052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0332"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: shm:Shewmr7_3796 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74064"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y281"
FT                   /protein_id="ABP74064.1"
FT                   /translation="MATMKFLCDTKRCIECNGCVTACKNENDSALEWGIQRRRVVTIND
FT                   GQRGEASISVACMHCSDAPCMAVCPANCFYRTDDGIVLHNKDACIGCGYCLYACPFGAP
FT                   QFPKKGAFGSRGKMDKCTFCAGGPEENHSDAERQKYGANRIAEGKLPMCAELCATKALL
FT                   AGDAEVVSSIFRERMAYRGAKNAAWN"
FT   gene            complement(358082..360934)
FT                   /locus_tag="Sputcn32_0333"
FT   CDS_pept        complement(358082..360934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0333"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: shm:Shewmr7_3795 twin-arginine
FT                   translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74065"
FT                   /db_xref="GOA:A4Y282"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y282"
FT                   /protein_id="ABP74065.1"
FT                   /translation="MKLTRKSNIAPVADKPALGISRRQFMKQAGIATGGIAAASLMGTG
FT                   MMRRVEAKEVPHDAPIEVKRTICSACAVGCGLYAEVQNGVWTGQEPAFDHPFNAGGHCA
FT                   KGAALREHGHGEKRLKYPMKLVDGKWKKISWEDAINEVGDQMLNIRKESGPDSVYFMGS
FT                   AKFSNEGCYMYRKLAAMWGTNNIDHSARICHSTTVAGVANTWGYGAQTNSFNDIQNANA
FT                   IFLIGANPAEAHPVSMQHILIAKERNNAKIIVVDPRFSRTAAHSDLHCAIRPGTDIPFI
FT                   YGMLWHIFENGWEDKTFIKHRVFEMESIRAEVKKFPPKEVENITGVSEADVYQAAKLMA
FT                   DNRPGTVIWCMGGTQHHVGNANTRAYCILQLALGNMGVSGGGTNIFRGHDNVQGATDLG
FT                   LLFDNLPGYYGLTSAAWSHWTHVWDLDMEWVKGRFDQTAYLGKDPMTTPGIPCSRWHDG
FT                   VLEDKSKLAQKDNIRMAFFWGQSVNTETRQREVRDALDKMDTVVVVDPFPTMAGVMHRR
FT                   KNGVYLLPAATQFETQGSVSNSGRSIQWREQVIQPLFESKTDIEIMYRLAQKLGIDEQY
FT                   TKRIAKENGLPVIEDITREINRGMWTIGMTGQSPERIKLHTQNWGTFSNKTLEAAGGPA
FT                   KGETYGLPWPCWGTPEAKHPGTQILYNQAKHVKDGGGNFRARYGVEYNGQSILADGTYS
FT                   KGAEIKDGYPEFTADMLKQLGWWDDLTAEEKAEADGKNWKTDLSGGIVRVAIKHGCIPF
FT                   GNAKARCIVWTFPDQVPVHREPLYTARRDLVAKYPTYDDMQVHRLPTLYKSIQEKDLSG
FT                   KYPLVLTSGRLVEYEGGGEESRSNPWLAELQQEMFVEINPADAADRGIRNGENVWLEGA
FT                   EGGRIKVQAMVTPRVKPGVTFMPYHFAGVMHGESLAPNYPEGTVPYVIGESCNTALTYG
FT                   YDPVTQMQETKASLCQIVKA"
FT   sig_peptide     complement(360776..360934)
FT                   /locus_tag="Sputcn32_0333"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.772) with cleavage site probability 0.761 at
FT                   residue 53"
FT   gene            complement(360952..361152)
FT                   /locus_tag="Sputcn32_0334"
FT   CDS_pept        complement(360952..361152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0334"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: shm:Shewmr7_3794 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y283"
FT                   /protein_id="ABP74066.1"
FT                   /translation="MKQQPSDLSRRSLLKALTVGSVAGAAIAATGMSMAQASDSSTVTA
FT                   KKSTGYHETAHINSYYASLRS"
FT   sig_peptide     complement(361039..361152)
FT                   /locus_tag="Sputcn32_0334"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.796 at
FT                   residue 38"
FT   gene            complement(361537..362565)
FT                   /locus_tag="Sputcn32_0335"
FT   CDS_pept        complement(361537..362565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0335"
FT                   /product="formate dehydrogenase gamma subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   shm:Shewmr7_3793 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74067"
FT                   /db_xref="GOA:A4Y284"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y284"
FT                   /protein_id="ABP74067.1"
FT                   /translation="MLNKQLNKSLRSLFALLVLVMGLGLGSVMSSSPVQASDQQSSQQQ
FT                   AKAQTSDADLWRAVKAGDAGYTTAKGVETGVLINVAGNQGKELRNEYLTPVMALAVTGV
FT                   FGAFLVFYLVNGPSKLSHGFSGKLVARWSKADLWIHWIMATSCLALMFTGLTIMLGRHV
FT                   IQPLLGPDLWAPLIYGSKTIHDWAGPVFIAAWAVCVVKWMPLQTFKMYDLKWFLVVGGY
FT                   INFGPFKGKHPDSGFANAGEKMWFWTLTLFGLFISVSGIMLVLPGLDLPREASMAALLI
FT                   HAISAVILIAFTIVHIWMATVLSEGGMECMVSGYCDENWAIQHHNLWYDEIKANGNLKY
FT                   KD"
FT   sig_peptide     complement(362455..362565)
FT                   /locus_tag="Sputcn32_0335"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 37"
FT   gene            complement(362615..363211)
FT                   /locus_tag="Sputcn32_0336"
FT   CDS_pept        complement(362615..363211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0336"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: son:SO4510 formate dehydrogenase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74068"
FT                   /db_xref="GOA:A4Y285"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y285"
FT                   /protein_id="ABP74068.1"
FT                   /translation="MAVMKFLCDTKRCIECNGCVTACKNENDSALEWGIQRRRVVTIND
FT                   GQPGEASISVACMHCTDAPCMAVCPADCFYRTDDGIVLHNKDTCIGCGYCFYACPFGAP
FT                   QFPKKTAFGSRGKMDKCTFCAGGPEETFSEAERKKYGANRIAEGKLPMCAELCATKALL
FT                   AGDAGVVSNIYRERMASRGNPNVIWGYNPKTGEIN"
FT   gene            complement(363238..366087)
FT                   /locus_tag="Sputcn32_0337"
FT   CDS_pept        complement(363238..366087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0337"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.17.1.9"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: son:SO4509 formate dehydrogenase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74069"
FT                   /db_xref="GOA:A4Y286"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y286"
FT                   /protein_id="ABP74069.1"
FT                   /translation="MRLTRKTDQVVEPKASTLGLNRRQFLKSAGLATGGIAAASMLGTG
FT                   MMRKAEAKDIPHNVPTEVKRTICSHCAVGCGIYAEVQNGVWTGQEPAFDHPFNAGGHCA
FT                   KGAALREHGHGEKRLKYPMKLEGGKWKKISWDQAINEVGDKMASIRQESGPDSIYFMGS
FT                   AKFSNEQAYLYRKFAALWGTNNVDHSARICHSTTVAGVANTWGYGAQTNSINDIRNSKC
FT                   IMFIGANPSEAHPVAMQHILIGKERGAKIIVVDPRFTRTAAKSDEYVHIRPGTDIPFIY
FT                   GLLWHIFENGWEDKEFIKHRVYGMDRIREEVKKYTPEEVENVVGVPKAQMYRVAKMMAE
FT                   TKPGTIVWCMGGTQHHVGNSNTRSYCMLQLALGNMGVPGGGTNIFRGHDNVQGATDFGL
FT                   LFDNLPGYYGLTTAAWDHWANVWDLDPKWVSSRFDQGEYLGQTPQTSTGIPCSRWHDGV
FT                   LEDKTKIAQKDNIRLAFFWGQSVNTETRGREVREALNKMDTVVVVDPFPTMAGVMHQRQ
FT                   DGVYLLPAATQFETYGSISATNRSVQWRSKVIEPLFESLPDHVIMCKLAKKVGIDKELF
FT                   KQIKVNGDEPLIEDITREFNKGMWTIGYTGQSPERLKMHQENWGTFDADSLEAPGGPAK
FT                   GETYGLPWPCWGTPEMKHPGTQILYNEAKHVKDGGGNFRARYGVEHEGNNILAEGTYSK
FT                   GSEIQDGYPEFTADMLKQLGWWDDLTADEKKHAEGKNWKTDISGGIQRVAIKHGCIPYG
FT                   NAKARCIVWTFPDDIPRHREPLYTPRRDLVAKYPTYEDRMVARLPTLYKSIQDKDFAKD
FT                   FPLALTSGRLVEYEGGGEESRSNPWLAELQQEMFIEMNPADAADRGIRDGDNVFVHGPE
FT                   GAKITVKAMVTPRVIAGECFMPYHFAGVFEGESLAKNYPEGTVPYVIGESANTILTYGY
FT                   DVVTQMQETKSSLCQISKA"
FT   sig_peptide     complement(365929..366087)
FT                   /locus_tag="Sputcn32_0337"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.931) with cleavage site probability 0.917 at
FT                   residue 53"
FT   gene            complement(366106..366336)
FT                   /locus_tag="Sputcn32_0338"
FT   CDS_pept        complement(366106..366336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74070"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y287"
FT                   /protein_id="ABP74070.1"
FT                   /translation="MPLYSVTQGDTMKKQASDMGRRQLLKALALGSAAGAVATVSGQAL
FT                   AAAPTVEPIEPKSENYRETDHIRHYYASLKN"
FT   sig_peptide     complement(366196..366336)
FT                   /locus_tag="Sputcn32_0338"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.997 at
FT                   residue 47"
FT   gene            complement(366463..367140)
FT                   /locus_tag="Sputcn32_0339"
FT   CDS_pept        complement(366463..367140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0339"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: shm:Shewmr7_3789 cytoplasmic chaperone TorD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74071"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y288"
FT                   /protein_id="ABP74071.1"
FT                   /translation="MTESVRQVSENDQLRADIYQLLAALLRRHPSPELLHFLANLEIDA
FT                   NEDNAMTKAWLSLQLAAQQFSSEQLEDEYFALFLGVGCGEILPYGSWFMTGSLMDKPLA
FT                   LLRQDLMQLGFEREENVKEPEDHVAALCEVMGTLILEAPGYRQLAFYQRHIGSWISRFC
FT                   DNLTKAPSAAFYATVAQLAKAFFEMEANAFEQLSLDIPVNCPGSADLQPATNDAEKQVE
FT                   LVN"
FT   gene            complement(367151..368812)
FT                   /locus_tag="Sputcn32_0340"
FT   CDS_pept        complement(367151..368812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0340"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: son:SO4506 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74072"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y289"
FT                   /protein_id="ABP74072.1"
FT                   /translation="MTNQTQHALKQARQNVLAQTQILQNLIPPTVSYTTEGTVLIIGPE
FT                   DLARLAADKLSTMANRVILANEAITSQDEAHLERVMAAATNVESYYNKLIGIKGFLGQF
FT                   QVSVEHQNGAAELSLVSIRKPHFDLVLDLSSTPCLNLEMLPPGYFYVGQDTAKLEDALT
FT                   QIPELVGQFDKPRYVKINPDLCAHNRNDINGCNRCLNFCPADAISSVAKKIEIDPYLCH
FT                   GAGSCTSACPTGAISYDLPTPQALSSYLNKIISRFREQAQTAPVILFHDNATGADFISE
FT                   DLAGDILPVALEEITVASLDHWLSALAWGARQVLILNTEATAPTLTQMLKGELTLANSI
FT                   LDEMGQPQRISLIDPSMITHLESMLDISLDWPIIVPAAFVSTTKRDTLFEAIDHLNSQA
FT                   GEIDTCLSMNNIPYGKVSVNVEKCTLCMSCVAICPTMSLQDGGDKPALHFIEQNCVQCG
FT                   LCEAACPEKVISLTPQINFDKAARQQQNTLKEEAPFECIRCGSPFATQSMVHRMLDMVG
FT                   AHSAFSANIERLKMCGDCRVKDMFEDILQDPEKQLR"
FT   gene            complement(369000..369656)
FT                   /locus_tag="Sputcn32_0341"
FT   CDS_pept        complement(369000..369656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74073"
FT                   /db_xref="InterPro:IPR021735"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y290"
FT                   /protein_id="ABP74073.1"
FT                   /translation="MADNTQKISGLFSRWTQRREQVAAEEALETKKIQDVIEDVPSDTE
FT                   VASTNATTASPSPEIEHQSQEDPNRILTAEDLPNPEEIEIGGSFASFMAANVDPAVKTA
FT                   ALRALWKQPHFNEIDGLLEYALDYSNQTKLTPEVSAELAKKVFRYMTKDNEDSDEEATL
FT                   VKNELNAIPETAMGSDNEIETELAAKPLTDNLDGEIDDLPQNAPELSAQVHPRVV"
FT   gene            complement(369656..370120)
FT                   /locus_tag="Sputcn32_0342"
FT   CDS_pept        complement(369656..370120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74074"
FT                   /db_xref="InterPro:IPR021736"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y291"
FT                   /protein_id="ABP74074.1"
FT                   /translation="MQHTTSVWPMYVSLKKVETHVGRWTSVKWEIDHLLPATHEAPEGA
FT                   TLVLLELHKDERASYRINLDMDNAMLFLVCDEMADGTWVPALLSADQNVAAGCLEGNTP
FT                   VLNILMPEAIACWIEAFITQYGEVEISAHRRRHVDGRNNQGPSSDPLRRN"
FT   gene            370426..371322
FT                   /locus_tag="Sputcn32_0343"
FT   CDS_pept        370426..371322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0343"
FT                   /product="formate dehydrogenase, subunit FdhD"
FT                   /note="PFAM: formate dehydrogenase, subunit FdhD; KEGG:
FT                   she:Shewmr4_3714 formate dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74075"
FT                   /db_xref="GOA:A4Y292"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y292"
FT                   /protein_id="ABP74075.1"
FT                   /translation="MISDNSTITAKSSIATNTNLQIKHPFTFVKTQAEVPLTIAVKAVN
FT                   EAGEVLDKFVACERPLTVYLNWRPIVTLMTLGAKPESLALGYLKNQGFISDVSLLDSVI
FT                   VDWDVNSAAVITREQIADLDGKLSEKTVTSGCGQGTVYGSFMQDLEGITLPTPSLKQST
FT                   LYSLLKNINEYNETYKNAGAVHGCGLCEDDQIMAFVEDVGRHNAVDTLAGDMWLGQNPG
FT                   DNKIFYTTGRLTSEMVIKVAKMGIPVLLSRSGVTQMGLELAQQLGITIIARAKGRHFLV
FT                   YHGSENLQFDVNSDPVT"
FT   gene            371385..372290
FT                   /locus_tag="Sputcn32_0344"
FT   CDS_pept        371385..372290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0344"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   KEGG: she:Shewmr4_3713 DNA binding domain, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74076"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y293"
FT                   /protein_id="ABP74076.1"
FT                   /translation="MTSASELVYMSAKQVAEYLDLNEKKVYAMANDRILPATKITGKWL
FT                   FPKVLIDRWVMDSCHSGMLTDRLLITGSDDPLLSMLVARLMSQVGSRELISYSATGSRL
FT                   GLELLAKGYADVCTLHWGSMEDRNIRHPALLKGYNNHQQWIMVHGYSRQQGLIMRADMH
FT                   HRCQEEDKVVSLPWRWVSRQGGAGSQQHLEHWLLKQGARLDQLNVLLTAYSERELAGYI
FT                   ARGDADIGFGCQSVALESGLSFVPLVKESFDFVMPQSIYFRRQLQQLFTMLSSCHTRQM
FT                   AALLGGYDLTDCGQLLWSAS"
FT   gene            373088..374622
FT                   /locus_tag="Sputcn32_R0005"
FT   rRNA            373088..374622
FT                   /locus_tag="Sputcn32_R0005"
FT                   /product="16S ribosomal RNA"
FT   gene            374951..377843
FT                   /locus_tag="Sputcn32_R0006"
FT   rRNA            374951..377843
FT                   /locus_tag="Sputcn32_R0006"
FT                   /product="23S ribosomal RNA"
FT   gene            378074..378189
FT                   /locus_tag="Sputcn32_R0007"
FT   rRNA            378074..378189
FT                   /locus_tag="Sputcn32_R0007"
FT                   /product="5S ribosomal RNA"
FT   gene            378226..378302
FT                   /locus_tag="Sputcn32_R0008"
FT   tRNA            378226..378302
FT                   /locus_tag="Sputcn32_R0008"
FT                   /product="tRNA-Asp"
FT   gene            378641..379153
FT                   /locus_tag="Sputcn32_0345"
FT   CDS_pept        378641..379153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74077"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y294"
FT                   /protein_id="ABP74077.1"
FT                   /translation="MLYDLTVVQFSKMLKNLSVILEKGECFANLKKVDMAVLLNSRLAP
FT                   DQFNLIRQVQIACDTAKIGVARLTDNLDTVPKHDDSETTLAELQARISSVLDYLATFKA
FT                   EDFANAAAIHVSQPRWEGKYLTGYEFAIEHAIPNIYFHITTAYAILRHNGVEIGKKDYL
FT                   GAMPYKS"
FT   gene            379564..379773
FT                   /locus_tag="Sputcn32_0346"
FT   CDS_pept        379564..379773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74078"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y295"
FT                   /protein_id="ABP74078.1"
FT                   /translation="MSIESHVIESPTGVTVTDLPMKSKKAKKVAIASGLRIKDKLTQDT
FT                   RRRIEILHEQRQLSNRFGVDIEID"
FT   gene            380239..381642
FT                   /locus_tag="Sputcn32_0347"
FT   CDS_pept        380239..381642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0347"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; KEGG: bsu:BG12951 similar to
FT                   2-oxoglutarate/malate translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74079"
FT                   /db_xref="GOA:A4Y296"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y296"
FT                   /protein_id="ABP74079.1"
FT                   /translation="MNKKIISWLIILAVGGGIWLTPVPAGVDPTAWHLLAIFAATVLGL
FT                   ILEPIPMGAVAIGGITITALTGTLTIKDSLTGFSNDVIWLIVTAFFISRAFIKSGLGAR
FT                   IGFVFMRLLGKKTLSLSYGLLLTDLILAPAIPSNTARTGGIVFPLANSVADAYGSKAEE
FT                   GTSGKLGSFLMTTVFHGTTITGAMFLTGMAANPLAAKLAADMGVEITWGQWALAALVPG
FT                   IIALILMPLFAYMLNKPSITSTPQAPQIAAKALADMGKMKLTEWVTLGTFIALIALWIG
FT                   GPALGVSGTTAAMVGLIILVTANVLSWDDVLKEKGAWNTLVWFSALVMMATFLNKLGLI
FT                   TWFGTNIATNLSGLDWPVALFSLVLIYFYIHYAFASATAHVAALYSVFLAVAIQLGAPG
FT                   LLAALIFGFTSNLYACGTHYGTGPAPILFGAGHVSLPKWWSVGFAMGLLQIAIWTLVGG
FT                   IWWKVIGLY"
FT   sig_peptide     380239..380322
FT                   /locus_tag="Sputcn32_0347"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.831 at
FT                   residue 28"
FT   gene            381710..383218
FT                   /locus_tag="Sputcn32_0348"
FT   CDS_pept        381710..383218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0348"
FT                   /product="fumarase"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyases, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; hydro-lyases, Fe-S type,
FT                   tartrate/fumarate subfamily, beta subunit; PFAM: Fe-S type
FT                   hydro-lyases tartrate/fumarate alpha region; Fe-S type
FT                   hydro-lyases tartrate/fumarate beta region; KEGG:
FT                   ppr:PBPRA2409 putative fumarate hydratase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74080"
FT                   /db_xref="GOA:A4Y297"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y297"
FT                   /protein_id="ABP74080.1"
FT                   /translation="MTTIKKVDFIDSIEDALQYISYYHPLDFIRAMEKAYHAEKSVAAK
FT                   DAIAQILINSRMAAEGKRPICQDTGIVTCFVKIGMQVQWDTDMTVQEMVDEGTKRAYNC
FT                   VTNPLRMSVVSDPAGARKNTNTNGPAVVHIEMVLGDKVDIMIAAKGGGSENKTKMAMLN
FT                   PSDDIAAWVEKTVPLMGAGWCPPGMLGIGIGGTAEKAALMAKEALMGSVDIHELQARGA
FT                   QTTEEELRLDIFERVNKLGIGAQGLGGMTTVVDIKIKTAPTHAASKPVCIIPNCAATRH
FT                   VHFTLDGNGPAKLTPPKLADWPEVTWEVGKNVRRVDVNKLTKADIAEWRSGETVLLSGK
FT                   ILTGRDAAHKRIQDMLARGESFPVDFQNRFIYYVGPVDAVGDEVVGPAGPTTSTRMDKF
FT                   TDMMLEQAGLMGMIGKSERGAATVESIKKNQAVYLMAVGGAAYLVAKAIKSAKILAFED
FT                   LGMEAIYEFDVEDMPVTVAVDSLGGNVHETGPQTWKLKIAEMTA"
FT   gene            complement(383302..383979)
FT                   /locus_tag="Sputcn32_0349"
FT   CDS_pept        complement(383302..383979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0349"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: vpa:VP1711 response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74081"
FT                   /db_xref="GOA:A4Y298"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y298"
FT                   /protein_id="ABP74081.1"
FT                   /translation="MIIEDDPKASYALESIIHQHPDFEVVVVSETYQDALMHYDLYKPQ
FT                   LVFVDITLPDGSGINVIKQLRSQGANCYFIMTTAEREATTVEQVVQLGVSDYLVKPLRM
FT                   SRVRQALDDYKLYRQKLACHETMDQCVIDHILGKRTNLPMRRTPKGIDANTLDTLKDIL
FT                   RKEQLTEFSGDDISDRMNVSRITIRRYLEYLESEGVIKMVLNYKTGGRPSRVYQLIDVD
FT                   LLG"
FT   gene            complement(383969..385636)
FT                   /locus_tag="Sputcn32_0350"
FT   CDS_pept        complement(383969..385636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0350"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; KEGG: bld:BLi01245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74082"
FT                   /db_xref="GOA:A4Y299"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y299"
FT                   /protein_id="ABP74082.1"
FT                   /translation="MLSTNKRFDLVKPMKFKKHLFTSIFMAMVLILTIMVAATFHLLKS
FT                   THDESLKQRGLELASILALDPVVIDAVERANVTPEVSIRSYIENLRAQTSVSFIVVVNK
FT                   EGIRLSHPEESKLHHPFVGDDLKPVLSEGIKVSTFAEGSLGPAIRSFSPVMSNGKVIGA
FT                   VAVGILTKEVSLLFLQSHANLLFVVILVLTIAVLLIIVVLSKLKRTMQYLEPELVMKRL
FT                   MEHDRIFNAIHDPIISVSNDFTISAINDIATQVLPMGSMSKQDYIGQPLAHFSAALSQI
FT                   TKASHREASSERLRLGKLDYRVCIYPWQINQEQHGYVIIFLADMELNDLRKELLHYKNY
FT                   SEQLRSKTHEYSNKLNVLSGMLQLKHYDEVIEFIDRESKGHQRIIGNIVRSIHNSLVAS
FT                   ILLAKYNKATETNVKYVLDEDNNLLNYSKLVSEKLATILGNLIDNAIVAAWNNRSNVPP
FT                   EVQVYVSDRSQHIILEVQDSGSGVIPEIADTIFDFGVTSKTDQEQSGIGLYLVNELVKQ
FT                   FSGSLDWERTEDNTTLFSIYIEKSEVKRYEAESHHHDY"
FT   sig_peptide     complement(385502..385636)
FT                   /locus_tag="Sputcn32_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.350 at
FT                   residue 45"
FT   gene            complement(385820..386185)
FT                   /locus_tag="Sputcn32_0351"
FT   CDS_pept        complement(385820..386185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0351"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: fumarate reductase, D subunit; KEGG:
FT                   vfi:VF2337 fumarate reductase, 13 kDa hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74083"
FT                   /db_xref="GOA:A4Y2A0"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2A0"
FT                   /protein_id="ABP74083.1"
FT                   /translation="MINYSPKRSDEPIWWGLFGAGGVWFAMITPVTVLLMGILLPLHGF
FT                   GVVDIGYDKVYAFVSHPIGGAFTVLSLSLPMWHAMHRVHHGLHDLQIHLGTVGKYACYL
FT                   AAALVTVLATVWVIQLS"
FT   gene            complement(386198..386581)
FT                   /locus_tag="Sputcn32_0352"
FT   CDS_pept        complement(386198..386581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0352"
FT                   /product="fumarate reductase, subunit C"
FT                   /note="PFAM: fumarate reductase, subunit C; KEGG:
FT                   vch:VC2658 fumarate reductase, 15 kDa hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74084"
FT                   /db_xref="GOA:A4Y2A1"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2A1"
FT                   /protein_id="ABP74084.1"
FT                   /translation="MQNRKPYVRPMQRTWWSENNFFSWYMVRELTIVPLILFTLNLCAG
FT                   LFALVSSSDAWNNWLYFSSHPVMLLINVLALIGALYHAKTFFSMMPQVMPIKLGEKVVP
FT                   TGVIVTVQWLLLVLVSLVAIACI"
FT   gene            complement(386583..387323)
FT                   /locus_tag="Sputcn32_0353"
FT   CDS_pept        complement(386583..387323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0353"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: vpa:VP2841 fumarate reductase, iron-sulfur
FT                   protein; TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74085"
FT                   /db_xref="GOA:A4Y2A2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2A2"
FT                   /protein_id="ABP74085.1"
FT                   /translation="MTEHNIQTVNILRYDPERDNEPFLETFKVPADNTTSIQDALTYIK
FT                   DHMDKSLSYRWSCRMAICGSCGVMVNKVPKLACKTFLRDYPEGITLEPLANFAIEKDLV
FT                   VDKAPFLERLEAMKPYIIGNDRKPEDGPNRQTPAQMAKYKQFAGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDSRDLGKVERMKLINGKDGAWGCTFVGYCSKVCPKHVDPA
FT                   AAVNQSKVESAKDFLINMITTKEA"
FT   gene            complement(387323..389098)
FT                   /locus_tag="Sputcn32_0354"
FT   CDS_pept        complement(387323..389098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0354"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: vfi:VF2334 fumarate reductase flavoprotein
FT                   subunit; TIGRFAM: fumarate reductase, flavoprotein subunit;
FT                   succinate dehydrogenase or fumarate reductase, flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74086"
FT                   /db_xref="GOA:A4Y2A3"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2A3"
FT                   /protein_id="ABP74086.1"
FT                   /translation="MKTITTDVAVIGAGGAGLRAAIAAAEANPKLSIALISKVYPMRSH
FT                   TVAAEGGSAAVIKDEDSLDNHFNDTVAGGDWLCEQDVVEYFVENALREMTQLELWGCPW
FT                   SRKPNGEINVRRFGGMKIERTWFAADKTGFHMLHTLFQTSMKYSNIVRYDEFFVLDLIV
FT                   VDNEVQGVIALCIAEGELVCFKAKSVILATGGGGRVYHFNTNGGIVTGDGMAIAYRHGV
FT                   PLRDMEFVQYHPTGLPGTGILMTEGCRGEGGIMVNKDGYRYLQDYGLGPETPVGQPQNK
FT                   YMELGPRDKVSQAFWHEQRKGNTIKHPLGDVVHLDLRHLGEDYLKERLPFICELAKAYV
FT                   NVDPAKEPIPIRPTAHYTMGGLETDPQTETQIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRLAGETAAKRAAEFQGWNYDAINEQAAAVEARLDALLAQKGTENWSDVRTEMCK
FT                   SMESGCGIYRDEAGMQATIDKLAELRLRYKNIQITDKGKVFNTDLLYAIEVGFSLDVAE
FT                   AMAHSAIQRRESRGAHQRLDEGCNSRNDKDYLKHSLALYNPNSVPTIKYSEVKITKSQP
FT                   QARLYGDAAKQQEKV"
FT   sig_peptide     complement(389027..389098)
FT                   /locus_tag="Sputcn32_0354"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.411 at
FT                   residue 24"
FT   gene            complement(389401..389970)
FT                   /locus_tag="Sputcn32_0355"
FT   CDS_pept        complement(389401..389970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0355"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   son:SO4489 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74087"
FT                   /db_xref="GOA:A4Y2A4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2A4"
FT                   /protein_id="ABP74087.1"
FT                   /translation="MTTEFMRANRGYNLPIHPLFPINLEIYMKVIDLKSAPQHIPQLAE
FT                   WHHQAWAHLSSADASVTTLIEEMNEYLTDAAMPKMFICEQANQVMGSSSLIVADMDSRT
FT                   DLSPWLANVYVNANHRNKGLGKLLVNAVIEHARAIGLQKIYLFTADKADFYQALGWSMI
FT                   SQENYKGEMVTIMEYQLMPQGDSSTN"
FT   gene            complement(389991..391307)
FT                   /locus_tag="Sputcn32_0356"
FT   CDS_pept        complement(389991..391307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0356"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; KEGG: son:SO4488 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74088"
FT                   /db_xref="GOA:A4Y2A5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2A5"
FT                   /protein_id="ABP74088.1"
FT                   /translation="MYSLKGYLTRNLLITLTFAMVLLLYFLYQGIQILTQDFVASRLQH
FT                   DADSLISALNHNPDGTWALTTDRLPNVYHRVNSGHYFAIQIGEQTLRSRSLFDHNVNMP
FT                   KLTAGEQHQATEFVSKEHWLMFSQAVIKDDQLVTLWVTEDISSLEQTQVQFLAFASAAV
FT                   LLTIVILLIAQYQLLKRGFKPLEQMPEAIRQMRTQGQEINPDQVPSEIVPLIEEIDRLV
FT                   NQLGQRVQRSRNALGNLAHEMKRPLQGLQSYLESLPLEQRSEGSKVLANLHHIIERELK
FT                   RTKIVGLSTPGRYTVLDDDLAPLIQVMQRIYPDRIIHSHYASGLVMPFDRDDLLELLGN
FT                   LLDNACKHSRKNIEIHISQQNVPATGYGIEVSDDGEGVSDAALSVIIERGIRLDESIQG
FT                   HGLGLSICKDIVDSYQGELSFSHAKQGGLKASVFLPLPS"
FT   gene            complement(391312..391971)
FT                   /locus_tag="Sputcn32_0357"
FT   CDS_pept        complement(391312..391971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0357"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4487 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74089"
FT                   /db_xref="GOA:A4Y2A6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2A6"
FT                   /protein_id="ABP74089.1"
FT                   /translation="MRLLLIEDDTDLVARLIPALNEAGYTVEHADNGIDGAFLGEEENF
FT                   EAVILDLGLPGKPGLQVLGQWRQKGLAMPVLILTARDAWHERVDGLKAGADDYLGKPFH
FT                   IEELLARLEVLIRRHFGRADNVLQHAGVSLDVDKQAVTNVDGEVIELTKIEYRLLHYLM
FT                   VNPSKIVSKSELSERIYEEDQIKDSNVIEVYVNRLRQRLGKDYIETRRGQGYRLKE"
FT   gene            complement(391971..392237)
FT                   /locus_tag="Sputcn32_0358"
FT   CDS_pept        complement(391971..392237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0358"
FT                   /product="Propeptide, PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide, PepSY amd peptidase M4; KEGG:
FT                   shm:Shewmr7_3780 propeptide, PepSY amd peptidase M4"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74090"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2A7"
FT                   /protein_id="ABP74090.1"
FT                   /translation="MISSPSTDAHDDDLSSKVVEWVKEGKVLPFDTIMQRYESRLQGRL
FT                   LDLEVEQKHGRIIYELEILREDGIVYEIKIDAKTGERLKEKVD"
FT   gene            complement(392230..392793)
FT                   /locus_tag="Sputcn32_0359"
FT   CDS_pept        complement(392230..392793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0359"
FT                   /product="diheme cytochrome c"
FT                   /note="KEGG: son:SO4485 diheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74091"
FT                   /db_xref="GOA:A4Y2A8"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2A8"
FT                   /protein_id="ABP74091.1"
FT                   /translation="MTQQAHPISWLLGSSLTAAALAIGVIGISLTLTGTGYADDGRELS
FT                   RAIPQNAEYTAECGSCHMAYPANLLPADKWRAITANLENHFGDNASVEPQATARIEEYL
FT                   VQHAAQNGKVMKNSTPLLAGMGPQKITEQAFFIGKHDEIPRRMVQDNPKVGSFSQCSNC
FT                   HNLAEKGIFDEDTVNIPGFGRWDD"
FT   sig_peptide     complement(392677..392793)
FT                   /locus_tag="Sputcn32_0359"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.595 at
FT                   residue 39"
FT   gene            complement(392884..393330)
FT                   /locus_tag="Sputcn32_0360"
FT   CDS_pept        complement(392884..393330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0360"
FT                   /product="cytochrome c-type protein Shp"
FT                   /note="KEGG: shm:Shewmr7_3778 cytochrome c-type protein
FT                   Shp"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74092"
FT                   /db_xref="GOA:A4Y2A9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015170"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2A9"
FT                   /protein_id="ABP74092.1"
FT                   /translation="MNRLTRHTNKSRLVIIAISTLLLTNLSVSAANSKVPSLPLSAERI
FT                   GTQLQRYQAQGAGPFTAAAGQKLWLQDMDGRSCASCHTAKVTDMGMHQNTRKPIDPMAP
FT                   SITADRLTDSAKIEKWFTRNCNWTFKRDCTPQEKGDALLWLSLQ"
FT   sig_peptide     complement(393238..393330)
FT                   /locus_tag="Sputcn32_0360"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.969 at
FT                   residue 31"
FT   gene            complement(393384..393971)
FT                   /locus_tag="Sputcn32_0361"
FT   CDS_pept        complement(393384..393971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0361"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: she:Shewmr4_0244
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74093"
FT                   /db_xref="GOA:A4Y2B0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2B0"
FT                   /protein_id="ABP74093.1"
FT                   /translation="MSSNTLQTIKVWDLLIRIFHWSLVGFFALAYLTEGEDEWMTIHSY
FT                   AGYSILILLVFRLLWGVVGTHNARFSNFITRPKEVLVYLKRLITGKAKDYIGHNPAGAM
FT                   MIVALIASIAITGFSGMALYATDGYCPLATSFFATWPEGALKEVHEFFANFTVFLVVIH
FT                   VGGVIVSSLLHKENLVRAMVTGKKQRPVEQED"
FT   gene            394188..394652
FT                   /locus_tag="Sputcn32_0362"
FT   CDS_pept        394188..394652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0245 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74094"
FT                   /db_xref="GOA:A4Y2B1"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2B1"
FT                   /protein_id="ABP74094.1"
FT                   /translation="MSAAVIRAFISRNPSRKSFCIYAVLLFLTEVLIALYAPAGFIRGF
FT                   VGDVLVVILLFCMVRAVVPVDSPAEKSLAQNTGEGMKRFFQTPWLAFSVLLFAFAIEFG
FT                   QYWGLVDKLGLGGNRLARIVIGSHFDPLDLVAYFVGYLILLGCYWKSRQS"
FT   gene            394733..395236
FT                   /locus_tag="Sputcn32_0363"
FT   CDS_pept        394733..395236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74095"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2B2"
FT                   /protein_id="ABP74095.1"
FT                   /translation="MQPITGFSLLTEHTDGLEPNPLKMPLYFNGQPTHTFIAGLVIEGQ
FT                   YRCVLPNKTSGYLVITSFDCPFEESTEFSLLDEGFKLIATTSLAQMYDSFLLYAHWPMA
FT                   DNRLRLHYYGQFVLDLVMTTGSSWLTFQPKLKLVEVVDPQSDPQTASSLAELAQRLARI
FT                   DNIN"
FT   gene            complement(395402..396922)
FT                   /locus_tag="Sputcn32_0364"
FT   CDS_pept        complement(395402..396922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0364"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: son:SO4480
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74096"
FT                   /db_xref="GOA:A4Y2B3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2B3"
FT                   /protein_id="ABP74096.1"
FT                   /translation="MIYAQPGTAGAIVNFKEKYANFIGGKWIAPVNGKYFDNRSPVNGQ
FT                   NFCQIPRSDAQDIELALDAAHAAKDAWGKTSVTERSNLLLRIADRVEQNLEYLAVAETW
FT                   ENGKAVRETLNADLPLFVDHFRYFAGCIRAQEGSAADIDGNTVSYHFPEPLGVVGQIIP
FT                   WNFPLLMAAWKIAPALAAGNCVVLKPAEQTPVSILVLLELIEDLLPAGILNVVNGFGAE
FT                   AGQALATSKRIAKLAFTGSTEIGYHILKCAAESLIPSTVELGGKSPNVFFADVMDHEDE
FT                   YLNKAVEGMLLAFFNQGEVCTCPSRVLVQESIFDRFIEKVLARAQTIKQGDPLDTDTQV
FT                   GAQASKEQFDKILSYLAIGKAEGAEVLLGGTLCQLDGGQSEGYYISPTIMKGHNKMRIF
FT                   QEEIFGPVISVTTFKDEAEALAIANDTEYGLGAGVWTRDMNTAQRMGRGIQAGRVWINC
FT                   YHAYPAHAAFGGYKKSGIGRETHKMMLNHYQNTKNLLVSYDVNPLGFF"
FT   gene            397183..399084
FT                   /locus_tag="Sputcn32_0365"
FT   CDS_pept        397183..399084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0365"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: shm:Shewmr7_3771 GAF modulated
FT                   sigma54 specific transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74097"
FT                   /db_xref="GOA:A4Y2B4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2B4"
FT                   /protein_id="ABP74097.1"
FT                   /translation="MTVKPHLPSTQAWLADSWQRSIGAGLSEFQLPQDLRLDASELKQK
FT                   HEQYQMLIALVQSHALPLFNQLMVHSNSRLLLSDAEGYVLKHWGVSRYSTKLADVALDI
FT                   GVNWLEQHKGTNAIGTALTAKQAVSVVGEQHFIRQNRFMSCTACPIFSPQGEMLGVIDI
FT                   TSEQQRHTQQTLMLVSSLAQQVETALLCHLPDSHYRIDLAAQPNLLNSGWQGIVIADSD
FT                   GRIVGCNPMAKQLLNHAKVGDAVEQYLGDNWSRVGGFNQHLALHLQTQSLNIPSAKGRV
FT                   AISNKSLNQLGVRFRDPQLERAWQHANKVITKQIPLLVLGETGVGKEQFVKKLHAQSAR
FT                   RTEPLVAVNCAALPAELVESELFGYQAGAFTGANRTGFIGKIRQAHGGFLFLDEIGEMP
FT                   LAAQSRLLRVLQEREVVPVGSNQSFKVDIQIIAATHMDLEKQVAQGLFRQDLFYRLNGL
FT                   QVRLPALRERQDIERIIHKLHRKHRIAAQDICPELLGKMMQYDWPGNLRELDNLMQVAC
FT                   LMAEGDNTLNWQHLPDYLAAKLTCEPLKGDLLQAASLCEEFKEVSGQPSASPLPSAKFA
FT                   VEPNVTKVQSDSLNEAIYSNVQQAFQACNGNVSQCAKRLGISRNALYRKLKQMGLKA"
FT   gene            complement(399127..400476)
FT                   /locus_tag="Sputcn32_0366"
FT   CDS_pept        complement(399127..400476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0366"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: son:SO4478 sensor protein CpxA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74098"
FT                   /db_xref="GOA:A4Y2B5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2B5"
FT                   /protein_id="ABP74098.1"
FT                   /translation="MPNRLFIKLLLGFWLCSSLIIALVGLLPLLQQKHDRAPIPPHLEN
FT                   ALSNIAIRFQENPSLFESDFLRRWERQRNMEGKPLRIYLANSEGQVINTQKISRGVRSF
FT                   MLMTDEDKRPISHQFKDELVFGPYHFNVNGETYSLYGRLPDHHPRPWFFFFVENKLLTL
FT                   SLAILLSGLLCGLLAWHLGKALNSLKKSANALAEGDLSNRVDKATTKRNDEIGQLASAF
FT                   NSMADSIETMVKNQQRLMGDISHELRTPLTRLQLSLALARKKGQQTTETDRIGYEAEQL
FT                   EKLIAELLELSRVKLNTNETKVRLGLAESLSQVLDDAEFEADQQDKKITIDIDEDIELA
FT                   HFPKSLSRAIENLLRNAIRYAKNDIYIHASATADEVYITIKDDGPGIDASELDAIFKPF
FT                   YRPDSARQRESGGWGLGLAITEAAITAHKGKIKAKNRVPHGLEVNITLPV"
FT   sig_peptide     complement(400375..400476)
FT                   /locus_tag="Sputcn32_0366"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.851) with cleavage site probability 0.391 at
FT                   residue 34"
FT   gene            complement(400491..401177)
FT                   /locus_tag="Sputcn32_0367"
FT   CDS_pept        complement(400491..401177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0367"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4477 transcriptional
FT                   regulatory protein CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74099"
FT                   /db_xref="GOA:A4Y2B6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2B6"
FT                   /protein_id="ABP74099.1"
FT                   /translation="MSRILLIDDDLGLSELLGQLLELEGFTLTLAYDGKKGLDLALTTD
FT                   FDLILLDVMLPKLNGFEVLRALRQHKQTPVLMLTARGDEIDRVVGLEIGADDYLPKPFN
FT                   DRELIARIRAIIRRAHLTAQEIHAAPAQEFGDLRLDPSRQEAYCNEQLIILTGTEFTLL
FT                   HTLALHAGELMNKEELNEIVLGKKLMPFDRSLDMHLSNLRKKLPERSDGRPRVKTIRGK
FT                   GYIWLP"
FT   gene            401444..401935
FT                   /locus_tag="Sputcn32_0368"
FT   CDS_pept        401444..401935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0368"
FT                   /product="protein of unknown function, Spy-related"
FT                   /note="PFAM: protein of unknown function, Spy-related;
FT                   KEGG: she:Shewmr4_0253 protein of unknown function,
FT                   Spy-related"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74100"
FT                   /db_xref="GOA:A4Y2B7"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2B7"
FT                   /protein_id="ABP74100.1"
FT                   /translation="MMKTLSPLKAGLFAILASSTVFATTVSAESTQGCDHSRGEFHKKG
FT                   NRMEHGGMHKMFEGLDLTDAQKADIKKLFAEQKASRSDERPTKEELLAHRNEMQAVITA
FT                   ATFDETQAKALLNARQDKRQAQAIERMKIQNQIYNLLTPEQQAKFKARFEAQAGKEPRG
FT                   "
FT   sig_peptide     401444..401530
FT                   /locus_tag="Sputcn32_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.937 at
FT                   residue 29"
FT   gene            401986..402867
FT                   /locus_tag="Sputcn32_0369"
FT   CDS_pept        401986..402867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0369"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   shm:Shewmr7_3767 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74101"
FT                   /db_xref="GOA:A4Y2B8"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2B8"
FT                   /protein_id="ABP74101.1"
FT                   /translation="MTQTSQYDFWVKLASRASVATALTLIIIKLLAWLYSGSASMLASL
FT                   TDSFADALASIVNFIAIRYAIVPADQDHRYGHGKAEPLASLAQSAFIMGSAFLLLFYGG
FT                   ERLITPAPVEYATLGVVVSVVAIALTLALVMLQKRALAATNSTVVEADSLHYKSDLFLN
FT                   AAVLLALVLSQYGWWWADGLFAVLIAFYIGHQAFGLGYRSIQALLDRELDEETRQQIKQ
FT                   IAKEDPRVQGLHDLRTRQAGKTVFIQFHLELDGNLSLNEAHSIADTTGLRVKAAFEDAE
FT                   VIIHQDPVKLEE"
FT   gene            402886..403347
FT                   /locus_tag="Sputcn32_0370"
FT   CDS_pept        402886..403347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74102"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2B9"
FT                   /protein_id="ABP74102.1"
FT                   /translation="MMAWMQKQSHRLDYSTKLICRYHWLSTRFELIAESLLNDVSDPED
FT                   AALTTLAENLPMIPIPIQVDRAASPAIKRAWSQLVLRKHLYYLPQKIDINIANQSYRVH
FT                   IWPLFLWRTRITCVATGRVVVSECLDVRRRRSLIRWLYASFIGLLRVLS"
FT   gene            complement(403434..404846)
FT                   /locus_tag="Sputcn32_0371"
FT   CDS_pept        complement(403434..404846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0371"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis family"
FT                   /note="KEGG: shm:Shewmr7_3764 nitrogen metabolism
FT                   transcriptional regulator, NtrC, fis family; TIGRFAM:
FT                   nitrogen regulation protein NR(I); PFAM: response regulator
FT                   receiver; sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74103"
FT                   /db_xref="GOA:A4Y2C0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2C0"
FT                   /protein_id="ABP74103.1"
FT                   /translation="MRISEQVWILDDDSSIRWVLEKALQGAKLSTASFAAAESLWQALE
FT                   ISQPRVIVSDIRMPGTDGLSLLERLQIHYPHIPVIIMTAHSDLDSAVSAYQAGAFEYLP
FT                   KPFDIDEAISLVERALTHATEQSPAPVQETQVKTPEIIGEAPAMQEVFRAIGRLSRSSI
FT                   SVLINGQSGTGKELVAGALHKHSPRKDKPFIALNMAAIPKDLIESELFGHEKGAFTGAA
FT                   NVRQGRFEQANGGTLFLDEIGDMPLDVQTRLLRVLADGQFYRVGGHNAVQVDVRIIAAT
FT                   HQDLELLVQKGGFREDLFHRLNVIRVHLPPLSQRREDIPQLATHFLASAAKEIGVEPKI
FT                   LTKETAAKLSQLPWPGNVRQLENTCRWLTVMASGQEILPQDLPPELLKDPVSITHATKV
FT                   GQDWQSALTEWIDQKLSEGNSDLLTEVQPAFERILLETALRHTQGHKQEAAKRLGWGRN
FT                   TLTRKLKELSMD"
FT   gene            complement(404884..405930)
FT                   /locus_tag="Sputcn32_0372"
FT   CDS_pept        complement(404884..405930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0372"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; PAS fold-4 domain protein; KEGG: shm:Shewmr7_3763
FT                   signal transduction histidine kinase, nitrogen specific,
FT                   NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74104"
FT                   /db_xref="GOA:A4Y2C1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2C1"
FT                   /protein_id="ABP74104.1"
FT                   /translation="MDKETLLNHLVTAVLVIDKDLKPCYANAAAEQLLGVGSHRLIEQA
FT                   LPAHYQILGIDTQLLSSAVKASQGLTVNTTTLVTLDGQHHTVDLTLVPLEDEAELSLLE
FT                   LRQVDQQRRIHQQLSQDAQQQAAQFLVRNLAHEIKNPLGGLRGAAQLLSRELDDPAQKE
FT                   FTTLIIEQADRLRNLVDRLLGPQRPTQHSLHNIHKVVQKVYKLVEMALPANIQLKRDYD
FT                   PSIPDIEMDPDQMQQAVLNILQNAVQALEHTGGEILIRTRTQHQVTIGSQRHKLVLTLS
FT                   IIDNGPGIPPELMDTLFYPMVTSREQGSGLGLSIAHNIARLHSGRIDCISSAGHTEFTI
FT                   SLPILNAK"
FT   gene            complement(406052..406591)
FT                   /locus_tag="Sputcn32_0373"
FT   CDS_pept        complement(406052..406591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74105"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2C2"
FT                   /protein_id="ABP74105.1"
FT                   /translation="MMRSLTLIGLVLFSMLAQATVYKWVDKDGKVHYSDEPRANAEVVE
FT                   LNEKTLNQIALPPVKIGSDNNNQVIEDIQYQINIISPEEEATVRDNNGNFEVVATVSPE
FT                   IKSQFLMQLKLNGQIIAPPQVGGRFKLTNIDRGEHTIIVDAMTQNGKVFASSSPRKIFL
FT                   HQAAMTPHPKKQPKSN"
FT   sig_peptide     complement(406532..406591)
FT                   /locus_tag="Sputcn32_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(406777..407139)
FT                   /locus_tag="Sputcn32_0374"
FT   CDS_pept        complement(406777..407139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0374"
FT                   /product="glutathione S-transferase-like protein"
FT                   /note="KEGG: sdn:Sden_1385 glutathione S-transferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74106"
FT                   /db_xref="GOA:A4Y2C3"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2C3"
FT                   /protein_id="ABP74106.1"
FT                   /translation="MFGYSYLQWLHFAESSAMLPLLLRMFVQKDGCKTNFLEGYAAIEV
FT                   SKISHYFNDMLAGKTYLVADKLTGADIMMSFVVELLANSGVLDKFEHIQRYAIQLSQHA
FT                   AWVKANEIEKQLDASL"
FT   gene            complement(407300..407665)
FT                   /locus_tag="Sputcn32_0375"
FT   CDS_pept        complement(407300..407665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0375"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   KEGG: vvu:VV20508 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74107"
FT                   /db_xref="GOA:A4Y2C4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2C4"
FT                   /protein_id="ABP74107.1"
FT                   /translation="MITLHHLNKSRSKRIIWLLEELGQPYEIKRYQRDSQTFLAPPELK
FT                   QIHPLGKSPVIEMDGQVIAESGAITEYLIEKYAVDTLAPARDSADYVYPSYLKIRVSER
FT                   LGCFNSRRINERMSATF"
FT   gene            complement(407799..408491)
FT                   /locus_tag="Sputcn32_0376"
FT   CDS_pept        complement(407799..408491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0376"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: psb:Psyr_3319
FT                   ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74108"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2C5"
FT                   /protein_id="ABP74108.1"
FT                   /translation="MKMNILMVLTSHDKLGDTGLKTGFWLEEFASPFYVFKDKGFDITL
FT                   TSPLGGQPPLDPKSDEPDFQTEATALFSKDPEAQALLANTTRLSAINAADYDAVFYPGG
FT                   HGPLWDLAEDKHSIALIEQFYQANKPLGLVCHAPAALLHPKTSDGKPLVSGKRVTGFSN
FT                   SEEEAVQLTHVVPFLVEDMLQKKGGNYVKGDDWTSFVVADGHLITGQNPGSSEAVAETI
FT                   VAQLNARG"
FT   gene            complement(408563..409720)
FT                   /locus_tag="Sputcn32_0377"
FT   CDS_pept        complement(408563..409720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0377"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   son:SO4469 alcohol dehydrogenase, iron-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74109"
FT                   /db_xref="GOA:A4Y2C6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2C6"
FT                   /protein_id="ABP74109.1"
FT                   /translation="MLNFNYYNPTRIRFGKDTIAEIDSLVPSDAKVMILFGGSSARKTG
FT                   TLDEVKQSLGNRFVVEFDGIEPNPTYETLMKAVAQVREQNIDFLLAVGGGSVIDGTKFV
FT                   AAAAVFEGEPWDILTSWGAKVTQAMPFGSVLTLPATGSEMNNASVVTRKSLQAKLPFRN
FT                   DLVYPQFSILDPTKTFTLPERQVANGVVDAFVHITEQYLTYPVNAAVQDRFAEGLLQTL
FT                   IELGPQVLVQPEDYDIRANLMWVATMALNGTIGVGVPHDWATHMIGHELTALYDIDHAR
FT                   TLAIVLPALLQCTKEAKREKLLQYADRVWHINTGTDDERIDAAIAKTKAFFEAMGIPTH
FT                   LSAYDLDASHVDTVVKQLEQHGMVALGEHGNIDPTMSHKILTLAL"
FT   gene            complement(409863..410471)
FT                   /locus_tag="Sputcn32_0378"
FT   CDS_pept        complement(409863..410471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0378"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   shm:Shewmr7_3760 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74110"
FT                   /db_xref="GOA:A4Y2C7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2C7"
FT                   /protein_id="ABP74110.1"
FT                   /translation="MLGAMKTETQSTRQHILDIGYKLIVRKGFSCVGLSLLLQEAEVPK
FT                   GSFYHYFKSKEQFGEALITDYFEKYQLDLDTLFNNSTLTGYERLMQYWQQWLHVQTDGC
FT                   VDQKCLVVKLSAEVADLSEAMRLALLQGSAGIIDRLTTCVQVGITDKSIAEQDPQSTAE
FT                   MLYHMWLGASLMNKLGHSPAALERALVTTEAILTPKTVP"
FT   gene            complement(410754..411065)
FT                   /locus_tag="Sputcn32_0379"
FT   CDS_pept        complement(410754..411065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0379"
FT                   /product="protein of unknown function DUF1255"
FT                   /note="PFAM: protein of unknown function DUF1255; KEGG:
FT                   shm:Shewmr7_3759 protein of unknown function DUF1255"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74111"
FT                   /db_xref="GOA:A4Y2C8"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2C8"
FT                   /protein_id="ABP74111.1"
FT                   /translation="MSLLEQVSVSKKANIYFDGKVASRSVFLADGSKQTLGVVLPGEYE
FT                   FSTSQGEVMEVTSGRFEVLLPESTLWQEFSEGTQFELAANVSFKIRNTAIAEYCCSYL"
FT   gene            411424..413379
FT                   /locus_tag="Sputcn32_0380"
FT   CDS_pept        411424..413379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0380"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   shm:Shewmr7_3758 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74112"
FT                   /db_xref="GOA:A4Y2C9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2C9"
FT                   /protein_id="ABP74112.1"
FT                   /translation="MGFTRKIQLISLLIVLLPLIFATAIVTYIARDELFAEAQSRLVAV
FT                   REIKQRQIVSMFQDFSDNLQAVSAVIASQKNLDTLTDIDQTLQSLNKSLGFYDLFIIRD
FT                   DGTVLYTVEKESDFGTNLRTGPFHDSGLAQLFNKALGSAGTVLLQDFSAYAPSNGQPAA
FT                   FIGQSIQFNQQRLVVAAQVSIDRINRVMQIREGMGQSGETYLIGPNNRMRSDSFLDPVN
FT                   RTVTASFAGTVAQNGVDTQAVKEALAGKTGVMQLNDYNNNPVLSAYSPVVELGLRWGLM
FT                   AEIDVSEIAAPAYRMLFIGLSVCVAALVLAFAAAKLVTGFVLKPLGGEPEDMCNLTSMI
FT                   ASGDLTHHLPHIQTDNHLMSWLARMQTKLKEIISQLVGVGHELESAAEQNSAAMSQADC
FT                   SIQMQAKETDMLATAVEEMSYAAAEISTNTMRSSDEVSACTHSSEILSQNLASTRKSLK
FT                   VTLNSFATIHQQVGSLEADSQKIGSVLAVINAIAEQTNLLSLNAAIEAARAGEHGRGFA
FT                   VVADEVRQLAVKVQLATQDIGQVLKGIQQQSGVLALHSVTCSTEASKTAEDADGMQAAV
FT                   DDIALRLETLKALMIQTATAAEEQTTVSATIAQGIAGLSVAAEENSAAISQVAASTRSL
FT                   LGLANQLGLTTAQFKV"
FT   sig_peptide     411424..411498
FT                   /locus_tag="Sputcn32_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.562 at
FT                   residue 25"
FT   gene            complement(413512..415629)
FT                   /locus_tag="Sputcn32_0381"
FT   CDS_pept        complement(413512..415629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0381"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   shm:Shewmr7_3757 protein of unknown function DUF323"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74113"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR027577"
FT                   /db_xref="InterPro:IPR027625"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2D0"
FT                   /protein_id="ABP74113.1"
FT                   /translation="MDKPITQPPQTLKLIGETEVGKRQELKQYFNQTWALYESLFDLIQ
FT                   DDSAYYLKAEPLRHPLIFYFGHTATFYINKLKLGKFLDERVNDNFESMFAIGVDEMSWD
FT                   DLNEQHYPWPDVAEVRSYRQQVNAVVNRVIDEMPLTLPITQNSPAWIILMGIEHERIHL
FT                   ETSSVIIRQLPLEYVAPNHLWPACQDTAPAETNSLLAVKGQKVTLGKTEQDQTYGWDNE
FT                   YGHKIFNVNDFKAAKFLVSNQEYLAFVEAGGYRSPQFWNEEGQAWLAYTQAQMPRFWRL
FT                   RQDKWWQRNLAEEIPLPLNWPVEVNQLEAKAFCNWKAEQKQSNIRLLTEAEWYILRANV
FT                   PADAPDWHEVPGNIALAYYASSCPVNRFEHNGFFDIVGNVWQWTETAIDGFDGFAVHPL
FT                   YDDFSTPTFDGKHNLIKGGSWISTGNEAIASSRYAFRRHFYQHAGFRYVESTQNPAQMA
FT                   EVNVYETDELISQYLEFHYGAEYFGVANFCVNGVQQALSEIQLNHTTKALDIGCSVGRA
FT                   SFELAKVFDHVDGIDFSARFIQQAYALTEQGEKRYTIRTEGDLQEFKSASLAKLGYELE
FT                   AKKVNFMQGDACNLKPIYTGYDLVYASNLIDRLNDPKHFLTSIAQRINQGGYLVIASPY
FT                   TWLEDYTPKDKWLGGVKIKGENFTTLDGLTETLIGQFELVAVKEIPFVIRETKRKFQHS
FT                   ISEMTIWRKRS"
FT   gene            415995..416390
FT                   /locus_tag="Sputcn32_0382"
FT   CDS_pept        415995..416390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74114"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2D1"
FT                   /protein_id="ABP74114.1"
FT                   /translation="MTINALWIPAWYELDPSIVVGVTEEFIFHKPTTNGALRFYSGAEN
FT                   IDAVRATGAISSIYHAVLGDIESVDAQGLDYTIVLKDGRRLLVNAEEDPGLIYEWVDDS
FT                   WQPSEMTISDWQLEVKFTSLSLLTSVD"
FT   gene            416767..417621
FT                   /locus_tag="Sputcn32_0383"
FT   CDS_pept        416767..417621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0383"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: son:SO4458
FT                   carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74115"
FT                   /db_xref="GOA:A4Y2D2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2D2"
FT                   /protein_id="ABP74115.1"
FT                   /translation="MANILLVANLNCDRILLLDKPLKTGGRFHYQDGGQRLGGGGANTG
FT                   LGLVWAGHRVALVSQVGRDEMGDWAIAEASTQGLDCRLVQRRSGNTCEMLLVMTPDGER
FT                   TIIRPQRPIFELSVPPKWQQWDALYFNTSAEGTVSWAKTALEHCLVVAQLAKDDRPRPC
FT                   HVLLASMSDMQGRCDSAFWEYGKSIGGDSLRYFIVTDGINGANVYTKDKVQHVQAVPAK
FT                   VIDTTGAGDAYAAGLIHSLCSGQSITDAMAEGAIWAAFAVATDSSIPGDALKGYLEVKG
FT                   SLS"
FT   gene            417926..419386
FT                   /locus_tag="Sputcn32_0384"
FT   CDS_pept        417926..419386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0384"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: son:SO4457 GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74116"
FT                   /db_xref="GOA:A4Y2D3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2D3"
FT                   /protein_id="ABP74116.1"
FT                   /translation="MGNNVWNERRKFIWLLSILLLFAFLVTSSISYKVAHDSLSQQIES
FT                   NTLPLTSDNIYSEIQQDLLRPIFISSLMAQDTFVRDWTLNHEQEPEKLIRYLKEIQEKY
FT                   GTVTSFFVSEKSRNYYHSTGILKQIQDVEPDDAWYFRVRSLPESEYYEINIDADTADRS
FT                   KTTVFVNYKVFDFEGKFIGVTGVGLAVEKVKLLVELYQKRYNRRVFFTDRLGNVTLHGD
FT                   AYDGSDSLQTSTGLEQLATRILTSPSAAFSYKKNGKTVYLNSRLVSEFKWYLIVEQEDA
FT                   PQEQDLLNTFWGNLALSLIVTMGILFISNMTLGRYQRKLEMMASTDKLTGAANRQVFEE
FT                   YFRQALDKAKLTQSPISILLLDIDHFKKVNDSYGHGMGDLVLKTMANMLRGLLQPQDIL
FT                   CRWGGEEFLILLPEMDLSRAAEFAEQIRDLISLREIKVNGLHISITASIGVAEHQAQEP
FT                   AEDLIKRADLALYQAKAAGRNQVVLNHP"
FT   sig_peptide     417926..418012
FT                   /locus_tag="Sputcn32_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.447 at
FT                   residue 29"
FT   gene            419515..420210
FT                   /locus_tag="Sputcn32_0385"
FT   CDS_pept        419515..420210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0385"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: 3-alpha; MOSC domain containing protein; KEGG:
FT                   she:Shewmr4_0269 MOSC domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74117"
FT                   /db_xref="GOA:A4Y2D4"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2D4"
FT                   /protein_id="ABP74117.1"
FT                   /translation="MSKLLINKLSGLYLGTQLQEVAGVATGIDGKQAAQQLLVHIDHVE
FT                   GDAQADPKHHGGLDRVLHHFPREHYGQYRRWDLITQFEDAPSMGENISTVGLNETQVNI
FT                   GDILQIGAVKVQVTQPRSPCFKLNLQFGHREFALAMQQSQLCGWFYRILTPGVIELHDR
FT                   IELIERRTDISVAEAMSLYFSPTFNASAYDRLASCEGLALSWINSLQRRLASQTVEDWQ
FT                   MRLYGPSGI"
FT   gene            420247..420603
FT                   /locus_tag="Sputcn32_0386"
FT   CDS_pept        420247..420603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74118"
FT                   /db_xref="GOA:A4Y2D5"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2D5"
FT                   /protein_id="ABP74118.1"
FT                   /translation="MIESVTKSDKDFGLLVYASSFIGYLVPLGSILGPLIIWLMKREES
FT                   AFVDQCGRSCLNFKLSLLIYVIISGVLAFIGIGFIFLIVLAILDLVCTVLGIIKASEGQ
FT                   VYRYPLTIKFISMD"
FT   gene            complement(420671..422587)
FT                   /locus_tag="Sputcn32_0387"
FT   CDS_pept        complement(420671..422587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0387"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: shm:Shewmr7_3750
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74119"
FT                   /db_xref="GOA:A4Y2D6"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2D6"
FT                   /protein_id="ABP74119.1"
FT                   /translation="MILNNLTIKQKILLTVTFAVLLSTILVGVLSQNSAKRVVEQRMLG
FT                   SEMPSLMMQIRNKIELDISSLMNAAEQLASSRMLLQWLENDRPQEQEAQVVAQLKDITL
FT                   QYKLAQASYADRQTAAYYTQDGFLRVLTPAQDGWFFGYRDSGQERMLNVFTEANGEVKL
FT                   FINYQQPNGRGLVGLAKSLDDMVRLLGSFKIEKTGFVYLVDAKGEVKLHPDTSQIGKST
FT                   LNNLYKDASSNSLLNRGDFNLINTKINGKDMLVASSYIASMDWYLVAQVPEAEVFALLA
FT                   DAAYQILIWTLLIAAGFIVLAIAVAGSVSRPIAQVAAMFRDIGEGEGDLRQRLPVNGED
FT                   EIAQLAKGFNSFISKIQESVIEVAQTSEQLGFSAKDVSNQAQQTLEDSHEQKDRTMMVV
FT                   TAINEMGATVNEIASNAAQAAVAARDADTEASSGQVVVTRARDTINQLSKDVGQVGEVI
FT                   ESLATHTKSIGGILDVIRAISEQTNLLALNAAIEAARAGEAGRGFAVVADEVRNLASRT
FT                   AASTNEVQGMIDKLQSEATRAVNAMAQSRTRSHEGVVAVDEASQSLVGISDRIGLISDM
FT                   NIQVAAATEEQSTVVEDINRNVTEINDITQRTANTAQAAAQASLALNQLAHRLDTLVAK
FT                   FKV"
FT   sig_peptide     complement(422492..422587)
FT                   /locus_tag="Sputcn32_0387"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.662 at
FT                   residue 32"
FT   gene            complement(422933..424582)
FT                   /locus_tag="Sputcn32_0388"
FT   CDS_pept        complement(422933..424582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0388"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase; KEGG:
FT                   shm:Shewmr7_3749 electron-transferring-flavoprotein
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74120"
FT                   /db_xref="GOA:A4Y2D7"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2D7"
FT                   /protein_id="ABP74120.1"
FT                   /translation="MERESMEFDVVIVGAGPAGLATACRLMQISQDSGKEITVCVVEKG
FT                   SEVGAHILSGAVFETKVLDELFSDWREKDAPIKTAVTHDEIYLLSSATDGRVMPNAFVP
FT                   KTMHNDGNFIISVGNLSRWLASRAEELGVEIFPGFAASELLFNEDNSVKGILIGDMGIG
FT                   ADGEPKDSYMPGMELHAKYTVFSEGCRGHLGKQLIEKYHLDNGKTPQHYGLGFKEIWKV
FT                   PAEQHEQGKVVHTGGWPLTEGASGGGFLYHMEDNQIAVGLIIDLNYKNPHLSPFDEFQR
FT                   YKTHPVIAKYLTGGERLSYGARAITKGGLNSLPKMSFPGGLIIGCNAGTLNFAKIKGTH
FT                   TAMKSGIVAAETLATAMMAGVEGGKDLDCYQTHFEESWLHEELYKSRNFGPAMHKFGTY
FT                   LGGAFNYIDQNWFGGKFPITLRDEHPDYAQMAPVSAYSKIDYPKPDGKLSFDKLSSVYL
FT                   SSTYHEEDQPCHLRLKDSSIPLGINLTQFNEPAQRYCPAGVYEIVEEAGQPKFVINAQN
FT                   CIHCKTCDIKDPSQNITWVTPEGGGGPNYPNM"
FT   gene            424919..425932
FT                   /locus_tag="Sputcn32_0389"
FT   CDS_pept        424919..425932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0389"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="KEGG: she:Shewmr4_0273 molybdenum cofactor
FT                   biosynthesis protein A; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein A; PFAM: Radical SAM domain protein;
FT                   molybdenum cofactor synthesis domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74121"
FT                   /db_xref="GOA:A4Y2D8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2D8"
FT                   /protein_id="ABP74121.1"
FT                   /translation="MLSPPTLGKVIMSQLQDSFGRKFHYLRMSVTDVCNFKCSYCLPDG
FT                   YHPDGKPKFLSLNEIENLVSAFSQVGTQKIRITGGEPTLRKDFTDIIRVVADNPRIHTV
FT                   ATTTNGYRLEKHAKEWFDAGLRRINVSVDSLDPKMFYQITGENKFDEVMRGIDAALSAG
FT                   FERVKINAVLLKGLNDKDLPRFLHWIKHTPIDLRFIELMETGLGREYFQAHHLAGADIK
FT                   AQLLADGWQFDTPSASDGPAQNFSHSDYKGRIGLIMPYANNFCATCNRLRVSAKGKLHL
FT                   CLFTESGVDLRDLLQHADQQAELIERLHGQLAQKKETHYLHQGITGVTQHLASIGG"
FT   gene            426030..426506
FT                   /locus_tag="Sputcn32_0390"
FT   CDS_pept        426030..426506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0390"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: shm:Shewmr7_3747 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74122"
FT                   /db_xref="GOA:A4Y2D9"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2D9"
FT                   /protein_id="ABP74122.1"
FT                   /translation="MSNVFTHINADGNAHMVDVTEKAVTEREARAEAFIEMASTTLEMI
FT                   MSGSHHKGDVFATARIAGIQAAKKTSDLIPLCHPLMLTKVEVDLEAQPEHNRVRITSLC
FT                   KLSGKTGVEMEALTAASVAALTIYDMCKAVQKDMVISQVRLLEKRGGKSGHFKV"
FT   gene            426530..426781
FT                   /locus_tag="Sputcn32_0391"
FT   CDS_pept        426530..426781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0391"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein; KEGG: son:SO4450 molybdenum
FT                   cofactor biosynthesis protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74123"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2E0"
FT                   /protein_id="ABP74123.1"
FT                   /translation="MINVLFFAQVRELLGTAKLSLEASEQTQTAEALRATLAATDDKWA
FT                   KVLTSDKLLVAVNQTISQWDTPVKDGDEVAFFPPVTGG"
FT   gene            426783..427244
FT                   /locus_tag="Sputcn32_0392"
FT   CDS_pept        426783..427244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0392"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE; KEGG:
FT                   she:Shewmr4_0276 molybdopterin biosynthesis MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74124"
FT                   /db_xref="GOA:A4Y2E1"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2E1"
FT                   /protein_id="ABP74124.1"
FT                   /translation="MRLLPAVRVQEVDFSVSDEYRQLAQDDSDGAVVTFVGKVRDFNDG
FT                   AAVTDLTLEHYPGMTEAVLEQIVAEARSRWPLNRVTIIHRVGTMSLGEQIVFIGVTSAH
FT                   RKAAFAACEFLIDFLKTKAPFWKLEAGEQGKSWVEAKDADEQAAKLWQA"
FT   gene            427301..428113
FT                   /locus_tag="Sputcn32_0393"
FT   CDS_pept        427301..428113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0393"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; KEGG: she:Shewmr4_0277
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74125"
FT                   /db_xref="GOA:A4Y2E2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2E2"
FT                   /protein_id="ABP74125.1"
FT                   /translation="MVGLTRFFNSVFLSVCCLLSTLSLSIQAATNTSTASVPAIAAASD
FT                   LRFALDEISQKFTHETGLKVNISYGSSGNFATQIQNGAPFELFLSADEKYIQQLHSAGI
FT                   ARDAGVLYAQGQLAIVVPKAGSLSVDPELKGLAEALAAGKITRFAIANPDHAPYGEKAK
FT                   EALQFVQLWDAIQPKLILGENVSQAGQFAISGSTQGGIIALSLAMSPTFSKLSDYAIVP
FT                   AKMHTPLFQRMALMAKAGETAQHFYDYLRADSARRILADYGFSLPEQP"
FT   sig_peptide     427301..427387
FT                   /locus_tag="Sputcn32_0393"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.981 at
FT                   residue 29"
FT   gene            428110..428793
FT                   /locus_tag="Sputcn32_0394"
FT   CDS_pept        428110..428793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0394"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: shm:Shewmr7_3743 molybdate
FT                   ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74126"
FT                   /db_xref="GOA:A4Y2E3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2E3"
FT                   /protein_id="ABP74126.1"
FT                   /translation="MMDWQALWLSVKLSGITVLVLIPLAILAGRALAYRQFVGKSWVEA
FT                   LIMVPLVLPPTVIGYYLLVGLGSQSWLGQWIEQVIGQQLVFHFSGLVIASVLVNIPFAV
FT                   QPIQRAFETVPNDVRDAAACCGMSRLKILLKIELPMVWPGVLTALVLCFSHVLGEFGVV
FT                   LMMGGNIAGETKTISIAIYDSVQSFDFNAAGTMSLVLLLFAVTALALTTSLSRRLGGQR
FT                   GANHR"
FT   sig_peptide     428110..428211
FT                   /locus_tag="Sputcn32_0394"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.607) with cleavage site probability 0.578 at
FT                   residue 34"
FT   gene            428774..429877
FT                   /locus_tag="Sputcn32_0395"
FT   CDS_pept        428774..429877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0395"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: shm:Shewmr7_3742 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74127"
FT                   /db_xref="GOA:A4Y2E4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2E4"
FT                   /protein_id="ABP74127.1"
FT                   /translation="MAQIIADLQCQIQNHKHINLSADFRCKAGEVLAVVGPSGGGKTTL
FT                   LRMIAGLNHPDTGQIHFGDRPWFDDKARIALSPQQRHIGYMPQHFGLFPNLTALENVVA
FT                   GLDHIPKAERIPRAKDWLERVNLQGLPDRLPAHLSGGQRQRVALARALAREPSVLLLDE
FT                   PFSAVDRETRERLYLELARLKEQLLCPVIMVTHDLNEALLLADSMILISQGKMLQQGAP
FT                   FEVLSRPRNEAVARQMGLRNIFDGEVVFQDSTKNLTWLKFGEQLIACDYGKDRPVGSRV
FT                   RWVIPNQGIRFNSISKGRLCRSFNKLTVTIDAMLVMGESVRLICYVAGTQLQINTEVSL
FT                   HFAQKLALTKGMQTTVALKSEQIHILE"
FT   gene            430094..430615
FT                   /locus_tag="Sputcn32_0396"
FT   CDS_pept        430094..430615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74128"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2E5"
FT                   /protein_id="ABP74128.1"
FT                   /translation="MRLWLLGFILVSGAVSAAQSLYSMLGSGQYQPPLKVMQQIEKDFP
FT                   GVIAEFEMEMQEGELVYQFELINPLANAITHFEYRARDGKLLKQKAGKVSADDLGEVEA
FT                   TRLITSKHQTFSGLITMAIKDHKGFLTDAKLDHDLGISYLELKLLDDTGKYKLAFDVDN
FT                   LRQLPLLKWD"
FT   sig_peptide     430094..430147
FT                   /locus_tag="Sputcn32_0396"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.859 at
FT                   residue 18"
FT   gene            430657..431334
FT                   /locus_tag="Sputcn32_0397"
FT   CDS_pept        430657..431334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0397"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4428 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74129"
FT                   /db_xref="GOA:A4Y2E6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2E6"
FT                   /protein_id="ABP74129.1"
FT                   /translation="MKILLVEDDATTIDYIVKGFLEQGHNIETANDGHQGLSLATSCQY
FT                   DLVILDRMLPQLDGLKLLAALRATGNQTPVLILSALAHVDERVKGLRAGGDDYMTKPFA
FT                   FSELLVRAEKLMQRGQSTPISTDLVVGGLKMELLTRNVTLDGQELMLQPKEFQLLKYLM
FT                   EHANQVISRTLLFEAVWDYHFDPRTNVIDVHIAKLRRKFEELGHGELIETVRGAGYRLR
FT                   QRH"
FT   gene            431384..432640
FT                   /locus_tag="Sputcn32_0398"
FT   CDS_pept        431384..432640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0398"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: son:SO4427 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74130"
FT                   /db_xref="GOA:A4Y2E7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2E7"
FT                   /protein_id="ABP74130.1"
FT                   /translation="MTVIIGALLFALYRQLIIEQQYQVTQYLESETQRYQQLALTVDRR
FT                   SFAAQIRAADPQTALIAWRNSYDMVGALSFMPEGMPMLPQTRDFPILTGGPDKLHILTG
FT                   GLVMTRYGPVLIATRTDNLATLIDKFISAAATAVMLTIVLTLALGYLFSKAILRRLVQY
FT                   NRLSEQIERGHYDTRLPLSWRQDEFDMLALQFNNVLDILENNLMAVRGATDNIAHDLRT
FT                   PLSHIRIGLEELATKSHDDISEGCAILIEELDHCLATFDAMLSLTRIEEGQQTLDLQEL
FT                   SLAQLCTDLLEMADAVAESNEQTLSLSLLSDHTVLGDKYLLFQALYNLVDNAMKYSGQG
FT                   ARIDIIQSGAQIQIRDNGPGIPDESKEKVFERLVRLDPSRHLQGTGLGLSMVKAILSRH
FT                   NAQIKLSDNHPGLVVTIQF"
FT   gene            432674..433363
FT                   /locus_tag="Sputcn32_0399"
FT   CDS_pept        432674..433363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0399"
FT                   /product="pseudouridine synthase Rlu family protein,
FT                   TIGR01621"
FT                   /note="TIGRFAM: pseudouridine synthase Rlu family protein,
FT                   TIGR01621; PFAM: pseudouridine synthase; KEGG:
FT                   she:Shewmr4_0283 pseudouridine synthase Rlu family protein,
FT                   TIGR01621"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74131"
FT                   /db_xref="GOA:A4Y2E8"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2E8"
FT                   /protein_id="ABP74131.1"
FT                   /translation="MYQIIADEADFLVISKFPKVHFHSQDGTVGVVAQVEQDLGIKLFA
FT                   VHRLDTPTSGLLILAKSTAAAKQFTELFTAHKVQKYYLALAKGKPKKKQGWVIGDMAKS
FT                   RRSMFKLLRTKENPAITQFFSVSVGDGLRLYLLKPHSGKTHQLRVALASLGVPILGDEL
FT                   YGGAVADRCYLHAYCLHFRYQDAVTGWRDYTYLNIPQQGEAFQLEAVSDALALWHKPET
FT                   LAWPSKE"
FT   gene            433484..433651
FT                   /locus_tag="Sputcn32_0400"
FT   CDS_pept        433484..433651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0400"
FT                   /product="protein of unknown function UPF0057"
FT                   /note="PFAM: protein of unknown function UPF0057; KEGG:
FT                   shm:Shewmr7_3736 protein of unknown function UPF0057"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74132"
FT                   /db_xref="GOA:A4Y2E9"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2E9"
FT                   /protein_id="ABP74132.1"
FT                   /translation="MDTNKLLLVIIAILLPPVAVFLKAGAGKDLLINIVLCLFFWFPGL
FT                   LHALWVVTKD"
FT   sig_peptide     433484..433552
FT                   /locus_tag="Sputcn32_0400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.928) with cleavage site probability 0.525 at
FT                   residue 23"
FT   gene            complement(433725..435896)
FT                   /locus_tag="Sputcn32_0401"
FT   CDS_pept        complement(433725..435896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0401"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: she:Shewmr4_0286 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74133"
FT                   /db_xref="GOA:A4Y2F0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2F0"
FT                   /protein_id="ABP74133.1"
FT                   /translation="MTFKSSLVALAILTALTQSAAAQDASDNSNKDQEIEKITVTASRM
FT                   DKSPSAIPNTVTIIDRLQLEEQFRTTKDLSTIIGNLAPSFSPSRQKMSNTGETLRGRPP
FT                   LIMIDGVPQSNPLRSGGREGQTIDPAMIERIEIIHGANAMHGLGAQGGIINYITKKPSG
FT                   HNEHVVSFDVTVPDSMKSNGMSFGTSYAFSGESELVDMLGSVSYRNNGVYYDANHDLVG
FT                   VDTTQGESMDSQSADFFIKLGHNFAESRIELMVNHYNMDNNGDWMPIAGDKPNGVPTGA
FT                   IKQNQPWEAANNQVTTTSLTYTHENIAGQQLNLQLFNQDFKAVYGGGCFESFYDPAFEG
FT                   SDQVIQCGVGSKGESLYYDQSRNSSVKWGLKSALIAKDIAGSGIDAAYGIDLFRDTTEQ
FT                   DLVKTGFSWVPESTYDNIAPYLQLDYDLIKNLTLSTGIRYEHAELSVDDYKTLWGAGNK
FT                   QIAGGEASFNETLLNIGISYKITPDIRIYTSYNEGFGMPDIGRILRDGKSFPGANPSIS
FT                   DSLALTPIVTDNVEVGADYQGKYLRAKISYYRSATDFGSRLALNSDGFYDVKREKSVID
FT                   GIEANVTAYLTSNDDLGMNIAIQQGEYDSNGDNKVDTDLDGANIAPNRINLYWTHNFDN
FT                   EMSTRVQANYFMDRDFKNAAGTQYAEFDGYTTVDASFSMPLYTGTLSLGLQNLLNKDYF
FT                   NYYSQTMGTNDRYFKGMGRTATIGYTLPF"
FT   sig_peptide     complement(435828..435896)
FT                   /locus_tag="Sputcn32_0401"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.977 at
FT                   residue 23"
FT   gene            436216..436380
FT                   /locus_tag="Sputcn32_0402"
FT   CDS_pept        436216..436380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74134"
FT                   /db_xref="InterPro:IPR021677"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2F1"
FT                   /protein_id="ABP74134.1"
FT                   /translation="MNRKKKINQTLKNKAKKANAKLQTCNKPKYIAKADREALVPAVLP
FT                   ESEPSDAAA"
FT   gene            complement(436397..436909)
FT                   /locus_tag="Sputcn32_0403"
FT   CDS_pept        complement(436397..436909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0403"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: son:SO4420 peptidase,
FT                   M23/M37 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74135"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2F2"
FT                   /protein_id="ABP74135.1"
FT                   /translation="MKLKYVGLALVLLLISGYLVPESPIIPVKGASSKDWNSQTFWYEP
FT                   WGASGVHKGIDIFAKKNTAVIAPTPMLIIYRGGFFQGGKVVVGLGPKWQIHYFAHLATI
FT                   ATDTGLIITKGETLGAVGDTGNAQGKPPHLHYSILSLLPKPWLIDTSTQGYKKAFYQNP
FT                   IRYLEAQ"
FT   gene            complement(436949..437527)
FT                   /locus_tag="Sputcn32_0404"
FT   CDS_pept        complement(436949..437527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74136"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2F3"
FT                   /protein_id="ABP74136.1"
FT                   /translation="MSVLAWFTKCVNLIKSSKQDVALPEVFNQIQMPCITIPLQQTYPL
FT                   VMPMAQDDIYAYQIHCLLTLEGKQAIDTLINNAGFKALPEHSAPFNGLIMHSNQSSCVF
FT                   LNQYADFAGICLNLITNDQTLLEQLISFKSPLPDPWKSFPDIDPDTLGSLQGNLDFWCH
FT                   YFWRPYWLSLSQKERLQYPEPWREFSEFH"
FT   gene            complement(437533..438180)
FT                   /locus_tag="Sputcn32_0405"
FT   CDS_pept        complement(437533..438180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0405"
FT                   /product="CHAP domain containing protein"
FT                   /note="PFAM: CHAP domain containing protein; KEGG:
FT                   son:SO4418 trypanothione synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74137"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2F4"
FT                   /protein_id="ABP74137.1"
FT                   /translation="MIKRISILFLGLGILLSLIYCAYRLITQHNFNPKYQVGDVIDSLN
FT                   GVEIYYNGGVNTSDGRNLSIDGYNLGIKYQCVEFVKRYFYQRHQHKMPDTYGHARDFFD
FT                   NSLADGAWNEKRAMLQYVNGSQLTPQADDLLVFAPWLFNPYGHVAIIAEVHDHQVEIVQ
FT                   QNPGPFGPSREYFPLTQHDGLWYIDAPRLKGWLRLQTPTIAPSLFSNHAVEE"
FT   sig_peptide     complement(438112..438180)
FT                   /locus_tag="Sputcn32_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.782) with cleavage site probability 0.769 at
FT                   residue 23"
FT   gene            438489..439667
FT                   /locus_tag="Sputcn32_0406"
FT   CDS_pept        438489..439667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74138"
FT                   /db_xref="GOA:A4Y2F5"
FT                   /db_xref="InterPro:IPR015029"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2F5"
FT                   /protein_id="ABP74138.1"
FT                   /translation="MKPATYNTEAFDDWIRTRFVELNSELERLYYLQSDRANVLNIGDE
FT                   AKQRLESEGRELIKTLLDEGNTDEGFDSAFDLLGNVGLYMAACRRHEITEPSRETTSPL
FT                   VEASALAMHIGASIGVTPRFATAHLTTHNRAHRGIYKRFTDLPDEKLFVDYNTKGILAY
FT                   KRAADALLKIQPLGISHPISLDLLRVAKQALQDVIESNTQLFNRLDTDRFFYCVRPYYK
FT                   PYRVGSIVYRGANAGDFAGINVIDLTLGLCFANESSYSQMLVDKFLYMMPEDQQLLREC
FT                   MRRPNLMDDFLQAKNSVNQDWYQQNLKLFIEVCELHGATAIQHHNQLVTKYIAEPSTTM
FT                   AQQHLAKVTASGPPLSVLLGSLEKLRDRRAATKRSDIRTRYDDLNCLKESLR"
FT   gene            439672..440793
FT                   /locus_tag="Sputcn32_0407"
FT   CDS_pept        439672..440793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0407"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG:
FT                   shm:Shewmr7_3724 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74139"
FT                   /db_xref="GOA:A4Y2F6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2F6"
FT                   /protein_id="ABP74139.1"
FT                   /translation="MFSDFKKDFCLANPGYLLSHSVGRPLKSTEQVFKEAFFAPWQDSG
FT                   REPWGQWLSVIDDFTFALSKLFNGHQKDFCPQVNLSSALAKILMSLARLNREHAVVLMS
FT                   EIDFPSMGFAIKKALPASCEVRFIPKTLDITDANVWDAHMGSDIDLVFVSHAYSNTGQQ
FT                   APLANILAMARQYGCLSVVDVAQSAGIIPLNLAQLQPDFLIGSSVKWLCSGPGAAYLWV
FT                   NPSIIDSCQPKDVGWFSHENPFEFNIHDFRYHNSALRFWGGTPSIAPYAIAAHSIHYFA
FT                   DIGVEQLRKGNQLLIDIVAEALDQEFVSPREIEKRSGTLVLQFGEQQGQIMAALAKANI
FT                   SVDARSMGIRISPHIYNDKADIQLLLSVIKAHR"
FT   gene            complement(440882..441205)
FT                   /locus_tag="Sputcn32_0408"
FT   CDS_pept        complement(440882..441205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74140"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2F7"
FT                   /protein_id="ABP74140.1"
FT                   /translation="MRWLIWSVVCCSLTGCATITSRMGENSTWGHSFSSVQTAVDNGEE
FT                   CMVISALAAPPLLLFTIPLTLVDMGSALLVDAVMLPADLAITPSDPKLHTPRPMVCRYD
FT                   YKI"
FT   sig_peptide     complement(441131..441205)
FT                   /locus_tag="Sputcn32_0408"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.954 at
FT                   residue 25"
FT   gene            441571..441765
FT                   /locus_tag="Sputcn32_0409"
FT   CDS_pept        441571..441765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_1960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74141"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2F8"
FT                   /protein_id="ABP74141.1"
FT                   /translation="MAPEGRVSTRFILRLRLSTEHHYAFKPSPCLKCVELPLNEQIFNT
FT                   IGINHGGLFAAPSQNFDKF"
FT   gene            441963..442835
FT                   /locus_tag="Sputcn32_0410"
FT   CDS_pept        441963..442835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vch:VCA0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74142"
FT                   /db_xref="GOA:A4Y2F9"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2F9"
FT                   /protein_id="ABP74142.1"
FT                   /translation="MNNKVAPQQSASTEQETQPLDDSRYEDLPRSEFLQLPQEEQDRLN
FT                   KLRQQRVREAPTLHEWDIKVATVYAMGWLVVIIPCGIMVLIGLVAYWYESDQWYGFFFM
FT                   ALIFAPFIRYLWLADKQYHYRLTTEGLVTTYHDAIPDVAYAVVRGLAWFGVVVCIVGVA
FT                   FLGPAVLVGAGGFAVMAFFFTGFKNIETTYESPIKNGHRHLIKVTRNRPFIACQSDVRT
FT                   MGLRASIRLHCPLDKMHIILSLLMTQLPDSEIRVFKNERVLDGVPFASFESGEPAQLAD
FT                   FAPENTHAV"
FT   gene            443018..443890
FT                   /locus_tag="Sputcn32_0411"
FT   CDS_pept        443018..443890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vch:VCA0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74143"
FT                   /db_xref="GOA:A4Y2G0"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2G0"
FT                   /protein_id="ABP74143.1"
FT                   /translation="MNKRAAPQQSASTEQDTQPFNDSRYEDLPRSEFLQLPQEEQDRLN
FT                   KLRQQRVREAPTLYEWDIKVATVYGIGWIMVLIPCGITALVGLVTYWYGFEQWYYFLII
FT                   VMIFGPFMRYLWLADKQYHYRLTTEGLVTTYHDVIPDAAYAVVRGLAWFGVVVCIVGVA
FT                   FLGPAALVGAGSFAVMAFFFTGFKNVETTYESPIKNGHRHLIKVTRNRPFIACQSDVRT
FT                   MGLRASIRLHCPLDKMHIILSLLMTQLPDSEIRVFKNERVLDGVPFASFESGEPAQLSD
FT                   FAPDNPQPS"
FT   gene            complement(444209..445618)
FT                   /locus_tag="Sputcn32_0412"
FT   CDS_pept        complement(444209..445618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0412"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: son:SO4410 glutamine synthetase, type I;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase, catalytic region; glutamine synthetase,
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74144"
FT                   /db_xref="GOA:A4Y2G1"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2G1"
FT                   /protein_id="ABP74144.1"
FT                   /translation="MSVESVLKQLEELEVKFVDLRFTDTKGKEQHVSIPTHQVDADFFE
FT                   DGKMFDGSSIAGWKGINESDMVLMPDPTTFVLDPFTEETTALIRCDILEPGTMTGYDRD
FT                   PRSIAKKAEEYLRSTGIADTVLIGPEPEFFLFDDVRFGTDMSGCFVKIDAKEAAWNSGT
FT                   SYEGGNTGHRPFVKGGYFPVAPVDSSQDLRSAMCLVLEEMGQVVEAHHHEVATAGQNEI
FT                   ATRFNTLTKKADEIQILKYVVHNMAHAYGKTATFMPKPIVGDNGSGMHVHQSLSKDGVN
FT                   LFAGDKYAGLSETALYYIGGIIKHARALNAFTNPSTNSYKRLVPHFEAPVMLAYSARNR
FT                   SASIRIPVVPSPKGRRIEARFPDPHANPYLGFAALLMAGLDGIQNKIHPGEAMDKDLYD
FT                   LPAEEAAEIPQVATSLENALENLQADHEFLTRGGVFSEDFIQSYIALKTAEAERVARTT
FT                   HPLEFEMYYSL"
FT   gene            446653..448464
FT                   /locus_tag="Sputcn32_0413"
FT   CDS_pept        446653..448464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0413"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor, GTP-binding; elongation factor
FT                   Tu, domain 2 protein; KEGG: son:SO4408 virulence regulator
FT                   BipA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74145"
FT                   /db_xref="GOA:A4Y2G2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2G2"
FT                   /protein_id="ABP74145.1"
FT                   /translation="MLENLRNIAIIAHVDHGKTTLVDKLLSQSGTLATRGEATERVMDS
FT                   NDLEKERGITILAKNTAIKWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVDG
FT                   PMPQTRFVTKKAFAQGLKPIVVINKIDRPGARPDWVIDQVFDLFDNLGATDEQLDFPIV
FT                   YASALNGFATLDPDVVSEDMTPLFQTIVEKVSFPDADADGAFQMQISQLDYNSYVGVIG
FT                   VGRINRGSIKTNQQVTIIGADGKTRNGKMGQVLGYMGLDRTEVEVANAGDIVAITGLGE
FT                   LKISDTVCAAGNVEALPPLSVDEPTLTMTFQVNTSPFAGKEGKYVTSRNILERLQQELV
FT                   HNVALRVEETDSPDRFRVSGRGELHLSILIENMRREGYELAVSRPEVILKTIDGELCEP
FT                   FETLTVDVEEEHQGTVIEKLGTRKAEMKDMQLDGKGRVRIDFIIPSRGLIGFQTEFMTA
FT                   TSGTGLIYHSFDHYGPHKGGDIGQRANGVLISNATGKALTFALFGLQDRGRLFIGHAAE
FT                   VYEGQVVGIHARSNDLTVNCLKGKQLTNMRASGTDEAQVLTTPITMTLEQALEFIDDDE
FT                   LVEVTPKSIRVRKRHLTENDRKRNNRG"
FT   gene            complement(448536..449576)
FT                   /locus_tag="Sputcn32_0414"
FT   CDS_pept        complement(448536..449576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0414"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: son:SO4407 GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74146"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2G3"
FT                   /protein_id="ABP74146.1"
FT                   /translation="MRQRRLQLMQSLFDEYIEMYSSRNDKLTTRFSDNFSGYAGSSDVL
FT                   ITNKEEWIRITRQDFAQVPERIHIEMLDLSLQDLAEDILVVTAFFHIHLPIPESILCQE
FT                   TARLVLIFHQENKDWKIAHSGISIPYGLANNGEIYPMTSLEERNRELESMIEARTRELA
FT                   EANSRLEKLSNTDGLTNIGNRRLFDHILQMEWSRGQRSSAPLALIMLDIDHFKLFNDHY
FT                   GHLAGDDCLKLLAKGLSQSGRRAGELVARYGGEEFVILLPNTDQQTALDTAQYIHQLIQ
FT                   SLAIPHVKTDLGTVTVSLGVTCIEPSEQHSALELVRQADAALYLAKSAGRNCIRYMSPS
FT                   VNKLET"
FT   gene            449985..452171
FT                   /locus_tag="Sputcn32_0415"
FT   CDS_pept        449985..452171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0415"
FT                   /product="catalase/peroxidase HPI"
FT                   /EC_number="1.11.1.6"
FT                   /note="KEGG: she:Shewmr4_0311 catalase/peroxidase HPI;
FT                   TIGRFAM: catalase/peroxidase HPI; PFAM: Haem peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74147"
FT                   /db_xref="GOA:A4Y2G4"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2G4"
FT                   /protein_id="ABP74147.1"
FT                   /translation="MDKTHSSQGKCPVMHGGNTSVTTNNMDWWPKALNLDILHQHDKKT
FT                   DPMDPTFNYSEAFKTLDLAAVKQDLYALMTDSQDWWPADWGHYGGLMIRMAWHSAGTYR
FT                   IADGRGGAGTGNQRFAPLNSWPDNANLDKARRLLWPIKKKYGNKLSWADLIILAGNVAY
FT                   ESMGLKTYGFAGGRADIWHPEKDIYWGSEKQWLAPSDNPNSRYSGERDLENPLAAVMMG
FT                   LIYVNPEGVDGNPDPLRTAQDIRITFARMAMDDEETVALTAGGHTVGKCHGNGKAQNLG
FT                   PEPEAEDVEAQGLGWLNKHGRGVGRNTVTSGIEGAWTTHPTQWDNGYFSLLLGYDWELK
FT                   KSPAGAWQWEPINIKEEDKPVDVEDPTIRHNPIMTDADMAMKMDPEYRKISEKFYKDPA
FT                   YFSEVFARAWFKLTHRDLGPKSRYLGPEVPAEDLIWQDPIPQVDYRLSDDDITALKAKI
FT                   LASGLSIAELVTTAWDSARTFRGSDYRGGANGARIRLAPQKDWEGNEPVRLQKVLKVLT
FT                   DIQTGLSQKVSIADLIVLGGTAAVEKAAQDAGVNIRVPFASGRGDASQEMTDIESFAVL
FT                   EPLHDAYRNWQKKDYVVQPEELMLDRTQLMGLTAHEMTVLIGGMRVLGANYAGSAHGVF
FT                   TDRVGVLSNDFFVNLTDMSYNWKPAGNNLYQIIERKTGTVKWTATRVDLVFGSNSVLRS
FT                   YAEIYAQDDAKEKFVHDFVNAWTKVMNADRFDLA"
FT   gene            complement(452242..453456)
FT                   /locus_tag="Sputcn32_0416"
FT   CDS_pept        complement(452242..453456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0416"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: shm:Shewmr7_3712 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74148"
FT                   /db_xref="GOA:A4Y2G5"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2G5"
FT                   /protein_id="ABP74148.1"
FT                   /translation="MTFIESLTLMLALMYLASLSYWSGQKWGAIATLLCSLAAVAISLY
FT                   WPLALGLLIALPAAFAVNKFAPDSLKQEIKINTLREGTQHLLALSLLLVAIQYTINTIL
FT                   LKQGITPWLMRPDVVDAFLPIAGGIELKAIISLNLWDQTHPAAAVMLAAVLVTGLLCKR
FT                   AFCGWACPLGLAGEYLYAFRKRFIKAELAPPAWLDWPLRMLKYLLLFALCYIVIGMPAQ
FT                   TIPYYLEGNYHKIADLKMALFFITPGLVTLLCFGLILALAAWRRQGFCRYLCPYGAMLG
FT                   ILSFASPLKIRRDTQHCLIDAKGMKCDKCTRACPANIIVHTKTTVRSDECQACMRCVAA
FT                   CPKSAALGLSLKSGHRLGHKGLLALVLLALFALPLGAYLGGFWHSQTPDNIRMELIKVI
FT                   DRVGH"
FT   sig_peptide     complement(453385..453456)
FT                   /locus_tag="Sputcn32_0416"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.947) with cleavage site probability 0.724 at
FT                   residue 24"
FT   gene            complement(453975..454196)
FT                   /locus_tag="Sputcn32_0417"
FT   CDS_pept        complement(453975..454196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74149"
FT                   /db_xref="GOA:A4Y2G6"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2G6"
FT                   /protein_id="ABP74149.1"
FT                   /translation="MSQQGSAGNVIAAIASLFFPGLGQLLQGRIIAALLFFVITVVGYA
FT                   LWWLIVPAVIGAIFHLWAIIDAARFKAD"
FT   gene            454278..455162
FT                   /locus_tag="Sputcn32_0418"
FT   CDS_pept        454278..455162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0418"
FT                   /product="tRNA-processing RNAse BN"
FT                   /EC_number="3.1.-.-"
FT                   /note="TIGRFAM: putative ribonuclease BN; PFAM:
FT                   ribonuclease BN; KEGG: shm:Shewmr7_3708 putative
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74150"
FT                   /db_xref="GOA:A4Y2G7"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2G7"
FT                   /protein_id="ABP74150.1"
FT                   /translation="MTKKIEVAQIRVLFLGIWRFLQHLRLRLVEDQINIRAGHLAYVTL
FT                   LSLVPLVAVTMSMLSAFPVFKGIRGQIEAFVYENFLPAAGDTVQIYINEFVGNASKGTA
FT                   VGIAALVVVAIMLISAIDKSLNNIWRTKEKRSVVVAFSMYWMVITLGPVLVGASLVATS
FT                   YVVSLKLFEDDTFSGVVPLFIERLPMLFSVAAFLLLYMVVPNQKVKFLHALLGALVAAL
FT                   LFELGKKAFALYVTQFPSYEAIYGALATIPILFVWVYLSWMIVLLGAEITAAMPEYLDY
FT                   ESSFDKDEASTKT"
FT   gene            455234..455671
FT                   /locus_tag="Sputcn32_0419"
FT   CDS_pept        455234..455671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0419"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   shm:Shewmr7_3705 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74151"
FT                   /db_xref="GOA:A4Y2G8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2G8"
FT                   /protein_id="ABP74151.1"
FT                   /translation="MIALIQRVSRASVVVDNQTLGSIDKGLLVLLGVEREDNREKMEKL
FT                   ATKVMSYRVFSDENGKMNLNLEQVGGSLLVVSQFTLAADTGRGLRPSFSGAGTPDQALT
FT                   LYEEFVAFCRDKGVTTETGQFGADMQVSLVNDGPVTFNLQV"
FT   gene            455761..456210
FT                   /locus_tag="Sputcn32_0420"
FT   CDS_pept        455761..456210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0420"
FT                   /product="thioesterase domain, putative"
FT                   /note="TIGRFAM: thioesterase domain, putative; KEGG:
FT                   son:SO4397 hypothetical acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74152"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2G9"
FT                   /protein_id="ABP74152.1"
FT                   /translation="MRMDQLLIKLRQTWHSTIPVSEFMQIVPLDYSEGEFRVTAPITPN
FT                   INLHQTMFAGSIYTLMTLTGWGAVWLNQQLIGVAGDIVLADAHMRYLAPVSSQPVARVV
FT                   WQDANLAGLSAGRKAKVRLVVELYCGEQRCAEFTGLYISIPNITK"
FT   gene            456367..457587
FT                   /locus_tag="Sputcn32_0421"
FT   CDS_pept        456367..457587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0421"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap; KEGG:
FT                   mag:amb2240 TPR repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74153"
FT                   /db_xref="GOA:A4Y2H0"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2H0"
FT                   /protein_id="ABP74153.1"
FT                   /translation="MRFLSSVLIVLFCFHLSGCANTKLNANKLPKGVVLNKSITLPVDV
FT                   SVAYYLPHSQLNNRFYLEKWNIWVDPGKSLSDGVKDGFGAYFSNAKLLDRTQANQYGLL
FT                   IDIDPEWKFESGKAEMIMSYRVFNGSDKPIREGQKSFKTDIGYLGDGLGLYNASLRATQ
FT                   LVIVDVLNALTPSANNYPAQYAMKDVSANLLANMKKPVSTGTGFYINPQGQIVTAAHVL
FT                   KNCMVTQVNVGDKSFDAIVEASSTLLDLAVVSTGTPVEQYLPLRKGTEIFLGEAITNVG
FT                   YPLQGLLAASPNLTRGNISSREALKGAVGQFQFSAPIQPGSSGGPVVSDGGELLGITVS
FT                   TLNVTSLRESGALPQNVNFALDAKYAARFLDKHHISYQSVEPNMKGDIRTANAAALGAV
FT                   VQLNCYQ"
FT   sig_peptide     456367..456429
FT                   /locus_tag="Sputcn32_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.609 at
FT                   residue 21"
FT   gene            457599..458132
FT                   /locus_tag="Sputcn32_0422"
FT   CDS_pept        457599..458132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74154"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2H1"
FT                   /protein_id="ABP74154.1"
FT                   /translation="MPFMLRILMLGLLLISPFVKAQTTVLPPVFFISTIDSTDFYNKLK
FT                   GTPLFEKMDKENIGNPLKLIVTYNMEPTAGGEAAGLTSAILAGGSLGLLPMVTNNDLVL
FT                   TYEFRVHNEVVASVSYRENFTKAHNMYSNEGLYSLDKDSLAWAMTTTDKFIEDIQKVPE
FT                   LSHLINEYNYYFVQ"
FT   sig_peptide     457599..457664
FT                   /locus_tag="Sputcn32_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            458321..458917
FT                   /locus_tag="Sputcn32_0423"
FT   CDS_pept        458321..458917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0423"
FT                   /product="(Acyl-carrier-protein) phosphodiesterase"
FT                   /EC_number="3.1.4.14"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: shm:Shewmr7_3703
FT                   (acyl-carrier-protein) phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74155"
FT                   /db_xref="GOA:A4Y2H2"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2H2"
FT                   /protein_id="ABP74155.1"
FT                   /translation="MSKVLILKSSILGGYSQSAVLIDHLASHWENQGAAITVRDLGGKD
FT                   VLPMVDGEIASGLRGGAELSARQQEMLALSDTLVAELKANDTIVIAAPMYNFTIPAQLK
FT                   NWIDFIARAGVTFTYTETGSKGLVEGKRAVLVTTRGGAHKDGPTDHVVPYLKTVLAFIG
FT                   ITNVEVVYAEALNMGPEAHDKGMSEAKHSIDLLTA"
FT   gene            complement(459054..459620)
FT                   /locus_tag="Sputcn32_0424"
FT   CDS_pept        complement(459054..459620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0424"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: shm:Shewmr7_3700
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74156"
FT                   /db_xref="GOA:A4Y2H3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2H3"
FT                   /protein_id="ABP74156.1"
FT                   /translation="MQTINSYLATTLKALRNQKGWSLDKAAQETGVSKAMIGQIERGES
FT                   SPTIATLWKIASGFNISLSTFLEPTPQSQGAVFRKPDELRQQPATDGMLVASLFPFEER
FT                   FGFEMFELTLLPNYERLSEPHETGVTEHVIVLSGTMEVLVDGEWQPLKQGEAVRFAADK
FT                   PHGYRNLNEQAVVFHDIIHYQRGSI"
FT   gene            459784..460971
FT                   /locus_tag="Sputcn32_0425"
FT   CDS_pept        459784..460971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0425"
FT                   /product="benzoate transporter"
FT                   /note="TIGRFAM: benzoate transporter; PFAM: Benzoate
FT                   membrane transport protein; Xanthine/uracil/vitamin C
FT                   permease; KEGG: shm:Shewmr7_3699 benzoate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74157"
FT                   /db_xref="GOA:A4Y2H4"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2H4"
FT                   /protein_id="ABP74157.1"
FT                   /translation="MWRDAGSLSKISAGFIAVLVGYSSSAVIIFQAAEAVGATPAQISS
FT                   WLWALGVGMGVTSIGLSLYYKNPILTAWSTPGAALMVTSLAGLSVNQAIGAFLVSSILI
FT                   TLCGVAGWMDKLIRIMPQSVASAMLAGILLQFGLGLFQAMQTQLSLILIMLLVFVVVKP
FT                   FAPRYIILLTLLVGIGMSFQFDLLKLDAVQLQLAMPVWTTPEFSLASVIGVALPLFVVT
FT                   MASQNMPGVAALHGNGYRPPISPLITSTGLIGVILAPFGGFAFNLSAITAAICMGKEAD
FT                   PNPATRYWAAVWGGVFYFITGLLGATVVGLFSAFPKELVLAIAGLALLGTIANSLTAAL
FT                   AKTEDREVAVITFLVTASGFSVLGIGSAFWGLLLGFIIHWWNGHRTASVVKRANT"
FT   gene            complement(461022..461498)
FT                   /locus_tag="Sputcn32_0426"
FT   CDS_pept        complement(461022..461498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0426"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   shm:Shewmr7_3696 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74158"
FT                   /db_xref="GOA:A4Y2H5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2H5"
FT                   /protein_id="ABP74158.1"
FT                   /translation="MKSTIRAMKIILDDLKGPEIAALLQEHLDDMRATSPPESVHALDL
FT                   DGLRQPNIRFWTLWDNNNLAGCGALKWLDAEHAEIKSMRTAAPYKQQGIASKILQHLIN
FT                   DAKSAGIKRLSLETGSMDFFNPARLLYCKFGFEICGPFADYRLDPNSVFMTKRI"
FT   gene            461819..462571
FT                   /locus_tag="Sputcn32_0427"
FT   CDS_pept        461819..462571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74159"
FT                   /db_xref="GOA:A4Y2H6"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2H6"
FT                   /protein_id="ABP74159.1"
FT                   /translation="MVKQFYKYRSFTILNLLKDRRERPLLISTLLAFIVLCIVEIRFPI
FT                   FPFFIGSGLEDVLISDATKNIFSGLLIGLISAYIFYVFIDFIPRSRKEREIFSVLNSLI
FT                   ASVLHSYKNCHIYGHETALPHVDKSVLEKLWLESSLVTFRKNNSKYLPLLQAMNTSFTR
FT                   LDDFRHVLPLVVALSPKHTMQWLVLTDKIRLLAENYGENPEVSIDKQHLIDKNTDDNPI
FT                   LEYKTALNFRMLEIIEESICWLYPSENG"
FT   gene            complement(463101..463400)
FT                   /locus_tag="Sputcn32_0428"
FT   CDS_pept        complement(463101..463400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0428"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   she:Shewmr4_0332 plasmid stabilization system"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74160"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2H7"
FT                   /protein_id="ABP74160.1"
FT                   /translation="MNNKRYKLSRLSQTHLQQIKDYTLQHFSESQWHKYKESLISGLQM
FT                   LADNPGLGRSCEDIYPNGFYFPIAKHTAYFTKEDDFILIVALLGQPQLPQNHLK"
FT   gene            complement(463409..463651)
FT                   /locus_tag="Sputcn32_0429"
FT   CDS_pept        complement(463409..463651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0429"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: shm:Shewmr7_3693
FT                   prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74161"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2H8"
FT                   /protein_id="ABP74161.1"
FT                   /translation="MQTLTANEAKRNFGELLLNAQREPIKISKNSKDAVVVMSIHDYEQ
FT                   LEAMKADYLKHCFNAAKEDLAKGNVVDGEDFLNAL"
FT   gene            complement(463931..464674)
FT                   /locus_tag="Sputcn32_0430"
FT   CDS_pept        complement(463931..464674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74162"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2H9"
FT                   /protein_id="ABP74162.1"
FT                   /translation="MKPLFAGMLLSISLLSSPLLAQEYTVETYQEIFKGDNQFKQKEAI
FT                   ESLTIAGLSDPAIFDALEAKLLASLPQATEKNAIDYSAWLVKGLAYSGNDKYSETINKI
FT                   VNGDYPKKLKKYAGQALENITIYKKWNAILADKSQYTADQSQQNNAFANALRSNDLELM
FT                   RLAAKRIMDDRQYDDFILTVLSNELKTVRLMADDRLAIDTYANMAKALASSGNTAYRDV
FT                   IENMATASSNKKLKNYAESYLKKYY"
FT   sig_peptide     complement(464609..464674)
FT                   /locus_tag="Sputcn32_0430"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(464706..465965)
FT                   /locus_tag="Sputcn32_0431"
FT   CDS_pept        complement(464706..465965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0431"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: son:SO4383
FT                   3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74163"
FT                   /db_xref="GOA:A4Y2I0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2I0"
FT                   /protein_id="ABP74163.1"
FT                   /translation="MSEATNQTRLGKRVVVTGIGGITALGHDWPTIAASLKAQKNCVVT
FT                   MGEWDKYDGLNTRLAAPITDFEVPSHYSRKKIRSMGRVSIMATRASELALIDAGLLDDP
FT                   IVSSGEMGIAYGSSTGSTDAIIAFGDMLKTGDMSGVTATSYIRMMAHTTAVNVGVFFGL
FT                   KGRIHTTSSACTSGSQGIGYAYEAIKYGHQTLMLAGGGEELCPTEAVVFDTLFATSTKN
FT                   STPELTPRPFDASRDGLVIGEGACTLVLEELEHAKARGAKIYAELVGFGTNSDGQHVTQ
FT                   PNAQTMEIAIRLAIKDAQLEPSAIGYVNAHGTATDRGDIAESHATHAVFGAGMPISSLK
FT                   SYTGHTLGACGALEAWVSIEMMNAGWFAPTLNLESIDPQCADLDYIRNELRPIDTDYVM
FT                   SNNFAFGGINTSLIFKRWAQ"
FT   gene            complement(465966..466691)
FT                   /locus_tag="Sputcn32_0432"
FT   CDS_pept        complement(465966..466691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0432"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase,
FT                   putative; PFAM: short-chain dehydrogenase/reductase SDR;
FT                   KR; KEGG: shm:Shewmr7_3690 3-oxoacyl-(acyl-carrier-protein)
FT                   reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74164"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2I1"
FT                   /protein_id="ABP74164.1"
FT                   /translation="MNNRVLVTGSSRGIGKAIALKLAVAGFDIALHYHSNQTAADATAA
FT                   EVRALGVNASLLKFDVADRATVRAAIEADIEANGAYYGVILNAGINRDTAFPAMTESEW
FT                   DSVIHTNLDGFYNVIHPCVMPMVQGRKGGRIITLASVSGIAGNRGQVNYSASKAGIIGA
FT                   TKALSLELAKRKITVNCIAPGLIETDMVADIPKDMVEQLVPMRRMGKPSEIAALAAFLM
FT                   SDDAAYITRQVISVNGGMI"
FT   gene            complement(466804..467337)
FT                   /locus_tag="Sputcn32_0433"
FT   CDS_pept        complement(466804..467337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0433"
FT                   /product="thioester dehydrase family protein"
FT                   /note="KEGG: son:SO4381 thioester dehydrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74165"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2I2"
FT                   /protein_id="ABP74165.1"
FT                   /translation="MQLLKINQPFAEQNIADFIPHRAPMILLDKIIGYRRDNLETEVTI
FT                   TAKSPYFDDKHRAVPNYVGIEYMAQSIAALAGVEAKLRNDKIRVGFLLGSRKLTLHAKQ
FT                   YELGRTYRIQVSRLYQEESGLAVFDCQIYLLPEAGSNLEKSLVAQANVNVFQPQDTQAY
FT                   LAGNQDAANRSLGH"
FT   gene            complement(467342..468559)
FT                   /locus_tag="Sputcn32_0434"
FT   CDS_pept        complement(467342..468559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0434"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; KEGG: shm:Shewmr7_3688
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74166"
FT                   /db_xref="GOA:A4Y2I3"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2I3"
FT                   /protein_id="ABP74166.1"
FT                   /translation="MVKRHTMMNRVAITQIGLCTPLGQDPQQVLDRLIAGDTSAMLRSD
FT                   TLLFEHPTLVAPVTAALPTIPEKLIQFDCRNNQLLLCAALQIATTVEQAKRDFGHARIG
FT                   VVLGTSTSGISKGEAALSYRNQHGYFPADYHYFQQELGSTSDFLRQYFELDGPCYTIST
FT                   ACSSSAKVFASAKRLLQANLCDVVIVGGVDSLCQLTVNGFNALESVSKGHCNPFSINRD
FT                   GINIGEGAALFVLTLGESEVMLAGIGESSDAHHMSAPHPEGAGAIKAMHAALQDAHIAA
FT                   KDIGYINLHGTATPKNDAMESRAVVEVFGVNTPPCSSTKPLVGHTLGAAGAIEAAFCYL
FT                   LLSAHNHGKALPPHQWDGQVDPQDPPIALVERHQVAAKGALNYVMSNSFAFGGSNASLI
FT                   FCRNEA"
FT   gene            complement(468588..469352)
FT                   /locus_tag="Sputcn32_0435"
FT   CDS_pept        complement(468588..469352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74167"
FT                   /db_xref="InterPro:IPR021675"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2I4"
FT                   /protein_id="ABP74167.1"
FT                   /translation="MSLNFGAKWREFLALLIISLGLTGCSELLFRQTCVGLAKDMRYCL
FT                   APLPHDFAPAADKPLIKPTAKPADISSQQTESKTGVSSPQSFSQKVSIKVGDKSHELLT
FT                   QLELEDERMTLVGLAPLGQALFTLVYDGNTLSSEQSVLLGDNFKAEYLMAMMQLIYWPE
FT                   QSIRAHLEGGHLVTGLCDTVGGNQGDTLIGTRVNTIPCRQIYSQDTLISKSGQQTHVVQ
FT                   IRYQQNIGDVLWQAHISLTMPQAKFELEIEPI"
FT   gene            complement(469357..470646)
FT                   /locus_tag="Sputcn32_0436"
FT   CDS_pept        complement(469357..470646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0436"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase, FAD-binding; FAD dependent
FT                   oxidoreductase; tryptophan halogenase; KEGG:
FT                   shm:Shewmr7_3686 monooxygenase, FAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74168"
FT                   /db_xref="GOA:A4Y2I5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2I5"
FT                   /protein_id="ABP74168.1"
FT                   /translation="MPTPAHDLSAMPNSLAVDVAIIGAGPSGAIAASLLHQQGKRVLVL
FT                   EKQHFPRFSIGESLLPCCMQFIEEAGMLDALNAAGFQHKNGAAFRRNGTYTTFDFTDKF
FT                   TPGPGTTFQVQRASFDKLLADTAQSQGVDIRYGETVEAIDLTENPCLMVRNEQGELYQI
FT                   SAQYVLDASGFGRVLPRLLDLESPSCLPQRSAIFTHVEDNISDPNFDRNKILISVHPEH
FT                   KDIWYWLIPFSNGRCSLGVVAEPQLLARLQGSLEQQLMSIVNEEPGLKALLANAKVVQE
FT                   CATLKGYSANVSRLATDKFALLGNAGEFLDPVFSSGVTIAMQSASMAAKCVTKQLNGET
FT                   VDWQADYSAPLMQGVNTFRTYVQAWYDGRFQDVIFYEEPNPRIKQMICSILAGYAWDLN
FT                   NPFVKDSERRLNMVVELCQNQVAIPEFAEA"
FT   gene            complement(470670..473111)
FT                   /locus_tag="Sputcn32_0437"
FT   CDS_pept        complement(470670..473111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74169"
FT                   /db_xref="GOA:A4Y2I6"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2I6"
FT                   /protein_id="ABP74169.1"
FT                   /translation="MASNFAVRANQALIQSSPKWRLAIWLLVMLSASLWTLQLWQNGAR
FT                   VQSDILAMLPHLQQDKLTERALNQVEATLADQVYIALVAKDETTAIAAAQLLMQKLETD
FT                   LVATGKNAALTEIRSADMQLGEALGQYYFPHRFRLLTAPQAEALATKDIGNLIEAATAQ
FT                   LYNAFSYANSNLLAQDPLLLFPANLLALAPSSKVRASQGILLANQGDNVAAVVMAKGQE
FT                   SAFNPNAQLPQMTALTLGLDAVKQSYPDITLLKAGALFHAIAATQTAKSEISILGLASL
FT                   LGVITLVWLAFRSVMPLLLAIVTISSGLLLAVTLTLSVFGELHLLTLVFGTSLIGIAID
FT                   YSFHFYCERLSDTERNAKATVAYIFPTVTLAFITSALAYVGIGLAPFPGMQQVAIFCAA
FT                   GLLGAYLTLILAYPLLAGGRLPSGSRPLALAGKYLANLTQLSNRLTTPLGMGMFALVIV
FT                   VWCLVGATKLTVDDDIRHLQQSPASVTEPENQLRQLLSGGTDNQFLLVRAASEEALLQQ
FT                   LERVSPLLDAAIAHQELGNYVSLSRYLPSHQRQDTAYRLQGEIYQTQIDTVLTSLGLDE
FT                   NLKPELQASYLAAKEQYISPADFFKLEAGKQLAPLWLAPNGKATDYDALNDGGVSAEYG
FT                   AIVLLGGIKQIDALKARFAHDESVQLIDKVADISAVMGHYRLLTLKLLALALGIALLLF
FT                   SLSFGIKKAAVVVAVPALAALLTLATLGITGSPLSLFHALALILVFGIGIDYSLFFASA
FT                   QQHGKAVMMAVFMSACSTLLAFGLLAFSQTQAIHYFGLTLSLGIGFTFLLSPLILTTKK
FT                   S"
FT   gene            complement(473114..473881)
FT                   /locus_tag="Sputcn32_0438"
FT   CDS_pept        complement(473114..473881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74170"
FT                   /db_xref="GOA:A4Y2I7"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2I7"
FT                   /protein_id="ABP74170.1"
FT                   /translation="MNAALTHIKLMLILCFCSVLISAQCKADTSTTAVSANNYQQLFTQ
FT                   TADKAQLVALSQKLNLGETVRGQFVQSRQLKVLKKPLISQGQFIFDQTQGLIWQQIKPF
FT                   ESLLILKDKQLIQRDSQGRVQVSKADASASAAAMGDLLPSLVRAMLGGDISGLSENFEL
FT                   HFLITDRLSPERLSTDGQWQLGLTPKDPLMKKAIANMVLEGSDVLQSLVLLSAAPNVSP
FT                   QDMTRIDFSALSQGKLSETELAQYAVAIEAKKP"
FT   sig_peptide     complement(473798..473881)
FT                   /locus_tag="Sputcn32_0438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(473878..474312)
FT                   /locus_tag="Sputcn32_0439"
FT   CDS_pept        complement(473878..474312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0439"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   shm:Shewmr7_3683 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74171"
FT                   /db_xref="GOA:A4Y2I8"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2I8"
FT                   /protein_id="ABP74171.1"
FT                   /translation="MKSLLTIDMEMQIPFHDVDSMGITWHGNYLRYFEIARCKLLDELG
FT                   YNYRQMQASNYAWPIIDLQIKYVKASTFEQKITVRAELVEWENRLKINYQIRDVETGAR
FT                   ITKGYTIQAAVDMSTQELCFVTPEVFRDKIAILLAKVENQ"
FT   gene            complement(474309..475883)
FT                   /locus_tag="Sputcn32_0440"
FT   CDS_pept        complement(474309..475883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0440"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   she:Shewmr4_0344 histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74172"
FT                   /db_xref="GOA:A4Y2I9"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2I9"
FT                   /protein_id="ABP74172.1"
FT                   /translation="MSHTQAADSKNQSDLKTVEFGRQFLTLEQVVAVAKGAPVKLCDDA
FT                   DYQEYIQKGARFIDSLLHEEGVVYGVTTGYGDSCTVNVSLDLVHELPLHLTRFHGCGLG
FT                   ETLSIMQARAVMACRLNSLAIGKSGVTYELLKRIETLLNLNIVPVIPEEGSVGASGDLT
FT                   PLSYLAAVLVGEREVIYQGERQATQAVYAKLNIIPHVLRPKEGLALMNGTAVMTALACL
FT                   AFDRAQYLARLSSRITAMASLTLKGNSNHFDEILFAAKPHLGQNQIATWIREDLNHHEH
FT                   PRNSDRLQDRYSIRCAPHIIGVLQDALPFMRQFIETEVNSANDNPIVDGEGEHILHGGH
FT                   FYGGHIAFAMDSLKNTVANLADLIDRQMALVMDPKFNNGLPANLSGSTGPRRAINHGFK
FT                   AVQIGVSAWTAEALKHTMPASVFSRSTECHNQDKVSMGTIAARDCMRVLQLTEQVAAAA
FT                   LLAMTQGIGLRIAQNELDEASLTPSLAKTLAQVRGDFETLIEDRPLEAVLRQTIAKIQA
FT                   GEWEVCR"
FT   gene            complement(475880..477769)
FT                   /locus_tag="Sputcn32_0441"
FT   CDS_pept        complement(475880..477769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0441"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; lipid A
FT                   biosynthesis acyltransferase; KEGG: shm:Shewmr7_3681
FT                   glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74173"
FT                   /db_xref="GOA:A4Y2J0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2J0"
FT                   /protein_id="ABP74173.1"
FT                   /translation="MLTPPSDLVESAPIKLALVIPNYNHSAAIAQTLAELAQFNLPCYL
FT                   IDDGSNDETRYLLQSLAQTYPWVTLLLHPYNRGKGAAVMTGLRRAYRDGFSHALQVDAD
FT                   GQHNLADIPAMVARAQAKPDALISGKPEYDESVPNGRLYGRYITHFWVWVETLSFDIQD
FT                   SMCGFRVYPLAATERLLCQQALTERMDFDIEILVKLYWQGVEILFQPTKVIYPEGGVSH
FT                   FQGVADNVRITKLHTKLFFGMLKRLPWLLKRKSQRKSQQQAAQNSHCSSATQSTSATSS
FT                   TSATHWSGMKERGSYWGIKLLAESYRIGGHWLCRAIMYPVICYFFLTGKVTREASLDFL
FT                   RRVQTLEPQHPKLNQPVGWRDSLNHFLAFGNAALDRIDAWCDRIQLSQVDFPDRQVLAD
FT                   QLESGKGALLLVSHLGNLELCRAISIHQRKVKVNVMVLTSHAENFNNVLKQLNPDSTLN
FT                   LIQVTELNPATSMLLQQKIEAGELVVIAGDRTSSNTQGRVIYAPFMGQDAAFPQGPFIL
FT                   AGLLDCPVFLMFCLREQGRYRVHLEHFAETLKGPRAGRMDRLQQAVNRYSERLEYFARR
FT                   EPLQWFNFFDFWRKDSELERASANSVQADAVTTESASSQVPEQDHKTDRTSHS"
FT   gene            complement(477763..478176)
FT                   /locus_tag="Sputcn32_0442"
FT   CDS_pept        complement(477763..478176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0442"
FT                   /product="thioester dehydrase family protein"
FT                   /note="KEGG: son:SO4372 thioester dehydrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74174"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2J1"
FT                   /protein_id="ABP74174.1"
FT                   /translation="MIKSSLPPILHSNIGIDNIELRLLVAADLESFKGHFPEQAVLPGV
FT                   TQLDWAVRLGCQYFGYCEAVANLEVLKFQQLILPGQEVTLSISNNAAKGKLTFAYSDGE
FT                   NRYASGRIAFETTPLVNQPADTTNANSNGASQC"
FT   gene            complement(478169..479533)
FT                   /locus_tag="Sputcn32_0443"
FT   CDS_pept        complement(478169..479533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74175"
FT                   /db_xref="GOA:A4Y2J2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2J2"
FT                   /protein_id="ABP74175.1"
FT                   /translation="MTQLLKNWLTQGPFAQQLISFNHHDIVTGALFTNQVAYFYEQLLA
FT                   APEKKWLLASDTSDLFAVGLCAALLAGKEIILPANTQTGTLSELTHQFEGILSDKPLCE
FT                   SQAFILLRKELSLPSKPWPASEAIGELVLFTSGSSGEPKAIRKTLQQLDVEVSVLEHTF
FT                   AEHLPHCSVVSTVSHQHIYGLLFKILWPLAASRPFLSEQIEYPETLSYYTALLPNLCLI
FT                   SSPAQLSRLPKALEHERQLRSPSLVFSSGGPLSFAAAQGISQCYGHLPIEIFGSTETGG
FT                   IAYRRQHEADEPWQVFDRISIDQDPSDGALLLKSPYLVDDEWLRCEDKIEPTENGQFRL
FT                   KGRLDRIVKIEEKRLSLAQMETLLGSHAYVEQAALVVLPQFKSQLGAVVTLSALGRSVH
FT                   QEQGKLSINNALKAHLLTQFERVTLPRRWRYPDILPLNTQGKRVTAQLVELFDHD"
FT   gene            complement(479530..480078)
FT                   /locus_tag="Sputcn32_0444"
FT   CDS_pept        complement(479530..480078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74176"
FT                   /db_xref="GOA:A4Y2J3"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2J3"
FT                   /protein_id="ABP74176.1"
FT                   /translation="MRALLQVLTALTLLAYPVAVYLGLSYLPAGTIALVLCLLLIMRLM
FT                   LQKQRVKTLVLPLLVGIVLTAGSYIAKRSDWLLYYPVVINLTMLALFSYSLHTGPSMIE
FT                   RLARLKEPDLPDEATGYLKKVTLLWCGLFIFNGTMAAYTAGFTSLATWTLYNGLIAYVL
FT                   MGLLLGGEWLYRSFWLKKT"
FT   gene            complement(480078..480326)
FT                   /locus_tag="Sputcn32_0445"
FT   CDS_pept        complement(480078..480326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0445"
FT                   /product="phosphopantetheine-binding"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   shm:Shewmr7_3677 phosphopantetheine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74177"
FT                   /db_xref="GOA:A4Y2J4"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2J4"
FT                   /protein_id="ABP74177.1"
FT                   /translation="MQNREQILAMLTTILVDEFEIDAEAITPEANLYEELDLDSIDAVD
FT                   LVIKLQQLTGKKIQPDEFKSVRTINDVINAIEGLVKT"
FT   gene            complement(480336..480590)
FT                   /locus_tag="Sputcn32_0446"
FT   CDS_pept        complement(480336..480590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0446"
FT                   /product="acyl carrier protein, putative"
FT                   /note="KEGG: son:SO4368 acyl carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74178"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2J5"
FT                   /protein_id="ABP74178.1"
FT                   /translation="MNLNNEIKQLIIDCLDLEDVSIDDIETDAPLFGEGLGLDSIDALE
FT                   LGLAIKKKFDVKIEANSDATKAHFHSVASLARFIESQRP"
FT   gene            complement(480574..481449)
FT                   /locus_tag="Sputcn32_0447"
FT   CDS_pept        complement(480574..481449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0447"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   she:Shewmr4_0351 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74179"
FT                   /db_xref="GOA:A4Y2J6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2J6"
FT                   /protein_id="ABP74179.1"
FT                   /translation="MFDAAHSHDAAKDHQDSMLNAAYTLPETRRKGLNYVPRWLGGVSC
FT                   YIAFGLGGLLSSLTILPLLRFWPGTPEARIIRVQKAVHLMFKGFVAMLTWAGVIKVSSH
FT                   DAQKLHDAKGVIVIANHPSLVDVVVLISLMPNAGCIVKQALWRNPFLRGVVSCAGYIPN
FT                   RGAELMLEDCREVLARGTNLIIFPEGTRTVVGATINHFARGAANIALRAEADILPVVLR
FT                   TNVRGLTKEQPWYEIPRQTMGMAVEIGTIVSYQKYQAALGEHAKMARQLTRDLEHYYKQ
FT                   QLENNYELKQ"
FT   gene            complement(481442..482185)
FT                   /locus_tag="Sputcn32_0448"
FT   CDS_pept        complement(481442..482185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74180"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2J7"
FT                   /protein_id="ABP74180.1"
FT                   /translation="MQLTFSILSWGAWAPQYPLNDSWQCWRKNSAEQTSGTSTTSELDT
FT                   TSPPLTHIPSMQRRRFSRLTKMMLEVSFRCSVTHNCRSIFASRHGELQRTIGLLEDIIA
FT                   KQPLSPLGFSQSVHNTASGIFGIVAANTAPSTSIAAGTETLSQAMVEAFAQLHQSPEPL
FT                   LLVFGDDPVPPVYDEFTQEFELPLALGLQLAPFDTPASAKLTVSHISKATALNPLTYGA
FT                   FIHALATAQNISGCLSQWHWRLEHV"
FT   gene            complement(482525..483424)
FT                   /locus_tag="Sputcn32_0449"
FT   CDS_pept        complement(482525..483424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74181"
FT                   /db_xref="GOA:A4Y2J8"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2J8"
FT                   /protein_id="ABP74181.1"
FT                   /translation="MQFNQDDRINPQETSSSSNRFALFAIVLVVLLSAGGYYYYSGDSD
FT                   SPKRIPNAPIVLPETPSSEPMTLESATEPEETTETTPTTTETNTNSTESSVTTEPEVVV
FT                   EPVPALAESDTFVQQKALAIINNNLLASSLVQQDIIRQFVVFVDNLAQGELTRKVSPIK
FT                   GPEKLFTVSEITNKVYLNPDSYHRYDAYVDSITKMDEQSLIRTYKQLTPLLEEAFSELG
FT                   YSNAKFNDRMQQAIKVLLAAPIVEDPIELSSISVNYQFVDPNLEALPSAQKLLIRMGPE
FT                   NTRKLKVALRKLENQLAQ"
FT   gene            complement(483607..485697)
FT                   /locus_tag="Sputcn32_0450"
FT   CDS_pept        complement(483607..485697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0450"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: she:Shewmr4_0354 ATP-dependent DNA helicase
FT                   RecG; TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   helicase domain protein; nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74182"
FT                   /db_xref="GOA:A4Y2J9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2J9"
FT                   /protein_id="ABP74182.1"
FT                   /translation="MSANDLQQLDLVPITDLKGVAKKVAEKLAKLGITTVQDLLFHLPL
FT                   RYEDRTQIYPIAALSPGSYGTIEAEIQSTQIIQGRKRMLVCNVRDDTGSLSLRFFNFSV
FT                   AQRNAMQNGLMIRAYGEVRRGSHQAEIVHPEYKVVYPDEDVHLSDTLTPIYPTTEGLKQ
FT                   ASWLKLTEQALVLLKEGGLTELLPPQLQPNNISLKQALQTLHRPPAGISQFDLELGQHP
FT                   AQQRLVQEELLAHNLSMLRLRQRSNLDAAVTMQATGQLLNPFLAALPFKPTGAQQRVVA
FT                   NIGKDLEKPHPMMRLVQGDVGSGKTLVAAMAALQAIENGYQVAMMAPTELLAEQHATNF
FT                   AAWFEPLGLKVGWLAGKLKGKARTQSLADIESGAAQMVIGTHAIFQQHVVFNKLALIII
FT                   DEQHRFGVHQRLGLREKGMSQGFHPHQLIMTATPIPRTLAMTAYADLDTSIIDELPPGR
FT                   TPVTTVAIADSRRNEVLERVRNAVITDQRQAYWVCTLIEESEVLECQAAEDTAEELRLA
FT                   LPDLNIGLVHGRLKSAEKQQIMADFKAGMIHLLVATTVIEVGVDVPNASLMIIENPERL
FT                   GLAQLHQLRGRVGRGAIASHCVLLYKAPLSHTATQRLSVLRQSNDGFIIAQKDLEIRGP
FT                   GEVLGTKQTGLAELKIADLVRDQALIPHIQKLASHVMAQAPEKVDAIILRWLGHRQHYV
FT                   QA"
FT   gene            485930..486643
FT                   /locus_tag="Sputcn32_0451"
FT   CDS_pept        485930..486643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0451"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: yps:YPTB2345 multiple antibiotic resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74183"
FT                   /db_xref="GOA:A4Y2K0"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2K0"
FT                   /protein_id="ABP74183.1"
FT                   /translation="MYFQVVVLALLALLPMVNPPTTATLLLGLSKGMSREHVRHQVNLA
FT                   AIYLFCTLCVCFFIGSSILELFGISIPGLRLAGGLIIGFIGFRMLFPTPAQANNVDINE
FT                   SIAFVPLTMPSMCGPGTMALVISGAAQIAELPDEYSRFTIYSAMVTAFALMSLISWGVL
FT                   KLADPVCKILGATGIDAMTRIMGFLLVCMGMQFCINGIKEVAQDPVFHTPLIQKTALEM
FT                   GDSPTSLISPQPLAI"
FT   sig_peptide     485930..486001
FT                   /locus_tag="Sputcn32_0451"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.665 at
FT                   residue 24"
FT   gene            complement(486761..488206)
FT                   /locus_tag="Sputcn32_0452"
FT   CDS_pept        complement(486761..488206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0452"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   she:Shewmr4_0916 OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74184"
FT                   /db_xref="GOA:A4Y2K1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR032608"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2K1"
FT                   /protein_id="ABP74184.1"
FT                   /translation="MGQNTLLSAVLLTTTAFGANAEQLFIPFSDAKSPEEKRIHFTPFD
FT                   IITAVNDNKLTLLTVSGQLTRQSVELPESYSPEHVINNYLAQMKKLNAEVLFNCKAASC
FT                   GDGQAMQSQLKPLREVNADYHSAYVAAKMKGTSGDVYSSIYAVNREGRYTYIQVDILEV
FT                   IPEPLDLIQANNSFLQQAPKEIEIKDKRSEDAQGSADHPLLGRMPGSYIAHYKQINFTQ
FT                   VPVIVGMTGSDYQTKPLAAKLTQISYRMPESYSLFEINSNYAAAAQKLAAERIFHCKGT
FT                   ACGDDDSLIKAMGLFKDDQDDEGQEYQLFQLSHPQGDVYFDIYSQGYSNGTPTDTTVRV
FT                   MELSALKDDRVAINLDALTDAISQTGKATLEGLLFDYDSERMLPESKPVLEVLATYLKQ
FT                   NPALSFYVVGHTDDKGERSYNQSLSERRAAAVIKQLNEAFNIPSVQLTAHGNGEYSPVA
FT                   SNANDTGQRLNRRVELVLRSDKK"
FT   sig_peptide     complement(488141..488206)
FT                   /locus_tag="Sputcn32_0452"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.967 at
FT                   residue 22"
FT   gene            488359..488712
FT                   /locus_tag="Sputcn32_0453"
FT   CDS_pept        488359..488712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74185"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2K2"
FT                   /protein_id="ABP74185.1"
FT                   /translation="MNMNIRNGIRLEGEGFDLLPELKKIYFTNGLCLRKALSNNEQQYI
FT                   NRVIFVDWTQKTSPALVLRHEKSTVYVAVVNHHDTQIEITLLRAGFHGQVVRNSSLVSH
FT                   LSAIDCQSIECFT"
FT   gene            489267..489623
FT                   /locus_tag="Sputcn32_0454"
FT   CDS_pept        489267..489623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74186"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2K3"
FT                   /protein_id="ABP74186.1"
FT                   /translation="MEAEDGSAEGYQLYYRCQRWNNCKEVGGSASVFTEAFFRNHKKKL
FT                   GIPWELMRDGSAFGKDSSDFEDAKGHLYQYALKFSEDNWRLFEGRIPLETSDLAEQKFW
FT                   QWCSIQPLSIWENE"
FT   gene            complement(489949..490812)
FT                   /locus_tag="Sputcn32_0455"
FT   CDS_pept        complement(489949..490812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0455"
FT                   /product="YicC N-terminal domain protein"
FT                   /note="PFAM: YicC N-terminal domain protein; domain of
FT                   unknown function DUF1732; KEGG: shm:Shewmr7_0351
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74187"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2K4"
FT                   /protein_id="ABP74187.1"
FT                   /translation="MIQSMTAYARIEHKAQWGTASWEIRSVNQRYLETYLRLPEQFRSF
FT                   EPVLRDRLRKRLSRGKVEVNLRYELADNSNNELQLNQALAKQLLDAATWLKQEAGQGDV
FT                   NLTDILRWPGVLASGEQDMDAIGADLMTAFDSAIDQFIEARGREGEAIKDMLLSRLDGV
FT                   SEQIAIVREHMPTVMLYQREKLTNRLAEIKGELDPARIEQEMVLLAQKQDVAEEMDRLE
FT                   AHVAEARRILKKGGSEGRRLDFMMQEFNRESNTLASKSISTEITSAAVELKVLIEQMRE
FT                   QIQNVE"
FT   gene            491350..492063
FT                   /locus_tag="Sputcn32_0456"
FT   CDS_pept        491350..492063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0456"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: son:SO4256 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74188"
FT                   /db_xref="GOA:A4Y2K5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2K5"
FT                   /protein_id="ABP74188.1"
FT                   /translation="MRPSNRTPAQTRPITITRQFTAHAEGSVLVEFGETKVLCTASFTE
FT                   GVPRFLKGQGQGWVTAEYGMLPRSTHSRMDREAARGKQSGRTQEIQRLIGRALRACVDM
FT                   KALGENTIVIDCDVIQADGGTRTASITGACVALVDALNWARGKGIIKSNPLKFLIAAVS
FT                   VGIYKGEAISDLEYIEDSAAETDMNVVMTETGKIIEIQGTAEGEPFTHEELIELLGLAK
FT                   NSIREIVDVQKAALN"
FT   gene            492231..492872
FT                   /locus_tag="Sputcn32_0457"
FT   CDS_pept        492231..492872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0457"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: she:Shewmr4_3603 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74189"
FT                   /db_xref="GOA:A4Y2K6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2K6"
FT                   /protein_id="ABP74189.1"
FT                   /translation="MKAYQREFIEFALERQVLRFGEFTLKSGRISPYFFNAGLFNTGRD
FT                   LARLGRFYAAALVDSGIDYDLLFGPAYKGIPIATTTAVALCEHHDIDIPYCFNRKEKKD
FT                   HGEGGSLVGSELKGRVMLVDDVITAGTAIRESMEIIEAHKAQLAGVLIALDRQEKGKGE
FT                   LSAIQEVERDFGCGIVAIIKLADLISYLSEKPGMEVQLAAVSQYREQYGI"
FT   gene            complement(492931..493575)
FT                   /locus_tag="Sputcn32_0458"
FT   CDS_pept        complement(492931..493575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0458"
FT                   /product="GTP cyclohydrolase"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: son:SO4254 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74190"
FT                   /db_xref="GOA:A4Y2K7"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2K7"
FT                   /protein_id="ABP74190.1"
FT                   /translation="MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEIL
FT                   TLMSLDLSDDSLADTPRRIAKMYVDEIFSGLDYENFPKITVIDNKMGFDEMVRVQDISL
FT                   TSTCEHHLVTIDGTATIAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVALQTL
FT                   LETKDVAVKMDAVHYCVKSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQ"
FT   gene            complement(493799..494392)
FT                   /locus_tag="Sputcn32_0459"
FT   CDS_pept        complement(493799..494392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0459"
FT                   /product="cell division inhibitor SlmA"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: son:SO4251
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74191"
FT                   /db_xref="GOA:A4Y2K8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2K8"
FT                   /protein_id="ABP74191.1"
FT                   /translation="MAVSPKINRREHILQCLAQMLETSPGQRITTAKLASEVGVSEAAL
FT                   YRHFPSKARMFEGLIEFIEESLLSRINIIMDDEKDTMKRCQLMLQLLLIFAERNPGISR
FT                   VLNGDALLGENERLRSRISSLFAKIETQLKQILREKTLREGRGFNLDEAILANLLLAFA
FT                   EGRIAQFVRSEFKLKPTTHFDEQWRFIQHQLLQS"
FT   gene            complement(494425..494883)
FT                   /locus_tag="Sputcn32_0460"
FT   CDS_pept        complement(494425..494883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0460"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: shm:Shewmr7_0357 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; TIGRFAM: deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut; PFAM: deoxyUTP
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74192"
FT                   /db_xref="GOA:A4Y2K9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2K9"
FT                   /protein_id="ABP74192.1"
FT                   /translation="MKTPIELKILDSRIGSEFPLPAYATLGSAGMDLRAMIDTTMTIAP
FT                   GETQLIPTGIAIHVADPGLAAVILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNR
FT                   SNSPFTLDIGDRLAQLVFVPVVQAQFKLVDEFDSSDRGEGGFGHSGTK"
FT   gene            complement(494880..496100)
FT                   /locus_tag="Sputcn32_0461"
FT   CDS_pept        complement(494880..496100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0461"
FT                   /product="Phosphopantothenoylcysteine decarboxylase /
FT                   Phosphopantothenate-cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: shm:Shewmr7_0358 phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74193"
FT                   /db_xref="GOA:A4Y2L0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2L0"
FT                   /protein_id="ABP74193.1"
FT                   /translation="MMSVSLTNKNVLLGIGGGIAAYKSADLVRRLKERGFDVRVVMSQS
FT                   AMEFITPLTLQALSGHPVASSLLDPAAEAAMGHIELARWADLVIIAPATANLLARINAG
FT                   MADELITTTCLATEAPIALCPAMNQQMYRNLATQANLTSLQSRGYTLWGPASGSQACGE
FT                   VGPGRMLEPLEIAELASDFFATKEVSAQPLAGQSVLITAGPTREAIDPVRYISNHSSGK
FT                   MGFALAKAAAEMGATVTLVSGPVNLATPEGVTRIDVESAQNMLDAVMDNVDKKDIFIGC
FT                   AAVADYRISDIATCKIKKSAEKMQLALERNPDILATVASLPNRPFVVGFAAETHDVETY
FT                   ARDKLKRKNLDMIAANDVSVTGQGFNADTNALRVFWPLGSQDLPATDKLTLARQLLSLI
FT                   VKEKINT"
FT   gene            496223..496900
FT                   /locus_tag="Sputcn32_0462"
FT   CDS_pept        496223..496900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0462"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG:
FT                   she:Shewmr4_3597 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74194"
FT                   /db_xref="GOA:A4Y2L1"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2L1"
FT                   /protein_id="ABP74194.1"
FT                   /translation="MGIKDWPEGEGPRDKLLQKGAAYLSDAELLAVLLRNGLAGLNAVD
FT                   LARSLISEFGGLRNLLCAPKNQVCRLPGVGPVKYAQLQAAAELARRVAQENLQRGQVLT
FT                   NPDLTRDYLMRQLTDRSYEVFAILLLDSQHRVIQFVELFRGTIDSASVYPREVVSLVLE
FT                   KKAAAVIVCHNHPSGIAEPSQADRRITERLKNALATIDVSLLDHMVVGDREIVSFAERG
FT                   WIN"
FT   gene            497022..497258
FT                   /locus_tag="Sputcn32_0463"
FT   CDS_pept        497022..497258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0463"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="PFAM: ribosomal protein L28; KEGG: shm:Shewmr7_0360
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74195"
FT                   /db_xref="GOA:A4Y2L2"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2L2"
FT                   /protein_id="ABP74195.1"
FT                   /translation="MSRVCQVTGKKPMVGNNRSHAKNATRRRFLPNLQNHRFWLEEEKR
FT                   FVQLRVSTKGIRLIDKKGIEVVVAELRARGEKV"
FT   gene            497265..497438
FT                   /locus_tag="Sputcn32_0464"
FT   CDS_pept        497265..497438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0464"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="PFAM: ribosomal protein L33; KEGG: shm:Shewmr7_0361
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74196"
FT                   /db_xref="GOA:A4Y2L3"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2L3"
FT                   /protein_id="ABP74196.1"
FT                   /translation="MAKAKGNREKIKLVSSAKTGHFYTTEKNKRNMPEKMEIKKFDPVI
FT                   RQHVIYKEAKIK"
FT   gene            497762..499081
FT                   /locus_tag="Sputcn32_0465"
FT   CDS_pept        497762..499081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0465"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: amino-acid N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase;
FT                   aspartate/glutamate/uridylate kinase; KEGG: son:SO4245
FT                   amino-acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74197"
FT                   /db_xref="GOA:A4Y2L4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2L4"
FT                   /protein_id="ABP74197.1"
FT                   /translation="MRTTELVDGFRHSAPYVNAHRGKTFVVMLGGEALAQNQFRAILND
FT                   VALLHSLGIKVVLVYGARPQIDAALAANGIAPAYHEGVRITDEDSLKVIKQVAGALQFD
FT                   ITARLSMSLSNTPMQGAQINLVSGNFVIAQPLGVDNGVDFCLSGKVRRIDVQGLKRQLD
FT                   NHCIVLMGPIAASVTGESFNLTAEEIATQVAIKLKADKMIGFSSQNGILDRNGDVIAEL
FT                   MPNDAQNIMNKLAEQGSACVGTMAFLKASIDACRNGVPRCHLVSYLEDGALLQELFSRE
FT                   GIGTQIVTESAERLRRASIADIGGVLNLIRPLEEQGILVRRSREQLEIEIEQFMLIERD
FT                   GLVIGCAALYPFEEDNAGEFACLVVHPDYRDADRGSLLLKNIIGQARSRGYSRLFALTT
FT                   RSIHWFLEHGFVIEDVDALPQKKKQLYNYQRRSKILALDL"
FT   gene            499197..499715
FT                   /locus_tag="Sputcn32_0466"
FT   CDS_pept        499197..499715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74198"
FT                   /db_xref="GOA:A4Y2L5"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2L5"
FT                   /protein_id="ABP74198.1"
FT                   /translation="MSPQFFELAPLTQTSIFSFIVLLLGIVGILLMLWLKNMPKIAKSA
FT                   SLGILLVMMGGFSWVFYQSNSAELVLTDTELTLDVPFYKVQLSRADLLPAEARIVDLQQ
FT                   EADLTPSFKTNGIGMPGFQLGWFNLQGKTKAFLAITDKSQLVLVPTTKGYSLLLTVPQG
FT                   SEFLAQLQK"
FT   gene            complement(499762..500646)
FT                   /locus_tag="Sputcn32_0467"
FT   CDS_pept        complement(499762..500646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0467"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6, transmembrane;
FT                   KEGG: son:SO4243 rarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74199"
FT                   /db_xref="GOA:A4Y2L6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2L6"
FT                   /protein_id="ABP74199.1"
FT                   /translation="MPDREYRKGILLAVSAYCMWGFAPLYFKLLNHVSATEILLHRVIW
FT                   SFVFMLIIMQFIGGFSRLRLLFKQPKQLIVLVITSILIAGNWLLFIWAVNNDHMLDASL
FT                   GYFINPLLNVLLGMLFLGERLRKLQWFAVALASAGVLIQLISFGSIPIVSLALAGTFGF
FT                   YALLRKKVNVDAKAGLLVETAVLLPVALVYLVATLDTATASMLTNDWQLNLMLMAAGIV
FT                   TTIPLLCFAGAAVRIPLSMLGFFQYIGPSIMFILAVSLFNEPFDAEKGVTFGFIWSALL
FT                   VFTLDMAYKRKPA"
FT   gene            complement(500839..501303)
FT                   /locus_tag="Sputcn32_0468"
FT   CDS_pept        complement(500839..501303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0468"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: she:Shewmr4_3591
FT                   uncharacterized domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74200"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2L7"
FT                   /protein_id="ABP74200.1"
FT                   /translation="MTNPIQAEILSRVAEVFDQHVPFHNLLGLDIKRYDVDGVEVVINM
FT                   KPELIGNIHQQILHGGVTATVLDVVGGLTAFAGLVASREDWTIEELQQRLQTLGTIDMR
FT                   IDYLRPGRGLTFTGTGSVIRAGNRVSVCRMELHNEQGTHIAFGTGTYMVG"
FT   gene            501600..503423
FT                   /locus_tag="Sputcn32_0469"
FT   CDS_pept        501600..503423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0469"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: she:Shewmr4_3590 ATP-dependent DNA helicase
FT                   RecQ; TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74201"
FT                   /db_xref="GOA:A4Y2L8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2L8"
FT                   /protein_id="ABP74201.1"
FT                   /translation="MEKLVLDTHDDPLSQRLAQVFGYRDFRDGQREVIERICGGQDCLV
FT                   IMPTGGGKSLCYQLPALMMNGITIVVSPLISLMKDQVDSLLQTGVAAAYLNSSLPREQS
FT                   AEVLRQLRHGELKLLYVSPERLLTADFIERMQSLQLAMFAIDEAHCISQWGHDFRPEYA
FT                   ALGQLKQLFPYVPMMALTATADQATRQSICERLGIDPYRLLSSFDRPNIRYTVAEKLNA
FT                   ANQLRHFLLQQNGSSGIIYCSSRRRVDEVADRLCLQGFNAKAYHAGMTQEDRGAVQDSF
FT                   LKDQIDIVVATVAFGMGINKSNVRFVVHYDIPKSIEAYYQETGRAGRDGLDAEAFMLFD
FT                   PADIGRVRHLIEQSEPGPQQQVEFHKLNTMAAFAEAQTCRRQVLLHYFDESALEPCGNC
FT                   DICLDPPKRYNGTEDAQKVLSCIYRLGQRFGINHLIEVLRGSKGAPIVDRGHDKLTTWG
FT                   IGKDKSHEYWLSVIRQLIHLGLASQDVTRGSSITLNPSARPVLKGEVALMLAEPRIQLT
FT                   TTKRKASQSKAPLNYDRKLFARLKLLRRTIAEQQDVPPYLVFNDATLAEMAAMMPTSAG
FT                   EMLAVNGVGERKLSRFGDDFLDEIAAYLAGE"
FT   gene            complement(503405..505183)
FT                   /locus_tag="Sputcn32_0470"
FT   CDS_pept        complement(503405..505183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0470"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   she:Shewmr4_3589 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74202"
FT                   /db_xref="GOA:A4Y2L9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2L9"
FT                   /protein_id="ABP74202.1"
FT                   /translation="MDFRVLALSMLLWLVTLNACANSQLDELTEIIYQYPTKAFNQIAT
FT                   LEKQPVTEKASDIDQLRLSILKCQNLLQLGENKAAINLAQLGEAKAKRLKLDQARPYFL
FT                   TCQAEAHLNNNNIQNALPLLDSAITLARRYQQPQSLIDSLRLRGQLDTDTDNFSSAIED
FT                   LRLAIDIYPDIHSQTQNWIWPPQAYIYAAMGNLLYATHDFPQAMYYTNLALQSSDAKGK
FT                   VLHVILRNASRIAFDNQEFDYSDQLEKQAKALLPEIGSPLELAYSYAILASISLDKGRI
FT                   DTAEEYISISINSFQKQNQLVAVMRSTRLLAQIRFAQSQDEAALTLMQSAIEQGESLKQ
FT                   YSDLKEFYRILSDYYVDKGDFKQAYDFLLKRHQASEFANEAMNNTRILQFKARINQQDL
FT                   PQETAPNTQNPNILDELNLDWAYSTLFLLAMTILGGAIWYFIDKQNNRAPATDNDSQSL
FT                   SPIQQLESALNSAKQGNYPLALLLFNASQIRQVDLPPLQDELQHKLREHDKLIRYSMDE
FT                   IVIVLPHTSAMGAQRVVNQLTAAIQPWQGSNRVYIGIAALQQFDTLESLIKRAGINQLG
FT                   KIKISENSQDNHSPAK"
FT   sig_peptide     complement(505118..505183)
FT                   /locus_tag="Sputcn32_0470"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.946 at
FT                   residue 22"
FT   gene            505691..507259
FT                   /locus_tag="Sputcn32_0471"
FT   CDS_pept        505691..507259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0471"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: she:Shewmr4_3588 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74203"
FT                   /db_xref="GOA:A4Y2M0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2M0"
FT                   /protein_id="ABP74203.1"
FT                   /translation="MSNRVIIFDTTLRDGEQALAASLSVKEKLQIAMALERLGVDVMEV
FT                   GFPVSSPGDFESVQTIARTIKNSRVCALSRALEKDIDAAAQALSVADQFRIHTFISTST
FT                   IHVESKLKRSFDQVLEMAVGAVKYARRFTDDVEFSCEDAGRTPIDNLCRMVEAAILAGA
FT                   RTINIPDTVGYTVPSEFGNIIQTLFNRVPNIDQAVISVHCHDDLGLSVANSITAVQHGA
FT                   RQIECTINGIGERAGNCSLEEIAMILATRKGMLGLETGINAKEIHRTSNLVSQLCNMPV
FT                   QANKAIVGANAFTHSSGIHQDGMLKAQNTYEIMTPESIGLNRNNLNMTSRSGRHVIKHR
FT                   MEEMGYSEHDYNMDTLYEEFLKLADKKGQVFDYDLEALAFMEAQAEEDNHYQLQQLVVQ
FT                   SDSTEGVATATVRIEVGGEIKTEAATGNGPVDAAYNAIARATDRRIDIISYKLGAKGVG
FT                   QNALGQVDITAVYHEQNFHGVGLATDVVEASARALVHVMNLTCRADKVADYKQSMQKNR
FT                   ELGGV"
FT   gene            507330..508424
FT                   /locus_tag="Sputcn32_0472"
FT   CDS_pept        507330..508424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0472"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: shm:Shewmr7_0369 3-isopropylmalate
FT                   dehydrogenase; TIGRFAM: 3-isopropylmalate dehydrogenase;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74204"
FT                   /db_xref="GOA:A4Y2M1"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2M1"
FT                   /protein_id="ABP74204.1"
FT                   /translation="MSYQIAVLAGDGIGPEVMAEARKVLREVEARFDFNIEYTEYDVGG
FT                   IAIDNHGCPLPDATLKGCEAADAILFGSVGGPKWEKLPPNEQPERGALLPLRGHFELFC
FT                   NLRPAKLHDGLEHMSPLRSDISARGFDVLCVRELTGGIYFGKPKGRQGEGENEEAFDTM
FT                   RYSRREISRIARIAFEAARGRRKKVTSVDKANVLACSVLWRQVVEEVAVDFPDVELEHI
FT                   YIDNATMQLLRRPDEFDVMLCSNLFGDILSDEIAMLTGSMGLLSSASMNSTGFGLFEPA
FT                   GGSAPDIAGKGIANPIAQILSAALMLRHSLKQEEAACAIERAVSKALNSGYLTGELLSS
FT                   DKRSQAKSTAEMGDFIANAIKEGV"
FT   gene            508424..509848
FT                   /locus_tag="Sputcn32_0473"
FT   CDS_pept        508424..509848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0473"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, large
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   shm:Shewmr7_0370 3-isopropylmalate dehydratase, large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74205"
FT                   /db_xref="GOA:A4Y2M2"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2M2"
FT                   /protein_id="ABP74205.1"
FT                   /translation="MTTVPKNAVAKTLYQKVWDAHVVATPEGEAPIIYVDRHLVHEVTS
FT                   PQAFSGLKVAGRKLRAPEKTFATMDHNTSTRSASLDALSPMARTQVETLAQNCKDFGVR
FT                   LYDIHHPNQGIVHVMGPELGITFPGTVIVCGDSHTATHGAFGALAFGIGTSEVEHVLAT
FT                   QTLRQLKAKTMKIEVRGHVSDGVTAKDIVLAIIGKIGMDGGTGYVVEFCGEAIEALSME
FT                   GRMTVCNMAIEMGAKAGMVAPDQTTFDYLAGREFAPKGEDWAEAVAYWQAIKTDDGAVF
FT                   DAVVELDAADIAPQLTWGTNPGQVVAIDGKVPNPLDEANPSTRASMEKALEYIGLSAGT
FT                   PMTDISINKVFIGSCTNSRIEDLRSAAVHAKGRKVASGVTAIVVPGSGQVKAQAEAEGL
FT                   DKIFIEAGFEWRLPGCSMCLAMNDDRLEAGDRCASTSNRNFEGRQGRGSRTHLVSPAMA
FT                   AAAAVAGHFVDIRKPY"
FT   gene            509876..510481
FT                   /locus_tag="Sputcn32_0474"
FT   CDS_pept        509876..510481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0474"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   shm:Shewmr7_0371 3-isopropylmalate dehydratase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74206"
FT                   /db_xref="GOA:A4Y2M3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2M3"
FT                   /protein_id="ABP74206.1"
FT                   /translation="MQPFTTHTGLAVMIDSTNIDTDQIIPKQFLSKVTRDGFGVHLFHD
FT                   WRYLDDAGDVPNPEFSLNQPRYKGASILVSQENFGCGSSREHAPWALADFGLRAIIAPS
FT                   FADIFYGNSINNGLLPVALTHAQVRQLMDEVAAEEGAQITVDLTSCKVISPSGAEFSFT
FT                   LAESARHKLLNGLDAIGLTLSHAAQISQYETQIQGWRS"
FT   gene            511001..512356
FT                   /locus_tag="Sputcn32_0475"
FT   CDS_pept        511001..512356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0475"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: shm:Shewmr7_0372 membrane
FT                   protein involved in aromatic hydrocarbon degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74207"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2M4"
FT                   /protein_id="ABP74207.1"
FT                   /translation="MIMKKRLLTLAVTAALLSSTTQLHAAGFQLAEYSSTGLGRAFAGE
FT                   AAMADNASAQGRNPAMLTYLEGRQLSAGGIYVMPNVDVKGDVSLSSPLLGPDPVKMQGG
FT                   DALDVADSALVPNFYYSNQLNDQWTWGLAVNSNYGLATELPATHAAAIFGNKTSVTTVE
FT                   FNPNVAYRINDAVSVGGGVRIVYGEGEIGASLPGWVDGIKPSLPAQVAAMLPPGGTELK
FT                   SMKGDDIGYGWQLGASWQITPAHRLGLAYHSGVKLDLDGHASGVIYTGGQDVSIEGYLP
FT                   LELPAFAEIASHHQLTDNWAMHASVNWTDWSVFDQLVAYFPGEVKPKGDLESDLVKEEH
FT                   FEDNWRFALGTTYQVNNAWLVRAGVALDKTAATDEWRTTTIPDSDRLWFSVGAGYQASK
FT                   NLNVDFAVTYIKATGDAPINEQQNLLNLATVNFNGEASGNVWLAGIQMSYKM"
FT   sig_peptide     511001..511078
FT                   /locus_tag="Sputcn32_0475"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            512536..514020
FT                   /locus_tag="Sputcn32_0476"
FT   CDS_pept        512536..514020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0476"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: son:SO4230 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74208"
FT                   /db_xref="GOA:A4Y2M5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2M5"
FT                   /protein_id="ABP74208.1"
FT                   /translation="MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWV
FT                   EHDPMEIWASQSSVLVEALARAGIHSDEVAAIGITNQRETTVIWEKATGKPIYNAIVWQ
FT                   CRRSAEICEQLKAQGLEEYVRENTGLLLDPYFSGTKIKWILDNVPNAREQADRGELLFG
FT                   TIDTWLVWKLTEGKVHVTDPTNAARTLLFNIHSLTWDNKLLEALDIPLSMLPDVKPSCS
FT                   VYGTTRIAGEGSEIQVAGMAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGTKAVRS
FT                   NHGLLTTVAVGPKGEVNYALEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNG
FT                   VYLVPAFVGLGAPYWDPNARGALFGLTRGANRNHIIRAALESIAYQSKDLLDAMIKDSG
FT                   VSLKRLKVDGGAVANDFLMQFQADITDVEVLRPSVCETTALGAAFLAGLAVGFWESVIE
FT                   LEHKACIDKHFIPNIDAQTRVQLYAGWQDAVARTRT"
FT   gene            complement(514127..514456)
FT                   /locus_tag="Sputcn32_0477"
FT   CDS_pept        complement(514127..514456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74209"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2M6"
FT                   /protein_id="ABP74209.1"
FT                   /translation="MSGLDSIYAMLAQPVKAVLNPKRVVDQVHSATANAPDSHEAPQSQ
FT                   LPPTLERRDAKVRDRRKESETNKNKKRRASDKAKELKEGAVLEVTDDSAEIKKPQTQHI
FT                   IDVEV"
FT   gene            514915..515373
FT                   /locus_tag="Sputcn32_0478"
FT   CDS_pept        514915..515373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0478"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: she:Shewmr4_3579 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74210"
FT                   /db_xref="GOA:A4Y2M7"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2M7"
FT                   /protein_id="ABP74210.1"
FT                   /translation="MFRGASAINLDTKGRIAIPVRYREPLQLEHQGRIVITVDIQSACL
FT                   LLYPIHEWELIEAKLLKLSDTDKTQRSLKRLLLGYAHEVELDGNGRILLPPPLRQYANL
FT                   DKRIMLVGQLNKFELWDEQAWLQQIDECQETIRSEELANNERLADFSL"
FT   gene            515405..516346
FT                   /locus_tag="Sputcn32_0479"
FT   CDS_pept        515405..516346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0479"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: shm:Shewmr7_0378
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74211"
FT                   /db_xref="GOA:A4Y2M8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2M8"
FT                   /protein_id="ABP74211.1"
FT                   /translation="MSQEFAHLSVLLAETVGGLNIKDDGIYIDGTFGRGGHSRQILQRL
FT                   GDNGRLIAIDRDPQAIEAAKQFSDDPRFQIVHGGFGQLADYVEDLGLVGKIDGVLLDLG
FT                   VSSPQLDDAERGFSFLRDGPLDMRMDNSQGQTAAQWLAHAEIEDMAWVFKTYGEEKNAR
FT                   HIARCIAADRDKTPFLRTKDLADLIARITKNKERNKHPATRVFQAIRIYINSELDQIDQ
FT                   ALEGALAVLAPQGRLSIISFHSLEDRIVKRFIRRHSQGESVPYGLPITEDQINKSRKLR
FT                   AIGKAIMPSDEEIERNARARSSVLRIAERLDY"
FT   gene            516357..516671
FT                   /locus_tag="Sputcn32_0480"
FT   CDS_pept        516357..516671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0480"
FT                   /product="cell division protein FtsL"
FT                   /note="PFAM: cell division protein FtsL; KEGG:
FT                   she:Shewmr4_3577 cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74212"
FT                   /db_xref="GOA:A4Y2M9"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2M9"
FT                   /protein_id="ABP74212.1"
FT                   /translation="MSKPSLNLPRVVLHDLWSHKWILLLALLVLSNAVVVVYISHASRN
FT                   LATQWDQLLQERDRLDIEWRNLLLEEQTQTEHSRITRIASKELNMSRPLPSEEIVVKVP
FT                   "
FT   gene            516685..518436
FT                   /locus_tag="Sputcn32_0481"
FT   CDS_pept        516685..518436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0481"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   son:SO4225 peptidoglycan synthetase FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74213"
FT                   /db_xref="GOA:A4Y2N0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2N0"
FT                   /protein_id="ABP74213.1"
FT                   /translation="MIRQAKTKQASKKQKPQLIHWRLYVVVGFVFALFSSLVGRAAYIQ
FT                   IIEPDKLRHESDMRTLRTTSREVQRGLITDRNGDMLAVSVPVRAVWADPKQVNDSNSFA
FT                   DMRRWQALADVLHEPLADVLDRVRSNPTKRFTYLKRQVTPAVADYITQLKLPGVFLKSE
FT                   SRRYYPGGEITAQLIGITNIDDVGIEGVENAYNSWLTGTPSKQKVRKSRDGHVVEHLDI
FT                   VQEGESPNDLVLSIDHRIQQLAYRELKRTTEMNQATSGSIVVLDIHTGEVLAMVNTPSY
FT                   NPNSRDNLQTFRMRNRAMTDTFEPGSTIKPFVVAAALEAGTVKATDIIPTSPGWMRLGG
FT                   RQVRDPNNYGDMSLARILAKSSNVGISKLALSIPVQQLLGTYQSMGLGSFSGINLTGES
FT                   AGLIQDRHRWSDFERATLSFGYGLTATTLQLARMYATLGNGGTLYPVSILKLKKPPEGE
FT                   RVISAKVARDVLQMLVTVTEKGGTGTLAHIDGYPVAGKSGTSRKAVAGGYGDDYVALFA
FT                   GVAPANNPKLAIVVVVNEPKGDLYYGGSVAGPAFAKVMSGALQMLNVEPISDKEQVQLA
FT                   GIAGRAE"
FT   sig_peptide     516685..516810
FT                   /locus_tag="Sputcn32_0481"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.932) with cleavage site probability 0.840 at
FT                   residue 42"
FT   gene            518433..519935
FT                   /locus_tag="Sputcn32_0482"
FT   CDS_pept        518433..519935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0482"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetases;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: son:SO4224
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74214"
FT                   /db_xref="GOA:A4Y2N1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2N1"
FT                   /protein_id="ABP74214.1"
FT                   /translation="MMLLRDLLAPWFIYSGDQSFNELTLDSRAIRRGDVFLALPGYRVD
FT                   GRQFIDKALDLGAAGVLVHTDDADQHGKVLLGDNAERGVQIYFFQLNRQVSAIAAQRYP
FT                   LAHQFAVTPSLGIIGITGTNGKTSTSQLIAQLVTSLRRKAAVMGTLGNGLWGELVDSGN
FT                   TTADAITLMRQLHEFEAQGASVCAMEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHG
FT                   DMESYATAKQSLFRFSTLGHGLLNLDDPVGASWLIELKDMAAQIWGFSIEGHQAAAFYT
FT                   KNTQFDDQGVSTTLVWPEGETQIHSPLLGAFNLSNLLAALSALYLQGFDMEALAEQVQY
FT                   LTPVAGRMERFTTADNITLVVDYAHTPDAIEQALTALRRHCAGDLWCVFGCGGDRDKGK
FT                   RPLMGRAAEQYADRIMVTSDNARSEDPAQIISDIIQGLVTPERALTQVDRITAIKDVVG
FT                   LAKSGDLILLAGKGHETYQEAAGVRHNYDERALARQLAEQSK"
FT   gene            519932..521314
FT                   /locus_tag="Sputcn32_0483"
FT   CDS_pept        519932..521314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0483"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: son:SO4223
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74215"
FT                   /db_xref="GOA:A4Y2N2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2N2"
FT                   /protein_id="ABP74215.1"
FT                   /translation="MIPLSLEVLSQHLGAHRVGNDVTIQDLSSDSRKVGDATLFVALKG
FT                   ERFDGHDFAATAIENGAAALMVERELALNIPQLIVTDCQKAMGAIGAYVRDQINPICVA
FT                   LTGSNGKTSVKEMIATILSAKYQVLYTAGNFNNEIGVPLTLLRLTPADEYGVFELGANH
FT                   KGEIDYTSGLVRPNVALVNNVGSAHLEGFGSQAGVAQAKSEIFNHLQADGTAIINADDA
FT                   FADVMSVKARPYKQLHFSQQEGAAKRRIDVIATGHKADADGCYRFMLNYLGESCDVKLP
FT                   LAGRHQVSNALAAASVCIALGLSLTDIAHGLSQLTPVKGRMQPSQLGRIRLIDDSYNAN
FT                   PVSVGAAIAWLKEISENRCLVLGDLGELGDNAPLLHAELGQLAKQQGIDALFCTGALSQ
FT                   HTSQAFGAEHHESVAVLVEKLIKHINQLPGQVTVLVKGSRSAAMERVVDGLTVAFGRGE
FT                   LV"
FT   gene            521315..522397
FT                   /locus_tag="Sputcn32_0484"
FT   CDS_pept        521315..522397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0484"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: son:SO4222
FT                   phospho-N-acetylmuramoyl-pentapeptide- transferase;
FT                   TIGRFAM: phospho-N-acetylmuramoyl-pentapeptide-transferase;
FT                   PFAM: glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74216"
FT                   /db_xref="GOA:A4Y2N3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2N3"
FT                   /protein_id="ABP74216.1"
FT                   /translation="MLVYLAEYLTRFYTGFNVFSYVTFRAILGLLTALIFSLWWGPKLI
FT                   ERLQLLQIGQVVRNDGPESHFSKRGTPTMGGLLILAAIFISVLLWGDLGSRYVWVMLFV
FT                   LGSFGLIGFIDDYRKVVRKDTKGLIARWKYILQSLAALLIAFFLYATAANPGETQLVVP
FT                   FFKDVMPQLGGVFIVLAYFTIVGSSNAVNLTDGLDGLAIMPTVMVAAAFALIAYLSGHV
FT                   QFANYLHIPHLPGSGELVIVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLSLGAALGAIA
FT                   VLVRQEILLVIMGGVFVMETVSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIV
FT                   RFWIISIFLVLLGLATLKLR"
FT   gene            522404..523723
FT                   /locus_tag="Sputcn32_0485"
FT   CDS_pept        522404..523723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0485"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetases domain
FT                   protein; Mur ligase, middle domain protein; KEGG:
FT                   she:Shewmr4_3572 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74217"
FT                   /db_xref="GOA:A4Y2N4"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2N4"
FT                   /protein_id="ABP74217.1"
FT                   /translation="MQRQYSHIVLGLGATGLSVVRYLCGKGITPLVMDSRRQPPGADTL
FT                   AASFPEVQLITGGFDCRYLVQASQIIISPGIALDTAEVRAALDMGIEVIGDVELFAREI
FT                   ADRKPCVIGITGSNGKSTVTTLVGEMLREAGMAVAVGGNIGVPALDLLSENAEIFVLEL
FT                   SSFQLETTHSLNCVASTCLNVTEDHMDRYSDMDAYRKAKLRLYHQSRSIIFNRDDALTI
FT                   PTEPMNQNSFGLAPPEGDEWGICDSKIYHGRSEIMPITEVSLIGSHNHANLLAAMALVY
FT                   AVGVDKQVIAKVARTFTGLSHRCEVVGIKGGVTYVNDSKATNVGATVAALDGLSDHLGD
FT                   IILIAGGDGKGADFSPLVEPLSKVTHLITLGRDGNKIAALKEGAIKVDSMAAAVAKAAA
FT                   LATSGDIVLLSPACASLDMYSNFMARGDDFRNLVELLDGE"
FT   gene            523713..524924
FT                   /locus_tag="Sputcn32_0486"
FT   CDS_pept        523713..524924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0486"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: son:SO4220 cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74218"
FT                   /db_xref="GOA:A4Y2N5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2N5"
FT                   /protein_id="ABP74218.1"
FT                   /translation="MASDTRQFSLFGRLLSAMPNWQRDTEVPGVQLYDRALFTAVLSLI
FT                   AFGFVMVMSASMPEAQTLTGNPFHFMTRHVGYLMGCFVIAAFVLRVDMQTWQRLSPIML
FT                   LVVGLMLVAVLLVGTTVNGATRWLSIGPIRIQVAELAKFAFSVYMAGYLVRRHQEVREN
FT                   AKGFYKPIAVFAIYAILILMQPDLGTVVVLFVGTVGLLFLAGARLLDFFALIFTGVLAF
FT                   VALVLLEPYRMRRVTSFMDPWQDPFGSGYQLTQSLMAYGRGDWFGQGLGNSIQKLEYLP
FT                   EAHTDFIFAVIGEELGFIGIIAVLSVLLFVALRAIRLGNLCLVMDKAFEGYLAYAIGIW
FT                   ICFQTVVNVGASIGMLPTKGLTLPFVSYGGSSLWVMTAAAMTLLRIDYERRMSLVQAVQ
FT                   GRLK"
FT   gene            524924..526012
FT                   /locus_tag="Sputcn32_0487"
FT   CDS_pept        524924..526012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0487"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: shm:Shewmr7_0386
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74219"
FT                   /db_xref="GOA:A4Y2N6"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2N6"
FT                   /protein_id="ABP74219.1"
FT                   /translation="MTQEGKRILVMAGGTGGHVFPALAVAKYLAQQGWQVRWLGTADRM
FT                   EARLVPQYGFDIDFIDIKGVRGNGLVRKLAAPFKVIRSILQAKAVIAEFKPDVVLGMGG
FT                   FASGPGGVAARLAGIPLVLHEQNAIPGMTNKLLSRIATQVLCAFKNTFTTVKSKVVGNP
FT                   IRRELIALGAEPKPLADDALKVLVVGGSLGAKIFNDLMPSVVAALSKQQSITVWHQVGK
FT                   DNLAGVKAAYQQQGQEGGVNIAEFIDDMEAAYRWADVVLCRAGALTVSELAAVGLPSIL
FT                   VPYPHAVDDHQTRNGQVLVEAGAAFLLPQAILDVDKLVGKLQLLANDRTELARMGQRAR
FT                   DVAVLDATEQVAAVCISLAEKG"
FT   sig_peptide     524924..524998
FT                   /locus_tag="Sputcn32_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.908) with cleavage site probability 0.879 at
FT                   residue 25"
FT   gene            526015..527481
FT                   /locus_tag="Sputcn32_0488"
FT   CDS_pept        526015..527481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0488"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein;
FT                   cytoplasmic peptidoglycan synthetases domain protein; Mur
FT                   ligase, middle domain protein; KEGG: she:Shewmr4_3569
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74220"
FT                   /db_xref="GOA:A4Y2N7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2N7"
FT                   /protein_id="ABP74220.1"
FT                   /translation="MTKTERYIQLRSMIPEMRRIKRIHFVGIGGAGMGGIAEVLVNEGY
FT                   QVSGSDIAQNTVTDRLCLLGAKIQIGHAADNVQQVDVVVVSTAINAENPEIIAAKELRI
FT                   PIVRRAEMLAELMRYRHGVAIAGTHGKTTTTSLIASVYGQAGRDPTFVIGGLLNSAGTN
FT                   ARLGTSRYLIAEADESDASFLHLQPMVSVVTNIEADHMDTYGGDFEKLKSTFVDFLHNL
FT                   PFYGVAVVCIDDPVVREIMPRIGRHLVTYGFSDDADVQALNFSQQGHQCRFTVRRKGKE
FT                   DLDLLLNLPGQHNVLNALAAIAVATEDEIDDSALIQALAEFQGIGRRFQHLGKFATPKG
FT                   EVMLVDDYGHHPSEVAATIKAARAGWPEKRLVMAYQPHRYTRTRDLYEDFIEVLSQVDC
FT                   LLLLDVYSAGEAPITGADGRALCRSIRLRGQLDPIFIASPDQLAEVLPDVLQEGDLLLT
FT                   QGAGNIGALSRQLAVTELGFAKVEIAQVPA"
FT   gene            527633..528382
FT                   /locus_tag="Sputcn32_0489"
FT   CDS_pept        527633..528382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0489"
FT                   /product="Polypeptide-transport-associated domain protein,
FT                   FtsQ-type"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein, FtsQ-type;
FT                   KEGG: shm:Shewmr7_0388 polypeptide-transport-associated
FT                   domain protein, FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74221"
FT                   /db_xref="GOA:A4Y2N8"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2N8"
FT                   /protein_id="ABP74221.1"
FT                   /translation="MSRVNWYLWSGIGFLSLVIGSFVFAGYQLHKFLNDASTLPIEAVA
FT                   IKGERTYTTDRDIQIALQDLMQRSFFSADISLVQQALEALPWVYRASVRREWPAKLRVY
FT                   LQEQQPVAHWNGASWLNVHGEVFEAPARPELEYLPQLSGPDDMGVEVLTAYAQVNSLLK
FT                   INGFTLASLNLTPRHAWHATLENGIVLDLGREDKIARIQRFITVYPLLAKQDKPIARVD
FT                   LRYDTGLAVGWGDAQTRELIINDQKPR"
FT   sig_peptide     527633..527710
FT                   /locus_tag="Sputcn32_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.959 at
FT                   residue 26"
FT   gene            528363..529598
FT                   /locus_tag="Sputcn32_0490"
FT   CDS_pept        528363..529598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0490"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG:
FT                   shm:Shewmr7_0389 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74222"
FT                   /db_xref="GOA:A4Y2N9"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2N9"
FT                   /protein_id="ABP74222.1"
FT                   /translation="MTKNQDRNLIVGLDIGTSKVAVIIGEVLPDGEISIVGLGNHPSRG
FT                   MDKGGVNDLDSIVRSVQRALDQAELMADCQVSSVYLSISGKHIACQNENGMVSINDEEV
FT                   TQEDVDNVIHTARSVKIPTERRILHVLPQEYAIDVQDGIRSPIGMSGMRMEAKVHIVTC
FT                   ANDMAKNITKSVERCGLKVDDLVFSGIASADAVLTFDEKDLGVCIVDIGGGTTDIAVYT
FT                   NGALRHCAVVPVAGNQVTNDIAKIFRTPSSHAEQIKVQFACARSSMVSREDSIEVPSVG
FT                   GRPSRSMSRHTLAEVVEPRYQELFELVLKELKDSGLEDQIAAGIVLTGGTASIQGVVDI
FT                   AEATFGMPVRVASPLPIKGLYEYVDQSIYSTGVGLLHYGARRVLERQFERPERQGVTSA
FT                   WNRVQSWFKGEF"
FT   gene            529632..530819
FT                   /locus_tag="Sputcn32_0491"
FT   CDS_pept        529632..530819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0491"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   son:SO4215 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74223"
FT                   /db_xref="GOA:A4Y2P0"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2P0"
FT                   /protein_id="ABP74223.1"
FT                   /translation="MFEIMDTHSDDAVIKVIGVGGGGGNAVEHMVKHNIEGVEFVVTNT
FT                   DAQALRKSSAGSTIQLGRDVTKGLGAGANPDVGRAAAEEDRENIRAAIKGSDMIFIAAG
FT                   MGGGTGTGAAPVVAQIAREEGILTVAVVTKPFPFEGKKRMVYAEQGIAELAKHVDSLIT
FT                   IPNEKLLKVLGRGTSLLDAFAAANNVLLGAVQGIAELITRPGLINVDFADVKTVMSEMG
FT                   NAMMGTGVARGEDRAEEAAEAAVASPLLEDIDLAGARGVLVNITAGMDMSIEEFETVGN
FT                   HVKAYASDNATVVVGAVIDPEMSDELRVTVVATGIGAEKRPDIQLVSKPAPRPEPVVVE
FT                   PKVEAYVEEAVHVNYAAPKGNVLPTAAQPAPTPAPSTKHELDYLDIPAFLRKQAD"
FT   gene            531000..531920
FT                   /locus_tag="Sputcn32_0492"
FT   CDS_pept        531000..531920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0492"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase;
FT                   KEGG: shm:Shewmr7_0391 UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74224"
FT                   /db_xref="GOA:A4Y2P1"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2P1"
FT                   /protein_id="ABP74224.1"
FT                   /translation="MIFQRTVQKMVKATGVGLHSGNKVTLSIMPAPVNTGIVLVRTDLS
FT                   PAVAIPAKAEQVRETTMCTALVNDEGIRISTIEHLFAALAGLGIDNAVIEVDAPEIPIM
FT                   DGSASPFVFLLQSAGIKEQAAPKKYLKIKRPVRVEDGDKWAELKPFKGFRVNFKIDFAH
FT                   PEIARSQQHVVMDFSTSAFVKEISRARTFGFMRDIEYLRANNLALGGSMENAVVLDEYR
FT                   VLNPDGLRYEDEFVKHKILDAFGDLYVAGHAILGEFTAYKTGHALNNQLVRALLAQQDA
FT                   WELVSFEKEADVPVSFSVPSGAVFA"
FT   gene            complement(531932..532378)
FT                   /locus_tag="Sputcn32_0493"
FT   CDS_pept        complement(531932..532378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74225"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2P2"
FT                   /protein_id="ABP74225.1"
FT                   /translation="MKKPPQDLSQLLHQSGKLPDIAEKAELLLYLDQHVKQIVAGPVAE
FT                   QLKVANFRQGVLVIETTSAAWAARINFQKPKLLAQLQAETLTILTAIEVKVNPRLAMYD
FT                   AKPKQAHKELSPAAAEHIAALAENISGTLGEKLKRLASLASRNK"
FT   gene            532406..533305
FT                   /locus_tag="Sputcn32_0494"
FT   CDS_pept        532406..533305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0494"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: shm:Shewmr7_0393
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74226"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2P3"
FT                   /protein_id="ABP74226.1"
FT                   /translation="MSVTVFIQGRNGVTRWQPSKRWLLLPILLLATGTGIYQHNSARFE
FT                   NQQASVDNDRLVREQQKKQVLELKSATESQLAMLATHVARMQAKITRLEALGQQVAQQN
FT                   KLAEDFDFSSEVGVGGLSELGTNIELGQLIDDMDKLASRIDNNNVQLSLLETVSSNHHI
FT                   DDERYISGIPLDKGWLSSPYGLRNDPFNGRRSVHKGIDFTGREGAKVVATAAGVVTWAG
FT                   NMFGYGELVEIDHGNGFRTRYGHNKALSVTVGDVVAKGDTIASMGSTGRSTGAHVHYEV
FT                   LRGGQQIDPQKFVYRKAS"
FT   gene            533366..536095
FT                   /locus_tag="Sputcn32_0495"
FT   CDS_pept        533366..536095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0495"
FT                   /product="protein translocase subunit secA"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   helicase domain protein; SEC-C motif domain protein; SecA
FT                   DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region; KEGG: son:SO4211
FT                   preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74227"
FT                   /db_xref="GOA:A4Y2P4"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2P4"
FT                   /protein_id="ABP74227.1"
FT                   /translation="MFGKLLTKVFGSRNDRTLKGLQKVVIKINALEADYEKLTDEELKA
FT                   KTAEFRERLAAGETLDDIMAEAFATVREASKRVFEMRHFDVQLLGGMVLDSNRIAEMRT
FT                   GEGKTLTATLPAYLNALTGKGVHVITVNDYLARRDAENNRPLFEFLGLTVGINVAGIGQ
FT                   QEKKAAYNADITYGTNNEFGFDYLRDNMAFSPQDRVQRPLHYALIDEVDSILIDEARTP
FT                   LIISGAAEDSSELYTKINTLIPNLIRQDKEDSEEYVGEGDYSIDEKAKQVHFTERGQEK
FT                   VENLLIERGMLAEGDSLYSAANISLLHHVNAALRAHTLFERDVDYIVQDGEVIIVDEHT
FT                   GRTMPGRRWSEGLHQAVEAKEGVHIQNENQTLASITFQNYFRQYEKLAGMTGTADTEAF
FT                   EFQHIYGLDTVVVPTNRPMVRKDMADLVYLTANEKYQAIIKDIKDCRERGQPVLVGTVS
FT                   IEQSELLARLMVQEKIPHQVLNAKFHEKEAEIVAQAGRTGAVTIATNMAGRGTDIVLGG
FT                   NWNMEIDALDNPTPEQKAKIKADWQVRHDAVVAAGGLHILGTERHESRRIDNQLRGRAG
FT                   RQGDAGSSRFYLSMEDSLMRIFASDRVSGMMKKLGMEEGEAIEHPWVSRAIENAQRKVE
FT                   ARNFDIRKQLLEFDDVANDQRQVVYAQRNELMDAESIEDTIKNIQDDVIGAVIDQYIPP
FT                   QSVEELWDVPGLEQRLNQEFMLKLPIQEWLDKEDDLHEESLRERIITSWSDAYKAKEEM
FT                   VGASVLRQFEKAVMLQTLDGLWKEHLAAMDHLRQGIHLRGYAQKNPKQEYKRESFELFQ
FT                   QLLNTLKHDVISVLSKVQVQAQSDVEEMEARRREEDAKIQRDYQHAAAEALVGGGDEDD
FT                   ESIAAHTPMIRDGDKVGRNDPCPCGSGRKYKQCHGKLS"
FT   gene            536873..538407
FT                   /locus_tag="Sputcn32_R0009"
FT   rRNA            536873..538407
FT                   /locus_tag="Sputcn32_R0009"
FT                   /product="16S ribosomal RNA"
FT   gene            538651..538727
FT                   /locus_tag="Sputcn32_R0010"
FT   tRNA            538651..538727
FT                   /locus_tag="Sputcn32_R0010"
FT                   /product="tRNA-Ile"
FT   gene            538866..538941
FT                   /locus_tag="Sputcn32_R0011"
FT   tRNA            538866..538941
FT                   /locus_tag="Sputcn32_R0011"
FT                   /product="tRNA-Ala"
FT   gene            539233..542125
FT                   /locus_tag="Sputcn32_R0012"
FT   rRNA            539233..542125
FT                   /locus_tag="Sputcn32_R0012"
FT                   /product="23S ribosomal RNA"
FT   gene            542306..542421
FT                   /locus_tag="Sputcn32_R0013"
FT   rRNA            542306..542421
FT                   /locus_tag="Sputcn32_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            542495..542570
FT                   /locus_tag="Sputcn32_R0014"
FT   tRNA            542495..542570
FT                   /locus_tag="Sputcn32_R0014"
FT                   /product="tRNA-Thr"
FT   gene            542608..542723
FT                   /locus_tag="Sputcn32_R0015"
FT   rRNA            542608..542723
FT                   /locus_tag="Sputcn32_R0015"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(542884..543285)
FT                   /locus_tag="Sputcn32_0496"
FT   CDS_pept        complement(542884..543285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1559 ISSod10, transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74228"
FT                   /db_xref="GOA:A4Y2P5"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2P5"
FT                   /protein_id="ABP74228.1"
FT                   /translation="MWEARAARWLLFLYLQLLIPITFLWMTTHIWPPKRYSSTCSQALY
FT                   SAVCPAMGATQAIIAPHANSEYMYEHLKLISAATAFGHHALLIMDGAGSHQQTLIISRF
FT                   SSCPLFTGVKSDRAGMAVATSKYVGQLLF"
FT   gene            complement(543297..544304)
FT                   /locus_tag="Sputcn32_0497"
FT   CDS_pept        complement(543297..544304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0497"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   she:Shewmr4_3560 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74229"
FT                   /db_xref="GOA:A4Y2P6"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2P6"
FT                   /protein_id="ABP74229.1"
FT                   /translation="MNIITSAFPQRRMRRMRKHDFSRRLMAENHLTVNDLIYPMFILEG
FT                   TNRSEKIASMPGVERYSIDLLLKEAEELVELGIPLIALFPVTPAEKKTLMAEEAYNADA
FT                   LVQRAVRELKKAFPQLGIMTDVALDPFTTHGQDGIIDETGYILNDITTDILVKQALSHA
FT                   EAGADIIAPSDMMDGRIGAIRQALEAAGHVNTQIMAYSAKYSSSYYGPFRDAVGSAGNL
FT                   KGGNKHSYQMDPANSDEALHEVALDIQEGADMVMVKPGMPYLDIVHRVKTELAVPTFAY
FT                   QVSGEYAMHMAAIQNGWLAEKAIVMESLLCFKRAGADGILTYFAKRAAQWLKEA"
FT   gene            complement(544314..546188)
FT                   /locus_tag="Sputcn32_0498"
FT   CDS_pept        complement(544314..546188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0498"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Diverse 7TM receptor, extracellular
FT                   region 2; Diverse 7TM receptor, transmembrane region; KEGG:
FT                   son:SO4207 GGDEF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74230"
FT                   /db_xref="GOA:A4Y2P7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2P7"
FT                   /protein_id="ABP74230.1"
FT                   /translation="MAKVSRFLLFFLGLLTSVTSAAALLHIDTDTPTPLNLTPWLQVSH
FT                   PSTTQLADIQNLSKQEWRNFTNKDIQKLSQHNFWLNISLNSTDESLSRILALDNPLLDK
FT                   VTIYHLINQKPFNVVYMGDSLPYSERPLLSNIFLYPFKISANEEHTFYLHIETEGSAAV
FT                   PLYLWSANDLAQIAESTAVEHGFQLGVLAAIGIFSLFIAVASGSFSYSYYSGYVLSMTL
FT                   LVATINGFAFRFIWPEWPMLQQIMVPILLPVVMAFALMFTEKILQLKYYNRHMLLICRY
FT                   SAVYILLVGLLLPFIHYGTALYIEIISVAILSLILMVLAIMQAINGHKLARLYTIGWVS
FT                   MLTGACISSLLYLSVIDLNMKPQTPVMLGLTFEIIFMSLVLAIRYNDERKAKLRIQQEA
FT                   LKQAQKIRSAREEALKLEAETNEKLEQMVQERTLELEITLRELHEVNQKLTEQSTIDSL
FT                   TGVKNRSAFDKRLLAESRISRRQETPIAVLMLDIDKFKSINDQFGHLAGDQALKIIAQT
FT                   LQQNLKRPTDLVSRFGGEEFAIILPNTTADGALQVAETIRDAVTSIGLMWEGKPIPLTV
FT                   SIGVSADIVASDQHSTTLLEQADKALYQAKNSGRNQVKLYSSATAEPN"
FT   sig_peptide     complement(546120..546188)
FT                   /locus_tag="Sputcn32_0498"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.659 at
FT                   residue 23"
FT   gene            complement(546181..546984)
FT                   /locus_tag="Sputcn32_0499"
FT   CDS_pept        complement(546181..546984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0499"
FT                   /product="Sec-independent protein translocase TatD"
FT                   /EC_number="3.1.21.-"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   shm:Shewmr7_0398 TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74231"
FT                   /db_xref="GOA:A4Y2P8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2P8"
FT                   /protein_id="ABP74231.1"
FT                   /translation="MPSYIDIAVNLLGSALEPEIASIIQAAASQGVSPLIVIGSDLSES
FT                   AAAITLCKQYPNQLYCTAGVHPHHASTWNTDSSRLQAQLCQAPQAVAIGECGLDYNRDF
FT                   SPRPIQRQAFIAQLELAVELKMPVLMHERDAHEDFIAILQEYRPQLMGALLHCFTGTHA
FT                   QMETYISLDLHLGITGWVCDERRGQELAQLVPFIPQERLLIETDSPYLLPRSMRPKPKS
FT                   SKNKPEYLPYIAKYIADLRGENADEFAARCYQNSLAFFNLSRDNG"
FT   gene            complement(546984..547511)
FT                   /locus_tag="Sputcn32_0500"
FT   CDS_pept        complement(546984..547511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74232"
FT                   /db_xref="InterPro:IPR016987"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2P9"
FT                   /protein_id="ABP74232.1"
FT                   /translation="MRLTIMAVAIAMVSVQANASIEQQLTQCAATADKLERLICYDKLA
FT                   ESVKGVTPAIVNTQAPTTMTIVAPVSEQAATVATTSQAPAANIADDFGMEAKRIQENTV
FT                   DKIYLEVQSTTEDAYGALKVTFTNGQIWKQTEGRKYNLKQGETVYIEKAALGSFLMGTD
FT                   NRNAKIRVKRLK"
FT   sig_peptide     complement(547452..547511)
FT                   /locus_tag="Sputcn32_0500"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.973 at
FT                   residue 20"
FT   gene            complement(547558..548307)
FT                   /locus_tag="Sputcn32_0501"
FT   CDS_pept        complement(547558..548307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0501"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: she:Shewmr4_3556 sec-independent protein
FT                   translocase, TatC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74233"
FT                   /db_xref="GOA:A4Y2Q0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Q0"
FT                   /protein_id="ABP74233.1"
FT                   /translation="MSQQQPLISHLLELRSKLLKSIASVLLVFICSVYWANDIYHYMAI
FT                   PLMQSLPLGGSMIATDVAAPFFAPFKLTLVLSFFVAVPYVLFQIWSFVAPGLYKHEKRL
FT                   VMPLLFSSTVLFYLGIAFAYYIVFPVVFGFFANNAPEGVQVATDITSYLNFILKLFFAF
FT                   GLSFEIPIAVVLLCWAGVTTPDDLRQKRPYIVVGAFVVGMLLTPPDVISQTMLAVPMLL
FT                   LFEGGLFAARFYSKPSDESDDEEQTNS"
FT   sig_peptide     complement(548197..548307)
FT                   /locus_tag="Sputcn32_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.755) with cleavage site probability 0.754 at
FT                   residue 37"
FT   gene            complement(548311..548787)
FT                   /locus_tag="Sputcn32_0502"
FT   CDS_pept        complement(548311..548787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0502"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; KEGG: shm:Shewmr7_0401 twin-arginine translocation
FT                   protein, TatB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74234"
FT                   /db_xref="GOA:A4Y2Q1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2Q1"
FT                   /protein_id="ABP74234.1"
FT                   /translation="MFDGIGFMELLLIGVLGLVVLGPERLPVAVRSVTGWIRAMKRMAN
FT                   SVKEELEQELKIEQLHADLKKAESKGLSNLSPELKESIEQLKQAAQSVNRPYQVQDSSS
FT                   QGTAAPDNQIHSPAQVSQTNPTTPLETSQHLTSPAAHNEPSQGVDTSSNPKANG"
FT   gene            complement(548795..549034)
FT                   /locus_tag="Sputcn32_0503"
FT   CDS_pept        complement(548795..549034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0503"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: shm:Shewmr7_0402 twin-arginine
FT                   translocation protein, TatA/E family subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74235"
FT                   /db_xref="GOA:A4Y2Q2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2Q2"
FT                   /protein_id="ABP74235.1"
FT                   /translation="MGGISIWQLLIIALIVVLLFGTKKLRSLGGDLGGAVKGFKNAMSS
FT                   EEDKKALEDTEAAKTAQTTQQATEKKPESNKEQA"
FT   gene            complement(549094..550743)
FT                   /locus_tag="Sputcn32_0504"
FT   CDS_pept        complement(549094..550743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0504"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: shm:Shewmr7_0403
FT                   2-polyprenylphenol 6-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74236"
FT                   /db_xref="GOA:A4Y2Q3"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2Q3"
FT                   /protein_id="ABP74236.1"
FT                   /translation="MTLTSIRRGYHVIKTLLQYGLDEVLPPKMTPWYFTLARSSLFWIR
FT                   NKHKSKPGGERLKLAMQELGPVYIKLGQMLSTRRDLLSDEWAIELAMLQDKVPPFDGVL
FT                   ARKAIEAELKASIESLFDDFDETPLASASISQVHTATLKSNGKAVVLKVLRPNVEAKIL
FT                   ADLQLMSQTANLLEYFLGEGNRLRPAEVIEDYRVTILGELNLKLEALNAIKLRNNFLNS
FT                   DALYVPYVYEEFCYPRLMVMERIYGIPVSDIAALKAQGTNFKLLAERGVELFFTQVFRD
FT                   NFFHADMHPGNIFISRDHPENPYYIGLDCGIMGTLSEVDKRYLAENFLAFFNRDYHRIA
FT                   QLYIESGWVSEKTDLQAFEQAIKVVCEPMFNKPLDEISFGHVLLELFRTARSFDIVVQP
FT                   QLVLLEKTLLYIEGLGRQLYPQLDLWQTAKPFLEQWMAEQVGPKAMFKKVSTKLPYWSD
FT                   KLPEFPELIYDNLKLGRKLLSSQQQMLDKYLKHQQQAHKSNYMLITSAVLLICGTLLFN
FT                   QDATLWSPYVCLTSGVLMWFIGWRSRPKNRKF"
FT   gene            complement(550740..551360)
FT                   /locus_tag="Sputcn32_0505"
FT   CDS_pept        complement(550740..551360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0505"
FT                   /product="protein of unknown function DUF1243"
FT                   /note="PFAM: protein of unknown function DUF1243; KEGG:
FT                   she:Shewmr4_3552 protein of unknown function DUF1243"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74237"
FT                   /db_xref="GOA:A4Y2Q4"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Q4"
FT                   /protein_id="ABP74237.1"
FT                   /translation="MMPQEVVLLACAAIETGLKKLQAQAGGDYSRRRNLHGKVFRIQLS
FT                   QLSWPIYLIFAKEIQVLSHYEGEVDVSLHADATTLYRVTEGANLTELIKQDKLKLEGDL
FT                   NLLQSFSQYLRGIEFDFAEPISRYLGDAATHKLISTGHQAKNFALDVLRKTRSHLGQLA
FT                   VEEYRLAPHKIELVYFRDQLDDLVSDTLALEQRIIQLRDHIKP"
FT   gene            complement(551360..552115)
FT                   /locus_tag="Sputcn32_0506"
FT   CDS_pept        complement(551360..552115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0506"
FT                   /product="2-octaprenyl-6-methoxy-1,4-benzoquinone methylase
FT                   / demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferases; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   son:SO4199 ubiquinone/menaquinone biosynthesis
FT                   methlytransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74238"
FT                   /db_xref="GOA:A4Y2Q5"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2Q5"
FT                   /protein_id="ABP74238.1"
FT                   /translation="MSEGESKSTHFGYKTVEADKKAELVAGVFHSVAAKYDIMNDVMSF
FT                   GIHRFWKRHTIEVSGARPGMKVLDLAGGTGDLTAKFSHLVGDKGEVVLADINDSMLKVG
FT                   RTKLRDKGIVNNVSYVQANAEALPFPDNHFDIITIAFGLRNVTDKDAALRSMNRVLKPG
FT                   GKLLVLEFSKPQHEIMRKVYDLYSFKVLPKMGELITKDADSYEYLAESIRMHPDQDTLK
FT                   QMMVDAGFEQVDYTNMTDGIVALHRGYKF"
FT   gene            complement(552360..553424)
FT                   /locus_tag="Sputcn32_0507"
FT   CDS_pept        complement(552360..553424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0507"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   she:Shewmr4_3550 arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74239"
FT                   /db_xref="GOA:A4Y2Q6"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Q6"
FT                   /protein_id="ABP74239.1"
FT                   /translation="MPEFIPFTHADVAMLVNSRAGETKLGQCVHTANQEHTLDVILHTA
FT                   KAHGAQFAILGVGEDIGPRANFGRSGATDAFTTSMKQWLNLQSNRFLSGAECLVLGQVN
FT                   TADLQQQTTSNTTANNDVTLDELRDAVEQLDERVIRIVSAILKAGLEPILIGGGHNNAY
FT                   GLLMATYGHYQRQVAAVNLDPHSDFRLLEGRHSGNGFSYAADRGALGCYHVLGLHELKN
FT                   SETNLSQLTEFGGTWHSLQQIWVRREISLNQALLEIATKLNNTGLPVGLELDVDAIAKM
FT                   PSSASTAAGVPLLDAAHYVNYIARHCPCAYLHLAEAAPICHEAGIEAGFRDVGQSLSEL
FT                   IYAYVQGRIQYLAQ"
FT   gene            complement(553552..554037)
FT                   /locus_tag="Sputcn32_0508"
FT   CDS_pept        complement(553552..554037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0508"
FT                   /product="protein of unknown function 1935"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A;
FT                   protein of unknown function 1935; PFAM: Dimethylmenaquinone
FT                   methyltransferase; KEGG: son:SO4197 regulator of
FT                   ribonuclease activity A"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74240"
FT                   /db_xref="GOA:A4Y2Q7"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Q7"
FT                   /protein_id="ABP74240.1"
FT                   /translation="MEYNTSELCDMYLDVVDVVEPMFSNYGGCSSFGGSISTIKCFEDN
FT                   GLITEVLQEDGQGKVLLVDGGGSLRRALIDGAIAELAVSNNWEGIIVYGSVRDVDALEE
FT                   LDIGIQALASIPVGADGNSVGEVEIPVNFGGVTFLPGDHIYADNTGIILSPEPLDIE"
FT   gene            554356..554610
FT                   /locus_tag="Sputcn32_0509"
FT   CDS_pept        554356..554610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74241"
FT                   /db_xref="GOA:A4Y2Q8"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Q8"
FT                   /protein_id="ABP74241.1"
FT                   /translation="MPVEAINTIEIIGYFASVMVAISLMMKNIIWLRWLNFVGCTLFVI
FT                   YGVFISAWPVAGMNAFVACINIYHLTKIYRAKANPNAIA"
FT   gene            554971..555483
FT                   /locus_tag="Sputcn32_0510"
FT   CDS_pept        554971..555483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0510"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   son:SO4195 PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74242"
FT                   /db_xref="GOA:A4Y2Q9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Q9"
FT                   /protein_id="ABP74242.1"
FT                   /translation="MLSYIADLDKRFFCCIVAFTDRHGLYAYAKRLSASGDGHLYLYLS
FT                   VGLMLAHSQGQALFNLMLVSFLVELPLYLLLKNSIRRTRPCHALVGFESGFEPSDRFSL
FT                   PSGHTAAAFIMATSVAQIYPVAAPAAYLWALGVSCSRVALGVHYPLDIMAGASLGAGVV
FT                   LLVHQLI"
FT   gene            555557..556597
FT                   /locus_tag="Sputcn32_0511"
FT   CDS_pept        555557..556597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74243"
FT                   /db_xref="InterPro:IPR005262"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2R0"
FT                   /protein_id="ABP74243.1"
FT                   /translation="MRILYGVQGTGNGHLSRARVMAKALMEQDIKVDFLFSGRKPDQYF
FT                   DMQCFGDYRVQTGMTFATHSGRLNLPQTVRQNLSLSLMKDIQALDLSCYDLVLNDFEPI
FT                   SAWAARRQGVPSIGISHQAALIHPVPKMGNTWLNELLLMYFAPVDVALGCHWHHFGFPI
FT                   LPPFVEVVPCSSEHTHQILVYLPFEDVDTIASFLAPFSDYQFLVYHSQQPQVQTAKHIQ
FT                   WYGFNRDGFKQHLASCGGVIGNAGFELASEALTLGKKLLVKPLIGQFEQLSNVAALQLL
FT                   AAADSMMTLDINVLKRWLKAASPNPIAYPQVGDTLVKWLRGGDWHHSQPLCQELWAQVA
FT                   LPDTWR"
FT   gene            556739..558157
FT                   /locus_tag="Sputcn32_0512"
FT   CDS_pept        556739..558157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74244"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2R1"
FT                   /protein_id="ABP74244.1"
FT                   /translation="MSLKKFTQYKLLFLMLLSLCILLPFIPDQAYHIPGPDIAEQNFHV
FT                   IEFNDQGQAHDDRQWQGLRDRILQPNNDIAPELLIFVHGWHHSANPKDENFVAFEQFYR
FT                   QMAASDKQRNLLGLYIGWRGDKYDPFWLDGSDDATSQIEPIDFPTILQRKRVAKRIGQQ
FT                   GLSQLFDKLDGLVSNHQLLRYTVIGHSLGGSVVLHASKDRIKAAIDNGQDNPNLFLLLN
FT                   PAVPAKDYQPLDKLVSLDRQKPSMVVLQSKGDFAVKEAFNYIKDGERAVGNSWAITHDI
FT                   DKCSGGNCNTPIKMPSALMAHDKIPGCMMTLANSGWKIRARLQARRSVQTCPDANMQAV
FT                   WVLAVSDEIVSGHNGILTADHAKALSEVMSMIDLYRNQLPKHAVESPANQDLGALTPES
FT                   GAVVSAEGEIAVPEEPVVIVEPLPNEQSSDSQRQDESPITEVPPVPIIDSEPDSTSESQ
FT                   PEEDIKPQPETKDM"
FT   sig_peptide     556739..556831
FT                   /locus_tag="Sputcn32_0512"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.965) with cleavage site probability 0.794 at
FT                   residue 31"
FT   gene            complement(558265..559893)
FT                   /locus_tag="Sputcn32_0513"
FT   CDS_pept        complement(558265..559893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0513"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   ilo:IL1068 methyl-accepting chemotaxis protein with
FT                   ligand-binding sensor domain and HAMP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74245"
FT                   /db_xref="GOA:A4Y2R2"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2R2"
FT                   /protein_id="ABP74245.1"
FT                   /translation="MNVIKRLYSGFAVLLLIMLGITLFGLFKISIADENLTELSEQTAV
FT                   EQRQAINFRGSVHDRAISIRDVVLAKDNDKSKLHQNDIVRLNEYYQKAAVTLDAMYAKV
FT                   KHTPEEQNLLRSIKEIEASTLSLTENLLSMINNGRQAEATDYLITTVSPAYSEWLKRIN
FT                   KLIDYQEEAIQHQVASAREQTNSFQWIMLVVTTIAIIIGSLVAISTVNRLKKLVGGELE
FT                   YAAFVIKEIASGDLTTQVKFHTSESILSALKDLTDHMSGITKNSIKAASELLSASNELL
FT                   LTAKYNEDLIGNQKAATEQGATAINQMSSTVSEVANHTSDAAVLAQTAMNEFNAGQNEV
FT                   SKTQSSINKLADKVSEAAVVINNLSEDSRQIGSVLEVIQSIAEQTNLLALNAAIEAARA
FT                   GEQGRGFAVVADEVRNLARRTQESTGQVQTVIEKMQSNSINAVAVMNEGKTQAEISVEQ
FT                   AKSAGDSLYAINLSVTKISDMNTQIATAAEEQSVVASEINRNFSQITHSASLAEEQASK
FT                   ITIASQKLEVLAKTLEQNVKQFKTA"
FT   sig_peptide     complement(559795..559893)
FT                   /locus_tag="Sputcn32_0513"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.866) with cleavage site probability 0.838 at
FT                   residue 33"
FT   gene            complement(560099..560713)
FT                   /locus_tag="Sputcn32_0514"
FT   CDS_pept        complement(560099..560713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0514"
FT                   /product="DedA family protein"
FT                   /note="KEGG: shm:Shewmr7_0412 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74246"
FT                   /db_xref="GOA:A4Y2R3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2R3"
FT                   /protein_id="ABP74246.1"
FT                   /translation="MPDALQHIMSELTPWLQEYGYVLLFIAIAVEGFGIPAPGQSLLIV
FT                   ASLLAATGQMSLSAVLMVAACGALCGNSFGYYIGWRFGEVLLNKGWIKPQLEDKIHSVI
FT                   GQYGIAALILSRFIEGLKQFMFIGCGLAKMPLKQFVVGNCLATSIWVSIFGLGPAIIRD
FT                   EITPILAFYHQHKYPTWAGVSLILAVLILLTWRKWQTKNPQ"
FT   gene            complement(560912..561832)
FT                   /locus_tag="Sputcn32_0515"
FT   CDS_pept        complement(560912..561832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0515"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: phosphoesterase, RecJ domain protein; DHHA2
FT                   domain protein; KEGG: son:SO4190 inorganic pyrophosphatase,
FT                   manganese-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74247"
FT                   /db_xref="GOA:A4Y2R4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2R4"
FT                   /protein_id="ABP74247.1"
FT                   /translation="MPIYVVGHKIPDSDSICGAIALAYLKNQIGEEAVAARLGELSPET
FT                   AFILERFGFEAPEYKTSYAGEQVYIVDHSELTQAPDDIAKATIVGIVDHHKLGDLTTDT
FT                   PLECWIRPVGCSNTVIKMMYDFYQVAIPKNIAGIMMCAILSDTVIFKSPTCTTADIRCV
FT                   EALAEIAGIEDFKALGMEMFKVKSAVEGTPARDLVMRDFKDFNMNGHLVGIGQLEVIDL
FT                   SVFDAIKAELEADIKALKVEGNRHSVLLLLTDIMKEGSELLVVSDDADLVNRAYGKTPV
FT                   DGKVWLDGVLSRKKQVVPQLQAAFA"
FT   gene            complement(561969..562430)
FT                   /locus_tag="Sputcn32_0516"
FT   CDS_pept        complement(561969..562430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0516"
FT                   /product="conserved hypothetical protein 22"
FT                   /note="PFAM: conserved hypothetical protein 22; KEGG:
FT                   shm:Shewmr7_0414 conserved hypothetical protein 22"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74248"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2R5"
FT                   /protein_id="ABP74248.1"
FT                   /translation="MIVDTLANRHIYQTLNPRIASALEHLATTDFSQLPVGNYPLDGDD
FT                   IFVIVNDYHTKHQSTESFEAHQKYIDVQYVFSGEEEFGYLPLVDQTPSKPYFEKHDYAG
FT                   FDYESNKENASYIKLKAGMFALFFPGDIHMPGTGHPATAVRKVVIKVKV"
FT   gene            complement(562566..565019)
FT                   /locus_tag="Sputcn32_0517"
FT   CDS_pept        complement(562566..565019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0517"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug; KEGG: she:Shewmr4_3540 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74249"
FT                   /db_xref="GOA:A4Y2R6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2R6"
FT                   /protein_id="ABP74249.1"
FT                   /translation="MVLTFVRSNCCFIYTLLRGCMRLAVIALAVSSTLTMSAAQADSQH
FT                   AAVEKIEVIGSRIALRTATDSVAPVDIITAEQLESTGMTETAKALQFAAPSYSFPFSSV
FT                   TDGSDAVRPASLRGLSPDHTLVLVNGKRRHGSALVHLSGTMGKGSSNVDLNAIPMTAIK
FT                   RIEILRDGASAQYGSDAIAGVINVVLKDSDQGGSVSAQAGQTYQGDGEQWRVGVNHGIS
FT                   LSNDGFVNVALEAHHKDSTNRAGLDPRQQYPKLADGSDDPREATFNRKSHQVGDAEYDN
FT                   VGLFINAAQPISTDGKLYAFGGISQRETKSGAFYRLALDARNLPEVYPDGFLPQINPKI
FT                   IDSSLTLGYEFNLSDWDIDTSVGYGKNSFNYNIVNTLNASLGPESPTEFDAGTLATRET
FT                   NINLDISRYFAFVNDSEILFATGVSWRQNGYEIEAGEEGSYINGGYNGKAPGSQGFTGF
FT                   TPESEVDETRDNTGIYAELENQLTNEFYWAAALRYENYSDFGGNTSWKLAGRYDFTDNL
FT                   ALRGTINTGFRAPSVQQLYFSNISTLFNPDPVTGQLVPVESGTFNTLSPVTKALGINEL
FT                   EPEISQSFSLGLVYTNDSGLAVTLDTYQIEIDDRIILSGSLRATDSPAVAAALAGTNAD
FT                   SARFFVNAVDSRTRGVDLVVSQDIDIGTWGDLRANLAYAYNKTEIQDINLPSILGGLEK
FT                   KLFDGIERTRMTSATPHNTGSIGLTHELGDFKTNARLNYFGDYSEGYSTGDVNYSDQWV
FT                   MDLSVRYAATDALSFTAGVQNLFDVYPEKRPDNNNFNGIFVYPLTNTPFGFNGGYYFLE
FT                   AKYTY"
FT   sig_peptide     complement(564894..565019)
FT                   /locus_tag="Sputcn32_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.990 at
FT                   residue 42"
FT   gene            565272..565847
FT                   /locus_tag="Sputcn32_0518"
FT   CDS_pept        565272..565847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0518"
FT                   /product="ATP-dependent protease La (LON) domain protein,
FT                   putative"
FT                   /note="KEGG: son:SO4182 ATP-dependent protease La (LON)
FT                   domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74250"
FT                   /db_xref="GOA:A4Y2R7"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2R7"
FT                   /protein_id="ABP74250.1"
FT                   /translation="MQTREMALIIRDALLLPQGRIEVRVVEPGYLRMVADVLKGKYDLA
FT                   FAAANPRGNPPCYPTATQCNIIDFNQLEDDSLSIVLEGRQRVNILSAAQAKDKVWMSRT
FT                   LPCRNWRHEPIKGEFELISAALEQFYEVNPALLELYAQVHLEDAAWVSQRWLEVLPMYN
FT                   KDKLVLVNQPDCHKTLDFVLQLIKSHVD"
FT   gene            565901..566818
FT                   /locus_tag="Sputcn32_0519"
FT   CDS_pept        565901..566818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0519"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: shm:Shewmr7_0418
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74251"
FT                   /db_xref="GOA:A4Y2R8"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2R8"
FT                   /protein_id="ABP74251.1"
FT                   /translation="MTLTVRAAQPSYVVLPRNITDTPTVFAFLSTHFARIGEEVWRERI
FT                   LDGKVHWQDGSLIALDTLYRPMARVYYYREVPVETKVPFEEQILFQDDNLILACKPHFL
FT                   PVTPSGNYVNECLVHRLRLRTGIETIAPAHRLDRETAGVILMTIQPETRHLYHQLFVDN
FT                   AICKDYQAIAKLTPGIIEQYQKGHLTLPLHWTVKNRMQPGDPSFTMQVVEGEANSHSEI
FT                   SLVAIKDDLGLFHLSPITGKTHQLRVHMLSLGMPLLNDRFYPKLQPKSPDNFATPLKLM
FT                   AQRLRFVDPVSGIHHDAQCNGFEF"
FT   gene            566933..568237
FT                   /locus_tag="Sputcn32_0520"
FT   CDS_pept        566933..568237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0520"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; KEGG: she:Shewmr4_3530 periplasmic sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74252"
FT                   /db_xref="GOA:A4Y2R9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2R9"
FT                   /protein_id="ABP74252.1"
FT                   /translation="MTKILGTSLPAADQVALLRTLGLLLQMGLTTFAADTFGLSLQMEP
FT                   LVHVLVLETLYLSLTLVLRKPLFAKESGLFIALGLDTLFWISWLYFSGGATNAFISLLL
FT                   LPIALAAVTLPIWAPWSLTAISTLAYSLMIFTVPESQMQHHGMDMSSHYLGMWFNFVIS
FT                   ALVMTTSVALITKRMRRQDAQLAFMREGQLRQEQLLALGTASAQMAHQLATPLSTLRLL
FT                   LDEVKEEGRVVSASVGEMEIALGRCEHTLAELRLATESIRDRRQHPLALNELIDGLKQK
FT                   TSLLMPHTELNWQIACPPSQLTGLHILTDMSLAPAIMALIENAARASAETLGVAQVDIS
FT                   VDSEPNEGLLYVRIRDYGAGIAPSLLPQLGTLLVESPKGLGVALLLSHASLERLGAQLV
FT                   LANHPQGGTVAQICFTVLVDPKTLDKTALVDKITP"
FT   gene            568234..568785
FT                   /locus_tag="Sputcn32_0521"
FT   CDS_pept        568234..568785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0521"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix,
FT                   Fis-type; KEGG: she:Shewmr4_3529 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74253"
FT                   /db_xref="GOA:A4Y2S0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2S0"
FT                   /protein_id="ABP74253.1"
FT                   /translation="MKKLLIVEDDHALASVLERRLTRHGFNCRLTHDASDVLLVAREFR
FT                   PSHILLDMKLAEANGLSLIVPLRNLLPKVMMVLLTGYASIATAVEAIRLGADNYLAKPV
FT                   DTQTLLVALDIDTQSHLLQEDEIDDSPLNPKRLEWEHIQQVLNANQGNVSATARQLGMH
FT                   RRTLQRKLLKKPVSETGPLK"
FT   gene            568817..569293
FT                   /locus_tag="Sputcn32_0522"
FT   CDS_pept        568817..569293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74254"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2S1"
FT                   /protein_id="ABP74254.1"
FT                   /translation="MREYDGIEVRYRRPDANLAKSLQVIENLLGFAPESQQLDFDLSFW
FT                   AGGAGVLDKLAISCFVTPEQRQVLQQKLDLYSPEEAVARDYWRDDFIWLVADDEVCSDI
FT                   LAASAQFINDNKAPFQDECDTLQAIYFGYMSDVNCWTAVWGQGSRINYAYFCQG"
FT   gene            complement(569342..570049)
FT                   /locus_tag="Sputcn32_0523"
FT   CDS_pept        complement(569342..570049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0523"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   she:Shewmr4_3527 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74255"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2S2"
FT                   /protein_id="ABP74255.1"
FT                   /translation="MEILIVGGSGGIGKAMVKQIQETYPDAAVHATYRHHPPHDMQEKI
FT                   QWHALDVTNEAEIKQLSEQLAKLDWVINCVGILHTQDNGPEKSLQSLDTDFFQHNLKLN
FT                   TLPSVMLAKHFEPVLKRSVSARFAVVSAKVGSITDNRLGGWYSYRTSKAALNMFLKTLS
FT                   IEWQRTMKHCVVLSLHPGTTDTSLSKPFQQSVPKDKLFTPQYVAQCLVSIIANATPAQT
FT                   GRFLAYDGAELPW"
FT   gene            complement(570093..571658)
FT                   /locus_tag="Sputcn32_0524"
FT   CDS_pept        complement(570093..571658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0524"
FT                   /product="deoxyribodipyrimidine photolyase-related protein"
FT                   /note="PFAM: deoxyribodipyrimidine photolyase-related
FT                   protein; KEGG: son:SO4169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74256"
FT                   /db_xref="GOA:A4Y2S3"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2S3"
FT                   /protein_id="ABP74256.1"
FT                   /translation="MQLRQQLKHFHSVRLILGDQLNAQHTWYKQVDPKVLYLIAELHQE
FT                   NTYVTHHVQKICAFFSAMTQFASKLCADGHQVRYLTLDDTQNFADLNALLQHYIAETGA
FT                   IKFEYQRPDEYRLLAQLSQLKLANITVNCVDTEHFLLPFAEIDREFPQGQHRMMEHFYR
FT                   RMRKRFNILIEDGKPVGGQWNFDASNRQKLKSQDLKSLPTPLMFGHNVEDILERLKRHG
FT                   INTMGKADMHLLWPINRAQSLELLRYFCEYCLPAFGRFQDAMTQQHPAQWSLYHSRLSF
FT                   SLNAKLISPLEVINAVIEHYQANPHIEIAQVEGFVRQILGWREYVRGIYWANMPQYASI
FT                   NTLEATRKLPDYFWNGKTQMNCLRHALSQSLDFAYAHHIQRLMVIGNFCLLTEIEPNQV
FT                   DEWYLGVYVDAIEWVEMPNTRGMALFADGGIVGTKPYAASGSYINKMSDYCSGCHYKIK
FT                   ERSGALACPFNSFYWRFMNKHRARLSQNPRIGMLYQTWDKMEESVRNTILATAEHNLAN
FT                   LNRL"
FT   gene            572243..572953
FT                   /locus_tag="Sputcn32_0525"
FT   CDS_pept        572243..572953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74257"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2S4"
FT                   /protein_id="ABP74257.1"
FT                   /translation="MNKKPKSNLIGLSLTQVNKDILSDIAEISLDTTMKKFAADQELLR
FT                   DLPVIKWLVAANSVWNSVHNAHFLKKYASFIGQVSAEHITKEDVLLLNEDVLFADVIEK
FT                   ITENTLVYIDRYHDELKAKLLGQLFVETFVYYKFSVDEYNSLMFSIDSIHPFEGIPRLK
FT                   AFYQHKVQVNEALNDEDKEVILGKQAQLGYQPLVMSGLLNLPMGGAYFGDFGGASINEL
FT                   GFKFYEQVVRKVIC"
FT   gene            complement(573432..574019)
FT                   /locus_tag="Sputcn32_0526"
FT   CDS_pept        complement(573432..574019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74258"
FT                   /db_xref="InterPro:IPR025402"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2S5"
FT                   /protein_id="ABP74258.1"
FT                   /translation="MSEKVPCTACQTLIMPSTAERNAGLCMPCKNGNRENIEQAKAYYQ
FT                   QERELDKTCPFRALWRDIVVRVHDDKQGFHTLSEAAQYYYAVNCLSGEVYNGGFIQYFD
FT                   NSSGEHYEVAERGLQQIGALHSLALLQQAKQAVFGDHPVPTNRDQRLAATDNPVAEARL
FT                   NQLDDEFYKDLDNLDIKLESHARQTGLVNAIE"
FT   gene            complement(574118..574504)
FT                   /locus_tag="Sputcn32_0527"
FT   CDS_pept        complement(574118..574504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0527"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   she:Shewmr4_3523 protein of unknown function DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74259"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2S6"
FT                   /protein_id="ABP74259.1"
FT                   /translation="MTTASPNVIDLKLKRKSRILEISFDNGEQYQLSCEMLRVYSPSAE
FT                   VHGHGNPKLVTHKKNVNITSIEPVGNYAVKIVFDDGHDTGLFSWKVLYDLATHQVELWE
FT                   KYLARLRAEKASREPLISMNIKYN"
FT   gene            complement(574711..576039)
FT                   /locus_tag="Sputcn32_0528"
FT   CDS_pept        complement(574711..576039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0528"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: she:Shewmr4_3522 heat shock protein HslVU,
FT                   ATPase subunit HslU; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74260"
FT                   /db_xref="GOA:A4Y2S7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2S7"
FT                   /protein_id="ABP74260.1"
FT                   /translation="MSEMTPREIVHELDAHIIGQKKAKRSVAVALRNRWRRMQLDVDFR
FT                   QEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVEQIIRDLT
FT                   DIAIKLTREQQMGKCRQLAEEHAEERILDALLPKPKNDWESTDTDTGSNTRQIFRKKLR
FT                   EGQLDDKEIDIDVAQPQIGIEIMSPPGMEEMTNQLQSLFKNMGQAPAKRRKMKIKEAFK
FT                   LLIEEEAAKLVNQEDLKEQAIEMVEQHGIVFLDEIDKICKRGETSGPDVSREGVQRDLL
FT                   PLVEGCTVTTKHGMVKTDHILFIASGAFQMAKPSDLIPELQGRLPIRVELDALSADDFK
FT                   RILTEPHASLTEQYVALMGTEGVKVEFTESGIESIAKAAWQVNERTENIGARRLHTVME
FT                   KLMEDISYEASDKSGSAFVIDADYVSAHLDNLVQDEDLSRFIL"
FT   gene            complement(576059..576583)
FT                   /locus_tag="Sputcn32_0529"
FT   CDS_pept        complement(576059..576583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0529"
FT                   /product="20S proteasome, A and B subunits"
FT                   /note="PFAM: 20S proteasome, A and B subunits; KEGG:
FT                   shm:Shewmr7_0434 20S proteasome, A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74261"
FT                   /db_xref="GOA:A4Y2S8"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2S8"
FT                   /protein_id="ABP74261.1"
FT                   /translation="MTTIVSVRRNNQVVIAGDGQVSLGNTVMKGNAKKVRRLYHNKVLA
FT                   GFAGGTADAFTLFERFEAKLEMHQGHLLRSAVELAKDWRTDRMLRKLEAMLVVADAEAS
FT                   LIITGNGDVVQPEYDLVAIGSGGNYAQAAALALLQNTELSALEIAEKSLTIAGDICVFT
FT                   NQFKTIEELNY"
FT   gene            complement(576734..577312)
FT                   /locus_tag="Sputcn32_0530"
FT   CDS_pept        complement(576734..577312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74262"
FT                   /db_xref="GOA:A4Y2S9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2S9"
FT                   /protein_id="ABP74262.1"
FT                   /translation="MSRLQSSKGFTLIELVVVIIILGILAVVAAPRFLNLGQDAHDARA
FT                   KTAFAAFTSGVKLYHSCWLAGGHSGYIQDIACYGDGKIDSTSTGFPLGINTASSSNAGT
FT                   QLQGEFCGELWHNLIGNNEFVLANHFDWQQVPNTDIVYWYSGGPITNPNTFCYFNYVSD
FT                   DRRLGSENWELKYYPLNGHTEVGRSTLSQ"
FT   sig_peptide     complement(577223..577312)
FT                   /locus_tag="Sputcn32_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.737) with cleavage site probability 0.715 at
FT                   residue 30"
FT   gene            complement(577478..578029)
FT                   /locus_tag="Sputcn32_0531"
FT   CDS_pept        complement(577478..578029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0531"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: lpn:lpg1988 dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74263"
FT                   /db_xref="GOA:A4Y2T0"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2T0"
FT                   /protein_id="ABP74263.1"
FT                   /translation="MKASVFIAATLDGYIATPDGDIDFLNQHPSTNPDEDFGYHAFIDT
FT                   IDAIVMGRKSFEKVLSFDCDWPYMNIPVFVLSRSGITVPSALSEHVQVLNGNAANISKQ
FT                   LRERGFKHLYIDGGQTIQGFLAAGLIQELTLTRIPTLLGKGIPLFSDVPQAIQLMPIHT
FT                   QQYDNGYVQTRYRVIDNTAL"
FT   gene            complement(578040..578321)
FT                   /locus_tag="Sputcn32_0532"
FT   CDS_pept        complement(578040..578321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74264"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2T1"
FT                   /protein_id="ABP74264.1"
FT                   /translation="MFKSFIFIIFSLFLLTSIGGCVGPLNAKCDANSPYSTQECNAADA
FT                   AVYVAAAILEGPDKSQTCNDMSGKAKQDCLAQQQALKESLEKHARKSH"
FT   sig_peptide     complement(578238..578321)
FT                   /locus_tag="Sputcn32_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.916 at
FT                   residue 28"
FT   gene            complement(578755..579939)
FT                   /locus_tag="Sputcn32_0533"
FT   CDS_pept        complement(578755..579939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0533"
FT                   /product="flagellar biosynthesis protein, putative"
FT                   /note="KEGG: son:SO4160 flagellar biosynthesis protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74265"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2T2"
FT                   /protein_id="ABP74265.1"
FT                   /translation="MDNLIIKPGYVTQFQCVGPECEDSCCYDWRISFDKKSYKNTIKHP
FT                   LLATTAKSAFIETKKSTSDWADIRLNEQGACPFVNEHKLCDIHAKAGEQALSHTCKTYP
FT                   RIHKVIGGNKYESLYLSCPEVTRLVLFNPNAFQFDSNISGIKQPSTPSPIWLEKTHEYS
FT                   LDLLVNLGLDWEQVLLAIGLLIKVSDQVRQNILPIEELDKRLQQLKLYAQSGALAEQYK
FT                   NLPYSPLPQMHAFIAVHNELCKTHSRGVRERFTSLNQAVAALCNEENNYQIDALNQAWA
FT                   EHAVPALISHTDLFERYILYSIYHHHFPLIDSQQLSWEAFRLLVLDCFMIRSYLSAIAF
FT                   KNKGLSESDIVMCFQLYQVVRQHKIEFTQSMSKTLEECGIDSVPAAICLLKTNI"
FT   gene            complement(580151..580753)
FT                   /locus_tag="Sputcn32_0534"
FT   CDS_pept        complement(580151..580753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0534"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: shm:Shewmr7_0436
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74266"
FT                   /db_xref="GOA:A4Y2T3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2T3"
FT                   /protein_id="ABP74266.1"
FT                   /translation="MLTKLPLYLVDDDDAILDSLGFMLRQFGYQVQTFNNGRDFLEQCP
FT                   LSEAGCVILDSRMPEITGQEVQQKLIETHSPLGVIFLTGHGDLPMALSAFRKGACDFFQ
FT                   KPVSGKALVQAIEKAQCESLATFEKQSLQHKFDQLTEREQQVLAHVIQGMTNKQISEAM
FT                   FLSLRTIEVHRAKIMKKLEVNNMAELVQHLGNLNSVL"
FT   gene            581017..582825
FT                   /locus_tag="Sputcn32_0535"
FT   CDS_pept        581017..582825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0535"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: she:Shewmr4_3516 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74267"
FT                   /db_xref="GOA:A4Y2T4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2T4"
FT                   /protein_id="ABP74267.1"
FT                   /translation="MRLMFKAIGYLLLLGLSYVSLSYADEATEVNLFKVGVLANHGVLQ
FT                   AKQRWQPMMDYLSEQVPNSHFEVVPVDFNGMSSGLLNHDLQFIVTNPGQYLHLSNNFPL
FT                   SWLATMKSRKHQGSTFTIGATIIVRADSPIRTLQDLRGKNVVATDPQALGGYQAAMGLL
FT                   HKMGFLPEQFFGQVRFLGFPLEPLIYQVRDGSADAAIAPFCTLEEMIETGLINKADFRV
FT                   IHPTKPAGYDCEVSTQLYPSWSFAAADTVSPRITMQISRALFDLPPDHVAAITADTLGW
FT                   TAPVSQLKVIELFKELQLQGASPPLYQTVYKWMEKNKEWGGVLLLIFIVSTIYHLWLEY
FT                   KFRQKSEFLISTERQLKDKALQLERLQSAAILGEIGAGLAHELNQPIAAITQYSEGAML
FT                   QLERLGQNNPELYDVLGKINAQSIRAGAVVHRIRGLLKRRQAKTEPLDITLVVKEALAL
FT                   LRRELDRANVQVNVRVQGEPFELTGDSVGLSQMWVNLVKNSLDALETCGDTRVRQLWID
FT                   IYYLPHEIRVFVIDNGEGLQGQASELMASFASTKDEGLGLGLAICKDVVTRHHGSIQIE
FT                   NCQDCTTEAALPWQQGCIVTVVLPRE"
FT   sig_peptide     581017..581091
FT                   /locus_tag="Sputcn32_0535"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(582855..584012)
FT                   /locus_tag="Sputcn32_0536"
FT   CDS_pept        complement(582855..584012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0536"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: son:SO4150 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74268"
FT                   /db_xref="GOA:A4Y2T5"
FT                   /db_xref="InterPro:IPR031563"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2T5"
FT                   /protein_id="ABP74268.1"
FT                   /translation="MTAGKTPTHFTTQPLNRVLGETSGAFADLGTFLPLVLGLIALNQF
FT                   SPQGIFLGFGVFAIISAFFYRRPMPVQPMKVIAALVIAQGLTPGMLQASAMLMGIILLI
FT                   LAFSGAITWLAKQLSQAVSVGIQLAIGLQLMWMGAKMMSDFWLLGLGAFILLFVSKFLP
FT                   LRYLAMPLVITAGMIWQANSQTDMATSLSIPAVSASLHLAWPTLNEWSSAAILLVLPQL
FT                   ALTLTNAVIATSVMAREKFPEDAAKLTPKNLAISSGLANLLLAPFGAAAMCHGAGGLAV
FT                   QYHFGARTHLAPLIFGGTCLIIALFWDNQIAWLLGLIPVAILGSLLSIGGLQLAWSKRL
FT                   LDGKPFCIFVILSTAVTCLAINAAAGLAVGIILEQGRRTWAIAMR"
FT   gene            complement(584204..584995)
FT                   /locus_tag="Sputcn32_0537"
FT   CDS_pept        complement(584204..584995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_1924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74269"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2T6"
FT                   /protein_id="ABP74269.1"
FT                   /translation="MKLTVITKLLTMIIFSSLCLPKAAAVSPIVWQAHCRDRSPIIYFE
FT                   QGECKGPGAAVINEVFRRLGHRVHWTDVPWARTIKVAEAGQVDLIPSHSMTTERESFLD
FT                   PMLLGYDKRYVYYYALASQPTAIREFNELTPYIIGALRGTFYSTQFNENMNQLKVSFVN
FT                   TNSQLINMLKAGRIDLAISSEQHEMHIFANDPMLKQMEYVDISKNGRYFSIPLTSPRHK
FT                   YAKQVHQIVDQMRTSGEITRLFESYGVEPPLNLTESPTATH"
FT   sig_peptide     complement(584918..584995)
FT                   /locus_tag="Sputcn32_0537"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.935 at
FT                   residue 26"
FT   gene            complement(585195..586733)
FT                   /locus_tag="Sputcn32_0538"
FT   CDS_pept        complement(585195..586733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74270"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2T7"
FT                   /protein_id="ABP74270.1"
FT                   /translation="MLLILIIIAFVVLFIVFAKYQKKQAQAKALAAGEPTALLNHGLTL
FT                   INQGEVNAGLDYIQQAADKGLAVAAIAMAELYSGRFPQIPADPKASNDWYKKAAEIEPQ
FT                   YLPMLTLPNLLSSQSQTLDELIAQVEQLKPNAEAGQAEFQYELAYLYLSQPFLDPDASQ
FT                   AIYWFEKAAAQENQRAYYHLATLYWHDERVTSDYIKAREYFEKSAAADYELAKDDLGHM
FT                   LAAGQGGPKDLARAEALLSERAADDDFRQYYLGKRFLYGEDFAVDYDKARHWLSQSVAR
FT                   GNDFAKIEFAHLLLKAPQNESDYQQAKIDFEEFALKWNEDALLGLGKIYEQGLGVSRQP
FT                   IKALMYYQLAAMSNRADHLKELARFSQQLGTLEIREAERLCDSFLHQHPIPAEQQQYFY
FT                   SYKAESFLSGEKPTQEALQAAEAWYIKSAELGNEIAMRELVNIYGAEQLNKPIQMFIWS
FT                   SLLLRHFGKYGMNSVQRLHQNTAKSCLTESELAYAETQIETIESKLAPFIESED"
FT   gene            complement(586850..587686)
FT                   /locus_tag="Sputcn32_0539"
FT   CDS_pept        complement(586850..587686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0539"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   she:Shewmr4_3509 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74271"
FT                   /db_xref="GOA:A4Y2T8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2T8"
FT                   /protein_id="ABP74271.1"
FT                   /translation="MIAPGLDQELQQLQGVYQLITEFLVTYSFQLLGALLIFLLGLWVA
FT                   SKVSRLVAKQFEKHNIDITLSNFVSNLIRILIIVMVGIIALGKIGISVTPMVAAIGAAS
FT                   LGAGLALQGMLSNYAAGVTIIVTRPFVVGNTIEIKGESGVVKRINLGMTILTNEEGEQI
FT                   SIPNKHIVGEILHNSFSNKLVETQFNLSYSTDPEHAIAVITSQLTNNPYVHQETTPNIG
FT                   INGFNAVGIEMGVRYWVPTQSYFQHKYKVNLDLYHALKNAGIEIACPMKEIHLQNK"
FT   gene            587856..588335
FT                   /locus_tag="Sputcn32_0540"
FT   CDS_pept        587856..588335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74272"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2T9"
FT                   /protein_id="ABP74272.1"
FT                   /translation="MKTLLLCVSCLLTPIWAFAASYVTGDTINPISLVDQHDKSIEVTD
FT                   DTRVVLFSRSMKGGDIIKETLQPLSETQFPNHLVYVADISGMPSLIAKFVAVPQMKELP
FT                   FSIGLDREGEISQMLPDTKDMATMILLDHRNILDIAYFDSSEALSQALTKINVTQ"
FT   sig_peptide     587856..587915
FT                   /locus_tag="Sputcn32_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.581 at
FT                   residue 20"
FT   gene            588679..589854
FT                   /locus_tag="Sputcn32_0541"
FT   CDS_pept        588679..589854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0541"
FT                   /product="ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG: son:SO4136
FT                   decarboxylase, pyridoxal-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74273"
FT                   /db_xref="GOA:A4Y2U0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2U0"
FT                   /protein_id="ABP74273.1"
FT                   /translation="MSQFQSIDVADYYDMDTFKRIEAFAKDKATPFVVIDTSIIAKQYD
FT                   DMVNSFPYANVYYAVKANPAAEILSLLKDKGSNFDIASIYELDMVMNVGVTADRVSYGN
FT                   TIKKRQDVRAFYERGVRMYASDSEADLRMIAEEAPGSRIYVRILTEGTDTADWPLSRKF
FT                   GCQNEMAYELLVLAQELGLEPYGISFHVGSQQRDIGAWDSAIGKVKSIFDRLRDEHNIT
FT                   LKMINMGGGFPANYIDKTNQLGVYAEQITHFLKEDFGDDLPQIILEPGRSLISNAGILV
FT                   SEVVLISKKSYTALERWVFTDVGKFSGLIETMDEAIKFPIYTEKKGELDKCVIAGPTCD
FT                   SADIMYEHYSYGLPNDLAIGDRMYWLTAGAYTTTYSAVCFNGFPPLKDYYL"
FT   gene            complement(589917..590129)
FT                   /locus_tag="Sputcn32_0542"
FT   CDS_pept        complement(589917..590129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0542"
FT                   /product="protein of unknown function DUF465"
FT                   /note="PFAM: protein of unknown function DUF465; KEGG:
FT                   son:SO4134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74274"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2U1"
FT                   /protein_id="ABP74274.1"
FT                   /translation="MFPEYRELISTLKNQDAHFQRKFNEHNQLDEEIKQLEKRVGSDFN
FT                   PAVKELKSRKLHLKEEIYQILKSHN"
FT   gene            590665..591423
FT                   /locus_tag="Sputcn32_0543"
FT   CDS_pept        590665..591423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0543"
FT                   /product="uridine phosphorylase"
FT                   /note="TIGRFAM: uridine phosphorylase; PFAM: purine and
FT                   other phosphorylases, family 1; KEGG: son:SO4133 uridine
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74275"
FT                   /db_xref="GOA:A4Y2U2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2U2"
FT                   /protein_id="ABP74275.1"
FT                   /translation="MADVFHLGLTKAMLDGATLAIVPGDPERVKRIAELMDNATFLASH
FT                   REYTSYLAYADGKPVVICSTGIGGPSTSIAVEELAQLGVNTFLRVGTTGAIQPHVNVGD
FT                   VIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVTASSDTFYPG
FT                   QERYDTVTGRVTRRFAGSMKEWQEMGVLNYEMESATLFTMCATQGWRAACVAGVIVNRT
FT                   QQEIPDEATMKKTEVSAVSIVVAAAKKLLA"
FT   gene            complement(591526..592278)
FT                   /locus_tag="Sputcn32_0544"
FT   CDS_pept        complement(591526..592278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74276"
FT                   /db_xref="GOA:A4Y2U3"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2U3"
FT                   /protein_id="ABP74276.1"
FT                   /translation="MKKTCLCLALMLSPQAFAGDLVQWWDFSATALYGEDYDLAPSDKQ
FT                   ATITLETAGGWKYGDWFAFQDFIYFKGNHTGMDSTTYGEISPRFSASKILGEKIAFGPV
FT                   TDLSLALTYEEGEGPVHSLLYGLGVDVAVPYFTYLNFNTYRRDAMSTGNNSDGWQFTPV
FT                   FRIDIPVGSANIVLDGFIDWVFATDKDGYEENFHFNPQLKYDLGKSLFGEHKANKLLVG
FT                   IEYDLWTNKYGVKGVDQDTYSVIAQYHF"
FT   sig_peptide     complement(592222..592278)
FT                   /locus_tag="Sputcn32_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            592755..593225
FT                   /locus_tag="Sputcn32_0545"
FT   CDS_pept        592755..593225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0545"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   shm:Shewmr7_0449 protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74277"
FT                   /db_xref="GOA:A4Y2U4"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2U4"
FT                   /protein_id="ABP74277.1"
FT                   /translation="MELSNPILMWSVIGIILMLAELIVPGGIVILLGAACLVVAGALGI
FT                   GLVEGIVQSMTLWFISAIVLLLSFRQLTQRLVGGDSHVDNTDEELDIYNQIARVKQTIG
FT                   PGQTTGRVEFQGSEWPALGDGSIIAVGCEVRIICRENIALVVEPVTQATSQN"
FT   gene            593237..594172
FT                   /locus_tag="Sputcn32_0546"
FT   CDS_pept        593237..594172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0546"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: son:SO4129 SPFH
FT                   domain/Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74278"
FT                   /db_xref="GOA:A4Y2U5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2U5"
FT                   /protein_id="ABP74278.1"
FT                   /translation="MFLFTLIILFVLFILYKLMLIVPMREVHVIERLGKFRTVLQPGFH
FT                   FLIPFFDRVAYRHDTREQVLDVPPQSCISKDNTQLEVDGLVYLKVMDGKLASYGIENYR
FT                   KAAVNLAQTTMRSEIGKLTLSETFSERDSLNESIVREIDKASEPWGIKVLRYEIRNITP
FT                   SRHVIHTLEKQMEAERRKRAEITLANAEKAAMINMSEGERQEAINLSEGQKQKRINEAK
FT                   GTGQEIAIIAKAKSEGMAMISQALAVNGGTDAMNMLLKEQFIAQVGKILNDAQVSVVPA
FT                   EMAKLEGFFEGMEQVTHTMSGQNTVSKGAR"
FT   gene            594172..595116
FT                   /locus_tag="Sputcn32_0547"
FT   CDS_pept        594172..595116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0547"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein; KEGG: son:SO4128 SPFH
FT                   domain/Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74279"
FT                   /db_xref="GOA:A4Y2U6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2U6"
FT                   /protein_id="ABP74279.1"
FT                   /translation="MNIPFDTDLAVMAIWGLIFAIFVIKLFQSIRLVPTKSAYIVERLG
FT                   KYHSTLDAGFHTLIPFVDKVAYIHDLKEETIDVPPQECFSSDEVNVEVDGVIYISVTDP
FT                   VKASYGITDYRYAAIQLAQTTTRSVIGTLDLDRTFEERDVISAKVVEVLDQAGAIWGIR
FT                   VHRYEIKNITPPETVKNAMEMQVNAERERRALLAKSEGDKQSKINRSEGVKAETVNRSE
FT                   GEMQRRINEAEGKAEEILTLSRATAESIERLASVISAPGGHNALRMQLGEQYMKQLDGL
FT                   SQKNTRVVLPGNMVDFDYWMNSIGLKEAGLKDK"
FT   gene            complement(595307..595531)
FT                   /locus_tag="Sputcn32_0548"
FT   CDS_pept        complement(595307..595531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74280"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2U7"
FT                   /protein_id="ABP74280.1"
FT                   /translation="MNALIEIEANEFSQLFKDGDTLGIRMFMEHVNMPLDVQDKIYDEI
FT                   SALPQLEQNAIAQLIETHSHSQISERLAY"
FT   gene            complement(595826..596518)
FT                   /locus_tag="Sputcn32_0549"
FT   CDS_pept        complement(595826..596518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0549"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: son:SO4124
FT                   cell division protein FtsN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74281"
FT                   /db_xref="GOA:A4Y2U8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2U8"
FT                   /protein_id="ABP74281.1"
FT                   /translation="MSHRDYANRRPQSGAKPRPIRATRARPVQKSAPRKKYPVALILFV
FT                   ILAVGCFSYFLWSIKDTAKQQTPAPTPKTENRVKVKEASTLTPKVKEAQVQEERQAVTL
FT                   PVEKQEVTPKVDPNALPPKPKEEWTYLNELENKHVEVDIPDVVSTRAPQQYQLQCASFR
FT                   QESQANQMKAVIAFQGLEAQVRQIEGTTGTWYKVSLGPYTTKRDAERKRHVLQNAGING
FT                   CQILAVPK"
FT   gene            complement(596522..598267)
FT                   /locus_tag="Sputcn32_0550"
FT   CDS_pept        complement(596522..598267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0550"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: shm:Shewmr7_0456 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74282"
FT                   /db_xref="GOA:A4Y2U9"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A4Y2U9"
FT                   /protein_id="ABP74282.1"
FT                   /translation="MKSHIQSLLEQTIESFKQQGILPADFEARIQVDRTKDKSHGDLAT
FT                   NLAMMLTKVAGKNPRELAQLIIDTLPASAFVAKVEIAGPGFINFFINDSALADQLQNAV
FT                   NDEHLGIKLPTPQTVVVDYSSPNLAKEMHVGHLRSTIIGDSVVRALEFLGHKVIRQNHV
FT                   GDWGTQFGMLLAYMEELRAKNGEQAHLELSDLETFYRAAKLRFDESAEFATRARQLVVE
FT                   LQSGDEYCNKLWREFNDISLSHCHEVYARLGVSLTRADVHGESAYNADLEQVVKDLDAQ
FT                   GLLTESNGAKVVFQEAFRNKEGEALPVIIQKADGGYLYATSDLAAMRYRSNVLKADRVL
FT                   YFVDLRQALHFQQVFSLAKLAKFVREDMSLEHLGFGTMNGEDGRPFKTRSGGVVKLVDL
FT                   LEEANVRALELVRSKNPDMDEETLAEIARVVGISAVKYADLSKNRTSDYIFSFEQMLSF
FT                   EGNTAPYLLYAYTRVAGIFKRVTGLDLSQAKIVLEHEKEKDLGNKLAQFGEILNRVVDK
FT                   GQPHVLCAYLYELAGAFSSFYEACPVLAADNDEQKNSRLLLSQLTARTLQKGLNLLGIE
FT                   TLERM"
FT   gene            complement(598378..600573)
FT                   /locus_tag="Sputcn32_0551"
FT   CDS_pept        complement(598378..600573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0551"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: she:Shewmr4_3495 primosomal protein N';
FT                   TIGRFAM: primosomal protein N'; PFAM: helicase domain
FT                   protein; type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74283"
FT                   /db_xref="GOA:A4Y2V0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2V0"
FT                   /protein_id="ABP74283.1"
FT                   /translation="MSLFVEVALPVPMRQNFSYRVPETYPQTPQIGVRVKVPFGRQQLI
FT                   GLVTAVTDTCSLEPKQIKAVIDFIDDTPLLPESLYKLTLWAARYYFCSQGQMLTQALPV
FT                   ALRKGLDAAPQKIQYWQLTELGQNIAPEIVKRAPAQKKLLELLKKTSLTQEEVITFAIS
FT                   KTALKALEDKGWVARHEKIAELNLDWRTQLVLDETPHRLNKEQAIAVTILNQQQGYHCT
FT                   LLEGITGSGKTEVYLAVLEEILKQGKQALILVPEIGLTPQTINRFKRRFKVNVAVLHSG
FT                   LTDNQRLEAWRQARCGQAAIIIGTRSALFTPMAYPGMIILDEEHDSSFKQQEGVGYHAR
FT                   DLAVMRGHLESIPVILGSATPSLESLQNALSGRYVHLQLGERAGAAKKVRQGIIDIKNL
FT                   PLKAGMSAPLLNEIRLHLDAGNQVLLFLNRRGFAPALLCHECGHLHECDRCDAFFTVHQ
FT                   SLGEICCHHCGNQYAIPKQCHKCGSTMLMGQGIGTEQLAEALQQEFPKYPVVRIDRDTT
FT                   RLKGSLESHLSAIHKGEYKILVGTQMLAKGHHFPDVTLVGLLDVDGALFSADFRAPERF
FT                   GQLYTQVAGRAGRASKPGTVLLQTHQSDNPILRDLLHRGYGEFARSQLKERQQALLPPA
FT                   WHMVLVRAEAHSALDADSFLNAFAALLPQDKEFEVIGPMPAPLDRKAGKFRRQLMFQAK
FT                   NRNRLQQEFERIHPLLELLPEAKRCRWSLDRDPQDLL"
FT   gene            600641..601543
FT                   /locus_tag="Sputcn32_0552"
FT   CDS_pept        600641..601543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74284"
FT                   /db_xref="InterPro:IPR020012"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2V1"
FT                   /protein_id="ABP74284.1"
FT                   /translation="MMVYLRIVESKLMANIVKSLGLFILVCSASSMAQVSHVSINNMMF
FT                   ELGTYPKMRLNVITDNQDITRLEFVLRQSSGEEKLMAQELNRFLVLLTGVEDVKDPKAQ
FT                   LVVREYRVDRWYEVKKIPLFVEPSAVSSHTTSVDSTRISQGVKSAELSSEVRLNKVDIV
FT                   ATEAKSLPAVSSSNLTPITKSMGSESIVTTGFIFSKDEPDQETGNAPKMMPTKECLLNY
FT                   DSSETLWRVANRYANEWNVSVYGAMLAIYDANPKAFAKNKISALRGDAALYCPSTDLLA
FT                   QYPDAKEAKAIFEAKQAGK"
FT   sig_peptide     600641..600742
FT                   /locus_tag="Sputcn32_0552"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.983 at
FT                   residue 34"
FT   gene            601695..601934
FT                   /locus_tag="Sputcn32_0553"
FT   CDS_pept        601695..601934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0553"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="PFAM: ribosomal protein L31; KEGG: shm:Shewmr7_0459
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74285"
FT                   /db_xref="GOA:A4Y2V2"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2V2"
FT                   /protein_id="ABP74285.1"
FT                   /translation="MALHFEVTPMKQGIHPEYAVITANCTCGNVIKVNSTAGKDLHLDV
FT                   CGACHPFYTGTQKVVDTGGRIDKFNKRFAVLAKK"
FT   gene            602448..603692
FT                   /locus_tag="Sputcn32_0554"
FT   CDS_pept        602448..603692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0554"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /EC_number="1.1.1.40"
FT                   /note="PFAM: malic enzyme domain protein; malic enzyme,
FT                   NAD-binding; KEGG: shm:Shewmr7_0460 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74286"
FT                   /db_xref="GOA:A4Y2V3"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2V3"
FT                   /protein_id="ABP74286.1"
FT                   /translation="MSDIRQQALDYHEFPVPGKTAVCLTKPAETSHDLALAYSPGVAEP
FT                   VREIAANPDNAYRYTNKGNTVAVITNGTAILGLGNLGPLASKPVMEGKALLFKHFANID
FT                   STDIEITHNTPEEFINTVAAIADTFGGINLEDIKAPECFVIERELIARCKVPVFHDDQH
FT                   GTAIVTAAGMINALEIQGKLISDATFVCMGAGAAAIACMTMLVKCGANRANIYMLDTKG
FT                   VIHSGRTDLNEYKALFANDTDKRTLQDVIKGADVFLGLSGPDVIGAEEVAMMADKPVIF
FT                   ACSNPDPEIKPALAHAIRNDLIMGTGRSDYPNQVNNVLCFPFIFRGALDVRASCINDEM
FT                   KIAAVHAIAELAKEPVPESVLKAYPKVSSLSFGPEYVLPKPMDPRLLPQVARAVAQAAI
FT                   ESGVAAITTLPKYAD"
FT   gene            603879..605783
FT                   /locus_tag="Sputcn32_0555"
FT   CDS_pept        603879..605783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0555"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; KEGG: shm:Shewmr7_0461 diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74287"
FT                   /db_xref="GOA:A4Y2V4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2V4"
FT                   /protein_id="ABP74287.1"
FT                   /translation="MKFTRMLTTKLTSFWLMSLAAIAFVFLLCAMMSFVQLTYKFQQQK
FT                   VTELESMLVNHYHAQSGWELDSWLPPLLLAYNTVEFKLTLKTEVLFAYQGNVLTQNAMV
FT                   YNHLLDPNSDLRMSLILPQPFEQYHVGWYEFLILAVGIFAIVVLVRFGYLWFSQQLDGI
FT                   EELALRSRLILQGKHEQALASPGKGKPRLINRALTKLLEELQDAQKERGRFDKFIRSNT
FT                   FLDAETRIGNRLFLNNRLDALSHNQGMVAHGVIYLLEMDDLDLLQQAKGESVAKELLNS
FT                   TVNGINQILQTLPNSIFARRFHNQFAIVVPQVSLIEADQLASKLLKVCLSQPLTDVDNR
FT                   DNFFHLGCAYFTAGDNATQLIDEADMALRAAQLQGNSNWFMYDKGAIDEEFAKGSVRWR
FT                   SFLENTLVQRRFFPFSQPVIDSDANEHHKEIFTRARDNQGALIRATLFIPMANKCGLMP
FT                   QIERQMIERVLALLADERHSKQIYSVNLSLDSLTSRAFSQWLKTTLLEYRHLTPRLIFE
FT                   VSEDIVIQHQAKLQPKLDMIRKMGARLCVDHVGQQVVGTYYIRECHFDMIKLHRSIVRH
FT                   IHLRPENQLFIRSLIGGLYRTEVQVCAEGVEVFEEWQTLQILGVGMGQGMFFSDPVEA"
FT   sig_peptide     603879..603986
FT                   /locus_tag="Sputcn32_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.750 at
FT                   residue 36"
FT   gene            606009..606887
FT                   /locus_tag="Sputcn32_0556"
FT   CDS_pept        606009..606887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0556"
FT                   /product="conserved hypothetical biogenesis protein MshI"
FT                   /note="KEGG: son:SO4114.2 hypothetical biogenesis protein
FT                   MshI"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74288"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2V5"
FT                   /protein_id="ABP74288.1"
FT                   /translation="MDKRRIGRLAFWQNKAITTDLGVYVCADKLWVYAPATERYAEQWV
FT                   TFELQHEQWLMAFAELARVFPHARLQLLLASGPYQLLVADKPNVAPEELPQALLWSVKD
FT                   MVTLPVPQIHLDYFESPLPSGKINVVVVEKDKLINMVQAIHAHGLSIVGISIEELAMTN
FT                   LFVDDNQARLVVSHYSGHDLLLTVVKQGQLYMQRRVRGFMQLDKAEVDELNYGLADNLS
FT                   LEIQRSMDYFESQLRQAPVASIELLIDGAADALAKLVSTNFNQAVNVIEKNAVGACMAG
FT                   LAFYELSRGAE"
FT   gene            606884..607486
FT                   /locus_tag="Sputcn32_0557"
FT   CDS_pept        606884..607486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74289"
FT                   /db_xref="GOA:A4Y2V6"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="InterPro:IPR020274"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2V6"
FT                   /protein_id="ABP74289.1"
FT                   /translation="MIKSRVNLYSATLLPPELRLTFAKLMTYVAGLVLLCILVGVYGYW
FT                   QVSQSEQALQQASQQKQQLEQQKAALEAQIAARKPDPALVARVELESQQLELKQLLISE
FT                   LALRSALTSRGFAPVLKDLAQVSDASVWLSRIMINEQNVMFEGFADHPKSIPLWVGKLK
FT                   TTNTLKGQAFSSMTMDRGEDKPLAFTLTSEILVEPKR"
FT   gene            607483..608133
FT                   /locus_tag="Sputcn32_0558"
FT   CDS_pept        607483..608133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0558"
FT                   /product="MSHA biogenesis protein MshJ"
FT                   /note="KEGG: shm:Shewmr7_0464 MSHA biogenesis protein MshJ"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74290"
FT                   /db_xref="GOA:A4Y2V7"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2V7"
FT                   /protein_id="ABP74290.1"
FT                   /translation="MKMMFNHVGQQFEVLSRRERVLIGIALLALVSIIGFMPLESLWKK
FT                   QTSISQQLKALEQENQISVQQIELYQQRLTMDPNQDYQQRLVLLQQQNQDIDAQLNEQM
FT                   VDMVPADYMPELLGNLLGQVQGIKLIKFTSIAPVPLLAVGDEKKLNLYSHGIRMSLEGD
FT                   YFSVMRFVEAVEAMPDKLYWKRLDYKVAEYPKGMIDIEVYTLSLNKDFISVAK"
FT   gene            608120..608437
FT                   /locus_tag="Sputcn32_0559"
FT   CDS_pept        608120..608437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0559"
FT                   /product="MSHA biogenesis protein MshK"
FT                   /note="KEGG: shm:Shewmr7_0465 MSHA biogenesis protein MshK"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74291"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2V8"
FT                   /protein_id="ABP74291.1"
FT                   /translation="MLLNKPYLFMTLLCVASSVSAEALRDPTLPGKGYSGAGQVTQSQE
FT                   QTLILNSIVSSGSTAYAVINNKILSVGDSIQGVKIVRITPSSVSLSDGRKLALFQAITE
FT                   R"
FT   sig_peptide     608120..608185
FT                   /locus_tag="Sputcn32_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.763 at
FT                   residue 22"
FT   gene            608452..610128
FT                   /locus_tag="Sputcn32_0560"
FT   CDS_pept        608452..610128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0560"
FT                   /product="pilus (MSHA type) biogenesis protein MshL"
FT                   /note="TIGRFAM: pilus (MSHA type) biogenesis protein MshL;
FT                   PFAM: type II and III secretion system protein; Secretin
FT                   domain protein; Secretin/TonB, short N-terminal domain;
FT                   KEGG: she:Shewmr4_3486 pilus (MSHA type) biogenesis protein
FT                   MshL"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74292"
FT                   /db_xref="GOA:A4Y2V9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2V9"
FT                   /protein_id="ABP74292.1"
FT                   /translation="MTAIKYFTPLLSLCLVACQSTDRPQPEASKAALAASMQTANRATT
FT                   PPPATMPYAVQRELNSGALLAGLAPALETERRFDVSANDVDARVFFPSLVQGTPLSVAV
FT                   HPEVEGTISLSLKGVTLSEAIQVVEDIYGYEVSREGRVLRVFPAGMRTETFPLNYLYME
FT                   RDGLSLTSVSSGRISDNNSNSNTNNNNNSNNGNSNNNSGNNNSNNGSNSNNNSDSSNGT
FT                   FIRSRTKTDFWGDLKETLTAIIGDTGNGRQVVVTPQAGLVTIRAFPSELRQVRSFLNSA
FT                   ETHLQRQVILEAKILEVTLSDDFQQGIQWENVLGHVGNTNINFGTTAGTVGNKVTSTLG
FT                   GVTSLSIKGSDFTTMINLLDTQGDVDVLSSPRVTASNNQKAVIKVGTDEYFVTDVSSTT
FT                   VAGTTPVTTPQVELTPFFSGIALDVTPQIDKDGNVLLHVHPSVIDVKEQTKNIKVSNES
FT                   LELPLAQSEIRESDTVIRAASGDVVVIGGLMKSENVEVVSQVPLLGDIPLLGELFKNRS
FT                   KQKKKTELIILLKPTVVGGDTWKNELERSKTLLDRWYPETK"
FT   gene            610135..611061
FT                   /locus_tag="Sputcn32_0561"
FT   CDS_pept        610135..611061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0561"
FT                   /product="MSHA biogenesis protein MshM"
FT                   /note="KEGG: she:Shewmr4_3485 MSHA biogenesis protein MshM"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74293"
FT                   /db_xref="GOA:A4Y2W0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2W0"
FT                   /protein_id="ABP74293.1"
FT                   /translation="MYLKHFGLSQTPFSLTPNTGFFFGLSPHVEALQVLQTALQTGEGF
FT                   IKVTGEVGTGKTLLCRKLINDLPSGFHCAYLPNPYLTPAELRWAVANELGLHYAKDIDQ
FT                   QQLTGLIQLQLLELSRHGQAIVLVLDEAQALPDDSLEALRLFTNLETESRKLLQVVLFG
FT                   QPELDERLKRQEFRQLRQRITFSYNLRPLTWDETDAYIRYRLAIAGRQGEALFTPKLTR
FT                   KIANASRGIPRLINILAHKALLLSFGEGVTRVKASHVRDAILDTEDASKNSFWSRSMAL
FT                   VLALLTVFIFAIAASGIDFLQILGNRA"
FT   gene            611058..612248
FT                   /locus_tag="Sputcn32_0562"
FT   CDS_pept        611058..612248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0562"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: son:SO4110 MSHA
FT                   biogenesis protein MshN, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74294"
FT                   /db_xref="GOA:A4Y2W1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2W1"
FT                   /protein_id="ABP74294.1"
FT                   /translation="MSVINKMLKDLDQRQQGHQLSNIAQHQVQYLGRKHSVNIWVSISL
FT                   MSLLIGGVGVYGYQLISQMPVEPAPKFAAASETEVAIIPTVPEINAEAETITSEAVNVT
FT                   EPLALSKKTVVKASNGLVNTEMPLDEGSHPVAKQNAQIEATVTANAQSEPQTIVTEEDE
FT                   IVEAIQASAPEREFVKSSVDTPTIEPVKPAGKMAVTEVKLTPSQLAQKQLTLATDAEKQ
FT                   GKLDKALEYYEKALGFDPSLHNVRQQLAALHYGQGRLNNAEQVLQQAVLLYPQEFEFYL
FT                   LLARVQQELGEVDLALASLAQIPDSHVLARQKWLAQTDLAQKQGQFTLAEQAYRQLLQQ
FT                   EPQQGKWWMGLGYALDSQQQFAKASQAYRTALSHSGLSAQATTFIEQRLSQLGDSQ"
FT   gene            612245..614005
FT                   /locus_tag="Sputcn32_0563"
FT   CDS_pept        612245..614005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0563"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II, protein E domain protein; KEGG:
FT                   shm:Shewmr7_0469 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74295"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2W2"
FT                   /protein_id="ABP74295.1"
FT                   /translation="MKPRLKMRLGDLLVQESIITEEQLQQALTEQRKTGHKLGRTLIDL
FT                   RSISEHQLLQFLSQQLNLPLLDISKRPISAEVVQLIPEVQARRFRALAVEDRGDSVLVA
FT                   MSDPADLQALDHLEVLVAPKRLTLAVAPEQQLLEAFDNLYRRTDQIAQIAGKLEEEYAA
FT                   DKMFDLASLTSGDSDNETTVVKLLQSIFEDAVQMRASDIHIEPGDKALRIRQRIDGQLH
FT                   ETILNEVNIAAALVLRLKLMAGLDISEKRLPQDGRFHIEIKGHHIDVRMSTMPIYHGES
FT                   VVMRLLDQSAGLLTLNETGMPPHILARIRKQIKRPHGMLLVTGPTGSGKTTTLYGILSE
FT                   LNTADRKIITVEDPVEYQLPRINQVQVNHKIGLDFSNVLRTTLRQDPDIIMVGEMRDQE
FT                   TVEIGLRGALTGHFVLSTLHTNDAVTSALRLLDMGAASYLVASALRVIIAQRLVRRVCH
FT                   NCGVDYQPTLQEKAWLSSVSRKDFSAANFRIGTGCQSCNGSGYRGRIGIFEILELDEKM
FT                   IDAMRTGNPQDFARAALQSPNFTPLAESALQYLIEGMTTIEEVAKLVEDVSESQIPLSK
FT                   DLISQQGVEA"
FT   gene            614008..615228
FT                   /locus_tag="Sputcn32_0564"
FT   CDS_pept        614008..615228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0564"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   son:SO4108 MSHA biogenesis protein MshG"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74296"
FT                   /db_xref="GOA:A4Y2W3"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2W3"
FT                   /protein_id="ABP74296.1"
FT                   /translation="MPVYQYRGRSGQGQAVTGQLDAASESAAADMLLARGIIPLEVKVA
FT                   KVVKSFSVTQLFGGKVGLDELQIFTRQMYSLTRSGIPILRAIAGLSETAHSQRMKDALN
FT                   DISEQLTAGRPLSSAMNQHPEVFDSLFVSMVHVGENTGKLEDAFIQLSGYIEREQETRR
FT                   RIKAAMRYPIFVLIAITIAMVILNIMVIPKFAEMFSRFGADLPWATKVLIGTSNLFVNY
FT                   WPLMLVALIGAIVGIRYWHHTEKGEKQWDKWKLHIPAVGSIIERSTLSRYCRSFSMMLS
FT                   AGVPMTQALSLVADAVDNAYMHDRIVGMRRGIESGDSVLRVSNQSQLFTPLVLQMVAVG
FT                   EETGQIDQLLNDAADFYEGEVDYDLKNLTAKLEPILIGIVAVIVLVLALGIYLPMWDML
FT                   NVVKGGN"
FT   gene            615272..615766
FT                   /locus_tag="Sputcn32_0565"
FT   CDS_pept        615272..615766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO4107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74297"
FT                   /db_xref="GOA:A4Y2W4"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2W4"
FT                   /protein_id="ABP74297.1"
FT                   /translation="MRSQQKAESNLLNLYGRMIALIVVLTMMAIIGIKYFSTMPQLAAR
FT                   GLELEHTRFLNIVAMVRSQWLSLGKPSQMNLDWEIFDNQNQQLKPSVVKMNTLGWPQPQ
FT                   QRNNQGCQALWQQLMGTELKKSTLIGAYLPRDNSCHYRSQNGDSIGYQLDSGRVIFLTN
FT                   P"
FT   gene            615843..616460
FT                   /locus_tag="Sputcn32_0566"
FT   CDS_pept        615843..616460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0566"
FT                   /product="MSHA pilin protein MshB"
FT                   /note="KEGG: son:SO4106 MSHA pilin protein MshB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74298"
FT                   /db_xref="GOA:A4Y2W5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2W5"
FT                   /protein_id="ABP74298.1"
FT                   /translation="MKTKQNGFSLIELVIVIVILGLLAATAIPRFLNVTDDAQDASVDG
FT                   VAGGLSTAVSFVRSQWEVDGRRNNNVLLDGTSVNLDTRFGYPTGTSVTDATAMTDASCQ
FT                   EVFNTVLQSAPPNVLYTQDTRNQRYTVRVIDGAGGSATSIAGATVTGLDLCVYHQVASL
FT                   VVNQTTGVATPTPDLSTAGAKGVVYNPGTGRVLSFTQTPFTP"
FT   sig_peptide     615843..615926
FT                   /locus_tag="Sputcn32_0566"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.604) with cleavage site probability 0.175 at
FT                   residue 28"
FT   gene            616512..617021
FT                   /locus_tag="Sputcn32_0567"
FT   CDS_pept        616512..617021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0567"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: she:Shewmr4_3479 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74299"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2W6"
FT                   /protein_id="ABP74299.1"
FT                   /translation="MMKRQQGFTLIELVVVIIILGILAVTAAPKFINLQSDAYASTLNG
FT                   VKASLQGANSLVYSKAAIQGVESKDVSSIIIDDKGNSDADDDVKVNGVYGYLKQAADDM
FT                   VLVLDLDTTNEWTIVEAPTVTTTLTTPAIIHPKKLTPSNTAKCWVEYKQADSSNPPKYH
FT                   VESSGC"
FT   sig_peptide     616512..616595
FT                   /locus_tag="Sputcn32_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.691) with cleavage site probability 0.686 at
FT                   residue 28"
FT   gene            617035..617544
FT                   /locus_tag="Sputcn32_0568"
FT   CDS_pept        617035..617544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0568"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: she:Shewmr4_3478 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74300"
FT                   /db_xref="GOA:A4Y2W7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2W7"
FT                   /protein_id="ABP74300.1"
FT                   /translation="MKKQIGFTLIELVVVIIILGILAVTAAPKFINLQSDARASTVKGL
FT                   EAAIKGADTLINSKSLIAGNNTVASTVTPAPNVTVETGKTVLINYGHATPVWTGSLANA
FT                   LDINAADSGTSSEWLYVLATGSIYFYPQGQVSPTAATNPGACYVQYTNSLTTYGPITVT
FT                   SVVTGC"
FT   sig_peptide     617035..617115
FT                   /locus_tag="Sputcn32_0568"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.837) with cleavage site probability 0.831 at
FT                   residue 27"
FT   gene            617752..618240
FT                   /locus_tag="Sputcn32_0569"
FT   CDS_pept        617752..618240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0569"
FT                   /product="MSHA pilin protein MshC"
FT                   /note="KEGG: son:SO4104 MSHA pilin protein MshC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74301"
FT                   /db_xref="GOA:A4Y2W8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2W8"
FT                   /protein_id="ABP74301.1"
FT                   /translation="MAKFSMAKQAGFTLVELVTTVILIGILSVTVLPRLFTQSSYSAFS
FT                   LRNEFMAELRQVQQRALNNTDRCYRIAVSSVGYQVSQFATRDNTGCTGAPLSPEPLYTQ
FT                   AFKGGATLALSSSNASSFNIDFDINGRPSLACNGHCIKVIANDIVSINISSEGYIYAN"
FT   gene            618230..618778
FT                   /locus_tag="Sputcn32_0570"
FT   CDS_pept        618230..618778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0570"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: shm:Shewmr7_0475 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74302"
FT                   /db_xref="GOA:A4Y2W9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2W9"
FT                   /protein_id="ABP74302.1"
FT                   /translation="MPTNPRLFLHKISPHKGFTLIELVVGMLVIAIAIVMLSSMLFPQA
FT                   DRAAKTLHRVRSAELAHSVMNEIWGKRYDQNTNANGGVPACGSPLGMSCTHADKLGKDI
FT                   VSGIVESRNNFNDVDDYHGLNETAIMLNSSQTYTEAYPNYRLSVTVAYGAVPNTKLVTI
FT                   NVTTPDNEVITYNMVRSNY"
FT   sig_peptide     618230..618367
FT                   /locus_tag="Sputcn32_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.788) with cleavage site probability 0.348 at
FT                   residue 46"
FT   gene            618778..619623
FT                   /locus_tag="Sputcn32_0571"
FT   CDS_pept        618778..619623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0571"
FT                   /product="MSHA biogenesis protein MshO"
FT                   /note="KEGG: son:SO4102 MSHA biogenesis protein MshO"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74303"
FT                   /db_xref="GOA:A4Y2X0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2X0"
FT                   /protein_id="ABP74303.1"
FT                   /translation="MASHYAVNKKFARGFTLVEMVTVILILGILVVGVSSFIIFGTRIF
FT                   VESSSVDQVLSQSRFVVERMTRELRSAVPNSVRVNTDSLTYQCIEFVPIQASTTYLSMP
FT                   IAPSAAALSGTVILDDVTSKIAVNQYAWIYPLTDSDVYNSARQKRAQINTMAPLGNRVT
FT                   LTFTAPVRFAEASPRQRIYFGSNPVSYCFEKEPSANQLQVRRYAGYAFTATQSKPGDMG
FT                   SGVLMAQSVANRLNDSNDLPMTLTPSSLVNHAMVHLQPRFNVNGETFQYRHQVQVINVP
FT                   "
FT   gene            619658..620101
FT                   /locus_tag="Sputcn32_0572"
FT   CDS_pept        619658..620101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0572"
FT                   /product="MSHA biogenesis protein MshP"
FT                   /note="KEGG: shm:Shewmr7_0477 MSHA biogenesis protein MshP"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74304"
FT                   /db_xref="GOA:A4Y2X1"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2X1"
FT                   /protein_id="ABP74304.1"
FT                   /translation="MRMLPRTSRVRSQRPALPTRQRGSALIIGIFVITVMFLLASALIN
FT                   IVEDADTGLTQEVWGARALAAANSGADAALAQLFPLNGSVGVCLASSSWTPPNVVGFHA
FT                   CRVELSCKAYAVDTVTQYRINSKAVCESGETRVSRQVEVEARG"
FT   sig_peptide     619658..619786
FT                   /locus_tag="Sputcn32_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.958) with cleavage site probability 0.530 at
FT                   residue 43"
FT   gene            620094..623870
FT                   /locus_tag="Sputcn32_0573"
FT   CDS_pept        620094..623870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0573"
FT                   /product="MSHA biogenesis protein MshQ"
FT                   /note="KEGG: shm:Shewmr7_0478 MSHA biogenesis protein MshQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74305"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2X2"
FT                   /protein_id="ABP74305.1"
FT                   /translation="MVRFLMILNLALRYQTHYMRGLLSNLLLIFFILTSSPTYAAIDCN
FT                   SVFPGPIQSFSSTGELYMQSGALIENYNVLDVCFKTVKNYHEMNVNACGIGKCQISGTA
FT                   SLARAAPTFVNSSTSATNIVANWTTPSVELGTTAGYGQRFNSSRWDIGTLTINTGGNVT
FT                   VSDAYSTYVIKDLTFFNSSIMTLKAGKTYIIDGDLNLNSGTLNIVGTGDTKLYIKGNFT
FT                   IALSSVFNAPTSVDVYVGNRLEVQSNAQIQGSYYVADDATLLNSAVLVGRLSAKNVTLQ
FT                   SNSKVIYDAGAPVLQCFNDTFSQSALSSDWVVSRSSGSFTPSIVGGRMRLTQASQKQST
FT                   ASTYQRLFPAAENLVEIQFDHYAYGGATNNGADGIAVVLSDAAITPQPGAFGGPLGYGF
FT                   KPGISGFAGGWLGVGIDEFGNFSGEGGSINLSGQRRQSVVVRGSGAGTSGYRYLRGTCN
FT                   NGTTNTSGSCLSPTVDKNNVTPAHRYKITIDSQSAGQSLVKVERNTGSGFVTLISSFNA
FT                   AAQTGQATIPKDFLLSLTGSTGDYYNNHEIDNVQICALKSNPITTQIDHFEFDHTGQGL
FT                   TCNPETVTIRACANTSCSQLFTEPLTATLLPESTAEGVWVGGNQVSFSGGTAQLQLRRN
FT                   TAGVVTLGVKGSSPTTRPLSKTLCRIGAGALSENNCSLTFADSGFIFDVPDKLANKPVE
FT                   VLVKAVKKSDVTQQCIPSFQNQAKSLSFWSQYVEPSAPITPKAVTINSTAISAASAVPT
FT                   ALSLGFDINGQAKITVNYPDAGKLQLNAQYTGNGTEQGLVMTGSDQFVSVPAGLCVKPV
FT                   NATAVCPSANMSCNVYRKAGQTFGMTVQAVAWQADNDSDFCSGNLPTPNFSDDSMMLAS
FT                   KVVAPTIASGANNGVLGVTSYSHSAQTNNLNTINNQTISEVGVFQISATASANYLGTST
FT                   SLNIPTAYSANIGRFVPDRFLIGDISVLPACGGFSYMDQPFPMSMSIKALNIGGTITQN
FT                   YFPPFSFATAKLVGENNNNGVDLQNRLSALPIKADSWSQGMATVDGSFRANVNRVTPNM
FT                   AANLYEDGPFELLDIGVQVSDNDPHPNGIFSYVASPDMDAASTGACTNCNAKKITTQIL
FT                   RHGRVVMDNTYGPETEVLKMPTRAEYWNGTNWVLNGDDSCTIATYGLGSQVDNAGLGYH
FT                   FDPNLATGQSVVRSGGTSTFQSGQFELLWRAVATSGPLYRGQVTAPLDVPAWLEWYWNW
FT                   NGVSPTSLSEPRASAFFGRYRGHDRIIYWREVN"
FT   sig_peptide     620094..620216
FT                   /locus_tag="Sputcn32_0573"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.967 at
FT                   residue 41"
FT   gene            624214..625263
FT                   /locus_tag="Sputcn32_0574"
FT   CDS_pept        624214..625263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0574"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: son:SO4098 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74306"
FT                   /db_xref="GOA:A4Y2X3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2X3"
FT                   /protein_id="ABP74306.1"
FT                   /translation="MFKKLRGIFSNDLSIDLGTANTLIYVRDEGIVLNEPSVVAIRGER
FT                   NSSGQKSVAAVGTEAKQMLGRTPGNIQAIRPMKDGVIADFYVTEKMLQHFIKQVHNNSF
FT                   FRPSPRVLVCVPVGATQVERRAIRESAMGAGAREVYLIEEPMAAAIGAGLPVSEATGSM
FT                   VVDIGGGTTEVAIISLNGVVYSSSVRIGGDKFDDAIINYVRRNYGSLIGEATAERIKHT
FT                   IGTAYPGDEVLEIEVRGRNLAEGVPRSFILNSNEILEALQEPLSGIVSAVMVALEQSPP
FT                   ELASDISERGMVLTGGGALLRDLDRLLMQETGIPVMVADDPLTCVARGGGKALEMIDMH
FT                   GGDLFSEET"
FT   gene            625307..626311
FT                   /locus_tag="Sputcn32_0575"
FT   CDS_pept        625307..626311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0575"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: she:Shewmr4_3471
FT                   rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74307"
FT                   /db_xref="GOA:A4Y2X4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2X4"
FT                   /protein_id="ABP74307.1"
FT                   /translation="MKPIFVRGISNQFRLTLAIILSVILLVANHRLEPARQSLSSVLSP
FT                   VQYLASFPGALLDWSSESFATRNMLALQNKELLRQQLLMSERLQRFEHLRQENERLRAL
FT                   LGSPAYQDSRKMVAEVLEVASDPSHHYVVLNHGARSGVFVGQPVVDAQGVVGQVVQISE
FT                   MTSRVLLLSDVSHGLPVRITRNDVRLIANGTGENDEIELRHVAKSIDVRVGDLLVTSGL
FT                   GNRFPEGYPVARVMEVLTEDGQSYARVTAQPLAALDRIRYLLLIWPSSDSGVTLPHQMP
FT                   VPAADQPEEAKPDPNTINSAPNTQGSANTPQGAATNANATTGAVTTPPPAEVH"
FT   gene            626311..626799
FT                   /locus_tag="Sputcn32_0576"
FT   CDS_pept        626311..626799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0576"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="PFAM: Rod shape-determining protein MreD; KEGG:
FT                   son:SO4096 rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74308"
FT                   /db_xref="GOA:A4Y2X5"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2X5"
FT                   /protein_id="ABP74308.1"
FT                   /translation="MSLQAANGRLIVWLTLFIGLLSQIMPLPSVVEAWRPDWLLMVVMY
FT                   WSIALPHRYNILTAWVLGLALDILLGATLGVRSLAMSLVIYIAILHCQRLRNFPKWQQT
FT                   LVVALLIALYHLVVYWVEFVTDEATFNADLFLPAISGLVIWPWIFWILRRVRRHYKVR"
FT   gene            626802..627398
FT                   /locus_tag="Sputcn32_0577"
FT   CDS_pept        626802..627398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0577"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: shm:Shewmr7_0482 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74309"
FT                   /db_xref="GOA:A4Y2X6"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2X6"
FT                   /protein_id="ABP74309.1"
FT                   /translation="MNLVLASTSPRRKELLANIGLGRTDFSFTQVAPDIDETPLNDETP
FT                   RDYVQRLAAEKAQAGLALCLGMPQPAVLGSDTIVVLENAILGKPVDEHDAKRVLRALSG
FT                   KTHTVMTAVAITYGDVDSPTTSVRLVETQVRFCTLSDADIDAYVASKEPMDKAGSYGIQ
FT                   GLGGCFVESIEGSYSCVVGLPLVETRALLAEVGFG"
FT   gene            627580..629088
FT                   /locus_tag="Sputcn32_0578"
FT   CDS_pept        627580..629088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0578"
FT                   /product="RNAse G"
FT                   /EC_number="3.1.4.-"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; KEGG: she:Shewmr4_3468
FT                   ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74310"
FT                   /db_xref="GOA:A4Y2X7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2X7"
FT                   /protein_id="ABP74310.1"
FT                   /translation="MNTSRLNQNKIQRKMGSELLINVTPSEARVALVEHGVLQEVHIER
FT                   RMKRGLVGNIYKGKISRVLPGMQAAFVDIGLDKAAFLHASDIVPHTECVADVEKGHFVV
FT                   RDIAELVRQGQDIMVQVVKDPLGTKGARLTTDITLPSRYLVFMPGSSHVGVSQRIELEE
FT                   ERSRLKKITLPYVDEDGGFIIRTAAEGVGEDELAQDAAFLRRVWSKVSERRQRRGVALL
FT                   YQDLALPVRIVRDFVGTELDRIQVDSRRTFDELQTFAQEFMPEIAEKIEHYSGPAPIFD
FT                   LYDVENEIQRALGRKVELKSGGYLIIDQTEAMTTVDINTGAFVGHRNLEETIFNTNLEA
FT                   TQAIARQLRLRNLGGIIIIDFIDMLNEEHKTRVLNSLNSALAKDRVKTNVSGFSGLGLV
FT                   EMTRKRTRESLEHVVCSECPACHGTGSMKTVETVSYEIFREIIRLNRAYDADEFLLYCS
FT                   PAVYQSLSGEESHLIAELEVYISKRIRLQNEPMYSQHKYDVVMM"
FT   gene            629088..633239
FT                   /locus_tag="Sputcn32_0579"
FT   CDS_pept        629088..633239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74311"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2X8"
FT                   /protein_id="ABP74311.1"
FT                   /translation="MAAFVTVKSVSRFCWQLLAVVLVLFALAVSLIRGLLPQVDEVRQQ
FT                   LVDYIKNEYHLDVQVGELSAQWQAFGPALTIENLIIPPQHKVPVTVLVQNIQIKLDFWQ
FT                   SLLKTSPRIEDVNFDGIRLALDIDKLIEDPSVTTQSNVYQTDWLYKLLLKQLERFSLTD
FT                   VSVQLLSQQHEYRPIHIRHLNWRNNGDSHRGAGQVYLDNHASMHESLQLQLDIKGDGAT
FT                   PDSLTGQIYLAAQSLDLGEWASRQSHPDEPSEKLPLEGVINLKAWLTFAQRSIHSGMIH
FT                   FEPSWLEWAIGDKPQKFEINSGSITWLPTASGWEVNSTDLDFITNGEAWPELTLALKQQ
FT                   GDELFGYASQLELQTLFPLLPLFPSVDLAALKQWHQLAPEGGIGPIRVYHKKGEPWLAN
FT                   TDIKQLHWRMDEGVPNANPLDAHLQWQDKTLVFSLPEQAYTLNFGDEFPAPLVLNGAAI
FT                   VGQFDTESLTLSVPQIRFDNDDIALDAAVKLDFSAAVLMSLAANVEVKNAANADKYFPV
FT                   KAMGESLAKYLDDAIKAGHSQNAQVLWQGALANFPFDDNSGVFQAAFTLQDAQFQFQPD
FT                   WPAVTDLSLDALFENARMDIWVNQGKLMDVIADGAHVFIPELGEYSLLKIQAELATQGR
FT                   AATQVLQASPLADSVGKTLNVVQVQGAVTGNLDISIPLYEGEDEDIRGQISFDNTPVYI
FT                   AQPGILLNGVTGIINFTNQVITGKGIKARLFEQPLSFTFDTQPKGKDFALNLQLKSRWD
FT                   LNRLPDQLHHPLSDFYQGKISWDGAMDMLFTEQGYQIQAKVTSDMLGTQLSFPGYFAKP
FT                   EDEPRSLVAEFIGDQNDAILDVKLASHAEFVGGFTADNGTRFSYFDLLLGRLFDEDEAK
FT                   NTEQGHIQIDLGKAKLAEWLPVINAFVGQEKMPKTGILVDEIPHKNVFPAVASIDSHIG
FT                   RLDLLGQQLTELRLNAKPNETGWRFNANANEFEGWIDFYPNWMTQGLKIAASKFYFAPE
FT                   LKNDAEADFGAEQVLTNLPPVAVNVEDFHVFDKPFGKLVLQASPQPSGYQIQTLSLATP
FT                   NVTLKGSGIWQQQDGQNKTELSMMLNATQFNHLTEQLGIDPGVNEAPLKVNADLSWEGA
FT                   PYAFSLESLNGKVNFALGKGHLSQVSDKGARIFSLFSLDSLVRKLSLDFSDVFGQGMYF
FT                   NSFTGNLQIDNGVVKTTDTEMDAIAGNMKVRGYTDLTTESLNYDIRFVPQLASSVPTVV
FT                   LLSTSAWTLGLGAFALTKVLEPVIEVISEIRFRVTGTMAEPVVEELERKSKEIEIPESI
FT                   LPIIGAGDKAMPTEGNNEQHTPKLGPKASEDMKLGEPLPQGSQPDTMPPEPAIKPIEPT
FT                   NSQDVKPIKQNQGDNNAHQPVAMSEQSRRQRQSAVYRIAA"
FT   gene            633163..633993
FT                   /locus_tag="Sputcn32_0580"
FT   CDS_pept        633163..633993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0580"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: son:SO4092 hydrolase,
FT                   carbon-nitrogen family"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74312"
FT                   /db_xref="GOA:A4Y2X9"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2X9"
FT                   /protein_id="ABP74312.1"
FT                   /translation="MHISLLQCQSSRDVSANLLFIESQLNELKRDADAPHLVVLPECSL
FT                   LFGGHESQQLAYAGDAHQNPLKSALSALAAKYRVFMVAGTIPALAEDGRVYSRCYLFDD
FT                   KGDTLGHYDKLHLFDVDVADGTKQYRESETFCPGDHITVIDTPFGKIGLAICYDLRFPD
FT                   LFRAMRLAGAEIITVPSAFTKVTGEAHWQVLLQARAIETQCVILAAAQWGAHNEGSRET
FT                   WGQSMIVGPWGNILAELKTGTGWVQAEVDLTELHSIRSKMPVMQHNRFREPCLK"
FT   gene            634127..635575
FT                   /locus_tag="Sputcn32_0581"
FT   CDS_pept        634127..635575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0581"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   son:SO4091 TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74313"
FT                   /db_xref="GOA:A4Y2Y0"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Y0"
FT                   /protein_id="ABP74313.1"
FT                   /translation="MPFLAQVEQSLLKNGLALDGLQSYLNTIHQHNIDYSDLYFQGSRH
FT                   ESWVLEDGIIKDGSFHIERGVGVRAISGEKTGFAYADDITPAALSAAVQAARGIASAGE
FT                   QTQVQAFKRQKALALYDSLDPIAAMEEVKKINLLKEADAFIRSLDSRIIQVVVSLAGVH
FT                   EEILIAASDGTLAADIRPLVRFNCSVILEENGKRERGGAGGGGRHDYGVLMANDDTGLP
FT                   MCFAFAREAVRQAQVNLNAIDAPAGEMPVVLGNGWPGVLLHEAVGHGLEGDFNRKGSSA
FT                   FSGKVGQQVASKLVTVVDDGTLPNRRGSLSIDDEGVQTQRTVLIEDGILKGYIQDKLNA
FT                   RLMGVAPTGNGRRESYAHLPMPRMTNTYMTAGESDPSEIIKSVKKGIYAPNFGGGQVDI
FT                   TSGKFVFSASEAYLIENGEVTQAIKGATLIGNGPEAMSQISMVGNDMALDRGVGVCGKD
FT                   GQSVPVGVGQPTLKLDRLTVGGTA"
FT   gene            635694..637088
FT                   /locus_tag="Sputcn32_0582"
FT   CDS_pept        635694..637088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0582"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   shm:Shewmr7_0487 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74314"
FT                   /db_xref="GOA:A4Y2Y1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Y1"
FT                   /protein_id="ABP74314.1"
FT                   /translation="MKRSRVAWLCLLSVPFLLPSALHAEPISFSDAWQQVLKVSDKLQA
FT                   QSQEVNRAKGEQQAGEGLNLPSLDIRGNYIHLDKPIEFDLKELNSVVSIPPALGGIIAG
FT                   IPPLPLSEQDIFSASLQAMWPIYTGGQITAAQGIHAAMVAEKQQELQLATRDLFTQLVD
FT                   RYYAVDVTQALVETQTDLVGSLTKHVEHALAMEREGQIAKVERLNAQVALDNAKVNLGS
FT                   ARRQHEMAVIALARMLQQSQVSTHSSLFVLPHAPSLDQLSQMTLSQHPALKLLEAKEAQ
FT                   ANGLVSLEKGKYHPTVFLFGNYTLYEEDTLLSSITPDWMVGVGVNVPLISRDGRSGKVE
FT                   AAKSALLQARYTKAQTKQDLSLLVDQSYRQLLQAEEEVKALDTSLELATENLRLREIAF
FT                   NQGLSTSIDRVDAELKLSAVKTQQLAARYRYVQAYARLMAISGQLDEFIGRTVDRHPVQ
FT                   EINHAR"
FT   sig_peptide     635694..635768
FT                   /locus_tag="Sputcn32_0582"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            637078..638052
FT                   /locus_tag="Sputcn32_0583"
FT   CDS_pept        637078..638052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0583"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   son:SO4089 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74315"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Y2"
FT                   /protein_id="ABP74315.1"
FT                   /translation="MRANRMLALVALVALGLILAYGLKLAYSPQPSLLQGQIEAREYNV
FT                   SSKVPGRVEQVLVRRGDSVAEGDLLFAIHSPELDAKLMQAEGGRDAAQAKQLEANNGAR
FT                   SQEVMAAKEQWLKAQAAATLAKTTYTRVENLFNEGVAARQKRDEAFTQWQAAKYTEQAA
FT                   LAMYQMAEEGARVETKAAAAGNARMAEGAVKEVSAVMEDSQMRAPKSGEISEVLLQAGE
FT                   LAPSGFPIVSLIDMQDAWAVFQVREDQLKRFNKGDKIQLNIPALGQDVEFTVSHISVMG
FT                   DFATWRSTESGHDFDMRTFEVELRPNAPIANLRVGMSVLLRGE"
FT   sig_peptide     637078..637140
FT                   /locus_tag="Sputcn32_0583"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.765 at
FT                   residue 21"
FT   gene            638121..639347
FT                   /locus_tag="Sputcn32_0584"
FT   CDS_pept        638121..639347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0584"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: son:SO4088
FT                   conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74316"
FT                   /db_xref="GOA:A4Y2Y3"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Y3"
FT                   /protein_id="ABP74316.1"
FT                   /translation="MGFMALFVALVCRELRALWHDPWQLALISYIPLLGMICLWWLFSA
FT                   GLPRQLPVAIVDQDHSQLSRMLTRQMKANPVTEPQSFTDLSSAVSAMQQAKVYAIVVFP
FT                   YDMKKDLLTGHKPTIDVRYNSQFLLVGKLLSSQIQLSLGEGLQQVAELKQLATGTPKPQ
FT                   VAVNLSPVKSQTTALFNRNNNYIGFLVPPVLIALWQLLSMLVMANSLNRELHLAPVVQA
FT                   DVISDRLTTHFWPKVLAKVALFTPILMLQGGFILAWLYLYLALPMAGSLALLLLAQLVM
FT                   LLAVWSLVLFIFVVMRDSARVISFCTALFAPAFAFMGITFPTHDMPPLAQWWRLIMPSS
FT                   HYMESHVSVVSYGASGLDVVSQMSSYWGFICLFPLIYLLARKLLPMTANTESGLAASDS
FT                   DAAQPAKGQ"
FT   gene            639349..640497
FT                   /locus_tag="Sputcn32_0585"
FT   CDS_pept        639349..640497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0585"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: she:Shewmr4_3461
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74317"
FT                   /db_xref="GOA:A4Y2Y4"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Y4"
FT                   /protein_id="ABP74317.1"
FT                   /translation="MNIWRLVFTELKAIISDKAIAVTLFGGVLFYSVLYPLPYLNQVPT
FT                   EQQLIVVDLDHSSLSRQLIRHADASAKIQVIGQVGSITEAKRFIEIGKAHGLLVIPEGF
FT                   RRDLLLGKGVTLSYGGDASYFLIYSAVVEGLVSAGMDAGKQVQLIGMLAQGQNPKQAQE
FT                   SLQSLHLNSVPAFNPSLGYTPYVVPGLFLLILHQTLLIGTGILGAGQWRHKGYWQQMSP
FT                   VQLVCGRILAFMLIYIFFTSFYVGYCYHWYNVSIQASLGLVALWLLPFLLATAAAGVAM
FT                   STLFTRRDLPTQVLLLISMPILFVSGFVWPIALIPEPLVLGSQFIPAVPAIMGMLELNQ
FT                   MGASWASVTPKWLQLWGLFAVFFGLAIVGIKRRAKLLLIDNP"
FT   gene            640729..641616
FT                   /locus_tag="Sputcn32_0586"
FT   CDS_pept        640729..641616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sputcn32_0586"
FT                   /product="Ion transport protein"
FT                   /note="PFAM: Ion transport protein; KEGG: sde:Sde_1761 cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sputcn32_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABP74318"
FT                   /db_xref="GOA:A4Y2Y5"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:A4Y2Y5"
FT                   /protein_id="ABP74318.1"
FT                   /translation="MSTSLLNAPTGLQARVINLVEQNWFGHFILTLILINAVQLGMETS
FT                   ASLMAQYGALLMSLDKVLLSVFVVELLLRIYAYRGKFFKDPWNVFDFTVIVIALIPASG
FT                   PLAVLRSLRVLRVLRVLTIVPSMKRVVSALLGSLPGLASIATVLLLIYYVFAVIATKIF
FT                   GDAFPEWFGTIADSFYTLFQIMTLESWSMGISRPVMEVYPYAWVFFVPFILVATFTMLN
FT                   LFIAIIVNTMQTFSDEEHALEREQDKQILEQEQRQMHEELKAIRLELQQLQTLLRNAAG
FT                   DSSNVSTKGNIGSD"
FT   gene