(data stored in SCRATCH zone)

EMBL: CP000685

ID   CP000685; SV 1; circular; genomic DNA; STD; PRO; 6096872 BP.
XX
AC   CP000685; AAPM01000000-AAPM01000022;
XX
PR   Project:PRJNA16082;
XX
DT   03-MAY-2007 (Rel. 91, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Flavobacterium johnsoniae UW101, complete genome.
XX
KW   .
XX
OS   Flavobacterium johnsoniae UW101
OC   Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales;
OC   Flavobacteriaceae; Flavobacterium.
XX
RN   [1]
RP   1-6096872
RX   DOI; 10.1128/AEM.01495-09.
RX   PUBMED; 19717629.
RA   McBride M.J., Xie G., Martens E.C., Lapidus A., Henrissat B., Rhodes R.G.,
RA   Goltsman E., Wang W., Xu J., Hunnicutt D.W., Staroscik A.M., Hoover T.R.,
RA   Cheng Y.Q., Stein J.L.;
RT   "Novel features of the polysaccharide-digesting gliding bacterium
RT   Flavobacterium johnsoniae as revealed by genome sequence analysis";
RL   Appl. Environ. Microbiol. 75(21):6864-6875(2009).
XX
RN   [2]
RP   1-6096872
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Goltsman E.,
RA   Singan V., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Mikhailova N., Xie G., McBride M., Richardson P.;
RT   ;
RL   Submitted (24-APR-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-6096872
RA   McBride M.J.;
RT   ;
RL   Submitted (06-NOV-2008) to the INSDC.
RL   Department of Biological Sciences, University of Wisconsin-Milwaukee, Rm
RL   181 Lapham Hall, 3209 N. Maryland Ave., Milwaukee, WI 53211, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-6096872
RA   McBride M.J.;
RT   ;
RL   Submitted (03-FEB-2009) to the INSDC.
RL   Department of Biological Sciences, University of Wisconsin-Milwaukee, Rm
RL   181 Lapham Hall, 3209 N. Maryland Ave., Milwaukee, WI 53211, USA
XX
DR   MD5; 718fe2e5ec03b6fa430ad3dca4b21224.
DR   BioSample; SAMN02598357.
DR   EnsemblGenomes-Gn; EBG00001045957.
DR   EnsemblGenomes-Gn; EBG00001045958.
DR   EnsemblGenomes-Gn; EBG00001045959.
DR   EnsemblGenomes-Gn; EBG00001045960.
DR   EnsemblGenomes-Gn; EBG00001045961.
DR   EnsemblGenomes-Gn; EBG00001045962.
DR   EnsemblGenomes-Gn; EBG00001045963.
DR   EnsemblGenomes-Gn; EBG00001045964.
DR   EnsemblGenomes-Gn; EBG00001045965.
DR   EnsemblGenomes-Gn; EBG00001045966.
DR   EnsemblGenomes-Gn; EBG00001045967.
DR   EnsemblGenomes-Gn; EBG00001045968.
DR   EnsemblGenomes-Gn; EBG00001045969.
DR   EnsemblGenomes-Gn; EBG00001045970.
DR   EnsemblGenomes-Gn; EBG00001045971.
DR   EnsemblGenomes-Gn; EBG00001045972.
DR   EnsemblGenomes-Gn; EBG00001045973.
DR   EnsemblGenomes-Gn; EBG00001045974.
DR   EnsemblGenomes-Gn; EBG00001045975.
DR   EnsemblGenomes-Gn; EBG00001045976.
DR   EnsemblGenomes-Gn; EBG00001045977.
DR   EnsemblGenomes-Gn; EBG00001045978.
DR   EnsemblGenomes-Gn; EBG00001045979.
DR   EnsemblGenomes-Gn; EBG00001045980.
DR   EnsemblGenomes-Gn; EBG00001045981.
DR   EnsemblGenomes-Gn; EBG00001045982.
DR   EnsemblGenomes-Gn; EBG00001045983.
DR   EnsemblGenomes-Gn; EBG00001045984.
DR   EnsemblGenomes-Gn; EBG00001045985.
DR   EnsemblGenomes-Gn; EBG00001045986.
DR   EnsemblGenomes-Gn; EBG00001045987.
DR   EnsemblGenomes-Gn; EBG00001045988.
DR   EnsemblGenomes-Gn; EBG00001045989.
DR   EnsemblGenomes-Gn; EBG00001045990.
DR   EnsemblGenomes-Gn; EBG00001045991.
DR   EnsemblGenomes-Gn; EBG00001045992.
DR   EnsemblGenomes-Gn; EBG00001045993.
DR   EnsemblGenomes-Gn; EBG00001045994.
DR   EnsemblGenomes-Gn; EBG00001045995.
DR   EnsemblGenomes-Gn; EBG00001045996.
DR   EnsemblGenomes-Gn; EBG00001045997.
DR   EnsemblGenomes-Gn; EBG00001045999.
DR   EnsemblGenomes-Gn; EBG00001046000.
DR   EnsemblGenomes-Gn; EBG00001046001.
DR   EnsemblGenomes-Gn; EBG00001046002.
DR   EnsemblGenomes-Gn; EBG00001046003.
DR   EnsemblGenomes-Gn; EBG00001046004.
DR   EnsemblGenomes-Gn; EBG00001046005.
DR   EnsemblGenomes-Gn; EBG00001046006.
DR   EnsemblGenomes-Gn; EBG00001046007.
DR   EnsemblGenomes-Gn; EBG00001046008.
DR   EnsemblGenomes-Gn; EBG00001046009.
DR   EnsemblGenomes-Gn; EBG00001046010.
DR   EnsemblGenomes-Gn; EBG00001046011.
DR   EnsemblGenomes-Gn; EBG00001046012.
DR   EnsemblGenomes-Gn; EBG00001046013.
DR   EnsemblGenomes-Gn; EBG00001046014.
DR   EnsemblGenomes-Gn; EBG00001046015.
DR   EnsemblGenomes-Gn; EBG00001046016.
DR   EnsemblGenomes-Gn; EBG00001046017.
DR   EnsemblGenomes-Gn; EBG00001046018.
DR   EnsemblGenomes-Gn; EBG00001046019.
DR   EnsemblGenomes-Gn; EBG00001046020.
DR   EnsemblGenomes-Gn; EBG00001046021.
DR   EnsemblGenomes-Gn; EBG00001046022.
DR   EnsemblGenomes-Gn; EBG00001046023.
DR   EnsemblGenomes-Gn; EBG00001046024.
DR   EnsemblGenomes-Gn; EBG00001046025.
DR   EnsemblGenomes-Gn; EBG00001046027.
DR   EnsemblGenomes-Gn; EBG00001046028.
DR   EnsemblGenomes-Gn; EBG00001046029.
DR   EnsemblGenomes-Gn; EBG00001046030.
DR   EnsemblGenomes-Gn; EBG00001046031.
DR   EnsemblGenomes-Gn; EBG00001046032.
DR   EnsemblGenomes-Gn; EBG00001046033.
DR   EnsemblGenomes-Gn; EBG00001046034.
DR   EnsemblGenomes-Gn; EBG00001046035.
DR   EnsemblGenomes-Gn; EBG00001046036.
DR   EnsemblGenomes-Gn; EBG00001046037.
DR   EnsemblGenomes-Gn; EBG00001046038.
DR   EnsemblGenomes-Gn; EBG00001046039.
DR   EnsemblGenomes-Gn; EBG00001046040.
DR   EnsemblGenomes-Gn; EBG00001046041.
DR   EnsemblGenomes-Gn; EBG00001046042.
DR   EnsemblGenomes-Gn; EBG00001046043.
DR   EnsemblGenomes-Gn; EBG00001046044.
DR   EnsemblGenomes-Gn; EBG00001046045.
DR   EnsemblGenomes-Gn; EBG00001046046.
DR   EnsemblGenomes-Gn; EBG00001046047.
DR   EnsemblGenomes-Gn; EBG00001046048.
DR   EnsemblGenomes-Gn; EBG00001046049.
DR   EnsemblGenomes-Gn; EBG00001046050.
DR   EnsemblGenomes-Gn; EBG00001046051.
DR   EnsemblGenomes-Gn; EBG00001046052.
DR   EnsemblGenomes-Gn; EBG00001046053.
DR   EnsemblGenomes-Gn; EBG00001046054.
DR   EnsemblGenomes-Gn; EBG00001046055.
DR   EnsemblGenomes-Gn; EBG00001046056.
DR   EnsemblGenomes-Gn; EBG00001046057.
DR   EnsemblGenomes-Gn; EBG00001046058.
DR   EnsemblGenomes-Gn; EBG00001046059.
DR   EnsemblGenomes-Gn; EBG00001046060.
DR   EnsemblGenomes-Gn; EBG00001046061.
DR   EnsemblGenomes-Gn; EBG00001046062.
DR   EnsemblGenomes-Gn; EBG00001046063.
DR   EnsemblGenomes-Gn; EBG00001046064.
DR   EnsemblGenomes-Gn; EBG00001046065.
DR   EnsemblGenomes-Gn; EBG00001046066.
DR   EnsemblGenomes-Gn; EBG00001046067.
DR   EnsemblGenomes-Gn; EBG00001046068.
DR   EnsemblGenomes-Gn; EBG00001046069.
DR   EnsemblGenomes-Gn; EBG00001046070.
DR   EnsemblGenomes-Gn; EBG00001046071.
DR   EnsemblGenomes-Gn; EBG00001046072.
DR   EnsemblGenomes-Gn; EBG00001046073.
DR   EnsemblGenomes-Gn; EBG00001046074.
DR   EnsemblGenomes-Gn; EBG00001046075.
DR   EnsemblGenomes-Gn; EBG00001046077.
DR   EnsemblGenomes-Gn; EBG00001046078.
DR   EnsemblGenomes-Gn; EBG00001046079.
DR   EnsemblGenomes-Gn; EBG00001046080.
DR   EnsemblGenomes-Gn; EBG00001046081.
DR   EnsemblGenomes-Gn; EBG00001046082.
DR   EnsemblGenomes-Gn; EBG00001046083.
DR   EnsemblGenomes-Gn; EBG00001046084.
DR   EnsemblGenomes-Gn; EBG00001046085.
DR   EnsemblGenomes-Gn; EBG00001046087.
DR   EnsemblGenomes-Gn; EBG00001046088.
DR   EnsemblGenomes-Gn; EBG00001046089.
DR   EnsemblGenomes-Gn; EBG00001046090.
DR   EnsemblGenomes-Gn; EBG00001046091.
DR   EnsemblGenomes-Gn; Fjoh_R0001.
DR   EnsemblGenomes-Gn; Fjoh_R0002.
DR   EnsemblGenomes-Gn; Fjoh_R0003.
DR   EnsemblGenomes-Gn; Fjoh_R0004.
DR   EnsemblGenomes-Gn; Fjoh_R0005.
DR   EnsemblGenomes-Gn; Fjoh_R0006.
DR   EnsemblGenomes-Gn; Fjoh_R0007.
DR   EnsemblGenomes-Gn; Fjoh_R0008.
DR   EnsemblGenomes-Gn; Fjoh_R0009.
DR   EnsemblGenomes-Gn; Fjoh_R0010.
DR   EnsemblGenomes-Gn; Fjoh_R0011.
DR   EnsemblGenomes-Gn; Fjoh_R0012.
DR   EnsemblGenomes-Gn; Fjoh_R0013.
DR   EnsemblGenomes-Gn; Fjoh_R0014.
DR   EnsemblGenomes-Gn; Fjoh_R0015.
DR   EnsemblGenomes-Gn; Fjoh_R0016.
DR   EnsemblGenomes-Gn; Fjoh_R0017.
DR   EnsemblGenomes-Gn; Fjoh_R0018.
DR   EnsemblGenomes-Gn; Fjoh_R0019.
DR   EnsemblGenomes-Gn; Fjoh_R0020.
DR   EnsemblGenomes-Gn; Fjoh_R0021.
DR   EnsemblGenomes-Gn; Fjoh_R0022.
DR   EnsemblGenomes-Gn; Fjoh_R0023.
DR   EnsemblGenomes-Gn; Fjoh_R0024.
DR   EnsemblGenomes-Gn; Fjoh_R0025.
DR   EnsemblGenomes-Gn; Fjoh_R0026.
DR   EnsemblGenomes-Gn; Fjoh_R0027.
DR   EnsemblGenomes-Gn; Fjoh_R0028.
DR   EnsemblGenomes-Gn; Fjoh_R0029.
DR   EnsemblGenomes-Gn; Fjoh_R0030.
DR   EnsemblGenomes-Gn; Fjoh_R0031.
DR   EnsemblGenomes-Gn; Fjoh_R0032.
DR   EnsemblGenomes-Gn; Fjoh_R0033.
DR   EnsemblGenomes-Gn; Fjoh_R0034.
DR   EnsemblGenomes-Gn; Fjoh_R0035.
DR   EnsemblGenomes-Gn; Fjoh_R0036.
DR   EnsemblGenomes-Gn; Fjoh_R0037.
DR   EnsemblGenomes-Gn; Fjoh_R0038.
DR   EnsemblGenomes-Gn; Fjoh_R0039.
DR   EnsemblGenomes-Gn; Fjoh_R0040.
DR   EnsemblGenomes-Gn; Fjoh_R0041.
DR   EnsemblGenomes-Gn; Fjoh_R0042.
DR   EnsemblGenomes-Gn; Fjoh_R0043.
DR   EnsemblGenomes-Gn; Fjoh_R0044.
DR   EnsemblGenomes-Gn; Fjoh_R0045.
DR   EnsemblGenomes-Gn; Fjoh_R0046.
DR   EnsemblGenomes-Gn; Fjoh_R0047.
DR   EnsemblGenomes-Gn; Fjoh_R0048.
DR   EnsemblGenomes-Gn; Fjoh_R0049.
DR   EnsemblGenomes-Gn; Fjoh_R0050.
DR   EnsemblGenomes-Gn; Fjoh_R0051.
DR   EnsemblGenomes-Gn; Fjoh_R0052.
DR   EnsemblGenomes-Gn; Fjoh_R0053.
DR   EnsemblGenomes-Gn; Fjoh_R0054.
DR   EnsemblGenomes-Gn; Fjoh_R0055.
DR   EnsemblGenomes-Gn; Fjoh_R0056.
DR   EnsemblGenomes-Gn; Fjoh_R0057.
DR   EnsemblGenomes-Gn; Fjoh_R0058.
DR   EnsemblGenomes-Gn; Fjoh_R0059.
DR   EnsemblGenomes-Gn; Fjoh_R0060.
DR   EnsemblGenomes-Gn; Fjoh_R0061.
DR   EnsemblGenomes-Gn; Fjoh_R0062.
DR   EnsemblGenomes-Gn; Fjoh_R0063.
DR   EnsemblGenomes-Gn; Fjoh_R0064.
DR   EnsemblGenomes-Gn; Fjoh_R0065.
DR   EnsemblGenomes-Gn; Fjoh_R0066.
DR   EnsemblGenomes-Gn; Fjoh_R0067.
DR   EnsemblGenomes-Gn; Fjoh_R0068.
DR   EnsemblGenomes-Gn; Fjoh_R0069.
DR   EnsemblGenomes-Gn; Fjoh_R0070.
DR   EnsemblGenomes-Gn; Fjoh_R0071.
DR   EnsemblGenomes-Gn; Fjoh_R0072.
DR   EnsemblGenomes-Gn; Fjoh_R0075.
DR   EnsemblGenomes-Gn; Fjoh_R0076.
DR   EnsemblGenomes-Gn; Fjoh_R0077.
DR   EnsemblGenomes-Gn; Fjoh_R0078.
DR   EnsemblGenomes-Gn; Fjoh_R0079.
DR   EnsemblGenomes-Gn; Fjoh_R0080.
DR   EnsemblGenomes-Gn; Fjoh_R0081.
DR   EnsemblGenomes-Gn; Fjoh_R0082.
DR   EnsemblGenomes-Gn; Fjoh_R0083.
DR   EnsemblGenomes-Tr; EBT00001648329.
DR   EnsemblGenomes-Tr; EBT00001648330.
DR   EnsemblGenomes-Tr; EBT00001648331.
DR   EnsemblGenomes-Tr; EBT00001648332.
DR   EnsemblGenomes-Tr; EBT00001648333.
DR   EnsemblGenomes-Tr; EBT00001648334.
DR   EnsemblGenomes-Tr; EBT00001648335.
DR   EnsemblGenomes-Tr; EBT00001648336.
DR   EnsemblGenomes-Tr; EBT00001648337.
DR   EnsemblGenomes-Tr; EBT00001648338.
DR   EnsemblGenomes-Tr; EBT00001648339.
DR   EnsemblGenomes-Tr; EBT00001648340.
DR   EnsemblGenomes-Tr; EBT00001648341.
DR   EnsemblGenomes-Tr; EBT00001648342.
DR   EnsemblGenomes-Tr; EBT00001648343.
DR   EnsemblGenomes-Tr; EBT00001648344.
DR   EnsemblGenomes-Tr; EBT00001648345.
DR   EnsemblGenomes-Tr; EBT00001648346.
DR   EnsemblGenomes-Tr; EBT00001648347.
DR   EnsemblGenomes-Tr; EBT00001648348.
DR   EnsemblGenomes-Tr; EBT00001648349.
DR   EnsemblGenomes-Tr; EBT00001648350.
DR   EnsemblGenomes-Tr; EBT00001648351.
DR   EnsemblGenomes-Tr; EBT00001648352.
DR   EnsemblGenomes-Tr; EBT00001648353.
DR   EnsemblGenomes-Tr; EBT00001648354.
DR   EnsemblGenomes-Tr; EBT00001648355.
DR   EnsemblGenomes-Tr; EBT00001648356.
DR   EnsemblGenomes-Tr; EBT00001648357.
DR   EnsemblGenomes-Tr; EBT00001648358.
DR   EnsemblGenomes-Tr; EBT00001648359.
DR   EnsemblGenomes-Tr; EBT00001648360.
DR   EnsemblGenomes-Tr; EBT00001648361.
DR   EnsemblGenomes-Tr; EBT00001648362.
DR   EnsemblGenomes-Tr; EBT00001648363.
DR   EnsemblGenomes-Tr; EBT00001648364.
DR   EnsemblGenomes-Tr; EBT00001648365.
DR   EnsemblGenomes-Tr; EBT00001648366.
DR   EnsemblGenomes-Tr; EBT00001648367.
DR   EnsemblGenomes-Tr; EBT00001648368.
DR   EnsemblGenomes-Tr; EBT00001648369.
DR   EnsemblGenomes-Tr; EBT00001648370.
DR   EnsemblGenomes-Tr; EBT00001648371.
DR   EnsemblGenomes-Tr; EBT00001648372.
DR   EnsemblGenomes-Tr; EBT00001648373.
DR   EnsemblGenomes-Tr; EBT00001648374.
DR   EnsemblGenomes-Tr; EBT00001648375.
DR   EnsemblGenomes-Tr; EBT00001648376.
DR   EnsemblGenomes-Tr; EBT00001648377.
DR   EnsemblGenomes-Tr; EBT00001648378.
DR   EnsemblGenomes-Tr; EBT00001648379.
DR   EnsemblGenomes-Tr; EBT00001648380.
DR   EnsemblGenomes-Tr; EBT00001648381.
DR   EnsemblGenomes-Tr; EBT00001648382.
DR   EnsemblGenomes-Tr; EBT00001648383.
DR   EnsemblGenomes-Tr; EBT00001648384.
DR   EnsemblGenomes-Tr; EBT00001648385.
DR   EnsemblGenomes-Tr; EBT00001648386.
DR   EnsemblGenomes-Tr; EBT00001648387.
DR   EnsemblGenomes-Tr; EBT00001648388.
DR   EnsemblGenomes-Tr; EBT00001648389.
DR   EnsemblGenomes-Tr; EBT00001648390.
DR   EnsemblGenomes-Tr; EBT00001648391.
DR   EnsemblGenomes-Tr; EBT00001648392.
DR   EnsemblGenomes-Tr; EBT00001648393.
DR   EnsemblGenomes-Tr; EBT00001648394.
DR   EnsemblGenomes-Tr; EBT00001648395.
DR   EnsemblGenomes-Tr; EBT00001648396.
DR   EnsemblGenomes-Tr; EBT00001648397.
DR   EnsemblGenomes-Tr; EBT00001648398.
DR   EnsemblGenomes-Tr; EBT00001648400.
DR   EnsemblGenomes-Tr; EBT00001648401.
DR   EnsemblGenomes-Tr; EBT00001648402.
DR   EnsemblGenomes-Tr; EBT00001648403.
DR   EnsemblGenomes-Tr; EBT00001648404.
DR   EnsemblGenomes-Tr; EBT00001648405.
DR   EnsemblGenomes-Tr; EBT00001648406.
DR   EnsemblGenomes-Tr; EBT00001648407.
DR   EnsemblGenomes-Tr; EBT00001648408.
DR   EnsemblGenomes-Tr; EBT00001648409.
DR   EnsemblGenomes-Tr; EBT00001648410.
DR   EnsemblGenomes-Tr; EBT00001648411.
DR   EnsemblGenomes-Tr; EBT00001648412.
DR   EnsemblGenomes-Tr; EBT00001648413.
DR   EnsemblGenomes-Tr; EBT00001648414.
DR   EnsemblGenomes-Tr; EBT00001648415.
DR   EnsemblGenomes-Tr; EBT00001648416.
DR   EnsemblGenomes-Tr; EBT00001648417.
DR   EnsemblGenomes-Tr; EBT00001648418.
DR   EnsemblGenomes-Tr; EBT00001648419.
DR   EnsemblGenomes-Tr; EBT00001648420.
DR   EnsemblGenomes-Tr; EBT00001648421.
DR   EnsemblGenomes-Tr; EBT00001648422.
DR   EnsemblGenomes-Tr; EBT00001648424.
DR   EnsemblGenomes-Tr; EBT00001648425.
DR   EnsemblGenomes-Tr; EBT00001648426.
DR   EnsemblGenomes-Tr; EBT00001648427.
DR   EnsemblGenomes-Tr; EBT00001648428.
DR   EnsemblGenomes-Tr; EBT00001648429.
DR   EnsemblGenomes-Tr; EBT00001648430.
DR   EnsemblGenomes-Tr; EBT00001648431.
DR   EnsemblGenomes-Tr; EBT00001648432.
DR   EnsemblGenomes-Tr; EBT00001648433.
DR   EnsemblGenomes-Tr; EBT00001648434.
DR   EnsemblGenomes-Tr; EBT00001648435.
DR   EnsemblGenomes-Tr; EBT00001648436.
DR   EnsemblGenomes-Tr; EBT00001648437.
DR   EnsemblGenomes-Tr; EBT00001648438.
DR   EnsemblGenomes-Tr; EBT00001648439.
DR   EnsemblGenomes-Tr; EBT00001648440.
DR   EnsemblGenomes-Tr; EBT00001648441.
DR   EnsemblGenomes-Tr; EBT00001648442.
DR   EnsemblGenomes-Tr; EBT00001648443.
DR   EnsemblGenomes-Tr; EBT00001648444.
DR   EnsemblGenomes-Tr; EBT00001648445.
DR   EnsemblGenomes-Tr; EBT00001648446.
DR   EnsemblGenomes-Tr; EBT00001648447.
DR   EnsemblGenomes-Tr; EBT00001648448.
DR   EnsemblGenomes-Tr; EBT00001648449.
DR   EnsemblGenomes-Tr; EBT00001648450.
DR   EnsemblGenomes-Tr; EBT00001648451.
DR   EnsemblGenomes-Tr; EBT00001648452.
DR   EnsemblGenomes-Tr; EBT00001648453.
DR   EnsemblGenomes-Tr; EBT00001648455.
DR   EnsemblGenomes-Tr; EBT00001648456.
DR   EnsemblGenomes-Tr; EBT00001648457.
DR   EnsemblGenomes-Tr; EBT00001648458.
DR   EnsemblGenomes-Tr; EBT00001648459.
DR   EnsemblGenomes-Tr; EBT00001648460.
DR   EnsemblGenomes-Tr; EBT00001648461.
DR   EnsemblGenomes-Tr; EBT00001648462.
DR   EnsemblGenomes-Tr; Fjoh_R0001-1.
DR   EnsemblGenomes-Tr; Fjoh_R0002-1.
DR   EnsemblGenomes-Tr; Fjoh_R0003-1.
DR   EnsemblGenomes-Tr; Fjoh_R0004-1.
DR   EnsemblGenomes-Tr; Fjoh_R0005-1.
DR   EnsemblGenomes-Tr; Fjoh_R0006-1.
DR   EnsemblGenomes-Tr; Fjoh_R0007-1.
DR   EnsemblGenomes-Tr; Fjoh_R0008-1.
DR   EnsemblGenomes-Tr; Fjoh_R0009-1.
DR   EnsemblGenomes-Tr; Fjoh_R0010-1.
DR   EnsemblGenomes-Tr; Fjoh_R0011-1.
DR   EnsemblGenomes-Tr; Fjoh_R0012-1.
DR   EnsemblGenomes-Tr; Fjoh_R0013-1.
DR   EnsemblGenomes-Tr; Fjoh_R0014-1.
DR   EnsemblGenomes-Tr; Fjoh_R0015-1.
DR   EnsemblGenomes-Tr; Fjoh_R0016-1.
DR   EnsemblGenomes-Tr; Fjoh_R0017-1.
DR   EnsemblGenomes-Tr; Fjoh_R0018-1.
DR   EnsemblGenomes-Tr; Fjoh_R0019-1.
DR   EnsemblGenomes-Tr; Fjoh_R0020-1.
DR   EnsemblGenomes-Tr; Fjoh_R0021-1.
DR   EnsemblGenomes-Tr; Fjoh_R0022-1.
DR   EnsemblGenomes-Tr; Fjoh_R0023-1.
DR   EnsemblGenomes-Tr; Fjoh_R0024-1.
DR   EnsemblGenomes-Tr; Fjoh_R0025-1.
DR   EnsemblGenomes-Tr; Fjoh_R0026-1.
DR   EnsemblGenomes-Tr; Fjoh_R0027-1.
DR   EnsemblGenomes-Tr; Fjoh_R0028-1.
DR   EnsemblGenomes-Tr; Fjoh_R0029-1.
DR   EnsemblGenomes-Tr; Fjoh_R0030-1.
DR   EnsemblGenomes-Tr; Fjoh_R0031-1.
DR   EnsemblGenomes-Tr; Fjoh_R0032-1.
DR   EnsemblGenomes-Tr; Fjoh_R0033-1.
DR   EnsemblGenomes-Tr; Fjoh_R0034-1.
DR   EnsemblGenomes-Tr; Fjoh_R0035-1.
DR   EnsemblGenomes-Tr; Fjoh_R0036-1.
DR   EnsemblGenomes-Tr; Fjoh_R0037-1.
DR   EnsemblGenomes-Tr; Fjoh_R0038-1.
DR   EnsemblGenomes-Tr; Fjoh_R0039-1.
DR   EnsemblGenomes-Tr; Fjoh_R0040-1.
DR   EnsemblGenomes-Tr; Fjoh_R0041-1.
DR   EnsemblGenomes-Tr; Fjoh_R0042-1.
DR   EnsemblGenomes-Tr; Fjoh_R0043-1.
DR   EnsemblGenomes-Tr; Fjoh_R0044-1.
DR   EnsemblGenomes-Tr; Fjoh_R0045-1.
DR   EnsemblGenomes-Tr; Fjoh_R0046-1.
DR   EnsemblGenomes-Tr; Fjoh_R0047-1.
DR   EnsemblGenomes-Tr; Fjoh_R0048-1.
DR   EnsemblGenomes-Tr; Fjoh_R0049-1.
DR   EnsemblGenomes-Tr; Fjoh_R0050-1.
DR   EnsemblGenomes-Tr; Fjoh_R0051-1.
DR   EnsemblGenomes-Tr; Fjoh_R0052-1.
DR   EnsemblGenomes-Tr; Fjoh_R0053-1.
DR   EnsemblGenomes-Tr; Fjoh_R0054-1.
DR   EnsemblGenomes-Tr; Fjoh_R0055-1.
DR   EnsemblGenomes-Tr; Fjoh_R0056-1.
DR   EnsemblGenomes-Tr; Fjoh_R0057-1.
DR   EnsemblGenomes-Tr; Fjoh_R0058-1.
DR   EnsemblGenomes-Tr; Fjoh_R0059-1.
DR   EnsemblGenomes-Tr; Fjoh_R0060-1.
DR   EnsemblGenomes-Tr; Fjoh_R0061-1.
DR   EnsemblGenomes-Tr; Fjoh_R0062-1.
DR   EnsemblGenomes-Tr; Fjoh_R0063-1.
DR   EnsemblGenomes-Tr; Fjoh_R0064-1.
DR   EnsemblGenomes-Tr; Fjoh_R0065-1.
DR   EnsemblGenomes-Tr; Fjoh_R0066-1.
DR   EnsemblGenomes-Tr; Fjoh_R0067-1.
DR   EnsemblGenomes-Tr; Fjoh_R0068-1.
DR   EnsemblGenomes-Tr; Fjoh_R0069-1.
DR   EnsemblGenomes-Tr; Fjoh_R0070-1.
DR   EnsemblGenomes-Tr; Fjoh_R0071-1.
DR   EnsemblGenomes-Tr; Fjoh_R0072-1.
DR   EnsemblGenomes-Tr; Fjoh_R0075-1.
DR   EnsemblGenomes-Tr; Fjoh_R0076-1.
DR   EnsemblGenomes-Tr; Fjoh_R0077-1.
DR   EnsemblGenomes-Tr; Fjoh_R0078-1.
DR   EnsemblGenomes-Tr; Fjoh_R0079-1.
DR   EnsemblGenomes-Tr; Fjoh_R0080-1.
DR   EnsemblGenomes-Tr; Fjoh_R0081-1.
DR   EnsemblGenomes-Tr; Fjoh_R0082-1.
DR   EnsemblGenomes-Tr; Fjoh_R0083-1.
DR   EuropePMC; PMC2148300; 18048332.
DR   EuropePMC; PMC2483708; 18620586.
DR   EuropePMC; PMC2717357; 19558960.
DR   EuropePMC; PMC2772454; 19717629.
DR   EuropePMC; PMC3463246; 23066504.
DR   EuropePMC; PMC4106360; 20206244.
DR   EuropePMC; PMC5524665; 28790987.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01685; 6S-Flavo.
DR   RFAM; RF01692; Bacteroid-trp.
DR   RFAM; RF01705; Flavo-1.
DR   RFAM; RF01726; SAM-II_long_loops.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP000685.
DR   SILVA-SSU; CP000685.
DR   StrainInfo; 8766; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000268
CC   Source DNA available from Mark McBride (mcbride@uwm.edu)
CC   Bacteria available from ATCC: ATCC 17061
CC   Contacts: Mark McBride (mcbride@uwm.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6096872
FT                   /organism="Flavobacterium johnsoniae UW101"
FT                   /strain="UW101; ATCC 17061"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:376686"
FT   gene            96..1145
FT                   /locus_tag="Fjoh_0001"
FT   CDS_pept        96..1145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0001"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase, zinc-binding; bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03039"
FT                   /db_xref="GOA:A5FP24"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP24"
FT                   /protein_id="ABQ03039.1"
FT                   /translation="MNKHEKYIKRCIELARNGFGTTYPNPMVGSVIVYEDTIIGEGWHK
FT                   KAGEPHAEVNAVRSVKDKSLLKKATIYVSLEPCSHFGKTPPCCDLIIANKIPNVVVGTV
FT                   DPNEKVAGRGIKKLIEAGANVVVGILEDECNELNKRFFTFHQKKRPYIILKWAESLDGF
FT                   LAPEKEIDQERKPVWITNQYSRQLVHKWRSEEQAILAGTQTVVDDNPKLNVRDWSGNNP
FT                   VRVILDQNNRISKDSFVFDESVKTIVFTKSENMISTENTIFEKIDFDKNSIENILAVLY
FT                   QHQIQSIIIEGGRQTLESFINENIWDEARIFIGKNTFKKGTKAPELQKQNAIKTYIQND
FT                   ELIYVRNHD"
FT   gene            1138..1740
FT                   /locus_tag="Fjoh_0002"
FT   CDS_pept        1138..1740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0002"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03040"
FT                   /db_xref="GOA:A5FP25"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP25"
FT                   /protein_id="ABQ03040.1"
FT                   /translation="MIDTIIFDFGDIFINLNKQGTISGLQKLGLKEWNAELDRLNLLFE
FT                   TGDISYDDFVSGFQEQLPNASIEEILEAWNAVLADFPSYRLDFVKELSKKYRLFLLSNT
FT                   DSIHIATFEKTVGVPFYTDFYNCFEKVHFSFEIGKRKPNANSYQHLIDEHNLVPEQTLF
FT                   VDDKKENTDAAAALGLHVWNLQVGQEDVVDLFTKGLL"
FT   gene            1918..2550
FT                   /locus_tag="Fjoh_0003"
FT   CDS_pept        1918..2550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0003"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03041"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP26"
FT                   /protein_id="ABQ03041.1"
FT                   /translation="MEYNDTYQTIARKSEEVLFKEKGSKFFGYAFPIENEEEVKPIIED
FT                   LRKLHPHAVHYCYAYQLGTAPKISYRANDDGEPSNTAGAPIYGQIQSFGVTNVLVVVVR
FT                   IFGGTKLGVGGLIAAYRTTAQMTLEVCEIVEKTIDVHFLISFDYKNMNKVMRVIKEKKL
FT                   EITSQEMEIDENSGLPIGKIITKTRKKNAEMIFDIFDLMFEIDVKII"
FT   gene            complement(2582..2986)
FT                   /locus_tag="Fjoh_0004"
FT   CDS_pept        complement(2582..2986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0004"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03042"
FT                   /db_xref="GOA:A5FP27"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP27"
FT                   /protein_id="ABQ03042.1"
FT                   /translation="MKKHQTQVRVRYSETDQMGVVYHGNYVPYFEIGRVEWLRNKGISY
FT                   KSMEESGIGLPIVSMQINYKKSARYDELLTIHTTFKSQSSVKIEFDCEIYNEANELLTT
FT                   AVFILVFISLKTGRPTAPPDYILELFKTME"
FT   gene            3174..4601
FT                   /locus_tag="Fjoh_0005"
FT   CDS_pept        3174..4601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0005"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03043"
FT                   /db_xref="GOA:A5FP28"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP28"
FT                   /protein_id="ABQ03043.1"
FT                   /translation="MTKTAQSVWENCLSFIKDNIQDQAYKTWFEPIKSVELTDNALYIQ
FT                   VPSKFFYEWLEEHYVKLLKVALTKELGKNAKLLYKIKMENTYGNKQPFTEQLPSSNRVP
FT                   MKPQEVDAPFKNLNPELKNPFVIPGIRNLKIESQLNPNYSFDNFLEGDSNRLARSAGMA
FT                   VANKPGGTSFNPLLIFGGVGLGKTHLAHAIGVEVKDKYPEKTVLYISAEIFTQQYIDSV
FT                   KKNNRNDFIHFYQLIDVLIIDDVQFLSGKSGTQDVFFHIFNYLHQNGKQVILTSDKAPV
FT                   DMQDIEQRLLSRFKWGLSAELHQPDYETRISILKNILYRDGVDMPEDILEYVARNIKSN
FT                   VRELEGAIISLIAQSSFNKKEVTIELAKSVVEKFVKNVKREISIDYIQKIVSDYFQLDI
FT                   ETLQSKTRKRHVVQARQLAMFFAKKFTKASLANIGSQIGDRDHATVLHACKTVDNLVST
FT                   DKQFKKFVEDINKKLTL"
FT   gene            4610..5077
FT                   /locus_tag="Fjoh_0006"
FT   CDS_pept        4610..5077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0006"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03044"
FT                   /db_xref="GOA:A5FP29"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP29"
FT                   /protein_id="ABQ03044.1"
FT                   /translation="MPVKVLMVCLGNICRSPLAEGILASKLPADKFIVDSAGTGSWHVG
FT                   HCPDKRSIDVARKNGINISAQKGRQIKSSDFDEFDYIYVMDNSNFRDVVHLAKTPEHKS
FT                   KVRLILNELFPDENVDVPDPYYGSANGFDNVYQMLDEVTDLIADQLLKKHS"
FT   gene            5133..5846
FT                   /locus_tag="Fjoh_0007"
FT   CDS_pept        5133..5846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0007"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03045"
FT                   /db_xref="GOA:A5FP30"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP30"
FT                   /protein_id="ABQ03045.1"
FT                   /translation="MKLLGKLYLIPTTMGESDPMDVLPQTVRRTIEVIDHYIVENDKTA
FT                   RKSIKAVYPEKKQSELVLFTLNKRTEPSEHLDFIKPLLEGKNMGLMSEAGCPGVADPGA
FT                   VIVKLAHEKGIQVVPLVGPSSILLAMMASGMNGQSFTFNGYLPIDKDEKKSAIRHFERL
FT                   SQDKNQSQLFIETPYRNNKLIEDLLQILNPSTHLCIATDITLPTEFIKTLKVSDWKKLK
FT                   IDIDKRPTIFIIHKI"
FT   gene            5860..6378
FT                   /locus_tag="Fjoh_0008"
FT   CDS_pept        5860..6378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0008"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03046"
FT                   /db_xref="GOA:A5FP15"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP15"
FT                   /protein_id="ABQ03046.1"
FT                   /translation="MKKALILILTSICFVQCNSSTDTKDSKNKKTEQNITKENNSEEFL
FT                   PEVNSTVNKDTVKIKEDTKVYDIDSIDVKPDFDKGIAKLHKFIRNNYKYPDEELKVKGI
FT                   VDVNFVVEKDGTLTDITVTKDADYGTGKEAIRILKKCPKWLPGTQNNKLVRVRYYLTIP
FT                   IDVYHEQTP"
FT   sig_peptide     5860..5919
FT                   /locus_tag="Fjoh_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.786 at
FT                   residue 20"
FT   gene            6362..7489
FT                   /locus_tag="Fjoh_0009"
FT   CDS_pept        6362..7489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0009"
FT                   /product="2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03047"
FT                   /db_xref="GOA:A5FP16"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP16"
FT                   /protein_id="ABQ03047.1"
FT                   /translation="MSKLPNVTTSIFTVMSKMASGYNAINLSQGFPNFPVDERLTDIAA
FT                   RLSKENVHQYTPMAGYPPLMNKIAKLIKDSYKRTINPDLELLVTAGATQGIFTTILALV
FT                   KENDEVIILDPSYDSYESPVLLCKAKPVRVALNDDYTPNWETIEKACSEKSRMIIINNP
FT                   HNPTGKILTENDFIQLKNLLEKYPDIIVLSDEVYEYITFEEKHISAHTKDFLLDRCIMV
FT                   SSFGKSFHITGWKIGYTIAPEHLMKEIKKVHQFLVFSVNSISQFAISEYLDVVDVNLLG
FT                   KFYQEKRDYFQKLLQNSRFELKPCEGTYFQVASYANISNEDDVTFCKNLIINHGVAAIP
FT                   ISTFYSDHKDQKLIRFCFAKDNFTLESAAKKLCEI"
FT   gene            7564..8445
FT                   /locus_tag="Fjoh_0010"
FT   CDS_pept        7564..8445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0010"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03048"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP17"
FT                   /protein_id="ABQ03048.1"
FT                   /translation="MSYTDKMLRDDALKGKVIVVTGGGSGLGKAMTKYFLELGAQVAIT
FT                   SRDLEKLKTTAAELESETGGKCLPLQCDVRHYEEVENMLQETLKIFGKVDVLLNNAAGN
FT                   FISPTERLSANAFDTVIDIVLKGSKNCTLAFGKHWIDTKQTSATILNIVTTYAWTGSAY
FT                   VVPSATAKAGVLAMTRSLAVEWAKYGIRSNAIAPGPFPTKGAWDRLLPGDLSEKFDMAK
FT                   KVPLKRVGDHQELANLAAYLVSDFSAYVNGDVITIDGGEWLKGAGQFNLLEAIPEELWD
FT                   QLEMMIKAKKNK"
FT   gene            8709..9317
FT                   /locus_tag="Fjoh_0011"
FT   CDS_pept        8709..9317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0011"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /note="TIGRFAM: uridine kinase; PFAM:
FT                   phosphoribulokinase/uridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03049"
FT                   /db_xref="GOA:A5FP18"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP18"
FT                   /protein_id="ABQ03049.1"
FT                   /translation="MLIIGIAGGTGSGKTTVVHQIMNELPDTEVGVISQDSYYKENHNL
FT                   SFDERALINFDHPRAIDFELLVKHLKALKAGETIDQPVYSFIQHNRTDDTISTHPRKVM
FT                   IVEGILILTNPELRELFDIKVYVHADSDERLIRRLKRDISERGRDIDEVLNRYQTTLKP
FT                   MHEQFIEPTKAFADIIIPNDKYNTVAIDVVRAVINQRIL"
FT   gene            9424..9756
FT                   /locus_tag="Fjoh_0012"
FT   CDS_pept        9424..9756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0012"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03050"
FT                   /db_xref="GOA:A5FP19"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP19"
FT                   /protein_id="ABQ03050.1"
FT                   /translation="MKFKNPYKDKKWFKFLGNKYVWVLLFFVIWMLFLDNYSYFDHRFL
FT                   DGQINELKDNKKYYQEEIKKDQEQIKQLKNPEQIEKYAREKYFMKKDSEDIYIIHFEGD
FT                   TIQEKE"
FT   gene            9774..11135
FT                   /locus_tag="Fjoh_0013"
FT   CDS_pept        9774..11135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0013"
FT                   /product="Methylmalonyl-CoA mutase-like protein"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03051"
FT                   /db_xref="GOA:A5FP20"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP20"
FT                   /protein_id="ABQ03051.1"
FT                   /translation="MTTNLFEDFNPISSKQWKQKIQFELDGADYNQTVIWNSPEDIQVK
FT                   PFYHSDEFTKSASVQTQASEFKICQNIFVHDVEKSINRALNTIERGAESLRFTIQNENT
FT                   DVQKLLENLPLEGRTVYFHLSFLSIDFVKKLDVISVQKNAIFYCNLDPIGQLARDGNWF
FT                   TTSDKNNFETLEKISNQTNLPFLSVDLGLYQNSGANITQQIAYSLAHANEYLNRFPAST
FT                   KTIVFQISVGTNYFFEIAKLRALRMLFKLIAAEYNPDLDCHFLVTPTKRNKTIYDYNVN
FT                   MLRTTTECMSAILGGADAVANLPYDALYHKDNEFGDRIARNQLLILKHESYFDKVDNPA
FT                   DGSYYIESLTVQLAEKSLALFKDIEANGGFLKLLNDGTIKKKIQESASKEQELFDSKKE
FT                   VLLGTNKYPNKEDRMKHDLELFPFVKIKPRKTLITPIIEKRLAEKLEQERLELE"
FT   gene            11178..13313
FT                   /locus_tag="Fjoh_0014"
FT   CDS_pept        11178..13313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0014"
FT                   /product="methylmalonyl-CoA mutase-like protein, large
FT                   subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03052"
FT                   /db_xref="GOA:A5FP21"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP21"
FT                   /protein_id="ABQ03052.1"
FT                   /translation="MIRKDLKHINLQSQQSKTESQKAEDLTKNFTTAEGIELKKNYTEK
FT                   DIEDLEFIDFGAGFTPNLRGPYATMYVRRPWTIRQYAGFSTAEESNAFYRRNLAAGQKG
FT                   LSIAFDLPTHRGYDSDHERVVGDVGKAGVAIDSVEDMKVLFDQIPLDEMSVSMTMNGAV
FT                   LPIMAFYIVAAEEQGVELNKLSGTIQNDILKEFMVRNTYIYPPAPSMKIIADIFEFTSK
FT                   KMPKFNSISISGYHMQEAGATADIELAYTLADGLEYIRTGLSTGMTIDEFAPRLSFFWA
FT                   IGMNHFMEIAKMRAGRMIWAKLIQQFNPKSDKSLALRTHCQTSGWSLTEQDPFNNVART
FT                   CIEATAAAFGGTQSLHTNALDEAIALPTDFSARIARNTQIYLQEETKITKTVDPWGGSY
FT                   YVESLTNEILENTWKLIEEVEELGGMTKAIEAGIPKLRIEEAAARKQARIDSGQDIIVG
FT                   VNKFRLEKEDPLHILDVDNQMVRKQQIERLEEIKAKRDTEKVNLSLEKLIHCAKTGEGN
FT                   LLEIAIEAARNRATLGEISDALESIFGRFKAQIKSFSGVYSAAIKNDENFEKAKQLADA
FT                   FAKQEGRRPRIMIAKMGQDGHDRGAKVVATGYADVGFDVDIGPLFQTPAEAAKQAVEND
FT                   VHILGVSSLAAGHKTLVPQVIEELKKHDREDIMVIVGGVIPAQDYQFLFDAGAAAIFGP
FT                   GTKISEAAIQILEILID"
FT   gene            complement(13364..14008)
FT                   /locus_tag="Fjoh_0015"
FT   CDS_pept        complement(13364..14008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03053"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP22"
FT                   /protein_id="ABQ03053.1"
FT                   /translation="MIKKWYFYASLIVIITFLSLGFKPFNVETKPWFLTEKTDGSEYIF
FT                   PSLEKDEYPKVNLNVPYTGNHLIGFKEAVAFKESQGKYRMVNSLGYMGKYQFGTKALRA
FT                   IGVKNDEAFLKDPALQEKAFVALLSKNKWILRNEIRKYEGKVINGVEITESGILAAAHL
FT                   GGAGSVKNFFKHNGNRHFRDAFGTSLKSYMRDFAGYDLSFIEADNNAVITN"
FT   gene            complement(14542..15576)
FT                   /locus_tag="Fjoh_0016"
FT   CDS_pept        complement(14542..15576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0016"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03054"
FT                   /db_xref="GOA:A5FP23"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP23"
FT                   /protein_id="ABQ03054.1"
FT                   /translation="MKLKKIITITAVAVISVLLIYGFILISQIFSANTKFEEKEVYVHV
FT                   PTGANYSDVKKILEPYIKNFDNFELVANKRSYPENVKSGRFLLKKDMNNIDLVRAMRSN
FT                   VPVKLAFNNQERLENFAGRVGSEIEADSLSLLKAFRDPKFLSDNGFNEENVFAMFIPNT
FT                   YEVYWNTSAEKFRDKMIKEYHKFWTPERIEQAKKQGLTPVQVSILASIVHKESVKKDER
FT                   PRIAGVYLNRLRLEMPLQADPTVIYALKLRDNNFDQVIKRVFYNDLVMKSPYNTYINIG
FT                   LPPGPIAMADITALEAVLNPEKNDYIYFCASVDRFGYHEFASNYADHTKNAKKYSDWGL
FT                   LVKV"
FT   sig_peptide     complement(15481..15576)
FT                   /locus_tag="Fjoh_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.820 at
FT                   residue 32"
FT   gene            complement(15587..16120)
FT                   /locus_tag="Fjoh_0017"
FT   CDS_pept        complement(15587..16120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0017"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03055"
FT                   /db_xref="GOA:A5FP08"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP08"
FT                   /protein_id="ABQ03055.1"
FT                   /translation="MITLKGDTIYLRALEPEDLEFVYGMENDQSIWEVSNTNTPYSRFL
FT                   IRQYLENAQQDIYEAKQLRLAICQDQDFPAIGLIDLFEFDPRNNRAGIGIVIQKDENKR
FT                   QNIGSEALELLIKYSFFNLNLHQLYANISTKNEASIALFTKFGFEKIGIKKDWILLNNQ
FT                   YHDEAIFQLINKNI"
FT   gene            complement(16177..16959)
FT                   /locus_tag="Fjoh_0018"
FT   CDS_pept        complement(16177..16959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0018"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03056"
FT                   /db_xref="GOA:A5FP09"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP09"
FT                   /protein_id="ABQ03056.1"
FT                   /translation="MQVEFYKYQGTGNDFVMIDNRSNFFPKEDVKLIERLCDRRFGIGA
FT                   DGLILLENDSETDFRMVYYNSDGNQSSMCGNGGRCLVAFANQLGVINDKTTFIATDGLH
FT                   HASVGDDSIVSLQMIDVDEVQKNDSYTFLNTGSPHHVQIVDDLEHYNVKENGAAIRYGE
FT                   LYGEKGSNINFVKKVDDGTFSLRTYERGVEDETLACGTGATAVAIAMNAIGQTDKTSIN
FT                   LNVEGGKLVVSFDKLGDHFTNVFLTGPAKFVFKGIIEI"
FT   gene            17134..18534
FT                   /locus_tag="Fjoh_0019"
FT   CDS_pept        17134..18534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0019"
FT                   /product="peptidase, subfamily S1B unassigned peptidases"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6,
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03057"
FT                   /db_xref="GOA:A5FP10"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP10"
FT                   /protein_id="ABQ03057.1"
FT                   /translation="MKKFSTLFLVSLLSGATTLGAYKLLFDSSDSFFGKGNSVVTLAPN
FT                   SYGRTVGLPGEAVDFTEAADKTIHTVVHVKNVSRRTVSNPMMEFFYGYGGQQQQEQVGT
FT                   GSGVIISEDGYIVTNNHVIKDATEIEITLNNKKSYKAKLVGTDSKMDIALLKINADEKL
FT                   PYTAFANSDSVKIGEWVLAVGNPYNLTSTVTAGIVSAKARNLDQSGIQSFIQTDAAVNP
FT                   GNSGGALVNTRGELIGINTMISSMTGSYVGYSFAVPSNIARKIIEDIMEYGNVQRGILG
FT                   VEGGELNSTASKELGITETQGFYINKVSKNSGAEKAGLAKGDIIVKLDEQNISTFADLS
FT                   GYINTKRPNDVVKVTYIKDGKTKTVPVTLSKNEFFSTEFKGIELENIDAADKKKFRIDY
FT                   GVKIKNITNENLMQYQNELQGNIILSIDNVKATNVETVSKLLNKKDEGQSIRIEMINKN
FT                   GEIFRIII"
FT   sig_peptide     17134..17199
FT                   /locus_tag="Fjoh_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.613 at
FT                   residue 22"
FT   gene            18745..20193
FT                   /locus_tag="Fjoh_0020"
FT   CDS_pept        18745..20193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0020"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; PFAM: glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03058"
FT                   /db_xref="GOA:A5FP11"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP11"
FT                   /protein_id="ABQ03058.1"
FT                   /translation="MSKKTLYQKEVSLQVDRRRAGVELIKVISDLWYDKSIEMVLFKNQ
FT                   LLDKNVSDIINLHQYAGEFVGKPITIFDSVEIAKVVLSLDLPPAKIDLGKLTYEYRLED
FT                   EKYPDARYFVIEKLKKSKSSKEIQPKDVVLYGFGRIGRLLARELMSKTGKGNQLRLRAI
FT                   VTRDKNDATSLEKRASLLRYDSIHGDFQGSVTADSKNNALIINGTTVHVITSNSPEEID
FT                   YTEYGINDALVIDNTGAFTTQEALKRHLKSNGVNKVLLTAPGKGVPNIVHGVNHNEYDP
FT                   DENDIFSAASCTTNAITPVLKVIEETLGVVKGHLETIHAYTNDQNLVDNMHRKYRRGRA
FT                   AALNMVITETGAGSAVAKALPSLEGKLTSNAIRVPVPNGSLVVLNLEVKKATSIAGINK
FT                   IMKKYALEGELVEQIKYSLNNELVSSDIVGTSAPSIYDSNATIVSKDGKNIVLYIWYDN
FT                   EYGYSHQVIRLAKYIAKVRRYTYY"
FT   gene            complement(20255..20713)
FT                   /locus_tag="Fjoh_0021"
FT   CDS_pept        complement(20255..20713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0021"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03059"
FT                   /db_xref="GOA:A5FP12"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP12"
FT                   /protein_id="ABQ03059.1"
FT                   /translation="MALDEIDKKILRLLQEDAHYTLKDIANKINLSLTPVHDRVKRLEK
FT                   DGIIEKYVTLLDKKKLGNNLTVYCQVTLTKQTYDTSEGFNQSILNLPEVVECNYVSGNF
FT                   DYMLKIIIPDMESYHHFHQKKLSVLPEVSLINTVFVISEVKSTTVLPI"
FT   gene            20915..22033
FT                   /locus_tag="Fjoh_0022"
FT   CDS_pept        20915..22033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0022"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="TIGRFAM: alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03060"
FT                   /db_xref="GOA:A5FP13"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP13"
FT                   /protein_id="ABQ03060.1"
FT                   /translation="MIIGVPKEIKNNENRVALTPAGVSEMKKHGHTVYVQSTAGLGSGF
FT                   ADAEYAEAGAVVLPTIEEVYAIAKMIIKVKEPIASEYPLIKKDQLLFTYFHFASSEELT
FT                   HAMLERGAVCLAYETVEKTDRSLPLLVPMSEVAGRMAIQQGAKYLEKPLKGRGILLGGV
FT                   PGVPPAKVLVLGGGIVGTQAAKMAAGLGAQVTIMDLSLPRLRQLDDIMPANVNTEMSNH
FT                   YNITRAIKDADLIVGAVLIPGAKAPHLITRDMLKLMRPGTVVVDVAVDQGGCIETCTPT
FT                   THENPTFIIDDIVHYCVANMPGAVPYTSTLALTNATLPYAVQLANKGWEKACAENEELK
FT                   KGLNVANGKILYKGVAEAWNLPFNEEIVLANA"
FT   gene            complement(22159..23778)
FT                   /locus_tag="Fjoh_0023"
FT   CDS_pept        complement(22159..23778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0023"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03061"
FT                   /db_xref="GOA:A5FP14"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR026263"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP14"
FT                   /protein_id="ABQ03061.1"
FT                   /translation="MKKSILLLALFVITSLSAQQRPKLVVGIVVDQMKMEYLYRFSDDF
FT                   SPNGFKKLMNDGFTFQNMHYNYMPTYTAPGHASIYTGTTPAIHGIVGNEWFSRTLGKEM
FT                   YCTDDAGVKTVGDGTAEEGAMSPKNLQSTTITDEVRMATNFNGKVIGMSLKDRGAILPA
FT                   GHFANWAFWYSKTGSFISSTFYGDKLPDWVTEFNNEKNYLKYINKGWDLYKPASVYNES
FT                   LPDNNPYEGKLYGSAAPVFPYDLKSMYEKNDAGVIRATPFGNDLLAEFAKRAIEKEELG
FT                   KDNITDFLTVSFSSTDYVGHLLGPRSMELQDTYLRLDQTIADFLAYLDKTVGKGNYLLF
FT                   LTADHAGAENVIYLKDRKYNVDNYPSKEVKKTLQDFSVKTFGVDLIQNYSNFNVFFNKQ
FT                   IIKEKGLELLKVKQAFKEFLITQPQVKKVYTEEEVLANTGNDYALNFVAKGYDVTQNGD
FT                   LVIVDKPGMIEYTPTGTSHGTIYSYDTHVPAIFYGWNIKKGESYDKKAITEIAPTIAQK
FT                   IKVTFPNGTEAKVMTEVLDNKK"
FT   sig_peptide     complement(23722..23778)
FT                   /locus_tag="Fjoh_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.560 at
FT                   residue 19"
FT   gene            complement(24140..24245)
FT                   /locus_tag="Fjoh_R0001"
FT   rRNA            complement(24140..24245)
FT                   /locus_tag="Fjoh_R0001"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(24400..27265)
FT                   /locus_tag="Fjoh_R0002"
FT   rRNA            complement(24400..27265)
FT                   /locus_tag="Fjoh_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(27468..27544)
FT                   /locus_tag="Fjoh_R0003"
FT                   /note="tRNA-Ala7"
FT   tRNA            complement(27468..27544)
FT                   /locus_tag="Fjoh_R0003"
FT                   /product="tRNA-Ala"
FT   gene            complement(27685..27758)
FT                   /locus_tag="Fjoh_R0004"
FT                   /note="tRNA-Ile6"
FT   tRNA            complement(27685..27758)
FT                   /locus_tag="Fjoh_R0004"
FT                   /product="tRNA-Ile"
FT   gene            complement(27884..29390)
FT                   /locus_tag="Fjoh_R0005"
FT   rRNA            complement(27884..29390)
FT                   /locus_tag="Fjoh_R0005"
FT                   /product="16S ribosomal RNA"
FT   gene            30377..32323
FT                   /locus_tag="Fjoh_0024"
FT   CDS_pept        30377..32323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0024"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); TGS domain protein;
FT                   Anticodon-binding domain protein; Threonyl/alanyl tRNA
FT                   synthetase, SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03062"
FT                   /db_xref="GOA:A5FP01"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FP01"
FT                   /protein_id="ABQ03062.1"
FT                   /translation="MIKITLPDGSIREFAQGVTPMEVAKNISEGFARNVISASFNGTTI
FT                   ETETPLTTDGNLILYTWNDAEGKKAFWHSTSHVMAQALEELYPGIKLTLGPAIANGFYY
FT                   DVDFEDQKISEADFKKIEDRILEIARGKFDFKMRPVTKAEALEMYKDNVYKTELISNLE
FT                   DGTITFCDHATFTDLCRGGHIPNTGIIKAVKIMSVAGAYWRGDEKNKQLTRVYGTSFPK
FT                   QKDLTEYLELLEEAKRRDHRKLGKELELFAFSQKVGQGLPLWLPKGAALRDRLEQFLKR
FT                   AQKKAGYEQVVSPHIGQKELYVTSGHYAKYGADSFQPIHTPAEGEEFLLKPMNCPHHCE
FT                   IYNVRPWSYKDLPKRYAEFGTVYRYEQSGELHGLTRVRGFTQDDAHIFCTPEQLDEEFK
FT                   KVIDLVLYVFGSLGFENFTAQISLRDQEDREKYIGTDENWEKAENAIINAAKDKGLNTV
FT                   VEYGEAAFYGPKLDFMVKDALGRQWQLGTIQVDYNLPERFELTYKGADNELHRPVMIHR
FT                   APFGSMERFIAILLEHTAGNFPLWLMPEQAIILSLSEKYENYAKKVLDLLENHEIRALI
FT                   DNRNETIGKKIRDAEMQKIPFMLIVGEEEEKNGTISIRRHGQEGKGNITVSIEEFASIV
FT                   DEEIKKTLKVFTV"
FT   gene            32505..32894
FT                   /locus_tag="Fjoh_0025"
FT   CDS_pept        32505..32894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0025"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /note="PFAM: initiation factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03063"
FT                   /db_xref="GOA:A5FP02"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP02"
FT                   /protein_id="ABQ03063.1"
FT                   /translation="MDLVEISPNAEPPVCKIMDYKKFVYEQKKRDKALKAKSSQVVVKE
FT                   IRFGPQTDEHDYEFKRKNAEKFLKEGAKLKAFVFFKGRSIIYKDQGQILLLRLATDLEE
FT                   YGKVEAMPVLEGKRMIMFIAPKKKK"
FT   gene            32999..33196
FT                   /locus_tag="Fjoh_0026"
FT   CDS_pept        32999..33196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0026"
FT                   /product="LSU ribosomal protein L35P"
FT                   /note="PFAM: ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03064"
FT                   /db_xref="GOA:A5FP03"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FP03"
FT                   /protein_id="ABQ03064.1"
FT                   /translation="MPKMKTKSSAKKRFKVTGSGKIKRKHAFKSHILTKKSKKRKLALT
FT                   HSALVHKTDEKSIKQQLRII"
FT   gene            33382..33726
FT                   /gene="rplT"
FT                   /locus_tag="Fjoh_0027"
FT   CDS_pept        33382..33726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="Fjoh_0027"
FT                   /product="50S ribosomal protein L20"
FT                   /note="TIGRFAM: ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03065"
FT                   /db_xref="GOA:A5FP04"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FP04"
FT                   /protein_id="ABQ03065.1"
FT                   /translation="MPRSVNSVAKRARRKKIMKQAKGFFGRRKNVWTVAKNAVEKAMSY
FT                   AYRDRKQNKRNFRSLWIQRINAGARLEGMSYSQFMGKVKANGIELNRKVLADLAMNHPE
FT                   AFKAILNKVK"
FT   gene            33849..34421
FT                   /locus_tag="Fjoh_0028"
FT   CDS_pept        33849..34421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0028"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03066"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP05"
FT                   /protein_id="ABQ03066.1"
FT                   /translation="MLTSLFDHIQKFIILEPSEIDILESYLGVTKVKKKEHLLQEGQVC
FT                   NTLYFMLKGCMRQYIINSKGSEQTLQFAIENWWITDYLSYHNHIASNFYLQAVENSEII
FT                   AIDKTVFEALLIEIPNLERYFRIVTQKSFGAMQMRIKYLFTMSAEERYHHFNDHFPEFV
FT                   QRVPQYMLASYLDFSAEFMSKIRDGKV"
FT   gene            34500..34934
FT                   /locus_tag="Fjoh_0029"
FT   CDS_pept        34500..34934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0029"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03067"
FT                   /db_xref="GOA:A5FP06"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP06"
FT                   /protein_id="ABQ03067.1"
FT                   /translation="MKSRIVIPNVAPEAYNALLNLEKYISSTSLTPVHKELIKIRASQI
FT                   NGCAYCINMHSADARKHGISEQRIYLTSAWREADVYTEEEKAILALTEQVTLISNHVSD
FT                   EVYQNAARLFDEKYLAEIILAIITINSWNRLAITTGLRAV"
FT   gene            35107..36825
FT                   /locus_tag="Fjoh_0030"
FT   CDS_pept        35107..36825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0030"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03068"
FT                   /db_xref="GOA:A5FP07"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP07"
FT                   /protein_id="ABQ03068.1"
FT                   /translation="MMLKNVHFYCFQAIILVLFSCQKKEPKFDASNNEKPKIAALTKKA
FT                   EFFIEKKKTDSAFYYYNEAKSICDPLTYPDTYVVTLNSMAVIQQNQNDFVGSKTTLKEA
FT                   LPFLTLITNSKHIWDTYSVLGVNYLNTYQFRKAEKYFKKALELNIDEFTNIESQKNIAE
FT                   VFIAENKHQEAIQILLLLIDKKEVKDNPKTHAEILDRIGYCYYLSSNSEAYTFLNDALQ
FT                   IRVQLKDPLEIAKSNYNLALFYENKNPLLAKKYMKTSYEKYILAKNVDGRLSALKLIMN
FT                   NSQNTELKQHSIKYIDLVDSIYEVRQKAKNLFAKIKYNSKKEKEENLILKTNKAENELQ
FT                   LEKQKIRNIILYLIILLSLSLILVLYFFLTSKANKDKIEASYKIETKIAKKLHDELAND
FT                   IYHTMAFAEHKNLSLAENKQQLLNSLDAIYYRTKDISKENNYRITDENYVSHLKKMISS
FT                   FNTPFINIIINGLDSIFWEDIDQNKKKTIYRILQELLVNMKKHSNASVVGINFKTAKKD
FT                   IIIHYYDNGKGVDNQDIIFKNGLHNIENQILHLKGEMQIDSAAGKGFKLTFKFSR"
FT   gene            36826..38595
FT                   /locus_tag="Fjoh_0031"
FT   CDS_pept        36826..38595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0031"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03069"
FT                   /db_xref="GOA:A5FNZ3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNZ3"
FT                   /protein_id="ABQ03069.1"
FT                   /translation="MSKKSFFINHSIKSLYIGLILISFIGAVFFINPNEKTVEKKSKKK
FT                   YQAIELDKLIEKADKYYDEEKLDSSYYFYNKVLPMYDPEIDYTKYVYTLSSMAEIQTLI
FT                   GNFIESEELLTKTLPYLSKIKEPIYARNVYSNMGMNYYNTYDFENSLFYHTKALKLPGT
FT                   PYKKAIVLNDIARVYMEQNRYDIAAEILEMLTARKIVYKREPLLSDYFYASLQNSLGVC
FT                   YFNLKKPKALDLYLKSLATTLQGTNKFILLNNYKSLSDYYMENNPELALQYAKKSYETA
FT                   REVNANSAKMELLAYLIKLSKGSELKKYTIDYIKLTDSVINSRKSARNQFTNIKYYSKI
FT                   NKDENLHLKAEKAENELKLQQHKTSNIISGVIITFILTLCIILSFYLSIKGRKQKNNAI
FT                   QESETRISNKLRNELLNEVQNVLTYAKNNDLETADNKNELLESLEKIYSQTRNISKENS
FT                   DIITDKRYSLTLKNMISTFKTTDTNVFTNGLTDINWIKIDKNKKIIIYRVIQELLVNMK
FT                   KHSSATLAGVNFKVIKKNIIINYTDNGKGVNMNQVSKSGLQIIENRILNVKGEIQFESN
FT                   PDNGFKISIKIPF"
FT   gene            38597..40375
FT                   /locus_tag="Fjoh_0032"
FT   CDS_pept        38597..40375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0032"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03070"
FT                   /db_xref="GOA:A5FNZ4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNZ4"
FT                   /protein_id="ABQ03070.1"
FT                   /translation="MKMLEIIKNKTFLKYLIFFLIILLIGVVLLYQLHRNQVIIIQQIK
FT                   KNNSVEINKNITEADRLFDQINYDSAYFFYKKAIALCDPIDDYADDYVYSQLSIANLHQ
FT                   NTNNYTACEEALLKVFPYLKKTSKPKYTYNTYTLLAYNYFFTYDNSDALLYHRKALRLA
FT                   ATPYKKSVIINDIALVYLRQKRYKEIIDALEPLARIKIKHETDSAKTDINYSLLLNNLG
FT                   FCYFKLGNPKALEYYKKSLKIQERLKSDYELMSTYSSVAMVYAETNPKLSKIYTEKQYQ
FT                   SACRAKSASFKANTLGDLIRKSEGKELKKYSKAYVKIIDSILSSRKQAKNQFSIIKYES
FT                   KTDKEENLKLKAEKAENELLLQKHKNRNTISYIIITFTIAVLLLLPLYLFIKGEKEKKE
FT                   AVFESEMRISKKLRNELTNKVHHTLLFAQNKDLQNDENKNQFLIKLDEIYSQTRNISRE
FT                   NSSIVTNENYDMGLKEMISGFKTPNLNLLVNGLDTIKWNKINKIKKIIIYRVLQELFYN
FT                   MKKYNDLTLIILSFKIINKNIVITYSDNSSKTQNERIILKKHLENVENRIKTTNGTINF
FT                   GNYTENGFKISFTFPL"
FT   sig_peptide     38597..38689
FT                   /locus_tag="Fjoh_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.575 at
FT                   residue 31"
FT   gene            40386..41054
FT                   /locus_tag="Fjoh_0033"
FT   CDS_pept        40386..41054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0033"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03071"
FT                   /db_xref="GOA:A5FNZ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNZ5"
FT                   /protein_id="ABQ03071.1"
FT                   /translation="MFKKVLVAEDLDSISIAVVQVLEDLNIPVIDHVKYCDEGLLKVKK
FT                   ALNEKEPYDLLITDLSFKTDHRKANIESGDELIEAINKVQPELKKIVFSIEDKSYRIKT
FT                   LFDELGINAYVSKGRNSIQELRSALEKTFKNEERILSSDLNFSFNDKSLIEIESYDISI
FT                   LSLLAKGYILENISNEFKEKSITPNGTSSIEKRINKLKIYFKANNNVHLIAIAKDFGLV
FT                   "
FT   gene            41418..42227
FT                   /locus_tag="Fjoh_0034"
FT   CDS_pept        41418..42227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0034"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; SMART:
FT                   deoxyribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03072"
FT                   /db_xref="GOA:A5FNZ6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR016202"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNZ6"
FT                   /protein_id="ABQ03072.1"
FT                   /translation="MKNSTFYFLLFLLTSFQAFSQTKFISWNLENFGKSKYQASLSFIA
FT                   KTVQEYDIIAIQEVVAGYGGSQAVAKLASILNEKGSKWDYTISDPTSGNSYKKERYAFI
FT                   WKTSKVKLKGKPWLEKKYHLEIDREPYFATFEVNKKLVTFVNFHAITKSKQPETEIKYF
FT                   KFLPQEYPDLNLVFTGDFNCPESHTVFNPLKKMGYVSVFQKQKTTLKQKCKAEVCLASE
FT                   FDNIFYKSNTLKPIKSGVVLFYNNYDSLQEARKISDHIPIWFEFFLN"
FT   sig_peptide     41418..41480
FT                   /locus_tag="Fjoh_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(42230..43489)
FT                   /locus_tag="Fjoh_0035"
FT   CDS_pept        complement(42230..43489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03073"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNZ7"
FT                   /protein_id="ABQ03073.1"
FT                   /translation="MKKSLLYIFLLVFSLQTKASFILLPMDETTQQNHLKAYGITYWCL
FT                   SRDYKASWLLNYRGGSFLLPDAEEIRKECKIRGVSFEVLSDTEEASLLNDISSPSQNME
FT                   SVILEKAPKIAVYTPKGKQPWDDAVTLVLTYAEIPFTPIYDEEVLSDQLLLYDWLHLHH
FT                   EDFTGQYGKFYAAYKNTPWYIEQKRDSEALAAKLGYSKVSQEKGAVAKKIRDFVIGGGF
FT                   MFAMCSATDSFDIALAADGVDICETMFDGDPSESNYQAKLNYGNSFAFKDFILERRPEV
FT                   YEFSDIDMTGKRRVPMEKDYFTLMEYSAKWDPIPSMLCQNHTQLVKGFMGQTTSFNETL
FT                   IKSNVLVMGTCELNGEARYIHGEKGKGMFTFFGGHDPEDFQHQVGDPPTVLDLHPNSPG
FT                   YRLILNNVLFPAAKKKKLKT"
FT   sig_peptide     complement(43430..43489)
FT                   /locus_tag="Fjoh_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.807 at
FT                   residue 20"
FT   gene            complement(43829..44494)
FT                   /locus_tag="Fjoh_0036"
FT   CDS_pept        complement(43829..44494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0036"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03074"
FT                   /db_xref="GOA:A5FNZ8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNZ8"
FT                   /protein_id="ABQ03074.1"
FT                   /translation="MNAIIKIALVDDEVLFRKGIAFLLQREDNIEIVFEASNGEDLVNK
FT                   LLENEIKPDIIIMDLKMPVLNGVEATKIIRKSFPEIKIIALTSYDSKSFIANMIQVGAV
FT                   AYLIKNTTPKDLIKTINEVNKKGFYYNESVLKTIQETIVSSKNSKGNLETSFLSPREIE
FT                   ILQLICQQKTTSEIAEHLFLSPRTVEGHRNNLLLKTESRNIAGLVVYAIQNEIAVLTL"
FT   gene            complement(44594..44689)
FT                   /locus_tag="Fjoh_0037"
FT   CDS_pept        complement(44594..44689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03075"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNZ9"
FT                   /protein_id="ABQ03075.1"
FT                   /translation="MKNINSRISFLDGTISFESEKGKGVEVIFTF"
FT   gene            complement(44795..45385)
FT                   /locus_tag="Fjoh_0038"
FT   CDS_pept        complement(44795..45385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0038"
FT                   /product="histidine kinase, dimerisation and
FT                   phosphoacceptor region"
FT                   /note="PFAM: histidine kinase, dimerisation and
FT                   phosphoacceptor region"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03076"
FT                   /db_xref="GOA:A5FP00"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="UniProtKB/TrEMBL:A5FP00"
FT                   /protein_id="ABQ03076.1"
FT                   /translation="MNTHSIPEKELVAIILYISLFFIIVSVVLIVFFYFSRKKIIQKEL
FT                   EKKDLILQYQKEQLHAVLQIQEEERKRIAQDLHDDISSKLNIVSLNTHLLSAPNLTEAE
FT                   TTEITENIINLTAKALENSRKIAHNLLPPVFEKFGLHAGIEELCGEFESSKSVKTYYKN
FT                   ELDFDDKEIDRHLHVFRVLQELMNNSLRHGKSN"
FT   gene            complement(45393..46043)
FT                   /locus_tag="Fjoh_0039"
FT   CDS_pept        complement(45393..46043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03077"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNY4"
FT                   /protein_id="ABQ03077.1"
FT                   /translation="MIDILVYSTYFVLIVNLIAYSYSFFRKEKANVFFLCYLAFSTVMQ
FT                   LSMELLYHLGMTNLVVVNMFFAGQMLLLGMFYNSLTNVKSQKMFIKISLIIALLVLAIQ
FT                   FCMNSSVFLKFNLFEIILTNLLIVVFALFHFYNMLTEDKTYYYISVGLIFYLLASTVLY
FT                   LIGNLSIGLSDDVKLLTWILNSFLVLCYQFFILFEWIKSFSKKAFSPNKTTLK"
FT   gene            complement(46070..46429)
FT                   /locus_tag="Fjoh_0040"
FT   CDS_pept        complement(46070..46429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03078"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNY5"
FT                   /protein_id="ABQ03078.1"
FT                   /translation="MSEEAFPDAVLIPLGIAKEWEKRYQDDTTIEDPKTKVKSFLIPRE
FT                   TLEKVLKLETEVVRACLAINDKDERTLLFVGARLDKETGKYIDVYGEGSSYMAKSAADD
FT                   AEEVVYDGIRPSPPF"
FT   gene            complement(46609..48153)
FT                   /locus_tag="Fjoh_0041"
FT   CDS_pept        complement(46609..48153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0041"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase, N-terminal domain protein; DnaB domain
FT                   protein helicase, C-terminal domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03079"
FT                   /db_xref="GOA:A5FNY6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNY6"
FT                   /protein_id="ABQ03079.1"
FT                   /translation="MENFKNVNPVKVDKTTIINLEKGKLPPQVLDLEEAVLGAMMIDKK
FT                   GVDDVIDILQPDAFYKDAHKHIFEAILQLFTETQPIDLLTVSTQLKKNGKLELAGGDFY
FT                   LIQLTQKIASSAHIEFHSRIILQKFIQRSLIRISSEIIEESYDETTDVFDLLDKAESKL
FT                   YEVTQGNIKRSSETAQSLVLQAKKRIEEIAGKEGLSGVATGFEKLDEVTSGWQPSDLII
FT                   IAARPGMGKTAFVLSMARNVAIQFGHAVAVFSLEMASVQLITRLISSETGLSSEKLRTG
FT                   KLEKHEWEQLSTKVKDLEKAPLFIDDTPSLSIFDLRAKCRRLASQHGIKLIIIDYLQLM
FT                   TAGGNGKGGGNREQEISTISRNLKALAKELNVPVIALSQLSRAVETRGSSKRPLLSDLR
FT                   ESGAIEQDADIVSFIYRPEYYKIEEWDDDEASPTAGQAEFIIAKHRNGGLENIRLKFLG
FT                   HLGKFDNLEDFTGGYDDLPSKMNHEDNPFITKNLPSANEAFGSNLNDDDDDSDVPF"
FT   gene            complement(48295..49248)
FT                   /locus_tag="Fjoh_0042"
FT   CDS_pept        complement(48295..49248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0042"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: acetyl-CoA carboxylase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03080"
FT                   /db_xref="GOA:A5FNY7"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNY7"
FT                   /protein_id="ABQ03080.1"
FT                   /translation="MEYLDFELPIKELEEQLEKCVIIGKESDVDVTPTCKEINKKLEQT
FT                   KKDIYKNLTAWQRVQLSRHPNRPYTLDYIKAICGDTFLELHGDRGFKDDKAMVGGLGKI
FT                   NGQSFMIVGQQKGYNTKTRQYRNFGMANPEGYRKALRLMKMAEKFGIPVLTLVDTPGAY
FT                   PGLEAEERGQGEAIARNIFEMVRLQVPIITIIVGEGASGGALGIGVGDRVYMLENTWYS
FT                   VISPESCSSILWKSWEYKERAAEALKLTSSDMKKQKLVDDVIPEPLGGAHYDRETTFKT
FT                   VADYITKGYNELKDLSTADLIAQRMDKYSNMGEYKE"
FT   gene            complement(49361..50251)
FT                   /locus_tag="Fjoh_0043"
FT   CDS_pept        complement(49361..50251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0043"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03081"
FT                   /db_xref="GOA:A5FNY8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNY8"
FT                   /protein_id="ABQ03081.1"
FT                   /translation="MRNDNLKSYLNLHLIVFIWGFTAILGALITIDADNLVWYRMLIAM
FT                   IFLGGFIAFKKQSFQVPVKEFFKLIFVGLLIALHWIFFFKAIHVSNVSITLSIFSLGAF
FT                   FASLLEPLFYGRKVLWYEVFFGLVIIAGLGLILQVEIKYLTGVYYALAAIILGVLFTLM
FT                   NGKLISDHEPSVITFYEFGAGVFFITIYFLFQGKFTADFFQMSLNNWVLLLILASICTA
FT                   YAFTASVKVMQRLTPYTVMLTTNLEPVYGIVLAYFILGGKEKMSVEFYIGAVIIIITVI
FT                   LNGVFKHYQNKKENL"
FT   gene            complement(50238..51326)
FT                   /locus_tag="Fjoh_0044"
FT   CDS_pept        complement(50238..51326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0044"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03082"
FT                   /db_xref="GOA:A5FNY9"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNY9"
FT                   /protein_id="ABQ03082.1"
FT                   /translation="MLTIIDKYILKRYLATFSVMILLFIPIGIVIDVSEKVNKMLENKI
FT                   PFTQIAIYYYNFTVYFANSLFPIFLFLSVIWFTSKLANNTEIIAILSSGISFTRFLRPY
FT                   IIGASIVSVFVLLMGFFIVPAASEGFNNFRYTYLKGNGKQLMRGENTNVFRQINDHDFI
FT                   FVNSFNEESKTAFNFTLEHFEKEKLTYKITASRIKWDPKKKIYTLYDYTKRTVGDLNDV
FT                   IEKAPEKNVGFKFELADLTPVVYIAETLTLGKLIDFIEKERKRGSGNINTYLVVLYKKY
FT                   SVPVSAFILTIIAVAVSSMKRRGGMGMNLAIGIAIAFSFVFFDKIFGTLAEKSTFSPLL
FT                   AVWFPNIVFGILAVYLLRNAKR"
FT   gene            complement(51394..52524)
FT                   /locus_tag="Fjoh_0045"
FT   CDS_pept        complement(51394..52524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0045"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03083"
FT                   /db_xref="GOA:A5FNZ0"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNZ0"
FT                   /protein_id="ABQ03083.1"
FT                   /translation="MKFDLLQKDPQSKARAGSITTDHGVIETPIFMPVGTVASVKGVHQ
FT                   RELKEEINPDIILGNTYHLYLRPQTEILEKAGGLHKFMNWDRNILTDSGGYQVYSLSSN
FT                   RKIKEEGVKFKSHIDGSYHFFTPENVMEIQRTIGADIIMAFDECTPYPCDYRYAQRSMH
FT                   MTHRWLDRCINHLEKVPYKYGYEQTFFPIVQGSTYKDLRRQSAEYIANAGQQGNAIGGL
FT                   SVGEPAEEMYAMTEVVCEILPEDKPRYLMGVGTPINILENIALGIDMFDCVMPTRNARN
FT                   GMLFTANGTINIKNKKWEADFSPIDEMAHTFVDTEYSKAYLRHLFAANEYLGKQIATIH
FT                   NLGFYMWLVREARKHILAGDFRPWKEMMVKNMSQRL"
FT   gene            52684..53607
FT                   /locus_tag="Fjoh_0046"
FT   CDS_pept        52684..53607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0046"
FT                   /product="YdjC family protein"
FT                   /note="PFAM: YdjC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03084"
FT                   /db_xref="GOA:A5FNZ1"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNZ1"
FT                   /protein_id="ABQ03084.1"
FT                   /translation="MLSDRVQPKSSRSISATIKNQMNLAQKLGYPENAKLLIIHADDAG
FT                   LSHSENQATIKALQNGSVNSYSIMVPCPWFYEMAEFAKKNPDFDCGIHLTLTCEWENYK
FT                   FGPVLPISEVSSLADQNGYFYKTRKDFKDNAKLSEIKKELIAQIEKALQFGIQPTHLDS
FT                   HMCSVGVTPEILDIYRELGKTYNLPVFINKGFVESISLSDKQYNFEDTLLADNLLIGYY
FT                   ADFEKGELRKSYEKALDNVVSGFNVFLLHPAYDDFEMQGITVNHPNFGSEWRQIDFDFF
FT                   TSDECKAKLKKNNIQLITWKEISSIR"
FT   gene            53710..54012
FT                   /locus_tag="Fjoh_0047"
FT   CDS_pept        53710..54012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03085"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNZ2"
FT                   /protein_id="ABQ03085.1"
FT                   /translation="MINSEDKLDDIKDEKIEKNLENMDYPANEDIYNQEERLEDIDPQD
FT                   ISGERIINNDNHEWKQNSDKIGNDLDVPGSELDDQQEDIGSEDEENNYYSESDTN"
FT   gene            54263..55111
FT                   /locus_tag="Fjoh_0048"
FT   CDS_pept        54263..55111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0048"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03086"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNX7"
FT                   /protein_id="ABQ03086.1"
FT                   /translation="MKPNTQQLSDLTIQVRRDILRMVHAVNSGHPGGSLGCTEFLVTLY
FT                   QNIMDRKEGFDMDGIGEDLFFLSNGHISPVFYSVLARSGYFPVSELATFRLLDSRLQGH
FT                   PTTHEGLPGVRIASGSLGQGLSVALGAAQAKKLNKDNHIVYSLHGDGELQEGQNWEAIM
FT                   YASAKKVDNIIATIDLNGKQIDGTTDEVLPMGSIRAKFEAFDWDVLEIKEGNSIDAIIA
FT                   GLTDAKSRTGKGKPVCILLHTEMGNGVDFMMHTHAWHGKAPNNDQLASALAQNVSTLAD
FT                   Y"
FT   gene            55185..56138
FT                   /locus_tag="Fjoh_0049"
FT   CDS_pept        55185..56138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0049"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03087"
FT                   /db_xref="GOA:A5FNX8"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNX8"
FT                   /protein_id="ABQ03087.1"
FT                   /translation="MKKYENTGSKDTRSGFGAGMTELGQKNENVVALCADLIGSLKFDD
FT                   FKKNHPERFFQIGIAEANMIGIAAGLTIGGKIPFTGTFANFSTGRVYDQIRQSVAYSDK
FT                   NVKICASHAGLTLGEDGATHQILEDIGLMKMLPGMTVINTCDYNQTKAATIALADHHGP
FT                   AYLRFGRPVVANFTPADEPFVIGKAILLNEGTDVTIIATGHLVWEALIAAEALEAKGIS
FT                   AEVINIHTIKPLDEEAILKSVAKTRCVVTAEEHNYLGGLGESVSGVLALNNPTPQEFVA
FT                   VKDSFGESGTPEQLMEKYKLNNQAIVEAVEKVIKRK"
FT   gene            complement(56332..57498)
FT                   /locus_tag="Fjoh_0050"
FT   CDS_pept        complement(56332..57498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0050"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03088"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNX9"
FT                   /protein_id="ABQ03088.1"
FT                   /translation="MNKFKYYFVLLLAGLAIVSCNKKDDDEEIVPLRDYQEQYNTDNAN
FT                   IEEYLNTYFITVTDAPGEQTDQDVTFTKITDPSTQPSIMSYLNSPTFPKLLKREVPMHG
FT                   IVYQMYYLVLREGTGTSPMNTDGAFTSYRGEYLTRVAKTDTEAEHLSTTFFEQVLFPTK
FT                   ALDLYGTIIGWSEAFPQFKTGTATMKPDGSMKYENFGAGVLFIPSGLGYYGSGASAIPA
FT                   YSPLIFSIKLYDLTRLDHDLDGVFDFEEDINGDGYVYDFRNTTEYPTPPANQYDDDTDK
FT                   DGIADFLDSDDDGDGYSTLFEITKPTGTEFLGGLSKYYPYNPVSDNPATPNYDETEKYG
FT                   IPRRPTGELTNPNLPESINNPRKFIEDDYLAAGRKRIHLDNTYPYKKN"
FT   sig_peptide     complement(57430..57498)
FT                   /locus_tag="Fjoh_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.763 at
FT                   residue 23"
FT   gene            57578..57973
FT                   /locus_tag="Fjoh_0051"
FT   CDS_pept        57578..57973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0051"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03089"
FT                   /db_xref="GOA:A5FNY0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNY0"
FT                   /protein_id="ABQ03089.1"
FT                   /translation="MRIDKYLWCVRYYKTRNMVTEACKKNQITVNGLVAKPSKEVFPTD
FT                   RITFRKDQITQIITVLDIPESRVGAKLVDIYRKNETPPEAYEHLELLKLSKEHYRKSGT
FT                   GRPTKKDRRDIDDYGNDFIDEENEDEI"
FT   gene            58048..58548
FT                   /locus_tag="Fjoh_0052"
FT   CDS_pept        58048..58548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0052"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03090"
FT                   /db_xref="GOA:A5FNY1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNY1"
FT                   /protein_id="ABQ03090.1"
FT                   /translation="MSKNIILTNQEIEHKIKRIAYQIYETFVDEEEVVIAGIASNGSVF
FT                   AQKLAESLRTISTLKVSLCEVKIDKQNPQSPIQTSLSKEDYKNKGLVLVDDVLNSGTTL
FT                   IYAVRHFLDVPLKKFKTAVLVDRNHKKYPVKADFKGISLSTSLLEHVQVVFDENGDNYA
FT                   FLS"
FT   gene            complement(58540..59058)
FT                   /locus_tag="Fjoh_0053"
FT   CDS_pept        complement(58540..59058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0053"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03091"
FT                   /db_xref="GOA:A5FNY2"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNY2"
FT                   /protein_id="ABQ03091.1"
FT                   /translation="MEKIVLLGYMGCGKSTIAQNLSKITQIPFLDLDICIEKRANLSIK
FT                   EIFEQHGEIYFRKLEHEMFLELLQSSENAIIGLGGGTPCYANNHLLLQRDDIVSVYLKA
FT                   SIDTLYNRLVHNKSKRPLIANMDEEEMKEFIAKHLFDRSFYYNHAQHKVAVDNRTIDET
FT                   VQDILDILA"
FT   gene            59185..59260
FT                   /locus_tag="Fjoh_R0006"
FT                   /note="tRNA-Lys1"
FT   tRNA            59185..59260
FT                   /locus_tag="Fjoh_R0006"
FT                   /product="tRNA-Lys"
FT   gene            59298..59373
FT                   /locus_tag="Fjoh_R0007"
FT                   /note="tRNA-Lys2"
FT   tRNA            59298..59373
FT                   /locus_tag="Fjoh_R0007"
FT                   /product="tRNA-Lys"
FT   gene            59415..59497
FT                   /locus_tag="Fjoh_R0008"
FT                   /note="tRNA-Leu1"
FT   tRNA            59415..59497
FT                   /locus_tag="Fjoh_R0008"
FT                   /product="tRNA-Leu"
FT   gene            59754..60158
FT                   /locus_tag="Fjoh_0054"
FT   CDS_pept        59754..60158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03092"
FT                   /db_xref="GOA:A5FNY3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNY3"
FT                   /protein_id="ABQ03092.1"
FT                   /translation="MEQKIHQGRNVKRFREMLNIKQEALAYDLGEDWSQKKISLLEQKD
FT                   VIEDNLLKQISAILKIPMEAFQNFNEEQAINIISNTFDNGAFLNTGYSPTFNTNPIDKI
FT                   IQLHEEKIALYERMLKEKDEMMQRLEKLIK"
FT   gene            60334..60409
FT                   /locus_tag="Fjoh_R0009"
FT                   /note="tRNA-Lys3"
FT   tRNA            60334..60409
FT                   /locus_tag="Fjoh_R0009"
FT                   /product="tRNA-Lys"
FT   gene            60603..61103
FT                   /locus_tag="Fjoh_0055"
FT   CDS_pept        60603..61103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0055"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03093"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNX0"
FT                   /protein_id="ABQ03093.1"
FT                   /translation="MKNLLVLSFIMISFSSWSQTAAIYFNKAFNKAAAGNYKSAIADYT
FT                   KAISKDSKFVEAYQNRGVAKFKLNDLKGAMSDFNKTIELDNMNADAFTGRANVNFKLSN
FT                   FKEAISDCTSCLDLNPRDYVAYNLRGLAYNNIGDKKNSCKDFSKAIELGSQSAIKNRNS
FT                   FCK"
FT   sig_peptide     60603..60659
FT                   /locus_tag="Fjoh_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 19"
FT   gene            61310..62209
FT                   /locus_tag="Fjoh_0056"
FT   CDS_pept        61310..62209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0056"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03094"
FT                   /db_xref="GOA:A5FNX1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNX1"
FT                   /protein_id="ABQ03094.1"
FT                   /translation="MINNIKTVFSIKDLENLSGIKAHTIRIWEKRYNILEPMRTDTNIR
FT                   LYNLQNLQKLLNITLLHEYGYKISKIATYPEEKIPQLVREIISKKNSQNYAITSFKMAM
FT                   MNFDQELFFNTFDWLISEKTFKEVFKEHFLPLLKELGLLWQSETITPANEHFMSHLIKQ
FT                   KILIYTESLQIQKPTKTDRIFVLSLPLNEIHQIGLLYLQYEILSKGYKTIYLGESMPIE
FT                   NLQDLTKHFENITFVSFMTIQPDRSVINQYVKSMGQKLLQKNNEVWLMGKMVEHIDRKN
FT                   LPERIRIFDSMEETMETI"
FT   gene            62247..63713
FT                   /locus_tag="Fjoh_0057"
FT   CDS_pept        62247..63713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0057"
FT                   /product="Phytoene dehydrogenase-related protein"
FT                   /note="TIGRFAM: Phytoene dehydrogenase-related protein;
FT                   PFAM: amine oxidase; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03095"
FT                   /db_xref="GOA:A5FNX2"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR014105"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNX2"
FT                   /protein_id="ABQ03095.1"
FT                   /translation="MTKTISIIGSGFSSLAASCYLAQQGNKVIIYEKNPTIGGRARQFK
FT                   KDGFTFDMGPSWYWMPDVFERFFQDFNKKPSDYYELVKLNPAYRVYFGINDFISIYDNL
FT                   AAIKNTFEEIEKGSGQKLETFINQAKSNYDIAIKDLVYRPGVSPLELITKETALKLNQF
FT                   LGNVSADIRKKFKNKKLIQILEFPVLFLGAKPTKTPSFYNFMNYADFGLGTWHPKTGMF
FT                   DVIRGIEKLALELGVTIKTNSPIEKIIVEGKTATGIVINGEIIKSDIILSGADYQHTET
FT                   LLEKEHRAYSDNYWESRIFAPSSLLFFIGFNKKIENISHHALFFDTDFDQHAIDIYDKP
FT                   KWPKEPLFYANFPSKTDLTCAPDGMETGFFLIPLAPGIEDNQSLREEYFEKIITRFEQL
FT                   TQQEIRNNIIFKESFCKNDFVQDYNAYKGNAYGMANTLLQTAFLRPKLKSKKVRNLYFT
FT                   GQLTVPGPGVPPALISGKLAAELIQKSLRS"
FT   sig_peptide     62247..62315
FT                   /locus_tag="Fjoh_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.753 at
FT                   residue 23"
FT   gene            63718..64557
FT                   /locus_tag="Fjoh_0058"
FT   CDS_pept        63718..64557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0058"
FT                   /product="Squalene/phytoene synthase"
FT                   /note="PFAM: Squalene/phytoene synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03096"
FT                   /db_xref="GOA:A5FNX3"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNX3"
FT                   /protein_id="ABQ03096.1"
FT                   /translation="MKSLFDAVSFKCSKLVTKNYSSSFSIAVKMLSPSIRDAIYSIYGF
FT                   VRFADEIVDSFHDYEKEYLIDDFEKEYYKAMELGISLNPILNSFQHTVKEYNITDDLVQ
FT                   AFLKSMKLDLIKSTYNTQTEYADYIYGSADVVGLMCLKVFVSGKEQKYEQLKEEAMRLG
FT                   SAFQKVNFLRDLKDDSTILNRAYFPGINLSNFNEDSKEQIIKEIEEDFRIAYQGIVKLP
FT                   IEAKFGVYTAYVYYKKLLKKLKNTPSHEIGNARIRVSNYTKAGLLAQSFVTYKLKLV"
FT   gene            64793..65233
FT                   /locus_tag="Fjoh_0059"
FT   CDS_pept        64793..65233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0059"
FT                   /product="Carotene hydroxylase"
FT                   /note="PFAM: Carotene hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03097"
FT                   /db_xref="GOA:A5FNX4"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNX4"
FT                   /protein_id="ABQ03097.1"
FT                   /translation="MISFLIFIGVFLFMECVTWLTHKYVMHGFMWYFHSDHHQPKYEDT
FT                   FERNDIFFVIFAIPSILLFYFGVQGGFNYLFFIACGVTLYGACYFLIHDVLIHQRFKWF
FT                   KNTKNKYLIALRKAHKIHHKHLGKEKGECFGMLFVPFKYYKM"
FT   gene            65265..65774
FT                   /locus_tag="Fjoh_0060"
FT   CDS_pept        65265..65774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03098"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNX5"
FT                   /protein_id="ABQ03098.1"
FT                   /translation="MKLYKIATVQYVNASVEDCWDFFSSPKNLQTITLDNMNFEIKDFD
FT                   DKRMYHGQIITYTLRPLLGIKISWVTEITACKENEYFIDVQRFGPYKLWHHKHFFEKTA
FT                   DGGTKMTDIVHYALPLGILGRLMNLLVVKNKLKTIFDFRHNKIEELFNSKSQPKIIQIN
FT                   AEQKSI"
FT   gene            65967..67262
FT                   /locus_tag="Fjoh_0061"
FT   CDS_pept        65967..67262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0061"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase, FAD-binding; DNA photolyase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03099"
FT                   /db_xref="GOA:A5FNX6"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNX6"
FT                   /protein_id="ABQ03099.1"
FT                   /translation="MTKQKVSFFWFRRDLRLEDNTGLFHALQSDLPVIPLFIFDEDILD
FT                   NLPKNDARVSFIYDSLQKINNELNTFESSILIKKGKTTAVWKSLLSEFDIQNVFFNKDY
FT                   EPFAIKRDTAICSLLKENNVECFSFKDHVIFEEKEITKADGSPYTVYTPYKNKWLEKYH
FT                   FLGTVPECDSSSMHSNFAKTKFSFPDLTEIGFKRSTIKVLPHNLTQIANYKETRDFPAL
FT                   DSTSYLSPHLRFGTVSIRKLVNWANRKNQTFLSELIWREFFIQILFSFPNCVNHNFKSA
FT                   YDGIQWRNNEEDFKRWCSGNTGYPMVDAGMRQLNETGYMHNRVRMVVASFLCKHLLINW
FT                   QWGEAYFAEKLLDFELASNVGNWQWAAGTGCDAAPYFRVFNPEIQQKKFDEKGEYIRKW
FT                   IPEFDFGYAEPMVDHAFARDRTIATYKAGILK"
FT   gene            complement(67426..68730)
FT                   /locus_tag="Fjoh_0062"
FT   CDS_pept        complement(67426..68730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0062"
FT                   /product="predicted protein kinase"
FT                   /note="PFAM: ABC-1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03100"
FT                   /db_xref="GOA:A5FNW3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNW3"
FT                   /protein_id="ABQ03100.1"
FT                   /translation="MKTIDYIPTSKIERAGKLVQTGAKIGVNYIKHYAEKVVNPDLTRD
FT                   KLNENNAEDIYDGLKSLKGSALKVAQMLSMDKNFLPQAYVEKFSLSQFSVPPLSAPLVL
FT                   KTFKSNFGKTPYEIFDEFNPNSVNAASIGQVHLAKKNDKKLAVKIQYPGVANSISSDLA
FT                   LVKPIAIRMFNLQGKDSDKYFKEVEDKLIEETNYLLELKQSQEVVDACGKIENIIFPNY
FT                   YPEFSSEKIITMDWMTGIHLSEFTAKNTDQEVGDKIGQALWDFYMYQIHVLRKVHADPH
FT                   PGNFLVNDQNQLIALDFGCMKQIPEEFYTPYFELINKNVITDEMLFNKKLFELEILRPD
FT                   DTPAEVEYFTDMFHDLLSLFTRPFQNETFDFADETFFNAIAELGKRFSEDTNLKKMNGN
FT                   RGSKHFIYMNRTFFGLYNLMFDLKAKIVVENYLKY"
FT   gene            complement(68727..69389)
FT                   /locus_tag="Fjoh_0063"
FT   CDS_pept        complement(68727..69389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03101"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041673"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNW4"
FT                   /protein_id="ABQ03101.1"
FT                   /translation="MAAKKKVITKDEIVSLYMDHVLEKDQKPKSVYHFAKENDFTEADF
FT                   YSFFGTLEGLEKEIFRLFFENTVNLLHTNEEYQQYDMKNKMLSFYFTFFEVLTANRSYV
FT                   LQTLKADRNPLKNFVQLTTLRESFKNYVSEILTDDYRLEQEKFQKFQEKAVQESAWLQL
FT                   MLTIKFWMEDESAGFEKTDIFIEKSVNASFELMNVAPMNHLIDFGKFLFKEKIHSRQ"
FT   gene            69488..70399
FT                   /locus_tag="Fjoh_0064"
FT   CDS_pept        69488..70399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0064"
FT                   /product="domain of unknown function DUF1731"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; domain of
FT                   unknown function DUF1731"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03102"
FT                   /db_xref="GOA:A5FNW5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNW5"
FT                   /protein_id="ABQ03102.1"
FT                   /translation="MAQNVLLTGGSGFIGSYLTNLLIGAGFTVSILSRNKKENTDTVTY
FT                   YKWNLDKDYIEEEAVLNADFIIHLAGEGIVEKRWTKKRKKAIIDSRVKPIDLIFSVLEK
FT                   NNKKLNGFISASAIGIYGAVTSHKVCTEETPPADDFLGTTCQIWENASEKIEKLGIRTV
FT                   KIRTGIVLGKDEGFLKKLNPSFKSGFGAALGTGKQYLPWIHIEDLCQIYCKAITDDQMH
FT                   GPYNAAVTDNTTNARFSRLLASLYGYAIWLPKVPPFVLRIVLGEMSKAVLEGQRVSSEK
FT                   IQRTGFEFQFTDLEKALISCIH"
FT   gene            complement(70404..70976)
FT                   /locus_tag="Fjoh_0065"
FT   CDS_pept        complement(70404..70976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03103"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNW6"
FT                   /protein_id="ABQ03103.1"
FT                   /translation="MKRTTLLILLFTAFSLLAQDKFKTTAAIVNFEASVPFFEEVKAVN
FT                   KLGTIVLEPSTSTLICTVVIKDFRFKMDLMQEHFNENYIESHRYPKSVFKGKIEKFDLK
FT                   DIDGLEKEYDVKGKLYLHGKSKIIEMKALIKRVPEGIQISCNYPISVSDFNIAIPSVVA
FT                   NKISKTANTNLIGVVQNGEEKKYLTLK"
FT   sig_peptide     complement(70920..70976)
FT                   /locus_tag="Fjoh_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(71319..71714)
FT                   /locus_tag="Fjoh_0066"
FT   CDS_pept        complement(71319..71714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0066"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03104"
FT                   /db_xref="GOA:A5FNW7"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNW7"
FT                   /protein_id="ABQ03104.1"
FT                   /translation="MVKFGYTILYVEDVEKSIEFYENVFEFERKFISPDNDYGELNTGE
FT                   TTISFASKKLGAQNLEDGFLESSLEDKPFAIELAFITDDVGHLVQKATSFGAVLVSEPK
FT                   KKPWGQVVAYVRDTDGFLLEICTPVHS"
FT   gene            complement(71758..72306)
FT                   /locus_tag="Fjoh_0067"
FT   CDS_pept        complement(71758..72306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0067"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03105"
FT                   /db_xref="GOA:A5FNW8"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNW8"
FT                   /protein_id="ABQ03105.1"
FT                   /translation="MTADYKPVSSSKISISELMLPSHTNFSGKIHGGYILQLLDQIAFA
FT                   SASKFSGNYCVTASVDTVNFLKPIEVGELVTMKASVNYVGRSSMIVGIRVEAENIQTGV
FT                   IKHCNSSYFTMVAKDKDGKSVQVPGLILSNLEEVRRFRKAIKHIEVRKEIEEHEKITTV
FT                   NSIEDLASLDKYNVLLEIS"
FT   gene            complement(72495..73868)
FT                   /locus_tag="Fjoh_0068"
FT   CDS_pept        complement(72495..73868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0068"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03106"
FT                   /db_xref="GOA:A5FNW9"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNW9"
FT                   /protein_id="ABQ03106.1"
FT                   /translation="MFDFLPYLTAFVVALFLGIYLGKILFSAKFQSEKVSLEERLNANA
FT                   NQLQQQKEQFDIERNNFQKQFQLSNSEKESIRTEKDSLAIQLSKKEVDFENLWERHKEQ
FT                   KAEINELQEKFTKEFENLANKILEEKSAKFTEQNSENMKNILLPLQDKIHVFEQKVDQT
FT                   HKESIDYHAALRQQIIGLSEMNAQMSKETLNLTKALKGDSKMQGNWGELVLERVLEKSG
FT                   LEKGREYEVQQSFVNAEGNRVMPDVIINLPDGKKMIVDSKVSLVAYERWVNEESDLLKI
FT                   DLLKEHVLSIKRHVEQLGNKNYHDLYRMESPDFVLLFIPIEPAFAIALNEDSTLYTKAF
FT                   DRNIVIVTPSTLLATLRTIDSMWANQKQQENAFEIARQAGALYDKFEGFVTDLVRIGNK
FT                   IKDTKTEYENAMNKLVDGKGNLITSVEKLKKMGAKAKKSLPENIINRALNSDETELLN"
FT   gene            74067..74915
FT                   /locus_tag="Fjoh_0069"
FT   CDS_pept        74067..74915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0069"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03107"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNV5"
FT                   /protein_id="ABQ03107.1"
FT                   /translation="MKKLMLSLFIAFGLNGCSLNNDDYNVSCGNDVDVSFTGFPLLCNY
FT                   SVKSLPNNPTAYVLESQEKMDTYFTKHENTCSVASDPNIDFSKNLLVGIFAGAKPTSGY
FT                   AIKITSMVENSCQITINFFEKAPLAGENITQAPTYPSDFILIPKTSKPIYFNRTNESAD
FT                   NIIIGSFGTTNSFFQINDYNILNFQNVVTGKYEFSQYKYSQKAKRSEYTLFSKSIPAEI
FT                   TALKGQTKTYGAPDSQGIYFELRKGIDVTKVFIDNTDTADQSTEVKAFKKAIQDKITSL
FT                   K"
FT   sig_peptide     74067..74129
FT                   /locus_tag="Fjoh_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.908) with cleavage site probability 0.534 at
FT                   residue 21"
FT   gene            74923..75321
FT                   /locus_tag="Fjoh_0070"
FT   CDS_pept        74923..75321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03108"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNV6"
FT                   /protein_id="ABQ03108.1"
FT                   /translation="MKKHFIFLIVITLFSSAYSLESTTEGAGSIVNTWIWEKSIGSGAN
FT                   PYTVTPKTIGFTKKVIFTPEGKVITYKNNVEIRVSNYQIEKGLGFLDQAEHDLITFEGK
FT                   TYIIENLDNQNLTIVSNNTDPVRTIYKR"
FT   sig_peptide     74923..74982
FT                   /locus_tag="Fjoh_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.679 at
FT                   residue 20"
FT   gene            75409..75924
FT                   /locus_tag="Fjoh_0071"
FT   CDS_pept        75409..75924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0071"
FT                   /product="ECF subfamily RNA polymerase sigma-24 subunit"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03109"
FT                   /db_xref="GOA:A5FNV7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNV7"
FT                   /protein_id="ABQ03109.1"
FT                   /translation="MKNDREGQLKIYQLFSPVLYGICLKYMKNEDDAKDVFQEAFVIVF
FT                   QKISQYKFEGSFEGWLKRIFINKLIETLNKKKKESFFLDVFDPDTDFVEEEELEVLPIE
FT                   QEKLLEYIRDLPDQYRTVFNLYVFEKMKHKEIADLLKISEGTSKSNLNRAKHILQKKIL
FT                   SIKNFKTA"
FT   gene            75921..77897
FT                   /locus_tag="Fjoh_0072"
FT   CDS_pept        75921..77897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03110"
FT                   /db_xref="GOA:A5FNV8"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNV8"
FT                   /protein_id="ABQ03110.1"
FT                   /translation="MKKHKIEDIFSSMENFSSVPPPELWSQIEEKLDKPKKKKRVILWW
FT                   SAAACLLLGLMLPSVLHFSSSDKQTNPIQNNTLENNNIVLDQKENNTEKTNKNTERSIE
FT                   NDINNQSKNNNQISSSEETINQSKNQLNKTQQTETVDSDSEKKLNTNSFAPKSNGTKNS
FT                   LNNNATVAEKSLTPVKENKFNLDSKNQFSGSKNGQSNQTVAEKTYVPAKENVFNAASTN
FT                   QFSGNKTGKTNQALAEKTYAPAKENAFNPASTNQFSGNKTGKTNQALAEKTFSPNQADR
FT                   LNSASKSQLSDIEKRNADKVLAEKTFNAGKQNKFNAGQKNQISNSIFENIPNSKNNNTI
FT                   AFTGSNSGLNGNQNAVNSNKEKQNIQKTSTDKSIASLQKDNSKGNTAFTNVNVLTKKDS
FT                   AQLAELQNLEKGIVTPEEEKKKKEDKLLSKADKWALQVFAGVANSENYSKNKTLGNVND
FT                   SKQSNSYGVKTQYKINKKWAVASGFKINELGQSVANVSYYNAKNSALFTPVDYFAQSAG
FT                   PTQFTSDANYVLVSNNAKEAINSSNIQTGNLDQNLRYLEMPLEVSYSIFNRKKTSINLN
FT                   TGAFVGKLISNNVALDGTSIGENINANDYVYGSTLSSTIQYRVYKKTNVFVEPAVNYYA
FT                   NPLNSQSFNQFQWGLNFGLNVNF"
FT   gene            77940..78467
FT                   /locus_tag="Fjoh_0073"
FT   CDS_pept        77940..78467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0073"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03111"
FT                   /db_xref="InterPro:IPR011235"
FT                   /db_xref="InterPro:IPR038231"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNV9"
FT                   /protein_id="ABQ03111.1"
FT                   /translation="MTFKNNWKNLSLPKNLLTAKELVYDICGFECSEPQPEKESQEYDA
FT                   FDFKIGESQIKFRSAKITPTKTGQFVTLWKRNINGIIEPFDYKDEIDFVIVSVQKEDLL
FT                   GQFIFPKEILLKKGVFTSETKEGIRATRVYPPWDETTSKQAQKTQQWQLDYFLFVSDKT
FT                   DLNRAKHLLDKK"
FT   gene            complement(78528..81929)
FT                   /locus_tag="Fjoh_0074"
FT   CDS_pept        complement(78528..81929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0074"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03112"
FT                   /db_xref="GOA:A5FNW0"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNW0"
FT                   /protein_id="ABQ03112.1"
FT                   /translation="MKNNYSFRHLMTFLGFFYCFTLSAQTMPAAQTLPVEQNFESWLAA
FT                   DAQFPAGFQGWTLGGNDSGVTQYLTSPTFTDYNTILTGKGANTNSGGFYNYVGKLGFLN
FT                   TGSVNLNIGFAFSSVGTTNVQVQYDVMTIRNPSDASNTRVNEVILQYRVGTTGDFISLL
FT                   GTAYRNNSITQTGTNVYLPQNSQLRKITLPAECDNQPVVQIRWASRQVSGGGGRPSFAI
FT                   DNLDIRKDTFAPANVSGYPKTANVLGESFDFINKIDEVGKTYYVLLPGGSAEPTVAQIK
FT                   AGQDSNGTAALQAGIFDITNPALEYIKSFTGLPLSTAYSIFSISEDIPGNIQASVNKID
FT                   VTTLSVMPPAISTSVSVLNLGGTEPNFDALTKSYQIGASDLTANVVLTASGSFTISKDN
FT                   VTFTSSLTFVPADFDSNATPTIYVKFTPASVGSFTGSITHETTGAVTKTVSVTGIGINP
FT                   YVQGFNDANVLTNSGWTQYNVSGPTNKWVYTNTARNVNSGTGAVLMNGYSDSGASQDWL
FT                   ISPKLRLNTFGDFPLLSFYSRKFYAGPGLKLKVSTDYDGVSNPNTATWTDIDGKFPTST
FT                   GNYVQSQYIKLNAYKTDHTYLAWVYETTAGGTNNASEWSFDDYAVTDEAGYVDSNPVLD
FT                   FGVVDQNTVSASQSFNFKAEGYGDITITAPASYQISADNISFGTTVVVSAADAFAGKIL
FT                   YAKFAPTTKELKISGTLTVTGTSLNKQIGSLTGSSLPKSDTFDVVTYNMEFFGAPTSAY
FT                   GPADKALQMQNAVKVINKLDADVYVVQEISSDAAIDDLITQMNVNGKSFNKVVSTSWSY
FT                   SWETNPSDPNYPPQKLVVIYDTKTTTLKNTRVMFKEFYDELRAGTKSLTNYPGTNSNFF
FT                   SSGRLPYMVTLETNLNGVKNEIKFVDLHARANSGTDISRYNMRKYDVEVLKDSLDTHYG
FT                   DSNIILLGDYNDDVKASVIAGQPSSYQSFVTDTNNYKALTLEISQAGAYSFLSSGGFLD
FT                   HITISNELFDQYINESIAVYDPRNDIANYTTTTSDHGPVIARFNLKQDVLSTPDFGTKN
FT                   GFYVKAYPNPTSDVINFTVKTNESKNLKLRLYDLNGRALGNPIDIQSSEEVNTTVMSLR
FT                   NLNAGLYIYTLSENNKVVYKNKILKN"
FT   sig_peptide     complement(81855..81929)
FT                   /locus_tag="Fjoh_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.708 at
FT                   residue 25"
FT   gene            complement(82241..82993)
FT                   /locus_tag="Fjoh_0075"
FT   CDS_pept        complement(82241..82993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0075"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03113"
FT                   /db_xref="GOA:A5FNW1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNW1"
FT                   /protein_id="ABQ03113.1"
FT                   /translation="MALLENKVAFVSGGGSGIGRAVAEAYAREGAKVVVSDINVEHGEE
FT                   TVKVIKASGGEAFFVKGDSSSASDNKHMVEVAVSKYGRLDIACNNAGMGGPAKPTGEYE
FT                   PEAWDRVIALNLSGVFYACRYQLEQMEKNGGGSIVNIASIHGQVAAPLSPAYTASKHGV
FT                   VGLTKNIAAEYAQKNIRCNAVGPGYIETALLKDNLNNDAMNAVAAKAPMNRLGTAEEIA
FT                   ELVTFLSSEKSSFTTGSYIIADGGYTAV"
FT   sig_peptide     complement(82922..82993)
FT                   /locus_tag="Fjoh_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.608 at
FT                   residue 24"
FT   gene            complement(83145..83615)
FT                   /locus_tag="Fjoh_0076"
FT   CDS_pept        complement(83145..83615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03114"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNW2"
FT                   /protein_id="ABQ03114.1"
FT                   /translation="MKLLYKLKAMLNHFLLKFRIRNINIETQNNKDMETNNLGSKKING
FT                   AQKDIDETKGKNISHDGKADDANLKKEVVTDTEGNKEVVERARNENEDIKKVKDDVNPN
FT                   NPNANRGVSSDEEAEKTVENKDRNSDITPNRYPNSHPDNHKDRGNMKLDEDN"
FT   gene            83941..84513
FT                   /locus_tag="Fjoh_0077"
FT   CDS_pept        83941..84513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0077"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03115"
FT                   /db_xref="GOA:A5FNU7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNU7"
FT                   /protein_id="ABQ03115.1"
FT                   /translation="MHRHFILFKPYGYLSQFIYELKRKKKLLGELHDFPEGTMAIGRLD
FT                   EDSEGLLLLTTDGKVSEQIRSKKVDKEYYVQVDGIITPEAIEKLQKGVEIGFEGGKYKT
FT                   KPCTAFIVTEIPDFGPRAKKIRDERHGPTSWASITVNEGKFRQVRKMTAAVGFPTLRLV
FT                   RVRIGNVYLQNLKAGEVLEVNDFQIND"
FT   gene            84535..84990
FT                   /locus_tag="Fjoh_0078"
FT   CDS_pept        84535..84990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0078"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03116"
FT                   /db_xref="GOA:A5FNU8"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNU8"
FT                   /protein_id="ABQ03116.1"
FT                   /translation="MLNVVLVEPEIPNNTGNIGRLCVGTESRLHLIHPFGFVINDKNLK
FT                   RSGLDYWVHLDVTEYQNVEEWIQQIPDHSRVFLMSSHSEKSYLENEFQDGDWLVFGKES
FT                   VGLSAAFMARFENHLTIPMSPLIRSFNIANSVAFVVGEAKRQIGLKK"
FT   gene            85025..85831
FT                   /locus_tag="Fjoh_0079"
FT   CDS_pept        85025..85831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03117"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNU9"
FT                   /protein_id="ABQ03117.1"
FT                   /translation="MKETVTVEKALSSGRRKLKYIPIIAAFSFIIGGFLLFYLKFFDAW
FT                   IIALGFILGPLSGWLIWSYNINKWKIWAFENVRNVHTLQRKAFEQKLIWKKGSLFEKSV
FT                   FKNYDQIQKLKRLETKFLEKDIFKDDISIPKETLIFYSKSTLILNLVIAIGFTGIGLYL
FT                   ILNKNWFGLLFVILGICIIADRIKNLRHNGPQITLNEKGIRLKDGKLIPWNEIYNDRVF
FT                   TKSGARSSTDYLAFNNEMISINEMTITFEELENLLHVYRLRFENNI"
FT   gene            complement(85828..86604)
FT                   /locus_tag="Fjoh_0080"
FT   CDS_pept        complement(85828..86604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0080"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03118"
FT                   /db_xref="GOA:A5FNV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNV0"
FT                   /protein_id="ABQ03118.1"
FT                   /translation="MRNILSASNLTIGYKSKKATVIIAENLNLNLKSGKLISLIGANGI
FT                   GKSTLLRTITGIQHPLSGNVYLNDTAVSAYKPLDLAQNLSLVLTEKLPPSNLSVFELVA
FT                   LGRQPYTNWVGTLTQTDIEKVQEAMELTQIEHLSHKKHYEISDGQLQKVLIARALAQNT
FT                   PLIILDEPTTHLDLLHKVSLFKLLKKLTQETQKCILFSTHDIDLAIQLSDEMIVMTPEN
FT                   VVQDEPCNLISNGSFAALFKDEHIIFDAEKGKFIVT"
FT   gene            complement(86696..87109)
FT                   /locus_tag="Fjoh_0081"
FT   CDS_pept        complement(86696..87109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03119"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNV1"
FT                   /protein_id="ABQ03119.1"
FT                   /translation="MITQKYLDELTYEVLGASIEVHKIIGKGLLENVYHQCLKEELSQR
FT                   KLNFFTELRVPIIYKDKELVTDFRCDLFVENCLVVELKTVSEINSIHQAQLLTYMKLLK
FT                   APKGIIINFNCFNIFKEGQKTLVNEYFRLLPKL"
FT   gene            complement(87184..88152)
FT                   /locus_tag="Fjoh_0082"
FT   CDS_pept        complement(87184..88152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0082"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03120"
FT                   /db_xref="GOA:A5FNV2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNV2"
FT                   /protein_id="ABQ03120.1"
FT                   /translation="MFFASISLGSVTIPLKDVFSSLTGGHAAKSTWEYIIINYRLPKAI
FT                   TAVLVGTGLSISGLLMQTLFRNPLAGPYVLGLSSGASLGVAFVILGAGFLPSFLSVIAL
FT                   SSYGIVIASTFGSTLVLLLVLIVSQRLRDTMAILIVGLMFGSFTTAIVSVLTYFSTAEQ
FT                   LQKFTFWSMGSLGNLSWSTIGILTFCVGIGLLLSAKSIKPLNALLLGENYAKSMGLNFN
FT                   QARLIIIFATSILSGAITAFAGPIAFIGLAVPHIAKLTFQTSNHTILFWSTLFFGSIIM
FT                   LFCDIVSQMPGFDVTLPINAITSIIGAPVVIWLLVRKINFQ"
FT   gene            complement(88214..89356)
FT                   /locus_tag="Fjoh_0083"
FT   CDS_pept        complement(88214..89356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0083"
FT                   /product="periplasmic binding protein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03121"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNV3"
FT                   /protein_id="ABQ03121.1"
FT                   /translation="MRHLFPKLIFISSFFILFGCKKNETSEVAKTDAAKNSIEYASGLS
FT                   IVKYDDYSVVTVSNPWPNANKDFKYVLKEKEAKVPDSLQAYTSIQIPLESVVVTSTTNI
FT                   PFLEMLEVENKLVGFPHTDYISSEKTRALIDKGSVKNVGQNEKLNIEQLIELSPDLIVT
FT                   FGVDNNNPMLDNLKKSGLNILIQGDWMEQSPLGKAEWIKLYGALFGKEEKAKELFDKIV
FT                   QSYEQAKKLAAEKEVNSTVLYGSMYEDVWYVAKGNSWVAEFMKDAHANYLWADLKGTGS
FT                   EGLSFEKVLDKAKTASVWIASGSFKSLDELQKANPHYGEFDAFKNKNVYSFEGKLGATG
FT                   GTVYYELAPSRPDLVLKDYIKIFHPDLLPSYEFTFASKLN"
FT   gene            89452..89814
FT                   /locus_tag="Fjoh_0084"
FT   CDS_pept        89452..89814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03122"
FT                   /db_xref="InterPro:IPR040807"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNV4"
FT                   /protein_id="ABQ03122.1"
FT                   /translation="MNTTKIKICSSCESEFSCGDISVESKCWCNDYPPIFNLSEGADCL
FT                   CPVCFKEACEDKIDAYIETITPKNALKNKAISLPQTTKLIEGIDYYIENGNMVFKTWYH
FT                   LKRGTCCGNNCRHCPY"
FT   gene            89845..90222
FT                   /locus_tag="Fjoh_0085"
FT   CDS_pept        89845..90222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03123"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNT9"
FT                   /protein_id="ABQ03123.1"
FT                   /translation="MKNNVVKNKSFDFAVRIIRLYQYLNNDKKEFILSKQLLRSGTSVG
FT                   AMIREAEHAESKSDFIHKFSIAQKEANETVYWLELLKATDYLNEKEFENINNDAISILK
FT                   LITSILKTSKNSSIKETSSIN"
FT   gene            90253..90762
FT                   /locus_tag="Fjoh_0086"
FT   CDS_pept        90253..90762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0086"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /note="PFAM: cobalbumin biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03124"
FT                   /db_xref="GOA:A5FNU0"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNU0"
FT                   /protein_id="ABQ03124.1"
FT                   /translation="MIYLITGGERSGKSTYAQNLALQLSDSPMYVATARKWDSDFQNRI
FT                   DRHQQERDERWTNIEKEKYISEIDFSDKVTLIDCVTLWLTNFFVDNKNNVESSLEEAKK
FT                   EFLSIANQENATLIIVTNEIGMGVHAATEIGRKFTELQGWMNQFLASKADEVVLMVSGI
FT                   PVKIKG"
FT   gene            90927..92606
FT                   /locus_tag="Fjoh_0087"
FT   CDS_pept        90927..92606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0087"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /note="PFAM: nitroreductase;
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03125"
FT                   /db_xref="GOA:A5FNU1"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNU1"
FT                   /protein_id="ABQ03125.1"
FT                   /translation="MSHLDDILKSRRDTRHFTTDEVPDEVIQKALQAGHWAPSVGLTDA
FT                   TRYYIIKSDAVKSAIKNLFLDYNKKAEELTDNPEQKELYKSLKLEAIEEAPIGLIIAYD
FT                   RSVLNQFTIGTIGSNEAVKFSSVCAAQNIWLSLTEQGYGMGWVSILNYFQFKKILDLPE
FT                   NIEPLGYFCIGKPATNYGNQPMLQQLHWKQKSETADCKEINEIHQINISDFDLKKETKA
FT                   DPKTDFAALLQEKIDSKTKPLGSLGTLETLAFQMASVFETLNPKIINPNVVVFAADHGI
FT                   ANHGVSDYPQDVTRQMVNNFLNGGAAINVFCKQNNIELSIVDSGVNYDFPTNAKLINAK
FT                   IAKGTQSFLYASAMSETELQLCFEKGKSIVENIAKTGSNCIGFGEMGIGNTSTASVLMS
FT                   LLTGLPIEECVGKGTGINDQKLLDKQNILKKALENYSGQTELKQHLAYFGGFEIMQMAG
FT                   GMLTAFENKMLILVDGFICSVAFLIAFKINPNIKQNAIFCHCSAEKAHLKLLEYLDAKP
FT                   ILNLDLRLGEGTGCAVAFPILKSAEAFLNEMASFESVGISKK"
FT   gene            92674..93105
FT                   /locus_tag="Fjoh_0088"
FT   CDS_pept        92674..93105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03126"
FT                   /db_xref="GOA:A5FNU2"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNU2"
FT                   /protein_id="ABQ03126.1"
FT                   /translation="MPFTKVYIHCVWSTKNRFPFLNSTDLRQKVWHHIKENALKKEIYL
FT                   EYISCYSDHCHCLISLGNNQTIQKTIQLLKGESSYWINKNQLTKEKFEWQDEYFAVSVS
FT                   ESIVDKVRNYIKNQEDHHKKKTFQEEYDEFITKFGFKHP"
FT   gene            93316..94101
FT                   /locus_tag="Fjoh_0089"
FT   CDS_pept        93316..94101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0089"
FT                   /product="cobalamin-5'-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /note="TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03127"
FT                   /db_xref="GOA:A5FNU3"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNU3"
FT                   /protein_id="ABQ03127.1"
FT                   /translation="MKKELHIFFTCLMFYTRIPCPKNIDHNPDYLNKATRYFPFIGWIV
FT                   GSISFLAFYLFSLFLSTETAVIFSIIISVLTTGAFHEDGFADVCDGFGGGWTKEKILTI
FT                   MKDSAIGAYGAIGLVLLFLVKFKLLSESISLFTHSIFLVFLLFISAHSLSRLAAISIIF
FT                   THEYSRDDASSKSKPIAKNHSWREVLGSFFFGLIPLLALSYFNYKTLLALIPIFITRYF
FT                   LARYFQKWIDGYTGDCLGATQQVCEVVYYLSILFIWKFI"
FT   gene            94086..94619
FT                   /locus_tag="Fjoh_0090"
FT   CDS_pept        94086..94619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0090"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03128"
FT                   /db_xref="GOA:A5FNU4"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR017578"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNU4"
FT                   /protein_id="ABQ03128.1"
FT                   /translation="MEIYLVRHTETICEKGICYGQSDVDIAAPFDEIFNRIISELPSQT
FT                   VIFSSPLKRCSILAKHIQKNTNAISYQEDDRLKEMNFGDWELKPWDEIPPEELNPWMED
FT                   FVNIPVSNGESFTELHSRVGGFLAEQISDLTHPVIIVAHAGIIRSILCHQTSLPLKEAF
FT                   QNKVDFGEVIRIEL"
FT   misc_binding    94689..94892
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 83.50"
FT   gene            94955..96778
FT                   /locus_tag="Fjoh_0091"
FT   CDS_pept        94955..96778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0091"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03129"
FT                   /db_xref="GOA:A5FNU5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNU5"
FT                   /protein_id="ABQ03129.1"
FT                   /translation="MLCQFTWAQSDSIKLKEVVVSDSNLKKYSTSQSVQVLNDSILDRN
FT                   QPSLTSLLNFNTVIYFKENGLGMTSAPSFRGTTGAQTAVIWNGININSQFLGQADFNTI
FT                   GTRDFNSITVKAGGGSVLYGSSAIGGSIHLNNDLRFKNEFSNHVFFSAGSYNTYSANYR
FT                   TIVSSDKYSLQVSISRNSSDNDFKYPGNSDERNINGQYYNTSMNTTFGYKINANNTLKA
FT                   YSQFYDSERHFSLTSPNASKTKYNDFNTRNLLEWESQLGRFTSKLRAAHIGESYKYFPS
FT                   ITSNNFTYGKVETSIIKYDLAFDVNDKIKLNSIVDYSRNKGYGSSIDNVKREVGTASLL
FT                   LHHLLTEKWDYNASIRQEITDNYGNPFLFSFGTKYDFTSFYRLKFNASKNFRMPTYNDL
FT                   FWERSGNPNLKPETSYQAEIGNEFFRKNFTLSITAYYNSIKDLLRWVPGEGGGDVWAPE
FT                   NTDKVRAYGAEVLVEWKPKFGQNNFTINGTYAYTVSESQQLIKNELIYKQLIYVPYHKL
FT                   TGSVAYNWKKLSSYFQYLYNGEVYTTPFNNRASKIKDYNVGNIGVDYDFGAKNSYKIGF
FT                   QVLNLWNENYQPVTSRQMPGRNYTIYINLNF"
FT   gene            96784..97851
FT                   /locus_tag="Fjoh_0092"
FT   CDS_pept        96784..97851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0092"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03130"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNU6"
FT                   /protein_id="ABQ03130.1"
FT                   /translation="MKKFNKLFLTVLISSAFFVSCSNDDDNNDEPRGDYENGIFIVNEG
FT                   NFGKTNGTISYLSDDLSIENNVFSLVNPGKITGDTPLFIGFKDDAAYIVVNGSNKIEVV
FT                   NRYTFKSIATVTANLNNPRFIAFANGKGYVTNWGEGSDPADDYVAVLDLTTNTVTSSIS
FT                   VVEGPEKIIENDGKLYVAHKGGWGQGNSLTVINSATNTVVTNFVVGDVPSDLVKDNGTL
FT                   YILCNGKPFYADVETAGKIVKVNLSTNTVSSTLDFTGITHPGFLDIEDSKVYYTIGNNI
FT                   YSMAANATSLPATALFKASDVTNLYGFAVEDNKIYAADAINNQDPGEAYIYSLTGTKNK
FT                   SFTVGISPNGFYFND"
FT   sig_peptide     96784..96852
FT                   /locus_tag="Fjoh_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.525 at
FT                   residue 23"
FT   gene            complement(97909..99381)
FT                   /locus_tag="Fjoh_0093"
FT   CDS_pept        complement(97909..99381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0093"
FT                   /product="peptidase S41, subfamily S41A unassigned
FT                   peptidases"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03131"
FT                   /db_xref="GOA:A5FNT1"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR041613"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNT1"
FT                   /protein_id="ABQ03131.1"
FT                   /translation="MKPILKSILFLCLLSFFLQSCEDEDDVRTPAQLQVNDFVWKGLNE
FT                   LYLWQGDVANLADDRFSSQEELNSYLEGYSNPEDLFQDLLNKPVSKYPSNAIDRFSWIV
FT                   SDYTVLEQELGGITKNNGVDFRLTRVAEGSNDVVGYVRYIIPNSDASSKAIKRGDFFTS
FT                   VNGTKLTVSNYKSLLVDPDSYTLDFADYNGTAFVLNGKSVALTKTVLEENPILINKVIN
FT                   SGGHKIAYLMYNGFYAEYDSKLNQAFQGFKNEGATDLVLDLRYNGGGSVRTSTRLASMI
FT                   TGQFEGKIFSKRQYNFKQMAGMTAEDLEVLNERFVKDIDGTPVNSLNLSTVYILTTSST
FT                   ASASELIINGLKPYINVIQIGETTTGKNVGSVTLYDSPTFTKRNVNPNHKYAMQPLVFK
FT                   ISNASDFGDYTQGLVPTYVQLEYLRSYGVLGDTAEPLLNMAISKITGAAAKKVQNDHGL
FT                   VLPYISDSKKINGLRNEMYIDGNAGEFIKTLK"
FT   sig_peptide     complement(99313..99381)
FT                   /locus_tag="Fjoh_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.504 at
FT                   residue 23"
FT   gene            99532..100041
FT                   /locus_tag="Fjoh_0094"
FT   CDS_pept        99532..100041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0094"
FT                   /product="ECF subfamily RNA polymerase sigma-24 subunit"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03132"
FT                   /db_xref="GOA:A5FNT2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNT2"
FT                   /protein_id="ABQ03132.1"
FT                   /translation="MNQNVFIELVNPFKDKVFRLAKRLLTSTEEAEDATQEVMVKLWNK
FT                   KENLDAYNNVEALAMTMTKNYCLDQLKSKRAGNLQIVHNNFTDREPQLDRKLEDADSLE
FT                   WVGKIISQLPEQLQILIQLRDVEQYEFEEIAKIVNMNETAIRVALSRARKKIRESMVNA
FT                   HSYGIR"
FT   gene            100028..100483
FT                   /locus_tag="Fjoh_0095"
FT   CDS_pept        100028..100483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03133"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNT3"
FT                   /protein_id="ABQ03133.1"
FT                   /translation="MELDKIENILAKYFQGETTIAEENQLKEYFSSSDVAQHLEQYKPI
FT                   FGYFSQVKQQKSTQEIPLKTKKRNVAWLSIAASIVVLLGIGTYYFTGEKTTSVTAQSEL
FT                   GTYDDPEEALKATQKALSLLSSNVNVGIESVQYINEYEQSKNRIFKQ"
FT   gene            100500..101027
FT                   /locus_tag="Fjoh_0096"
FT   CDS_pept        100500..101027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03134"
FT                   /db_xref="InterPro:IPR025348"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNT4"
FT                   /protein_id="ABQ03134.1"
FT                   /translation="MKNFIITLVFAFVTQAFYAQGAFDKFDGQDDVTSVIVNKKMFDLM
FT                   SKVKVDASDKETQQYINLIKKLDYLKVFTTKNPKIEADMKASADKYIKTAGLEELMRVN
FT                   DSGKNVKIMVKSGASDTQIKELLMFVDGAKNDETVLLSLTGNFDLNEISVLTDKMQLPG
FT                   GSDLKKASKNKK"
FT   sig_peptide     100500..100565
FT                   /locus_tag="Fjoh_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.942 at
FT                   residue 22"
FT   gene            101030..101569
FT                   /locus_tag="Fjoh_0097"
FT   CDS_pept        101030..101569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0097"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03135"
FT                   /db_xref="InterPro:IPR025348"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNT5"
FT                   /protein_id="ABQ03135.1"
FT                   /translation="MKVNVFTTAILALLTLVSCNSEPSLQKYFVENTDKKDFISVDVSS
FT                   DILNLEKTKLSAEQKEAVNSFDKMNILAFKATDKNQAEFETERKKVTAILKNPKYQELM
FT                   KFGSGKDGASISYVGSDENIKEFVVFANKKENGFAVVRVLGKDMNPNNIITLMSVLKES
FT                   KIDMEQLKPLQQLIKQ"
FT   sig_peptide     101030..101095
FT                   /locus_tag="Fjoh_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.726 at
FT                   residue 22"
FT   gene            101720..102118
FT                   /locus_tag="Fjoh_0098"
FT   CDS_pept        101720..102118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0098"
FT                   /product="YiaAB two helix domain protein"
FT                   /note="PFAM: YiaAB two helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03136"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNT6"
FT                   /protein_id="ABQ03136.1"
FT                   /translation="MIQKTSNAFIAASWVALGAGTIGFIVGLARAEMLLNEKGYYFTVL
FT                   MFGLFAVVSLQKSVRDRLEKLPVTDIYYGICWFGTLLSIVLLVVGLWNATILPSEKGFY
FT                   AFAFLLALFGAISVQKNTRDNMSFGQNE"
FT   sig_peptide     101720..101815
FT                   /locus_tag="Fjoh_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.960 at
FT                   residue 32"
FT   gene            complement(102192..105047)
FT                   /gene="carB"
FT                   /locus_tag="Fjoh_0099"
FT   CDS_pept        complement(102192..105047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="Fjoh_0099"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03137"
FT                   /db_xref="GOA:A5FNT7"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNT7"
FT                   /protein_id="ABQ03137.1"
FT                   /translation="MPKDTSIKSVLIIGSGPIVIGQACEFDYAGSQSARSIREEGIEVI
FT                   LINSNPATIMTDPSMADHIYLKPLTTKSIIEILKEHPQIDAVLPTMGGQTALNLCLEAE
FT                   EKGIWQDFGVRLIGVDVNAINITEDREQFKQLLEKIKVPTAPAKTATSYLEGKEIAQEF
FT                   GFPLVIRPSFTLGGTGAAVVYKKEDFDELLTRGLEASPIHEVLIDKALMGWKEYELELL
FT                   RDKNDNVVIICSIENMDPMGIHTGDSITVAPAMTLSDTTFQKLRDYAILMMRSIGNFAG
FT                   GCNVQFAVSPDEKEDIVAIEINPRVSRSSALASKATGYPIAKIASKLALGYNLDELQNQ
FT                   ITKSTSALFEPTLDYVIVKIPRWNFDKFEGSDRTLGLQMKSVGEVMGIGRSFQEALHKA
FT                   TQSLEIKRNGLGADGKGYKDYELIIDKLTHASWDRVFVIYDAIAMGIPLSTIHEITRID
FT                   MWFLKQYEELYTLEKEISNYKVTDLPKELLLEAKQKGFADRQLAHMMNCLESEVHTLRM
FT                   EQKINRVFKLVDTCAAEFKALTPYYYSTFEAEIEKANGERFVDNESIVTDKKKVIVLGS
FT                   GPNRIGQGIEFDYSCVHGVLAAKECGYETIMINCNPETVSTDFDTADKLYFEPVFWEHI
FT                   YDIIQHEKPEGVIVQLGGQTALKLADKLSKYGVKIIGTSFDALDLAEDRGRFSDLLTEL
FT                   NIPFPRFGIAETADEASKLADTLDFPLLIRPSYVLGGQGMKIVINKKELEEHVIDLLKA
FT                   IPGNKLLLDHYLAGAIEAEADAICDADGNVYIIGIMEHIEPCGVHSGDSNATLPPFNLG
FT                   EFVMQQIKDHTHKIARALKTVGLINIQFAIKDDTVYIIEANPRASRTVPFIAKAYGEPY
FT                   VNYATKVMLGHNKVTDFDFNPQLNGYAIKQPVFSFSKFPNVNKALGPEMKSTGESILFI
FT                   DDLKDDQFYELYSRRKMYLSK"
FT   gene            complement(105192..105353)
FT                   /locus_tag="Fjoh_0100"
FT   CDS_pept        complement(105192..105353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0100"
FT                   /product="LSU ribosomal protein L34P"
FT                   /note="PFAM: ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03138"
FT                   /db_xref="GOA:A5FNT8"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNT8"
FT                   /protein_id="ABQ03138.1"
FT                   /translation="MSKRTFQPSKRKRRNKHGFMDRMASANGRKVLARRRAKGRHKLTV
FT                   SSEPRHKK"
FT   gene            105522..106037
FT                   /locus_tag="Fjoh_0101"
FT   CDS_pept        105522..106037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03139"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNS2"
FT                   /protein_id="ABQ03139.1"
FT                   /translation="MFHKNIKLILAGLLVVAGIWQFTESNIGNGIFLILLTAIPIFLYF
FT                   KNEFILLAFLKLRKQDFEGANKWLSYIKNPEGALVRKQQGYLNYLQGIMLSQTNINQAE
FT                   KHFKKAIELGLSMDMDLAVAKLNLAGVAMSRRRKLEATNLLNEAKKLDKQGMLKEQISM
FT                   MKEQMKKI"
FT   gene            complement(106293..106952)
FT                   /locus_tag="Fjoh_0102"
FT   CDS_pept        complement(106293..106952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0102"
FT                   /product="peptidase, family S33 unassigned peptidases"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03140"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNS3"
FT                   /protein_id="ABQ03140.1"
FT                   /translation="MSKIPVYFMPGLAASPAIFERIQLDESVFEMCLLEWEIPHPKEAL
FT                   SDYALRISKKIKHENPVLVGVSFGGILVQEIAKHIQARKVIIISSVRSNIEFPKRMKIG
FT                   KTTKAYKLIPMKLILNIESLAKYSFGEKVNKRIKLYEKFLAVRDLNYLQWAVESVILWD
FT                   RNKVDENVIHIHGDKDEVFPIKYINSCIVVKGGTHIMILNKYKWLNENLPSIILED"
FT   gene            107241..107552
FT                   /locus_tag="Fjoh_0103"
FT   CDS_pept        107241..107552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03141"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNS4"
FT                   /protein_id="ABQ03141.1"
FT                   /translation="MTNMEPAETMEIKDNTFARQFETVVPEGLLSVEYSFQEKKIFLTK
FT                   INTPENFENQSVIDTLLKNIMELSTEKNFRVVPIHPKIAAFFKKNPKYKELLPPGIRI"
FT   gene            complement(107549..108979)
FT                   /locus_tag="Fjoh_0104"
FT   CDS_pept        complement(107549..108979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0104"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03142"
FT                   /db_xref="GOA:A5FNS5"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNS5"
FT                   /protein_id="ABQ03142.1"
FT                   /translation="MKEVQIPQTLITLAVGIAIWFIPAPNGVVIEAWHLFAIFVATILG
FT                   IILKAAPMGTMCMIAIALTAFTQVLAPGDPGKSITLALKGFGDKVIWLIGISFFIARGF
FT                   IKTGLGNRIAFLFIRIFGKSSLGLAYGLGLADLVLAPAVPSNTARGGGIIYPIMKSMSM
FT                   SFGSVPDQPETHRKLGSYLTLNCYNMNLIASSMFLTGTASNPMCQKFALNLGIKITWMS
FT                   WAAAAIVPGLCAFFVIPFVLYKIYPPELKKTGDAPQIAMQKLKEMGPITRNEWMMLLTF
FT                   FILLFLWMTGDLFSIDATTTAFIGLVILLLTSVLTWDDVKAEKGAWDTIVWFSVLVMMA
FT                   SSLNELGFIGWFSNVVKAEIGGLSWQMAFPIIILVYFFSHYLFASATAHVAAMYAALLG
FT                   VGVSLGIPGLLLAFMLGFMGSIYGTLTHYGHGPAPVFFGSGYVDLKSWWVKGLVTGLVM
FT                   LFIYMGIGGLWLWVINYF"
FT   gene            complement(109003..110151)
FT                   /locus_tag="Fjoh_0105"
FT   CDS_pept        complement(109003..110151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03143"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNS6"
FT                   /protein_id="ABQ03143.1"
FT                   /translation="MNKILLVPIIILFFITPFFLHAQGDVNAGEKTDSEIKYPQYQLKG
FT                   LLQARYLESFGDNVDVLGVHHSTGDVTQQSFDIKRMRVGLNTRLSEATEVVILVNLADF
FT                   KSDTKGKVLENAYGKYTFNKYIALTGGQFRPAFGIEELVPVDIIKSFDFSNQYYEFGKN
FT                   GWTSFQIGASATGSFDIGKIPVSYAVSVLNGNGKNVEMDKDNGKQYSTRWVFELSKEHK
FT                   INLGLNGGIGKVFKEDVFAVGADITSDFKLTDRFTFDLQIEYKQGTNHNLYFSLPAESR
FT                   VGDVSNYQMRGIYFLPNLRYVVNYKKLTALELSCRYETFNPSYKVNSNVRQTYTPMISL
FT                   EFGKNYTGRIEMGFEIDRFDKNIPDTSTYNDELFLIQLQLRL"
FT   sig_peptide     complement(110083..110151)
FT                   /locus_tag="Fjoh_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.986 at
FT                   residue 23"
FT   gene            complement(110380..112014)
FT                   /locus_tag="Fjoh_0106"
FT   CDS_pept        complement(110380..112014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0106"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03144"
FT                   /db_xref="GOA:A5FNS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNS7"
FT                   /protein_id="ABQ03144.1"
FT                   /translation="MITVNDISVQFGGTTLFSDVSFAINENDKIALMGKNGAGKSTLLK
FT                   IIAGVNKPSTGSISAPKEAVIAYLPQHLLTEDGATVMEEASKAFSDIFKMKAEIDEINE
FT                   QLTVRTDYESDEYMKLIERVSDLSEKFYAIEEINYEAEVEKILVGLGFEREDFTRQTSE
FT                   FSGGWRMRIELAKILLQKPDLILLDEPTNHMDIESIQWLEDFLLNQAKAVVVISHDRAF
FT                   VDNITNRTIEVTMGRIYDYKAKYTHYLELRKDRRIHQQKAYDEQQKMIAENRAFIERFK
FT                   GTFSKTDAVQSRVKMLEKLEIVQVDEVDTSALRLKFPPAARSGQYPVVVKEMSKSYGDH
FT                   VVFKDANIVIERGQKVAFVGKNGEGKSTMIKAIMKEIGVDSGSVEIGHNAQIGYFAQNQ
FT                   AALLDENATIFETIDSIAVGDIRTQIKNILGAFMFQGDDITKKVKVLSGGEKTRLAMIK
FT                   LLLEPVNLLILDEPSNHLDMKTKDIIKDALRDFDGTLILVSHDRDFLDGLATKVFEFGN
FT                   KRVKEHFEDVAGFLAHKKMDSMREIEK"
FT   gene            112335..112778
FT                   /locus_tag="Fjoh_0107"
FT   CDS_pept        112335..112778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03145"
FT                   /db_xref="InterPro:IPR021533"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNS8"
FT                   /protein_id="ABQ03145.1"
FT                   /translation="MKTKLKLAVSLIAGLLFGLSANAQKTVIKKEALPANAQTFLKTHF
FT                   GSKKPSYILEDKEILSTEYKVQFDNQIEIEFDKKGNWKEVDGKNSKIPKSIIPKKVASY
FT                   IKENFPKEKVTKIEIESSGYETKLTNGLELKFSLKGDFIKIDK"
FT   sig_peptide     112335..112406
FT                   /locus_tag="Fjoh_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            complement(112910..114085)
FT                   /locus_tag="Fjoh_0108"
FT   CDS_pept        complement(112910..114085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0108"
FT                   /product="Nucleoside-diphosphate-sugar
FT                   pyrophosphorylase/translation initiation factor 2B
FT                   gamma/epsilon subunits-like protein"
FT                   /note="involved in lipopolysaccharide biosynthesis;
FT                   eIF-2Bgamma/eIF-2Bepsilon subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03146"
FT                   /db_xref="GOA:A5FNS9"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR023917"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNS9"
FT                   /protein_id="ABQ03146.1"
FT                   /translation="MNYILFDGPVRNALLPFTFTRPVADILIGIMTIRQKWEARLGSTI
FT                   TTITEDYLSAKFPMVEMEENVMINAAYLPNDALAELVSDLKENQAIFKGDDVIAFFTTE
FT                   NQEEVDFDTYEIIQYNEECLTVEHTWDIFSKNDAAIRADFAFLTEDRKSQPIPKSVNVI
FT                   APENVFIEEGAKLEFVTLNASNGPIYIGKNTEIMEGTVIRGPFALCENAMVKMSAKVYG
FT                   ATTVGPGSRIGGEVKNSVLFANSNKGHEGFLGDSVLGEWCNIGADSNNSNLKNNYEEVK
FT                   LWSYETEGFAKTGLQFCGLMMGDHSKCGINTMFNTGTVVGVSANIFGSGFPRNFVPSFS
FT                   WGGAAGFTTYVTKKAFETARLVMSRRNIDFDETEAAILEHIFEETKKWRKD"
FT   gene            complement(114421..114675)
FT                   /gene="rpmE2"
FT                   /locus_tag="Fjoh_0109"
FT   CDS_pept        complement(114421..114675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE2"
FT                   /locus_tag="Fjoh_0109"
FT                   /product="50S ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03147"
FT                   /db_xref="GOA:A5FNT0"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNT0"
FT                   /protein_id="ABQ03147.1"
FT                   /translation="MKKGIHPENYRLVAFKDMSNDDVFITKSTADTKETIEVDGVEYPV
FT                   VKMEISRTSHPFYTGKSKLIDTAGRIDKFKTKYAKHAKK"
FT   gene            114926..115456
FT                   /locus_tag="Fjoh_0110"
FT   CDS_pept        114926..115456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03148"
FT                   /db_xref="InterPro:IPR025250"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNR3"
FT                   /protein_id="ABQ03148.1"
FT                   /translation="MINEVIKKNGIAYGVMIGIASALVTATIYAIDLNLFTAWWMGLIG
FT                   IAISITISIILLSKTKKELNGVFPFKDAFTTYFIAAVIGILISTSFNIILFNVIDPGAK
FT                   DTLSDIMVKYTANMMQKFGAPASSINEAIAKMKLTNPYSTLELLKGSVFAMVISAIFGL
FT                   IFAAFFKSKTTQE"
FT   gene            115466..116422
FT                   /locus_tag="Fjoh_0111"
FT   CDS_pept        115466..116422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0111"
FT                   /product="Candidate beta-glycosyltransferase;
FT                   Glycosyltransferase family 2 protein"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03149"
FT                   /db_xref="GOA:A5FNR4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNR4"
FT                   /protein_id="ABQ03149.1"
FT                   /translation="MNLSILIPLLNEEESLKELYSWIIKVMQSNNYSYEIIFVDDGSTD
FT                   DSWNIIEGFSNENPNVKGIRFMKNFGKSQALHAGFAKAKGDVIITMDADLQDSPDEIPE
FT                   LYEMITQQKFDLVSGWKKKRYDSVVAKNLPSKLFNWAARKTSGVELNDFNCGLKAYKNV
FT                   VVKNIEVSGEMHRYIPVLAKNAGFGKIGEKVVIHQARKYGETKFGMERFINGFLDLITI
FT                   WFLSRFGKRPMHLFGAIGSIMFIIGFLSAGYIGVSKLYHMYNGMKYSLVTNNPWFFIAL
FT                   TTMILGTQLFLAGFLGEIILRTKNNEERYKVSREVNF"
FT   gene            116535..118262
FT                   /locus_tag="Fjoh_0112"
FT   CDS_pept        116535..118262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0112"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03150"
FT                   /db_xref="GOA:A5FNR5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNR5"
FT                   /protein_id="ABQ03150.1"
FT                   /translation="MNIAPNILNAVNEWLTPTFDQETQAAVKELMTTSPKDLEESFYKN
FT                   LEFGTGGMRGVMGVGNNRINKYTLGKNTQGLSDYLHQVFPNEPLKVVIAYDCRHNSNTL
FT                   AKVVADVFSANGIQVYLFSDLRPTPELSFALKYLGCQCGIVLTASHNPPEYNGYKVYWQ
FT                   DGGQIVPPQDKEIVNVIESLGYDKIKFNANESLIQYIDTELDKAFIKSSIENASFNTPA
FT                   EAKDNLHIVFTSLHGTSIKSIPDVLSQAGYKNVHIVPEQAVPDGDFPTVKSPNPEEPEA
FT                   LTMALALADKTNSDIVVGTDPDCDRLGVAVRNNDGKMILLNGNQTMVLMTSFLLKQWKK
FT                   AGKINGKQFVGSTIVSTPMMMELATSYGVECKVGLTGFKWIAKMIKDFPELEFIGGGEE
FT                   SFGFMVGDAVRDKDAVAATLLICEVAAQAKAAGSSVYKELLQLYVENGFYKEFLVSLTK
FT                   KGMEGLEEINQMMVNLRQNPLKEINGQRVIMVEDYQSSTALNLLTNEESSMDIPKSNVL
FT                   IYYTEDGSKICARPSGTEPKIKFYISVNAELESVLDFDDAEKFLDEKIQNIIADMQLN"
FT   gene            complement(118381..118728)
FT                   /locus_tag="Fjoh_0113"
FT   CDS_pept        complement(118381..118728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0113"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03151"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNR6"
FT                   /protein_id="ABQ03151.1"
FT                   /translation="MYSIDDKQYPCSTSLTMKYIGGKWKAVILIHLIQKKRYSELRKEC
FT                   KVITERTLSLQLKEMEEDGLVTRTVYTSKPPLRVEYELTEFGKTLIPLLNSIAEWGMET
FT                   AKNNKRIQAVE"
FT   gene            118823..119428
FT                   /locus_tag="Fjoh_0114"
FT   CDS_pept        118823..119428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0114"
FT                   /product="dihydropteridine reductase"
FT                   /EC_number="1.5.1.34"
FT                   /note="PFAM: nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03152"
FT                   /db_xref="GOA:A5FNR7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNR7"
FT                   /protein_id="ABQ03152.1"
FT                   /translation="MSFLDLAKVRYSTKKYDNTKQISNEQIEELKQILRLSPSSINSQP
FT                   WKFTFITNQTLKKELASQSYVNEQSINDVNLLVVFSVMENIEHFENRNLSVLPEAWIKG
FT                   FYEPLIKSNGDEAVKSWLENQVYISLGFFLSACISMGLDATPMEGIDRTAYKNILKQDG
FT                   YSPLFAVTVGYADAANDWAHPAVLPKSRFEMKEIIESF"
FT   gene            119723..121552
FT                   /locus_tag="Fjoh_0115"
FT   CDS_pept        119723..121552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0115"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03153"
FT                   /db_xref="GOA:A5FNR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNR8"
FT                   /protein_id="ABQ03153.1"
FT                   /translation="MSNFKKIVPFIYPYKKYAFLNIFFNVLYALFSTLSFVALIPMLQV
FT                   LFDQTKERKVKPVYEGILKLQQYGEDYLSYYITTTKGTHDPGYILSIMVAIIISIFLLK
FT                   NLADYLAMFFITFLRNGVLKDMRNALYKRTLELPLAFYSEKRKGDVISRISADVNEVQN
FT                   SFLAILELIVKEPLTIIFTITTMLIISTKLTIFVFIFIPISGYIISLIGKQLKKQSTKA
FT                   QEEQGTFLSTIEETVGGLKVVKGYNAEGYFNTVFQNSTERFFSLSNKIGNRQNLASPAS
FT                   EFMGITVIAILLWYGGQMVLIDKTLSGPSFIAYMGLAYNILTPAKAISKASYGVKRGNA
FT                   AAERVLEILEQENTITSKENAIEKTSFDSIIDVQHVNFKYEEETVLKDFSLQIKKGQTV
FT                   ALVGQSGSGKSTIANLLTRFYDVNEGSISIDGINIKDMNLQSLRSLMGLVTQDSILFND
FT                   TIKANISLGKLDATDDEIIEALKIANAYEFVKELPLGIYTNIGDSGNKLSGGQKQRLSI
FT                   ARAVLKNPPIMILDEATSALDTESEKFVQVALENMMQNRTSIVIAHRLSTIQKADVIVV
FT                   MQKGKIVEQGTHEELIAHNGTYNKLVTMQSLES"
FT   gene            121684..122385
FT                   /locus_tag="Fjoh_0116"
FT   CDS_pept        121684..122385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03154"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNR9"
FT                   /protein_id="ABQ03154.1"
FT                   /translation="MYLNNPNIKLPDDPDTIVWKYLDLSKFLDLLLSKKLFMSRSDKFE
FT                   DQYEGTFSEPTYEEIKKLAVDNPEFLNYYKIHREKVAISSWHINEYESFAMWQIFTKNN
FT                   EGLAIQSTIGRLQKAVRPENNFDQYIGEVNYIDYKKEYIPFDDLFFPFLFKRKSFQYER
FT                   EVRILTDTSKSEIKLNDGLKINVDINQLIEKIYIHPKSENWYKKLVIELVERLDFGFEI
FT                   EKSDLESDILI"
FT   gene            complement(122577..123296)
FT                   /locus_tag="Fjoh_0117"
FT   CDS_pept        complement(122577..123296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0117"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03155"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNS0"
FT                   /protein_id="ABQ03155.1"
FT                   /translation="MKKYSKYIALAIIGTLISCREEVQKPKVSYDVSNKVSVTKADTTQ
FT                   IEIADLPIQMEGTDYLIHPVGDLRVFERGSKARFGSSSVNDVSFTISNLGEYEITGYLQ
FT                   NLKFQKVDSDSIHALSDKPILILTATYLKTVADKTQNKVMVYTLTDSDTNKDGKIDTSD
FT                   IKTLYLSNISGENFTKVSADLEELVDWNLIESKNRLYFRTIEDTNQNGQFDKNDVLHYN
FT                   YIDLASKKWEVKSYKPI"
FT   gene            complement(123381..125846)
FT                   /locus_tag="Fjoh_0118"
FT   CDS_pept        complement(123381..125846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0118"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="PFAM: TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03156"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNS1"
FT                   /protein_id="ABQ03156.1"
FT                   /translation="MNKNKLIFALLFLCFTCISFAQNAHVKGIILDNENHPVSNVNITS
FT                   GKNNTQSDVNGFFDIEVISNKKASIIFTHISLKMISLTVSLKPNEVFVFNPVMNNSQEQ
FT                   MGEVFVSSKNRKRVQGITTVETATIKKIPGANAGIENILKTLPGVNSNNELSTQYAVRG
FT                   GNYDENLVYVNEVEVYRPFLIRSGQQEGLSFTNTDLVQNVDFSAGGFQAKFGDKLSSVL
FT                   DITYRKPTQFGASLEASFLGGSASVDLVSKNKKWSAVTGVRYRNNSLLVNSQDTQTNYT
FT                   PTFADIQTNINYDISEKWQMSFLGNISQNKYLYQPLTRETKFGTIDQPMALAVYYEGQE
FT                   KDQYDTYFGALKTTYKVSPSLTLKLIGSLFHTTEQEHFDILAQYRLGNIDPENPNNASS
FT                   IDFTRGIGSQLNHARNDLDALIANVELKGTKEWQESQLEFGLKYTRESIRDRIVEWEMI
FT                   DSAGFSINPPLVILPENNQPYTPYTGPLLSYQDIRATNFNTINRFSGYAQWNKQSQLGS
FT                   NQIWYHLGARFQSWKVSGALEEGKNQVVVSPRAQFAIKPDWDMDMVFRISGGLYHQPPF
FT                   YRELRDLDGVVNPNVKAQEAVHVVLSNDYNFKMWNRPFKWVTEVYYKSLSDVNVYSIDN
FT                   VRIRYVANNNAKAYAQGLDFRLNGEFVPGTESWVSFGYLKTEENYENKGYIARPTDQRL
FT                   KFAMLFQDYMPNIPSVKLYLNLVYNTGLPGGAPAYSDPYLYQNRLNDYRRADIGFAKVF
FT                   VDASTQSSKTSWLKNFKELSLGVEIFNLFNNQNAITNTWVRDVYSKNQYAIPNYMTSRV
FT                   FNIKLNARL"
FT   sig_peptide     complement(125781..125846)
FT                   /locus_tag="Fjoh_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.629 at
FT                   residue 22"
FT   gene            complement(125858..127546)
FT                   /locus_tag="Fjoh_0119"
FT   CDS_pept        complement(125858..127546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0119"
FT                   /product="zoocin A; peptidase family M23"
FT                   /note="PFAM: peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03157"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNQ4"
FT                   /protein_id="ABQ03157.1"
FT                   /translation="MLLMRFSVLTLLICNFIFAQTQYPKDYFRPPLDIPMQLSGNFGEL
FT                   RPNHFHAGFDLKTNQREGLNVYAVADGYVSRIKISTFGNGKCIYVTHPNGYTSVYGHLQ
FT                   TPVGPILDYVKKTHYKEKAYEIEMFPKPNELPVTKGQLIGLSGNTGSSEGPHLHFEIRD
FT                   SKTEFVINPIFFGFDKNIKDTKKPTLSSLYVYPLDNATVNQSKQPLLVNMTLQKDGTYL
FT                   AGKVKTNGKIGFGINAVDTDDVSFNKNGVFNVSTFLNGNQNYNYQFNTYSFDEMRYINA
FT                   FIDYPRYKKTSQRVQKLFMKTPFALSIIKTDSLRGIVSAEPNLASSYKIEVSDYFGNQN
FT                   SITVPIEYDTATPLVQAEPSTSKYFVKYNRDTNFEKGNMSVFFPAGTFYEDFNMNFDVR
FT                   NNKVYIHDDTVPVHSNFTITIKDTLYPESLRDKLYIGKGTSYTGTIRKGDVFTAKAKIL
FT                   GTYGLVLDTIPPVIKITKPVEGKWISDQKKIEFTIGDSLSGIKSYNGYLNGSWVLFEYE
FT                   NKNRKITHTFDDQYLTEGENFLKIEVVDNVGNSTIFETHFFRSQK"
FT   sig_peptide     complement(127487..127546)
FT                   /locus_tag="Fjoh_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.957 at
FT                   residue 20"
FT   gene            127718..128008
FT                   /locus_tag="Fjoh_0120"
FT   CDS_pept        127718..128008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03158"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNQ5"
FT                   /protein_id="ABQ03158.1"
FT                   /translation="MSVLAEIIDTLEYKVEKLFEKSKGLEKNNQELRLELAKAAQIIQK
FT                   QSEEMEALKKQYETLKIANSLLGSDNNKRETKLKINSLIREIDYCIAQLSD"
FT   gene            128013..128306
FT                   /locus_tag="Fjoh_0121"
FT   CDS_pept        128013..128306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03159"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNQ6"
FT                   /protein_id="ABQ03159.1"
FT                   /translation="MDGKLRIKISIADRVYPLTVEPAQEEGLRSASKKIDAMIKQFEES
FT                   YAVRDKQDVLAMCALQFASQVEQKQIDNAIDGEETIERIKRLNSLLDQYLEN"
FT   gene            128515..130074
FT                   /locus_tag="Fjoh_0122"
FT   CDS_pept        128515..130074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0122"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM: KH,
FT                   type 1, domain protein; metal-dependent phosphohydrolase,
FT                   HD sub domain; HDOD; SMART: metal-dependent
FT                   phosphohydrolase, HD region; KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03160"
FT                   /db_xref="GOA:A5FNQ7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNQ7"
FT                   /protein_id="ABQ03160.1"
FT                   /translation="MDIITIIIGIVGIAAGFAIAKIIEKSNISNLIKNAKKEAASILKD
FT                   ANLEAENIKKDKILQAKERFIELKSEHEQVILARDKKVAEVEKRVRDKESQVSNELSKA
FT                   KKVNDEFEAKTAEYNNKIEVLDKKQAEVDKLHKSQLQQLEVISGLSAEEAKEQLVEGLK
FT                   AEAKTKAMSHIQETIEEAKLTAQQEAKKIIINTIQRVGTEEAVENCVSVFNIESDDVKG
FT                   RIIGREGRNIRALEAATGVEIIVDDTPEAIILSCFDPVRREIARLSLHKLVTDGRIHPA
FT                   RIEEVVAKTAKQIDDEIIEVGKRTVIDLGIHGLHPELIKVVGRMKYRSSYGQNLLQHSR
FT                   EVSKLCGIMAAELGLNVKLAKRAGLLHDIGKVPDTESDLPHALLGMQWAEKYGEKDEVC
FT                   NAIGAHHDEIEMKSLLSPIVQVCDAISGARPGARRQVLDSYIQRLKDLEDVAYGFSGVK
FT                   NAYAIQAGRELRVIVESEKVSDDNAANLSFEISQKIQTEMTYPGQVKVTVIRETRAVNI
FT                   AK"
FT   sig_peptide     128515..128577
FT                   /locus_tag="Fjoh_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.662) with cleavage site probability 0.661 at
FT                   residue 21"
FT   gene            complement(130142..131662)
FT                   /locus_tag="Fjoh_0123"
FT   CDS_pept        complement(130142..131662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0123"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein; PAS fold-3 domain protein;
FT                   SMART: PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03161"
FT                   /db_xref="GOA:A5FNQ8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNQ8"
FT                   /protein_id="ABQ03161.1"
FT                   /translation="MVFDLYSNEDCLEINNFYRKLFAEMPDLIFQFIIDSDNNYTFPLV
FT                   SKSADEIFELSVNEFTDDIKLTIYERILGQDRELFFQSLVKARKEIEPWQIEFRAVLPK
FT                   KGLRWFKVSAKTELSPDNRVSFFGHISDITELKDKEEKLRISEERFQFALEASTAGIWD
FT                   WDMVTNNVFYSSLSLKILELESTDIFDDPERWDKIVHPDDLPKYYSDIREHFDNKIPYY
FT                   ENYHRVMTSSGNYKWILDRGKVIKRDQNGKPLRVIGTHTDVSAQKEKELELLKTMKLYS
FT                   DQNSRLLNFSHIVSHNLNTQAGNIKSILDFIDADGDKETVTEMLEHLRTVSNDLNETIS
FT                   NLTQIVKTQSNINIAVEPLKLHEYIEKTISTIKGYDNQKKVTIVNNVPQYLTINFNPAY
FT                   LESVLLNFTTNAIKYAHPDREPVIVFDFGIEPEGYKSLKITDNGLGIDLKVYGDLLFGM
FT                   YKTFHKHQEARGIGLYITRNQIEAMKGTVSVESEVGVGTSFKIVFNDL"
FT   gene            complement(131805..132701)
FT                   /locus_tag="Fjoh_0124"
FT   CDS_pept        complement(131805..132701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0124"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03162"
FT                   /db_xref="GOA:A5FNQ9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNQ9"
FT                   /protein_id="ABQ03162.1"
FT                   /translation="MKWNNYIKDYQSYLRIERGLSKNTIENYSFDIERLCLFLETNQIE
FT                   VSPLKITDETIQQFIYAISKEVNPRSQARIISGLKSFFSYLVFEDYRNDSPLELIESPK
FT                   TGRKLPDTLAVKEIDALIDAIDLSSNEGERNRAILESLYGCGLRVSELVSLKISDLYFD
FT                   EGFIKITGKGNKERFVPIGKLTQKYIQIYQNEVRVHLNIKKGCEDTLFLNRRGNQLTRA
FT                   MIFTIIKDLAVKINLNKSISPHTLRHSFATHLLENGADLRSIQLMLGHESITTTEIYVH
FT                   LDRSFLKEVMHSYHPRR"
FT   gene            complement(132781..133365)
FT                   /locus_tag="Fjoh_0125"
FT   CDS_pept        complement(132781..133365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03163"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNR0"
FT                   /protein_id="ABQ03163.1"
FT                   /translation="MKKIILAAIAVMTFSFANAQQTRFGVKGGLNLSNWAGGDVSDTKA
FT                   LVGFHVGGFAEIKIIEKLAIQPELLFSTQGTKFDGGAFLGDFDVKTNYLNIPVLAKYYI
FT                   VEKFSVEAGPQLGILLSAKSNGEDVKDGFKTVDFGFNLGAGYHFTDNVSVNLRYTIGLS
FT                   PLADNADIENEGDYYDSAKNSVLALSFAYKF"
FT   sig_peptide     complement(133306..133365)
FT                   /locus_tag="Fjoh_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 20"
FT   gene            complement(133569..134129)
FT                   /locus_tag="Fjoh_0126"
FT   CDS_pept        complement(133569..134129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03164"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNR1"
FT                   /protein_id="ABQ03164.1"
FT                   /translation="MKKVILTAIAVLGFAFANAQTGGFAKGDAFISGALSVNSTKEGDA
FT                   KTSGFIIEPKVGYFVSENIAVGAKLGFGSTKVGDIKTNDFTVGAFGRYYFTPASQFSVY
FT                   GQAGVDFTNSKVKPGDFKSNEVGANLGLGLSYFLSNHFAIEATWLGLGYNVNNNGGHGA
FT                   DKTNSFNFGTDLRDVAFGVVYKF"
FT   sig_peptide     complement(134070..134129)
FT                   /locus_tag="Fjoh_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 20"
FT   gene            134411..134971
FT                   /locus_tag="Fjoh_0127"
FT   CDS_pept        134411..134971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03165"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNR2"
FT                   /protein_id="ABQ03165.1"
FT                   /translation="MKKILLAAVLFIATTTAIQAQFIQIGVKAGVNFANQTGGSDFNGI
FT                   SVDKEGITSYHAGLVAELKLLEKFSIQPELLYTTQGAEYKSAVQDFKNEMGYIAIPVMA
FT                   KIYMTKSLSLELGPQASFLVSNKKEFDAADPKTFDFSLNAGLGLKVVGGLFVQARYGIG
FT                   LTEVSKDADFKNSVFQLSAGYMF"
FT   sig_peptide     134411..134473
FT                   /locus_tag="Fjoh_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.654 at
FT                   residue 21"
FT   gene            135098..135511
FT                   /locus_tag="Fjoh_0128"
FT   CDS_pept        135098..135511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0128"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03166"
FT                   /db_xref="GOA:A5FNP5"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNP5"
FT                   /protein_id="ABQ03166.1"
FT                   /translation="MKICIINGPNLNLLGKREPEVYGSQTFEDYFETLKQKFPNVELSY
FT                   YQSNIEGELIGKIQEVGFSFDGIILNAGAYTHTSIGLGDAMKAVTTPVIEVHISNTYAR
FT                   ESFRHQSYLSGNAKGVILGFGLKSYELAIQSFL"
FT   gene            135669..138158
FT                   /locus_tag="Fjoh_0129"
FT   CDS_pept        135669..138158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03167"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNP6"
FT                   /protein_id="ABQ03167.1"
FT                   /translation="MKNITILAFLIFSISNFAQIKGTVTDEKGNPLPFVSIFEEGTYRG
FT                   TTSNEQGQYQLQVKEIGKNKIVFQYLGFKTQKLTVSSDSKILTLDVKMQEESFALNEVV
FT                   IDPKNNPANAIIKNAIANRKENSEKTARFTADFYSKGILKVKDLPKKILGQKVDLGPDL
FT                   SSNLDSTGTGILYLSETISKISYQKPDKLKETIIASKISGNNKGFSYNTAALSTYDFYD
FT                   NTLEFDINLISPIANNAFSYYKYKLEGSFYDDNKNQIYKIKVIPKRDKEPVFEGYIYIV
FT                   DDSFAIYAVDVDIKGYRVKNEFTESMTLKQSFSYNSKNKIWSKNAQTLSFNAGGFGVKF
FT                   SGQFNYVYSNYEFPDSFAKKTFGNEIVAFDLNANKKDDSYWNEIRPIPLTLEESTDYTK
FT                   KDSLQTIRKSKKYTDSIDAKNNKFKVLNILGAYDYKNTFKKYSFAFDGLLSPTSLSFNT
FT                   VQGFNLGTGFSFKKWNEETGKSTSISTDFNYGFSDERLRVTGQFTHRFNAINYATISAY
FT                   GGTKTAQFNSAEPISKLVNSVSSLFFKDNYMKLYNLEFAQVNYTQDIANGINLNAKLAY
FT                   EQRKPLFNTTDYSFFKRDDIYSSNNPLAPDDFSTPAFSQHHLMKANLNFRFNFGNKYIS
FT                   RPDGRYNFKDEKYPTVYLAFEKAFAASEKNYEFERIGTAVQYDLKLNNKGILGMNFKAG
FT                   KFFNAENISFIDYRHFNGNQTHIGTSDRYLNVFNLMPYYANSTNDSYFEMHLEHNDMGF
FT                   IMNKIPLLNLLKATMNLGFHSLAIPDRKPYTEFTVGLDNLGFGKFKLFRVDYVHSYQGG
FT                   MQQNGVVFGLKILNVLN"
FT   sig_peptide     135669..135725
FT                   /locus_tag="Fjoh_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.859) with cleavage site probability 0.773 at
FT                   residue 19"
FT   gene            complement(138330..139208)
FT                   /locus_tag="Fjoh_0130"
FT   CDS_pept        complement(138330..139208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0130"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03168"
FT                   /db_xref="GOA:A5FNP7"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNP7"
FT                   /protein_id="ABQ03168.1"
FT                   /translation="MTNEQKAVKATIFSIIGNTCLALIKGLAGFFGNSYALIADAIEST
FT                   TDIFSSFLVLFGIKYSNKPADENHPYGHGRAEPLITFLVVGFLITSATIIGYESIANIS
FT                   TSHDLPKSWTLYVLGAIIIWKEYSFRVVMKRSKQTNSSSLAADAWHHRSDAITSVAAFV
FT                   GISIALFMGKGYESADDWAALFAAFFILYNSYKIFRPALGEIMDENLNDDLVEEIRVVS
FT                   LKVPGILGTEKCFIRKAGMRYHVDLHAIVSAKISVKEGHDLSHKLQDTLKEQIPQLGNV
FT                   LIHIEPDDYHC"
FT   gene            complement(139275..140588)
FT                   /locus_tag="Fjoh_0131"
FT   CDS_pept        complement(139275..140588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0131"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03169"
FT                   /db_xref="GOA:A5FNP8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNP8"
FT                   /protein_id="ABQ03169.1"
FT                   /translation="MGIFKIEGGTPLKGEITPQGAKNEALQILCAVLLTGEKVKINNIP
FT                   DIIDINKLITLLGNLGVKIQRNEPGSITFQADEVNVGYLETEAFKKEGGALRGSIMIVG
FT                   PLLARFGKGYIPKPGGDKIGRRRLDTHFEGFINLGAKFRYNREDHFYGVESPKEGLKGT
FT                   DMLLDEASVTGTANIVMAAVLANGTTTVYNAACEPYLQQLCKMLNSMGAKITGVGSNLL
FT                   TIEGVESLGGCEHTILPDMIEIGSWIGLAAMTKSEITIKNVSWENLGLIPNTFRKLGIT
FT                   IEKRNDDIYIPAHKDGYEVKTDIDGSILTIADAPWPGFTPDLLSIVLVVATQAKGDVLI
FT                   HQKMFESRLFFVDKLIDMGAKIMLCDPHRAVVMGHNFESQLKATTMSSPDIRAGISLLI
FT                   AALSAKGTSTIQNIEQIDRGYERIDERLRAIGAKIVRA"
FT   gene            complement(140772..141488)
FT                   /locus_tag="Fjoh_0132"
FT   CDS_pept        complement(140772..141488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03170"
FT                   /db_xref="InterPro:IPR025632"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNP9"
FT                   /protein_id="ABQ03170.1"
FT                   /translation="MIEKYKKEVANDVVFNLEYNSERQRLIIPEYGRHLQKLIDQATAI
FT                   EDDETRNKAAKYIIQVMGSLNPHLRDVPDFQHKLWDQLFIMSDFKLNVESPYPIPSRDV
FT                   LQLKPETLQYPQNFPKYRFYGNNIKYMIDVANKWEEGEMKNALVMVIANHMKKSFLSWN
FT                   KDTVKDDVIFEHLYELSGGKINLLHSTEELLNTTDLMRTNKRVSNKTAVGGQAKIQNNK
FT                   NNKGGQKKTFQKNNQK"
FT   gene            complement(141492..141788)
FT                   /locus_tag="Fjoh_0133"
FT   CDS_pept        complement(141492..141788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03171"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNQ0"
FT                   /protein_id="ABQ03171.1"
FT                   /translation="MENDNEKNTAEFYERLKVELDNANTWPAEYLYKFIVPSVADNVER
FT                   VEKAFDRMGAVIKTTKSKTGKFTSVSIDVTMHSSDEVIAKYKEVSTIEGIVSL"
FT   gene            142189..143100
FT                   /locus_tag="Fjoh_0134"
FT   CDS_pept        142189..143100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0134"
FT                   /product="Esterase/lipase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03172"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNQ1"
FT                   /protein_id="ABQ03172.1"
FT                   /translation="MKKILLLFIALIINNIQAQEVKTLTYFQNDTLKLDLDLYLPKKKA
FT                   GEKIPLIMFAFGGGFSGGERTSEKEFGKFMAQNGYAVASISYSLYMKGKDFGCKGTLTE
FT                   KIKAIQIGVSDMWQATSYLIENADKFNLDTSKIFISGISAGAEIGFHASFWDYKLMNLY
FT                   KSNLPENFKYIGFIGGSGAIQDINLITKEKAIPMLLAHGNNDDTVPYAAGSHRSCPTNA
FT                   SGWLILFGSYAVYNHMQDLHKDIELITFCGGGHEFSGYLFHEGQQYVLDFVNDVLKGKK
FT                   FQSHLIMPSKKGKGSEKYLFCE"
FT   sig_peptide     142189..142245
FT                   /locus_tag="Fjoh_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.993 at
FT                   residue 19"
FT   gene            143250..143504
FT                   /locus_tag="Fjoh_0135"
FT   CDS_pept        143250..143504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03173"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNQ2"
FT                   /protein_id="ABQ03173.1"
FT                   /translation="MELYIYNVYFSINMSSHWDFLFFKIKFLKRTPKIKHCLSSSPDGS
FT                   GNPFAFSFKKQKIAAYSRNQFLLKMQNLSLLINILFNYE"
FT   gene            143517..144071
FT                   /locus_tag="Fjoh_0136"
FT   CDS_pept        143517..144071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0136"
FT                   /product="ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03174"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNQ3"
FT                   /protein_id="ABQ03174.1"
FT                   /translation="MRFIFRIVQKEIIVLLGGPGTGKSTLINELVARGYCCYPEISREV
FT                   TLEAQKRGIEQLFLEQPLLFSEMLLEGRIQQFKNAKEEPDNVVFIDRGIPDVVAYMDYI
FT                   GDEYPEHFIKACEDYKYSKTFILPPWEEIYQSDTERYENFEQALEIQKHLIETYKKYGY
FT                   DLIEVPKDTVENRILYILDKI"
FT   gene            144138..146033
FT                   /locus_tag="Fjoh_0137"
FT   CDS_pept        144138..146033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0137"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   PFAM: helicase domain protein; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03175"
FT                   /db_xref="GOA:A5FNN6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNN6"
FT                   /protein_id="ABQ03175.1"
FT                   /translation="MLDAQEILLKYWKHSSFRPLQKEIIDSVLEGQDTFALLPTGGGKS
FT                   ICFQVPAMMREGICLVISPLIALMKDQVANLQKRDIKAIALTGGIHTEEIIDLLDNCQF
FT                   GNYKFLYLSPERLQSDWILERIKNLPINLIAIDEAHCVSQWGHDFRPAYLKISELKKYF
FT                   PKIPFLALTATATPRVVEDIKTELGLKDTKLFQQSFERKNIAYMVFEVEDKLYRVEQIL
FT                   KKNPQPSIIYVRNRKSCLNMSTQLQSLGFRATYYHGGLSAQEKDKNMQLWMSEQAQVIV
FT                   ATNAFGMGIDKDNVKTVIHTQLPENLENYYQESGRAGRNGEKAFSVLLFNNSDATQTEQ
FT                   QFINVLPDKKFLKTIFIKLCNYFQIAYGEGLDDSYSFKMNHFCNKYDFPTLKTYNALQF
FT                   LNQQGIITMSQEFSEKVTMQFLIESKEVIRYMSLNPNDEEIILAILRTYPGIHEMKTPL
FT                   NLSLIAKKSNHSEEQVTALLEKLKEKEIIEYKSKNNDATILFNEVREDDLTINRVSKYL
FT                   EKQNKLKRDQLSSVLYYIKEDKTCKNRLVLDYFGEETKVNCGVCSYCITQKGKITEADS
FT                   IADKILHLLKATALTSREIQNQIKLDAKDVLLVLQELLENNHIVILANNKYTLKS"
FT   gene            146033..146980
FT                   /gene="fmt"
FT                   /locus_tag="Fjoh_0138"
FT   CDS_pept        146033..146980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="Fjoh_0138"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03176"
FT                   /db_xref="GOA:A5FNN7"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNN7"
FT                   /protein_id="ABQ03176.1"
FT                   /translation="MEKLRIIFMGTPEFAVGILDTIIKNNYDVVGVITAADKPAGRGQK
FT                   IKYSAVKEYALANNLTLLQPTNLKDESFLAELKALNANLQIVVAFRMLPKVVWEMPNLG
FT                   TFNLHASLLPNYRGAAPINWAIINGETKTGVTTFFIDDKIDTGAMILNSEIAIEPAENA
FT                   GQLHDRLMNLGSTTVIDTLKVIENGNVITTIQEDNNDIKTAYKLNKENCKIDWTKSGDE
FT                   INNLIRGLSPYPAAWCFLKDKNEELSIKIYEAKLLEEAHSYEAGKLISGKKEIKIAIKN
FT                   GFIQLLSLQLPGKKRMQVAELLNGITFSDEAKVY"
FT   gene            147161..147433
FT                   /locus_tag="Fjoh_0139"
FT   CDS_pept        147161..147433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0139"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03177"
FT                   /db_xref="GOA:A5FNN8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNN8"
FT                   /protein_id="ABQ03177.1"
FT                   /translation="MNKSELIDAIAADAGITKAAAKLALESFLGNVGTTLKKGGRISLV
FT                   GFGSWSVSARAARDGRNPQTGKTIKIAAKNVVKFKAGAELEGAVN"
FT   gene            147494..148123
FT                   /locus_tag="Fjoh_0140"
FT   CDS_pept        147494..148123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0140"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03178"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNN9"
FT                   /protein_id="ABQ03178.1"
FT                   /translation="MRFNDFFCDFNFFMIKFNKNCSRMISEKLKKGHLLIAEPSIIGDL
FT                   SFNRSVILLADHNKEGSIGFIINKPLKYTINDLIPEIDANFKIYNGGPVEQDNLYFIHN
FT                   IPDLIPNSVEISNGIYWGGDFESTKDLINDGSINKNNIRFFLGYTGWDENQLENEMQGN
FT                   SWIIADNNYKNKIIGKSTTHFWKEQIIELGGDYLIWSNAPENPYLN"
FT   gene            complement(148120..148956)
FT                   /locus_tag="Fjoh_0141"
FT   CDS_pept        complement(148120..148956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0141"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03179"
FT                   /db_xref="GOA:A5FNP0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNP0"
FT                   /protein_id="ABQ03179.1"
FT                   /translation="MINFNGNIVEEENLLTQNRAFLFGDGVFETVKIINNKILFLEDHY
FT                   FRLMASMRVVRMEIPMNFTMEHFEEQILNLVQQKGISASARARITVFRNDGGLYLPKTN
FT                   EISYLIHASQLESTVYALNTGQYEVDLYKDFYVTKQLLSSIKTTNKMINVTGSIFAYEN
FT                   GLANCLLINDAKNVVEGLQGNLFMLAGKKLITPPISEGCLNGIMRKQILALAKKVEGIE
FT                   VVEEIISPFDLQKADELFLTNVIMGIQPITKYRKKEFTSNLAHLLVQKLNESITEN"
FT   gene            complement(149011..149403)
FT                   /locus_tag="Fjoh_0142"
FT   CDS_pept        complement(149011..149403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03180"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNP1"
FT                   /protein_id="ABQ03180.1"
FT                   /translation="MDPKIRYEIEFPINSSPQLLYQYISTPSGLSEWFADNVNSRGEFF
FT                   TFIWNDSQEKARLASKKSGEKVKFKWVDESSKDTEYFFELHILVDELTKDVSLMVVDFA
FT                   EKEEIGEAKQLWENQISDLKHLIGSV"
FT   gene            149554..149630
FT                   /locus_tag="Fjoh_R0010"
FT                   /note="tRNA-Met1"
FT   tRNA            149554..149630
FT                   /locus_tag="Fjoh_R0010"
FT                   /product="tRNA-Met"
FT   gene            149766..150023
FT                   /locus_tag="Fjoh_0143"
FT   CDS_pept        149766..150023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNP2"
FT                   /protein_id="ABQ03181.1"
FT                   /translation="MDIVKFKITSKTIKVEVRNSNNYVFNFNTALDIAKEDKDVLLKLY
FT                   NALDLLFKKEAPAETKNYISPNQTNILDQISDIDNLKDGE"
FT   gene            150227..150595
FT                   /locus_tag="Fjoh_0144"
FT   CDS_pept        150227..150595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03182"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNP3"
FT                   /protein_id="ABQ03182.1"
FT                   /translation="MESKALLQEKITFREVYIFDMEILQNIFSQNNCVKAEGKMLFGIP
FT                   FLLAEKDNKINSFASLLLNSNNEIVYKIYDDGSLTDKDKTLFEEYISIFMKKKRNANFN
FT                   NAQQLKHSTDHFVHFLNF"
FT   gene            150614..152032
FT                   /locus_tag="Fjoh_0145"
FT   CDS_pept        150614..152032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0145"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03183"
FT                   /db_xref="GOA:A5FNP4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNP4"
FT                   /protein_id="ABQ03183.1"
FT                   /translation="MKNRETLYLKIAKIIEDQIHNETLVLGSKLPSVRSAQKLYNVSLN
FT                   TIKQAYLELESRSLIESRPKTGYYVSKSSQRTTALPTIASIDNHETENTPEELIDKVFG
FT                   TINKSDVTQFALGLPGKNFLPVAKLNKGIINAVRNRGDAGTAYEPVQGSEELRRAIAKW
FT                   ALVMEGKITEDDLVITSGAMHAMYNALMAVTSPGDSVAVESPAYFGILQAIKALGLKAV
FT                   EIPTHPLYGLDLDALKKVLPEIKACCFVTNFNNPMGFQMPDENKQELVKLITQYNVPLI
FT                   EDDIYGNLYFGSERPKPCKFYDEAGLVLWIGSVSKTLAPGYRVGWIAPGKFKDKIIRQK
FT                   LVQTVCNSSLYSDVIADFLEHGRYDHHLRTFRNKLYANYLQINRAVETYFPDNTKIAQP
FT                   KGGFMLWLELDERISTTELYNTALAQKIVFAPGRIFSQYNQYNNCMRLTYVLEWNDRVD
FT                   SDLKKLGSIIKNSI"
FT   gene            152039..152521
FT                   /locus_tag="Fjoh_0146"
FT   CDS_pept        152039..152521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0146"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03184"
FT                   /db_xref="GOA:A5FNM8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNM8"
FT                   /protein_id="ABQ03184.1"
FT                   /translation="MNNKDQVEIAAYNSKYQKSFKDLNIEWISNYFEVEPNDIKALDHA
FT                   EEYIINKGGEIFSAVLNDEVLGVCALIKSDGKNYDYELAKMAVSPKTQGKGVGLLLAES
FT                   AIKWASEKGASKIYLESNTKLTPAIKLYEKLGFKRITGISSAYNRVDIQMLLTLNS"
FT   gene            152756..153277
FT                   /locus_tag="Fjoh_0147"
FT   CDS_pept        152756..153277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0147"
FT                   /product="ECF subfamily RNA polymerase sigma-24 subunit"
FT                   /note="PFAM: sigma-70 region 4 domain protein; Sigma-70,
FT                   region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03185"
FT                   /db_xref="GOA:A5FNM9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNM9"
FT                   /protein_id="ABQ03185.1"
FT                   /translation="MDNKKLILSLKKGNEAAFKEVYFNYYDKLVNIAKRFNLTVLTPED
FT                   FVQESLLRLYNKRELLNEDVLLDKQLFTICKNIIINHVNRESKIIQLDPHKADIAEEET
FT                   DLGVFEDRKEKLYNFINQLPEQQQKIFTLHKLENLSYKEIAELTDLSEKTIANHIYLAS
FT                   KFIRKKIENH"
FT   gene            153286..153534
FT                   /locus_tag="Fjoh_0148"
FT   CDS_pept        153286..153534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03186"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNN0"
FT                   /protein_id="ABQ03186.1"
FT                   /translation="MISFVIYKNENKKMHIEAYKTNVRTKKDASLLVVLLQFVISDCII
FT                   NFDFKNRERILRIETNREIKDVVYGVFNKQGFYCKKL"
FT   gene            153546..154388
FT                   /locus_tag="Fjoh_0149"
FT   CDS_pept        153546..154388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0149"
FT                   /product="anti-FecI sigma factor, FecR"
FT                   /note="PFAM: FecR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03187"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNN1"
FT                   /protein_id="ABQ03187.1"
FT                   /translation="MDKEKLDEEFEKLWNETPASHSDKIKEASWGKFHSKTFTPKKKKF
FT                   KPWRYYAAAAVLLFVLVGTGIYFTNDSAAGAIVLPENVIENTTLKIKHVVLPDSSKVEL
FT                   SPNSKISYGNNFALNRKIEIVGEAYFQVKKDKQHPFQVFCNETTTTVLGTCFTVKGFQK
FT                   KEVTVELFEGSVQMNVKGQDQNWVLKPGQKFTYGNQTASVAEFSRFIDFDNEKLTVVST
FT                   YIEENYGYKVTLPKEYKDQKITIRINRKEDLKIIVQLISEMYNLNFEINEDLKQITFQ"
FT   gene            154489..157107
FT                   /locus_tag="Fjoh_0150"
FT   CDS_pept        154489..157107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0150"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03188"
FT                   /db_xref="GOA:A5FNN2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNN2"
FT                   /protein_id="ABQ03188.1"
FT                   /translation="MKHIISACFFLFSLCMSAQTVTITVDQNVTLKEFFKQIENQTDFK
FT                   FAFTDQIDTNQKYFTKKSTYKQVEIEKLISELNKTASVQFSIVGNNIFVKQKSQSAKTV
FT                   KKKSKLTGQIFDDTKQPVIGANVYIKELEVGAVTDVNGKFSIEIPNGNYTVAVSYVGFK
FT                   NHEKRITISDDTKINFNIDSDSQELEQVIVTGNKAVDIKTTQMSVNRLSMQEIKRIPAA
FT                   MGEPDPLKSILTLPGVTNAGEASSGFNVRGGAADQNLILLDGAPVYNDSHMFGFFSVFN
FT                   ADIVNGLDLYKGGIPSKFGGRVSSVLDVTQQTGDFENYKVNGGIGVISSRLLVQGPLQK
FT                   DKGSFIVSGRTSYAHLFLKLADNKNSAMFYDFNAKLNYRFNANNTLTFSGYLGNDIFDI
FT                   NDRFSSKYGNTMGILSWKHKFSDRLNHNLSVFYSDYKFNLGLSMENFEWDSNIQNYGLK
FT                   YGWNYQKSEKFKINYGIDGLYYNFNPGTVQPTSIDSQFNYKQLDKKYALETSAYLDFEN
FT                   QITEKLNFRYGLRYSMFYRLGSEAISTYENGQSVVYNPLYKIYEEGTPTGTTYYGKGKK
FT                   ISSFDNFEPRAALSYAFNDNTSVKASYNRMAQYIHILSNTQSPLPMSIWTPSGPFTKPQ
FT                   LLDQYAVGYFKNFKDNDYSFEGELFYKKVQNRIDYIDGADILANNNIEQVILNGKARSY
FT                   GMELLFRKNTGIFTGWISYTLSRAEQKTPGRTAEEPGIANGDWYLSGYDKMHNLSVVGS
FT                   YEFSPKWSFNGNFTLQSGQPVTYANGYYEFGGIHVPNYSLRNENRLPLFHHLDVAATYT
FT                   PRPDKKKGWQSYWVFSIYNIYNRKNAASMSFTTNEDTGANETRRLSIFGIVPGVSYNFK
FT                   F"
FT   sig_peptide     154489..154551
FT                   /locus_tag="Fjoh_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.927 at
FT                   residue 21"
FT   gene            157112..157954
FT                   /locus_tag="Fjoh_0151"
FT   CDS_pept        157112..157954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0151"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03189"
FT                   /db_xref="InterPro:IPR025345"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNN3"
FT                   /protein_id="ABQ03189.1"
FT                   /translation="MNKLKKYTKMNKILALMSLLFVVFFTSCEDVVTLDLETGETRLVV
FT                   DAEIIWKKGTSGNEQTIKISKTASYYSGSTPKVSGAQVRVENTSGDVFTFNETEPGVYV
FT                   CTNFVPVIDMDYKLFIEAEGKSFTAVEKLTSVTSITKVEQAVVPDFGGKDIIELTFYYT
FT                   DPADQVNFYLTDYKSDFLIYPEYEITNDEFYNGNEISTRYSHEDDIKTGSVVKITHRGV
FT                   SKNFFNYMKLILEASSANPFLVPPGNIRGNIVNTTDASNFALGYFRLCEADAVDYVVK"
FT   sig_peptide     157112..157201
FT                   /locus_tag="Fjoh_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.762 at
FT                   residue 30"
FT   gene            complement(158042..159481)
FT                   /locus_tag="Fjoh_0152"
FT   CDS_pept        complement(158042..159481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03190"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNN4"
FT                   /protein_id="ABQ03190.1"
FT                   /translation="MRIMSTEKLNNKTKEELKDILINDTDIHKIETWEFLVKHSLSNNE
FT                   LVIILEKCDDLRIRSKVAAILSGQNPSTNELVCIINYSWNFEITNNAFEILLEKDLTNY
FT                   NLIVIIEKCPIIEVKKRAFEVLIKNNPRNEELADVLRWFGNYEIRNDISRFLLTKNPDI
FT                   DELKDIIVMCNDPKIGNNAWEMLEKQNLTNKDLENVIRNPISLNNEGIRNKAAKVLLQK
FT                   EPSDNELHNILLGCSDIQMVNKASEVLLERTIVNENLLEILRLCTNHEIINNTWEILKR
FT                   NNPTSSDLRFVISFCTVIEVVKEAWGIFEKGDHKKEDLLGITKCCIDIEIVKTAWKNIE
FT                   KEEWNFYDLRDVIGECIDPEIRKSVWEKMKEQSQHWHWGTLAYILTDDFNTDLPVEIRN
FT                   EAWKMLAVRAGITKPFNEEPLIQKMLSKFGDKFDHTQKKIMFRQICIEDEEIMKIKKEY
FT                   SPILDLLVLPNYFYNITSADA"
FT   gene            159638..160678
FT                   /locus_tag="Fjoh_0153"
FT   CDS_pept        159638..160678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0153"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03191"
FT                   /db_xref="GOA:A5FNN5"
FT                   /db_xref="InterPro:IPR002225"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNN5"
FT                   /protein_id="ABQ03191.1"
FT                   /translation="MIHSHQKVLVTGGTGFVAIHSILQLLNRGYQVRTTVRSLNSRDKI
FT                   FEMLKNGGITDFSQLEFIETDLTSDKNWNEAMMGCQYVLHIASPIFLRLPKNEDEMIRP
FT                   AVDGTLRVLKAARDSGVKRVVMTSNFGAVGYSHKDKNSLITEESWTDPNEKGLSTYNKS
FT                   KVLAEKAAWDFIEKKGGALELSVINPMGIFGPSLNEDLSSGFELLKKLLDGSMKAIPDI
FT                   RLGIVDVRDVAELHILAMEKPQAKGERFLALSGGTMSLMEIVKLLKEKMPYVTTKAPAK
FT                   SLPTFIIRLSSIFNDQAKAILPLVGINRNASNKKAKTILGWVPRTNEEAVTASVISLIK
FT                   WKNLNI"
FT   gene            160683..161330
FT                   /locus_tag="Fjoh_0154"
FT   CDS_pept        160683..161330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03192"
FT                   /db_xref="GOA:A5FNM1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNM1"
FT                   /protein_id="ABQ03192.1"
FT                   /translation="MKVILTGATGMVGEGVLIECLNNKNIESVLYVGRKTSGRSHPKLT
FT                   EYLVSDFLSLQSNDSRLAGYDACFYCAGISSVGMDETEYTHITYDTTIHFAKAVLNQNP
FT                   NLVFNFVSGFHTDSSEKGKVMWARVKGKTENALQRLPFRAQYSFRPGLMKPDKEQIHLK
FT                   GFNKYIKFLYPVLGLFYTGCEIREIGRAMISTAQFGYSKKILEPIDIKKAAN"
FT   gene            161333..162475
FT                   /locus_tag="Fjoh_0155"
FT   CDS_pept        161333..162475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0155"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03193"
FT                   /db_xref="GOA:A5FNM2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNM2"
FT                   /protein_id="ABQ03193.1"
FT                   /translation="MKNRIFKILKRMFIVIAVLLLILAFSTWLYMQKAVFGSLPSQESM
FT                   VRIQKSVHYKNGEFQNNTYTPTFAPGYTFWGVIRSQLFDKTVPTEPSGKIPSVKRDLKH
FT                   LPANQNLLVWFGHSSSFLQVDGKKILIDPVFSSNASPLPNSVKVFAGTNSYQVQDLPDI
FT                   DYLLISHDHYDHLDYPTILALKEKVKTVICGLGVGAHFERWGYPKNKIIEKDWNDSVTV
FT                   GQYYTIHTLPARHKSGRGLKQNQSLWVSFLIHSPKTKIFYSGDGGYDTHFAEIGKKFGP
FT                   IDIAIMENGQYNKAWHYIHMLPEETLQAAKDLNAKSMIPVHNSKFALAKHTWNEPLNEI
FT                   SRLNKKYQIPLITPVIGEIVIFENHKVFPEWWKNNTDKPI"
FT   sig_peptide     161333..161422
FT                   /locus_tag="Fjoh_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.598 at
FT                   residue 30"
FT   gene            162482..163282
FT                   /locus_tag="Fjoh_0156"
FT   CDS_pept        162482..163282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0156"
FT                   /product="helix-turn-helix-domain containing protein, AraC
FT                   type"
FT                   /note="SMART: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03194"
FT                   /db_xref="GOA:A5FNM3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNM3"
FT                   /protein_id="ABQ03194.1"
FT                   /translation="MKYTEIKSCYIGPEISPEHFITEHFFLYLAKGTIEGYDGISKYSL
FT                   KPGEYCIARKNHLARYHKQKQDNEFEKVVVIFDTLFLKAFAEKHKIKAQKSEAEAAFVQ
FT                   LKKTNLVPNFILSLMPYYNEGGEIDETFSSIKREELLLILLKENPELTNILFDFAPPEK
FT                   IDLEAYMNRNYKFNISMERFAYLTGRSISAFKRDFAAIFSDTPSRWLIQRRLKEGYFLL
FT                   EKKGRKPSDIYLDLGFEDLSHFSFAFKKKYGISPSDILKLNLNK"
FT   gene            163279..163821
FT                   /locus_tag="Fjoh_0157"
FT   CDS_pept        163279..163821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0157"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03195"
FT                   /db_xref="GOA:A5FNM4"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNM4"
FT                   /protein_id="ABQ03195.1"
FT                   /translation="MKKVVLNLAVTLDGFIEGPNGEVDWCIMDEDMNFPAFIESVDTIF
FT                   YGRISYDAWGNYEADENADLAEKEMWNGIHSKNKFVFSSQNRNDENAVFITADLITKVN
FT                   EIKNQQGKDIWLYGGASLIKTFINLNLIDVYKISVHPIVLGSGKPLFENLSDRIGLKLM
FT                   DTRVFKSGVVELTYQPE"
FT   gene            163873..164637
FT                   /locus_tag="Fjoh_0158"
FT   CDS_pept        163873..164637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0158"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03196"
FT                   /db_xref="GOA:A5FNM5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNM5"
FT                   /protein_id="ABQ03196.1"
FT                   /translation="MSITTEAELIGMKKASEAVAYALREMRNFAKPGISTKELDEYGGK
FT                   ILNDLGAKSAPYVTYGFPGWTCISVNKEFCHGIPSEKRILKEGDLINIDVSAELNGFFS
FT                   DNGGSFVIGEDVNQHQKLIEASKEILHKAIHNIKGGVRISDIGFIMETEAKKRGYKVIK
FT                   NLTGHGIGRGLHEEPHEIANYRDRFNLTRFKKNSVVAIETFISTTSTIAETLKDGWTMV
FT                   GNKGGFMAQHEHTIIVTEGKPIILTEMNGIWN"
FT   gene            complement(164751..165773)
FT                   /locus_tag="Fjoh_0159"
FT   CDS_pept        complement(164751..165773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0159"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03197"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNM6"
FT                   /protein_id="ABQ03197.1"
FT                   /translation="MLSFQKYLSIAAIFLLLFSCQNESDDQDNTAQGTITNASPLTSYL
FT                   QRVAMVQTVQDNIIDGSTYCTIKFPYTVTVNNTQIAINSAADYQKVIDNINASNYDDDI
FT                   VKIDFPVTMVYYNYIEKLIPNEADFDTLIDYWNQYPDLLSKINGLNINYPITINIYNSA
FT                   NQIGSSQTIISDQAFFNFIKNLNASQYISLKYPISIVDYHGQTKAVNTNLDFENAIKYA
FT                   IDYCPENNIVTLNLNEVITKGSWQIPYYFADSDKTSSYSGYSFVFKSDNSVTATKAGIS
FT                   ETGQWESTVQNNVRELKLNFSSELLSKLNKSWKLFEFNNSQIRLRDVNNSTNYLYFEKQ
FT                   "
FT   sig_peptide     complement(165699..165773)
FT                   /locus_tag="Fjoh_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.595 at
FT                   residue 25"
FT   gene            165970..166485
FT                   /locus_tag="Fjoh_0160"
FT   CDS_pept        165970..166485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0160"
FT                   /product="ECF subfamily RNA polymerase sigma-24 subunit"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03198"
FT                   /db_xref="GOA:A5FNM7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014327"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNM7"
FT                   /protein_id="ABQ03198.1"
FT                   /translation="MPTKNQSDTCDEIIFSSFFKSHAKALRNFLLYKFGNIEQAEDITQ
FT                   EAFVKLWQNCASVPLEKAKSYIYTIANNSSLNQIAHQKVVLKYEKNFTGLDKTNESPEY
FT                   ILEEKQFQAKLLKAIENLNEKQRTAFLMHRIDGKKYSEIAAELNISVKAVEKRIHLALL
FT                   SLRKEIDL"
FT   gene            166537..167436
FT                   /locus_tag="Fjoh_0161"
FT   CDS_pept        166537..167436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0161"
FT                   /product="anti-FecI sigma factor, FecR"
FT                   /note="PFAM: FecR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03199"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032508"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNL5"
FT                   /protein_id="ABQ03199.1"
FT                   /translation="MKKNRLLAKWLNDDLSPDELAAFEASPDFEKYQKIKNYTAHLEVG
FT                   DLDENAMLSNILSQKKTAPKVVPLYKKWAFRAAAIFVLALAVTFVMQFFVPETETADFG
FT                   KRTTFSLPDNSEVVLNSGSEIQYKKWNWDNSRHLELKGEAYFRVAKGRKFEVETRLGKV
FT                   TVLGTQFNVKTRKNRFDVVCYEGRVKVNYNNTQILLTHGQSVSFENGKQVNLTVNTSKP
FT                   EWIDNQIGFYKENIRSLLDEVERQYNIKIELNTKDTTSLFTGKLPAKDLNTALQIISTT
FT                   YHLEAKQVSKNKIIFDEK"
FT   gene            167437..169967
FT                   /pseudo
FT                   /locus_tag="Fjoh_0162"
FT   gene            170273..171175
FT                   /locus_tag="Fjoh_0163"
FT   CDS_pept        170273..171175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0163"
FT                   /product="repetitive lipoprotein of unknown function"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03200"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNL6"
FT                   /protein_id="ABQ03200.1"
FT                   /translation="MKLKQLKFAAALAVTTFFLSCSSDNSGDNTNPDPTPETKKEVTLA
FT                   TSTTLGSYLVDKDGRSLYFFSTDAKGQSSCTGGCEAVWPVFNVDNLTADKLGTGLTLSD
FT                   FGTITTASSKKQLTYKGWPLYYYAPSSANDGYGNVTNTPEAPGKTDGDGIGGVWFIAKP
FT                   DYSIMIVRSQLVGHDGKNYKSDYTVGDGQTTYFTDAKGLTLYTFKNDNFKKNNFTKEDF
FT                   SNNAVWPIYETDKIVVPSILDKSKFSVITVFGKSQLVYNGWPLYYFGQDASVRGANKGI
FT                   SFPAPAVWPVPVKDIPLAI"
FT   sig_peptide     170273..170353
FT                   /locus_tag="Fjoh_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.696 at
FT                   residue 27"
FT   gene            171284..171679
FT                   /locus_tag="Fjoh_0164"
FT   CDS_pept        171284..171679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03201"
FT                   /db_xref="InterPro:IPR024422"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNL7"
FT                   /protein_id="ABQ03201.1"
FT                   /translation="MNKRKITILIVLLVISFGPYYIYQNIIYKDARDIDNEKSMLTISA
FT                   QNLESQYAQNSSQADSKYLNKTIEIEGTATEVTDSSMVIDGKVFCKMNKKSNQNFIKKQ
FT                   VNIKGRCIGYDDLFGVVKLDQCSTQQN"
FT   gene            171682..172524
FT                   /locus_tag="Fjoh_0165"
FT   CDS_pept        171682..172524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03202"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNL8"
FT                   /protein_id="ABQ03202.1"
FT                   /translation="MKKIFLIASFLICLCANAQEDLLSSLDSTQVVDKNATATFKGLQI
FT                   ITLQSTKMAAKKELYIVISHRFGSVKGGISEFFGFDDATTKIGGIYGVTDWLSVSASRH
FT                   TLLKIYETSLKYRLARQNDKFPFDIVGYNTIDINSGLKKDDYPKIEFSDRLTYVNQLLI
FT                   SRKFSDKLSLELVPSYIHKNLYNQDTENDNQFTLSAGGRLKLTKRLSLNLEYGENFNKP
FT                   DFYNNPLSVGLDIETGGHIFQLIFTNSQSMTESGYLTNATGDWGKGDFFFGFNLYRVF"
FT   sig_peptide     171682..171738
FT                   /locus_tag="Fjoh_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 19"
FT   gene            172536..172886
FT                   /locus_tag="Fjoh_0166"
FT   CDS_pept        172536..172886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0166"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03203"
FT                   /db_xref="GOA:A5FNL9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNL9"
FT                   /protein_id="ABQ03203.1"
FT                   /translation="MKKYIFLSGILLSLYGCESNTYESLEEPEVIVGKVTYNANAKAII
FT                   DANCIACHASGGTLKPLETYAQVRDAMLNTDLLDRIQRQNGTPGQMPKAGRMSQDKINT
FT                   ILQWNADGLLEN"
FT   gene            172898..173443
FT                   /locus_tag="Fjoh_0167"
FT   CDS_pept        172898..173443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03204"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNM0"
FT                   /protein_id="ABQ03204.1"
FT                   /translation="MKKQMILLFLFAGLFQVSAQKYATKTGNLKFEASADSFEEVAAEN
FT                   KNTSAILDSGTGDVAVLALMKGFRFKVALMEEHFNENYVESDKFPKASFKGKIEDFDAS
FT                   KLSASSKPVKISGDLTLHGKTKKITVNSKIQKSDDKITITGSFEVKAEDFDIEIPKLVS
FT                   KKIAEKIKVSFNLPLTKM"
FT   sig_peptide     172898..172957
FT                   /locus_tag="Fjoh_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.799 at
FT                   residue 20"
FT   gene            complement(173516..174496)
FT                   /locus_tag="Fjoh_0168"
FT   CDS_pept        complement(173516..174496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0168"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03205"
FT                   /db_xref="GOA:A5FNK4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNK4"
FT                   /protein_id="ABQ03205.1"
FT                   /translation="MEKRILGTQGLEVSALGLGCMGLSFAYGTAVDKQHGIKIIREAYE
FT                   QGINFFDTAEAYGIANEELVGEAVSPFRKDVVIATKFGFKGGQAFNGQDSRPENIRAVA
FT                   EESLRRLKTDVIDLFYQHRVDQNIPIEDVAGTVKDLIQEGKVKYFGMSEAGAETIRKAN
FT                   AVLPVSALQSEYSIWWREPELEVLPVLEELGIGFVPFSPLGRGFLTGAITQNTKFESTD
FT                   FRNSLPRFSEENRSANQKLVDLLSAIASQKQATPAQIALGWLLAQKPWIAPIPGTTKSN
FT                   RLTENIGGASINLSAEDVKKIDDAFAQTTIQGDRYPAQIQQTVGK"
FT   gene            174676..175569
FT                   /locus_tag="Fjoh_0169"
FT   CDS_pept        174676..175569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0169"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03206"
FT                   /db_xref="GOA:A5FNK5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNK5"
FT                   /protein_id="ABQ03206.1"
FT                   /translation="MDQLKLEHVTQYNQLKGVGTQHPLVSIFDNSNSNPLPNNTRLHFG
FT                   FYAIFLKAGNCGELKYGRNNYDYDDGTMVFVAPGQVLEVSNTDNYKSTGLTLLFHPDFI
FT                   KGTALFKNINQYSFFSYDSHEALHLSLKEQEIIKDLFNKLEYELSQSIDKHSKNIISNT
FT                   IELLLNHCVRFYDRQFITRENINSDILSKFENCLNDYFHSQNAQDSGLPSVGYFADLLH
FT                   LSPNYFGDLIKKETGKSAQEHIQLKLINLAKERIFDTEKSVSQIAFELGFKYPQHFNRM
FT                   FKKNTGYTPIEYRNLN"
FT   gene            175574..177148
FT                   /locus_tag="Fjoh_0170"
FT   CDS_pept        175574..177148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0170"
FT                   /product="Na+/H+ antiporter"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03207"
FT                   /db_xref="GOA:A5FNK6"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNK6"
FT                   /protein_id="ABQ03207.1"
FT                   /translation="MLDNFPFYLGLLIVILLLIMLANKIKVAYPVLLVLAGLLISFIPG
FT                   VPSINIEPELIFFIFLPPLLYEAAWTISWKELWRWRRIITSFAFIVVFVSALSVALVAN
FT                   YFIPGFSLALGFVLGGIVSPPDAVSAGAILKFVKVPKTMSSILEGESLLNDASSLIIFR
FT                   FAMIAVATEQFIFYKAALSFSWMVFGGAGIGLLIGWLFMKAHKYLPTDANSDIVLSLLT
FT                   PYIIYLAAEEVHSSGVLAVVSCGLLLSNNRHRFLNSRSRIQGVNVWESLCFILNGLVFM
FT                   LIGLDLPQITKGLEETTLLTAIGYGVLITVVLIISRLISAYGAVIVTLIARNFITVADN
FT                   RHPGYKTPFILGWTGMRGVVSLAAALSIPVYLDNGNGFPQRNLILFITFIVILLTLLIQ
FT                   GLTLPYFIKKIKLPNIYDPVPREEAHHQIRQELAEFALLYLKTNYQDHAENNTSLQHLI
FT                   QKWEQHIKGIDDESISQELKNIYRDLLDQQRQWLLNRNKEDKTLDEAIIRRQMYYLDIE
FT                   EEKLRYL"
FT   gene            177429..178895
FT                   /locus_tag="Fjoh_0171"
FT   CDS_pept        177429..178895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0171"
FT                   /product="protein of unknown function"
FT                   /note="PFAM: glycosidase, PH1107-related"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03208"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNK7"
FT                   /protein_id="ABQ03208.1"
FT                   /translation="MRVSVVRKSIKFTPDSRRVVARYFMNGYDRTQQMVLRIMTLDEKQ
FT                   VSETLEQTLREFARRHRNISAVFFRHCEKIRPIIEAMQVDYEAMTLNRKMLIGSYCTME
FT                   YAIESAAIFNPSIVEDFDQSGLEAGEKRVIISFRATGEGHISSIVFRRGILDRDNNLQI
FT                   MKIGHHIDKAEIEHKTLFNKERFLTKLIEMHTQDKYIDQIMQDLPEEFEFAILKNTLKT
FT                   ALSDPAIRQERRTALEEILWLANSFYDLQFKHDSDITERVIFPISDSESRGIEDARFVR
FT                   FVDDDDSVRIMATYTAYNGHAILPKLISTEDFYSFRVMPLHGEGAQNKNLALFPRKIKG
FT                   KYAMLARIDGVNNYIMYSNRVTQWNTPVLLQQPRYTWELTQIGNCGSPLWTEEGWLVIT
FT                   HGVGTMRRYCIGASLFDLDDPSKEIGRLSEPLLSPLEDEREGYVPNVVYSCGAIIHNNS
FT                   LILPYAVSDYSSTYGVVDMVELLDALKKSK"
FT   gene            178899..179117
FT                   /locus_tag="Fjoh_0172"
FT   CDS_pept        178899..179117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03209"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNK8"
FT                   /protein_id="ABQ03209.1"
FT                   /translation="MYQIILCEKATGIILELDGKTRYSYDGINDFPPTFFASLEEAEDK
FT                   ADALLKENNTIEIQICNTDGSRVKIMA"
FT   gene            complement(179134..179904)
FT                   /locus_tag="Fjoh_0173"
FT   CDS_pept        complement(179134..179904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0173"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: regulatory protein, LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03210"
FT                   /db_xref="GOA:A5FNK9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNK9"
FT                   /protein_id="ABQ03210.1"
FT                   /translation="MSKVSIEDQLTSTLLQQTFLDGEVLDIEEYKKSVVSYVEIEQCVA
FT                   VLSDFQADCSYIYAGNFGEFFGLSSENLIIDSAFEDCIFNKINSDDVTERHALELQYIQ
FT                   FLKNLPGEEYRKYSTFSRLRTSDSQNVNYINHRTMYLKKSSNGSIWLALCLYSPSGNLQ
FT                   TSTGIDGRIVNMQTGETIASEKYKSLSETLLSKRELEILKLAAKGNNSGQIAGFLNISV
FT                   YTVRRHRQNIIQKMQVSNTTEALRTALVMGLIQV"
FT   gene            180010..180762
FT                   /locus_tag="Fjoh_0174"
FT   CDS_pept        180010..180762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0174"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03211"
FT                   /db_xref="InterPro:IPR009784"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNL0"
FT                   /protein_id="ABQ03211.1"
FT                   /translation="MKTKFITCLVLFGIIIFSSCNNSSKENKTEEKTTEKISDSAFVRG
FT                   NPCDIKLEKIHFTKSINGADTLAKVDEKKNIQFHVGEKKDYFSDPNNKLSSNTAPILLS
FT                   KIDNTKPFTITAKVSPEFTESGLYNAGVLYLYVNDSFYQKFCFEQDERGNHRIVTVRTI
FT                   GTSDDNNHDVVKGKTVYMKISSDTQTVASYYSLDNKTWQMVRLYKNNYPAELWGGISAQ
FT                   CPVDKGTTSYFEEISLEQKSVKDFRLGI"
FT   sig_peptide     180010..180087
FT                   /locus_tag="Fjoh_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.428 at
FT                   residue 26"
FT   gene            complement(180906..181679)
FT                   /locus_tag="Fjoh_0175"
FT   CDS_pept        complement(180906..181679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03212"
FT                   /db_xref="InterPro:IPR023875"
FT                   /db_xref="InterPro:IPR025404"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNL1"
FT                   /protein_id="ABQ03212.1"
FT                   /translation="MTQVIYDSTFEGWLTAVFEIYELKLADVVFAKNEVSNALLFSETY
FT                   FVTTDISKANRVLHGLKQRLSPEGFDNIYRAFLSDLDKIEETLFQFVKYIFASSVNIED
FT                   DLANTFVLDVQRAAHLTGKESHRMKAFVRFKLTKDNLYYAIVEPDCDVLPLIEKHFKNR
FT                   YADQRWLIYDSKRKYGIYYDLEDTSTVQLQFNAESTSSKFLAEICDDNEEFFQNLWRQY
FT                   FSSVNIESRKNTKLHLQHMPKRYWKNLTEKIPNLK"
FT   gene            complement(181684..182925)
FT                   /locus_tag="Fjoh_0176"
FT   CDS_pept        complement(181684..182925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0176"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03213"
FT                   /db_xref="GOA:A5FNL2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023874"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNL2"
FT                   /protein_id="ABQ03213.1"
FT                   /translation="MEKLAILADAAKYDVSCSSSNSSRKNKDKGLGDASGNGICHAYTE
FT                   DGRCVSLLKILLTNHCIFDCAYCVSRKSNDIKRAAFTVQEVVDLTIGFYRRNYIEGLFL
FT                   SSGIFDNPDYTMERLVRIVKKLRLEENFNGYIHLKAIPGASPELLKEAGLYADRLSVNV
FT                   EMPTEQSLKLLAPDKNHVDVIKPMEYLKNEIIGYKEEKKQNYKAPLFAPAGQSTQMVIG
FT                   ATQENDMEILGMANYFYEQMNMKRVYYSGYVPISYDNRLPAIGTPVPMIRENRLYQADW
FT                   LIRFYGFHVNEMVGFDQPNLDLDIDPKLGWALRNLNQFPVDINTADLELILRIPGIGVL
FT                   SAKKIVAARKFKKLQPEDLQKLGISYSRSKYFLAFAAPFQLQRDLTSIQIKEHILNSQK
FT                   SKYKNDFSNQLALF"
FT   gene            183278..183520
FT                   /locus_tag="Fjoh_0177"
FT   CDS_pept        183278..183520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03214"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNL3"
FT                   /protein_id="ABQ03214.1"
FT                   /translation="MNFVKGQDVFYTTLSGRSYRATVIERKIDFKKGLIKKSAIKEMTY
FT                   HYLIEVHKVGIKEQILCTENQIKLLEKKQRAKKAA"
FT   gene            184604..185008
FT                   /locus_tag="Fjoh_0178"
FT   CDS_pept        184604..185008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03215"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNL4"
FT                   /protein_id="ABQ03215.1"
FT                   /translation="MTNKKLQRFYNFIDGLKVMNEYDPDFFKGNSFTSKSNGLFGSCLS
FT                   ASIGVGIAFVGLATIEVGSFGLATGVAVAGFIWASAEWGAACKGTGKKRLYPAHIDKSQ
FT                   EKTSRNFLILDENGDLIESPIYISYVPKIK"
FT   gene            185414..185977
FT                   /locus_tag="Fjoh_0179"
FT   CDS_pept        185414..185977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03216"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNJ5"
FT                   /protein_id="ABQ03216.1"
FT                   /translation="MDNEKFIFCLEGVQDVDTVTTTDVVKNLEEIAFNQGISSIYKTCD
FT                   TIEGLEESLNTLLYDDHNFKDYEIIYLVMPGQENNICLHDYYYSIEEIAELFEGKMKGK
FT                   IIHFANKKRLDLNDEEAQYFLDITGARAISGYGSTYNKIASCSTIDKAFFSLYQENDDL
FT                   TEVVEDLYQKHYALCKLLDFRLYY"
FT   gene            186121..186900
FT                   /locus_tag="Fjoh_0180"
FT   CDS_pept        186121..186900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0180"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03217"
FT                   /db_xref="GOA:A5FNJ6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNJ6"
FT                   /protein_id="ABQ03217.1"
FT                   /translation="MQMQHPVPPCKHSCHTLIFISSGQHVMKLGYQEYTTIDNEIIVVP
FT                   AGQIFSLENVNNIHKGYICQFHPDILIRKYGSREMINEFDFMKISGNPKITLAPKDVPH
FT                   ITAILSRLEKEYSETSTANLNIVQSYLITLFYEMNKNSVKSSKNISAAEVITNKFKELI
FT                   HQNIKTHHLVHYYASLLNVTPNHLNKSVRTVTGKSATKWIDETILLEAKYLLFQTTLSV
FT                   SEIAVQVGHEDQSYFSRFFKKHEGITPIQYRKMIDKS"
FT   gene            186963..187172
FT                   /locus_tag="Fjoh_0181"
FT   CDS_pept        186963..187172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03218"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNJ7"
FT                   /protein_id="ABQ03218.1"
FT                   /translation="MQIMIYVFKTSVNSQSKFESASTLLHELLPDTLWNFDLEDCDNIL
FT                   RIDSELDIPKLILNNGIFDCIELE"
FT   gene            187206..187778
FT                   /locus_tag="Fjoh_0182"
FT   CDS_pept        187206..187778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0182"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03219"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNJ8"
FT                   /protein_id="ABQ03219.1"
FT                   /translation="METKLYQNRTFDTVDYSDQSLSNTEFVNCEFINCNFSKSDLSHND
FT                   FLDSTFKNCNLSLAVLKNTGLKNIKFIGCKLMGLDFSASNSFLFSMSFQDCLLDYSTFI
FT                   YKKLKKTNFIDCSLKDVDFSNTDLSLAAFKNCDLSNATFAECILEKTDFRSSRNYAFDP
FT                   SENKIKGTKVSHTALAGLLEKFDLDIE"
FT   gene            complement(187911..189479)
FT                   /locus_tag="Fjoh_0183"
FT   CDS_pept        complement(187911..189479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0183"
FT                   /product="Fibronectin, type III domain protein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03220"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032530"
FT                   /db_xref="InterPro:IPR033427"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNJ9"
FT                   /protein_id="ABQ03220.1"
FT                   /translation="MMKAKYIFRGLIAVLLLAVGVSSCESYNEELLDSVGNTREFSPIG
FT                   LKATVRNQTTVELNWTVKTDENADHYVVEFSPDDPEFKTIFKTVNVTPAELPIQVALEG
FT                   ETTYSIRVKAVSAAGLDDSKWSVTTATTLSEQIFFPIKPEEIEAGYLTVRWTPNSNVTE
FT                   ILVQPGNITHTITAEEKAAGAAIVNGLTPETNYTATLKNGTKTRGILTFTSGVDLTKGI
FT                   VINPQDDLIAKVAQAPSGSRLLLMPGVYSTTGEIIVNKTLIFRGVRPENKPKLTVKFTL
FT                   ANNPANASEAVSLSLVDLDLSGSGLTGGVISILTAQASPLGDILISSSYVHDYPSQLMY
FT                   GNAAARLKSFTIDNSIVKNVNTAGSADFIDFRTTYVENVTLTRSTFNNCGSRDFIRLDA
FT                   AAGSGGSLVSNVVIDGCTIYTPTLIASSRILYVRFATNILAVRNTLLVVGQAIYTNNAA
FT                   TSAPGFGNNNNFNSPNLKATTNNNRPDAAATTLDPQFANAAGGDFTLGNQTLKDNKIGD
FT                   PRWIK"
FT   sig_peptide     complement(189408..189479)
FT                   /locus_tag="Fjoh_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.359 at
FT                   residue 24"
FT   gene            complement(189511..191325)
FT                   /locus_tag="Fjoh_0184"
FT   CDS_pept        complement(189511..191325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0184"
FT                   /product="RagB/SusD domain protein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03221"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNK0"
FT                   /protein_id="ABQ03221.1"
FT                   /translation="MKHKLIIAGLIISSLFSSCQQFEDDYLDTDAPSTLQPSLIFSDAE
FT                   LAKGAVDGIKVPFAETNSYRGRFLPYYGLNTDVEWYNTSQTAGDKADLCVYDARPGNTE
FT                   MNTTTNAYAMMYLGIERANICIQGIRQYGKPSPGTNMGQLLGEALTLRAIYYADLLKAW
FT                   GDVPARFEPITTATLYLPKSNRDIIYKQLIADLGEASTLVAWPNETSYTSTVEHVNKAF
FT                   VKAFRARLALAASGYQQYPDGVRRSNDPELSVPAMYALALKESREVIESGSAHLESTFE
FT                   GLWRKYNQEITTAGGESLWELPFADGRGRMLFTFAVRHTSAIDQFQANGANRGGVAGPL
FT                   PFVFYDYDQTDLRRDVTCVPYKWGTAVAASPYPIAKQELGTLDTWYFGKYRYEWMTRRV
FT                   TSDNDDGVNKMYMRYAEVLLIAAETANELEGPGAAMPYLKEVRRRSFPAAAQAVKVEAY
FT                   VDGLSSKEAMFNAIVEENKYEFTGEMERKQNLIRWNLLKVKLDEAKQKMTDLAARSGAY
FT                   ADVPATLYYKYKTDNVSLDIYGLNRGETTNPGTGYSSIVWTWTGTAADAKINSLYKPGV
FT                   NPDNRQYWPIWQVFIDGSNGQLKNDFGY"
FT   sig_peptide     complement(191254..191325)
FT                   /locus_tag="Fjoh_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.548 at
FT                   residue 24"
FT   gene            complement(191343..194585)
FT                   /locus_tag="Fjoh_0185"
FT   CDS_pept        complement(191343..194585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0185"
FT                   /product="SusC-like TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03222"
FT                   /db_xref="GOA:A5FNK1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNK1"
FT                   /protein_id="ABQ03222.1"
FT                   /translation="MNFKDLLNKGANRCFAVVFLLCLLMSSRAMAQTVTLEGTVKDAAG
FT                   LSLPGVNVLEKGTKNGTSTDFDGRYKIKLSNPKAILSFSFIGFKTKDVSAEGKTKVDIV
FT                   LIEDSNNLNEVVVIGYGTAKKGDLTGAVSTISGNDLKKVPVANVAEALTGRIAGVQVTS
FT                   AEGSPDADIRIRVRGGGSLTQDASPLIIVDGFPINSMNDISSSDIETMTVLKDAASTAI
FT                   YGSRGANGVILITTKSGKDGKISVNFNMFYGMKTMANEIDVLSPEDYTKWQYEYAMLSQ
FT                   TGTKVPSDPTSYTKYFGNWQDHDMYNGLKGNDWQKQIFGRRGEVQSRDLGIRGGTDKLN
FT                   YNFNYAHYDEKAIMLGSNYKRNNLALALKSKVSNKVDVGFTVRYSDTEIDGGGVNEQNE
FT                   KSATDSRMRTIVGYAPIPVSGLTSDDVSGDGTDILVNPLRSIYDNNRQQFRKNFNMLGS
FT                   FGWEIVDNLKFKVDLGLDNYNSLDYRFYGRSTYYVANTPASTLQGKPAMVITDGKERRF
FT                   RNANTLNYDFKKIMGENHHLTALIGEESINYEVNTVTSTIHGYPSFFDFSQAKSLTSQG
FT                   TPQAVDNYYNPDDRLLSFFGRANYDYKNRYILSATFRADGSSKFLPQNRWGYFPAFAAG
FT                   WKISEESFLKGKSWIDLLKIRASYGEAGNNNIPVGQQTQIFQSIPTAWINGVTSVWAIP
FT                   KTMPNPDLKWETTVTQNVGLDFGFFKNRLSGNFDVYKNVTSDLLINFPVPGSGYDYQYR
FT                   NMGETQNTGFEATLNVVAIEKAKYGLNFSFNMGVNKNRINSLGVMSNFGAATNWASSQI
FT                   GDDYLISVGSSLGTMYGYKNDGRYEVSDFDYVGGKYVLKSGVVATATTLVGDGSSLKPG
FT                   DMKLKDVNGDGKVDLTDKTVIGNINPKSTGGFVINGNAYGFDLMAAFNWSIGNEVYNAD
FT                   KIEFSTANASGQYKNLNSTMADGKRWTNLDPVSGQLVTDPDALAALNANTTMWSPYMRT
FT                   AIFTDWAVEDASFLRLNTLTLGYTAPEMFTSKLGVSKLRFYMTASNVFVWTKYSGSDPE
FT                   VSTKRKNPLTPGVDSSPYPRSRQMVFGMNLNF"
FT   sig_peptide     complement(194490..194585)
FT                   /locus_tag="Fjoh_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            complement(195212..196378)
FT                   /locus_tag="Fjoh_0186"
FT   CDS_pept        complement(195212..196378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0186"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03223"
FT                   /db_xref="GOA:A5FNK2"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNK2"
FT                   /protein_id="ABQ03223.1"
FT                   /translation="MKKSLIALSFGGLTIGITEFVMMGLLPDIASDMKVSIPVAGYLIS
FT                   AYALGVVIGAPLLVILGRNFPPKKMLLILAAMLAVFNALSIIAPTYNILFASRFLSGLP
FT                   HGAFFGVGAVVASRLADKGKEAQAIAIMFSGLTLANLIGVPIGTYIGHNFIWRYTFVLI
FT                   AVVGLLTFLFISLWMPHLDKGESVNMKKQLEFFKRREAWLIIGITAIGFGGLFAWISYI
FT                   APLLINVSKFAEGDVSYILILAGLGMVVGNFAGGKLADKYSPAPTTLALLFIMSVDLIL
FT                   VYFLSSNQYVSLFLTFLTGAISFSVIAPIQMLMIRTAKGAEMIASASLQGSFNIGNALG
FT                   AFLGGLPLSAGYSYASPNLIGVGMSVIGMLITLTLIKTHKNSLKLQSA"
FT   gene            196482..197315
FT                   /locus_tag="Fjoh_0187"
FT   CDS_pept        196482..197315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0187"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03224"
FT                   /db_xref="GOA:A5FNK3"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNK3"
FT                   /protein_id="ABQ03224.1"
FT                   /translation="MPKLNQFKTLMIDEFEEEKFHLPPHSHTYYEIIYIKKGSGVHHIN
FT                   NNLLSYKAGDLFVISPDDEHYFDIKKSTRFIFIKFTDNYFNSKQNLTCDEFLVHTPENF
FT                   MRDKILKETVLKFGEPCKTILRNTVENITKYDQYIDVTNSPIVFYQILSIFGLIKETIR
FT                   CMNLQMTSTHIDNEQIANYIHQNIYQPKLVQIKVIAEHFNIAQTYFSAYFKRTFSISYR
FT                   DYIHNLRTTLIEKRFQNNQLPIKQIAYEFGFTDESHLTNYFKKKRNMKPTDFKRL"
FT   gene            197388..197768
FT                   /locus_tag="Fjoh_0188"
FT   CDS_pept        197388..197768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03225"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNI8"
FT                   /protein_id="ABQ03225.1"
FT                   /translation="MTKKVYIAFLLVMIGFFLIPVSGYACGNHTLKKSHVEETALEKKK
FT                   NSCCTKSCCQETSKSKNKKHDCNGKCSHTNCTTSSFQLSIPVSSDFSFQNNFNFSVKKS
FT                   ITYYNKTNISDGFTTIWLPPKI"
FT   sig_peptide     197388..197465
FT                   /locus_tag="Fjoh_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.950 at
FT                   residue 26"
FT   gene            197881..198411
FT                   /locus_tag="Fjoh_0189"
FT   CDS_pept        197881..198411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03226"
FT                   /db_xref="InterPro:IPR021782"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNI9"
FT                   /protein_id="ABQ03226.1"
FT                   /translation="MKNSTTAVLAAITILFSVNTITANEIKSQINTEDVIASGELQSVF
FT                   DNYFAVKDALIKSDAKTTSAKAASLLTAISAVKMDKLKSNEHTVWMKVVKKLTADAKAI
FT                   SSNTDLKKQRESFKSLSKNTYDLIKVSNPDQPIYKQYCPMADADWLSKEKAVKNPYYGS
FT                   SMLTCGNVVETIK"
FT   sig_peptide     197881..197949
FT                   /locus_tag="Fjoh_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.538 at
FT                   residue 23"
FT   gene            198416..198976
FT                   /locus_tag="Fjoh_0190"
FT   CDS_pept        198416..198976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0190"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03227"
FT                   /db_xref="GOA:A5FNJ0"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNJ0"
FT                   /protein_id="ABQ03227.1"
FT                   /translation="MTLYIKNMVCARCKMVVKSEFEKLGLPTISVELGEVELENEITED
FT                   QKEALLKNLQDLGFDLLDDKKSKTIEKIKNLIVDLVHHKNNELKINLSDYLVENLNQDY
FT                   STLSNLFSEIENTTIEKYFISQKIEKVKELLIYNELSLSEIADLLNYSNVAHLSNQFKK
FT                   ITGFTPTSFKQSKDKMRIQIENL"
FT   gene            199213..201726
FT                   /locus_tag="Fjoh_0191"
FT   CDS_pept        199213..201726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0191"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03228"
FT                   /db_xref="GOA:A5FNJ1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNJ1"
FT                   /protein_id="ABQ03228.1"
FT                   /translation="MEHQYIISGMSCNGCRTKVEKTLNEIEGIHAEVNLNPGEATITMD
FT                   KHVATEKLQEALSAAGNYTIEMKTAENAVKSCCSSKKEHSHHDHAKKAAIPHNATGVFY
FT                   CPMHCEGDKTYNKPGDCPVCGMDLVPQIAAGTQFTCPMHPEVISNEPGDCPICGMDLVP
FT                   IQASESEDNKTYTDLLKKMKIATLFTLPIFIISMSEMIPDNPLFKIMSIEKWNWVQFIF
FT                   SIPVLFYAGWIFFVRAWKSITTWNLNMFTLIGIGTSVAFLFSIAGMFFPDIFPAEFKSH
FT                   HGTIHLYFEAATVITTLVILGQLLEARAHGQTNGAIKELLKLAPTEATLVENGNDKVIS
FT                   IHNIKKGDLLRVKPGEKIPVDGKITSGESSIDEAMITGEPIPVDKKTGDNVIAGTINGT
FT                   KSFVMTAEKVGSETLLSQIIQMVNDASRSRAPIQKLADRVAKYFVPTVVGISILTFIIW
FT                   AKFGPEPSYIYGLINAIAVLIIACPCALGLATPMSVMVGVGKGAQHGILIKNAEALENM
FT                   NKIDVLITDKTGTITEGKPTVEKIYAIDNNEDFLLQNIASLNQHSEHPLAQAVVNFAKE
FT                   KNQSLLEVPNFEAVAGKGVLGTVNNSKTALGNKKLMDQIGASIPDDLETKIIAEQNLGK
FT                   TVSYIAVNNKAVGYVSITDAVKGTSAKAIKDLMDQGIEVIMLTGDNKNTAKAVADHLHL
FT                   SSFKADCLPEDKLKEIERLQAEGKVVAMAGDGINDAPALAKADIGIAMGTGTDVAIESA
FT                   KITLVKGDLNGIVKAHKLSFCVMKNIKQNLFFAFIYNVLGVPIAAGILYPVFGILLSPM
FT                   LAALAMSLSSVSVIANALRLRNLNL"
FT   gene            201736..203976
FT                   /locus_tag="Fjoh_0192"
FT   CDS_pept        201736..203976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0192"
FT                   /product="multicopper oxidase, type 3"
FT                   /note="PFAM: multicopper oxidase, type 1; multicopper
FT                   oxidase, type 2; multicopper oxidase, type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03229"
FT                   /db_xref="GOA:A5FNJ2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNJ2"
FT                   /protein_id="ABQ03229.1"
FT                   /translation="MKLRVILIVILIAFNAKAQKVVRYDLHVRDTIVNFSGKEKRALTV
FT                   NGQIPMPTLTFTEGDIAEIYVHNELKNEDTAMHWHGLFLPNKEDGVPYLTQMPIKPGTT
FT                   HKYTFPIIQNGTYWYHSHSGLQEQIGLYGLFIINKKKDDPTIRKGIDDLPTIPVILSEW
FT                   SDLKPENIQRMLHNANDWFAIKKGTTQSYFEALKQGQFPTKVTNEWKRMNAMDVSDVYY
FT                   EKFLINGKNEDQLSQFKAGDKVRLRIANGGASSYFWLTYGGGKITVVASDGNDVEPVEV
FT                   DRLIIAVSETYDVVVTIPEDKKSFAFLATAEDRTGSASLFLGNGTKQPVHHLPKLKYFS
FT                   GMKMMNDMMKMNGEMNDMGMNMSLNKMDMNAVMYPEISGEDENSKPAMDHSGHNMEEMK
FT                   MESDSTENPEIVTLNYGMLKSPFKTNLPKDAPVKELRFELSGNMNRYVWSLDNKVISET
FT                   DKILIKKGEIVRITLYNGSMMRHPMHLHGHDFRVLNEHGDYSPLKNVLDIMPMETDTIE
FT                   FAANADGDWFFHCHILYHMMAGMGRIFSYENSASNPLIHHPEMAYKMLKMDDRMFHFMA
FT                   ENDFASNGNDGEAMYSNTRWSIGTEWRLGYNNEHGYETETHIGRYIGKMQWFMPFIGFD
FT                   WRYRKMGIDEQEQNLFGQKNTKDNRSVFSIGAEYTLPMLIKAQVEMYTDGNVRIQFERK
FT                   DIPLSRRLRMNLMWNTDKEYMAGLKYIVARNFGITTHYDSDMGIGFGLNLNY"
FT   sig_peptide     201736..201792
FT                   /locus_tag="Fjoh_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.908 at
FT                   residue 19"
FT   gene            complement(204423..204875)
FT                   /locus_tag="Fjoh_0193"
FT   CDS_pept        complement(204423..204875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03230"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNJ3"
FT                   /protein_id="ABQ03230.1"
FT                   /translation="MAISVSKLNKFVLFKLPSAYFCGVRVKAIDKDRCIVSVKHRWINQ
FT                   NPFNSMYFAVQAMAAELTTGALVISQIQQSGKKISMLVANNKGNFTKKATGRITFVCND
FT                   GHLIADAIKKTIETGEGQTFWMKSIGTNEEGVQVSEMDFEWSVRLK"
FT   gene            205106..205585
FT                   /locus_tag="Fjoh_0194"
FT   CDS_pept        205106..205585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0194"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03231"
FT                   /db_xref="GOA:A5FNJ4"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNJ4"
FT                   /protein_id="ABQ03231.1"
FT                   /translation="MQSSTPLIMEKSTEKNTSAFTHLSTLSQYIIPFGNYIFPIIIWSS
FT                   YKDKSEFVDHHGKQALNFQLSLLLYTLILALIAIPIFVTVFLQNLPIEAIFNDHDFYIR
FT                   NFNFEGNIGLLSIGATAVILFGLLKFVEFFLVIYASIKASNGELYKYPLTIPFIK"
FT   gene            205742..206074
FT                   /locus_tag="Fjoh_0195"
FT   CDS_pept        205742..206074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0195"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03232"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNI2"
FT                   /protein_id="ABQ03232.1"
FT                   /translation="MNIENTKAQMRKGVLEFCILSVLKEKDAYTSEILDTLKNAKLLVV
FT                   EGTVYPLLTRLKNDGLLNYRWEESTSGPPRKYYGLTEIGQTFLNELSGTWTELSDAVNL
FT                   ITNQNQ"
FT   gene            206078..207814
FT                   /locus_tag="Fjoh_0196"
FT   CDS_pept        206078..207814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0196"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03233"
FT                   /db_xref="GOA:A5FNI3"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNI3"
FT                   /protein_id="ABQ03233.1"
FT                   /translation="MNKTVNINLGGMFFHIDEDAYLKLSRYFDAIKRSLNNSSGQDEII
FT                   KDIEMRVSELLTEKQKSEKHVVGLKDVDEVIAVMGQPEDYRIEDEESTSQSNSSYNTRR
FT                   HKKLYRDKENGMVGGVATGLAHYFGIDAVWVKIVFLIFVFAGFGTGILAYFVLWVVTPE
FT                   AVTTSEKLEMTGEPVTISNIEKKVREEIDSLSEKFKNADYDKMGNQVKSGAERISSSFG
FT                   DFIMTVFKIFAKFLGVILIIAGISTLIMLLVGVFTLGTNLFVEFPWQNFIEAGNFTEYP
FT                   LWSFGLLMFFAVGIPFFFLTLLGFKLLSPNLKSIGNITKYTLLAIWIIAIAVLVSIGIK
FT                   QATEISHDNKIIEKKAFNINPTDTLYVKFRYSDYYAKSLNHYREFEFVQDSANNELIYS
FT                   NDVRLHVLHTDEKAPFVQIEKSARGNSFTNAKKRAEKINYKFQINGNHLILDNYFLTDI
FT                   KNKFRGQEVDIYLYLPEGQLLKPDSSVRDYFNYDDDFFNLNHDGNYDYKVEGSKVKCLN
FT                   CPADDHDNDSDNDNDSDEVNTIDNDTVKEVSIKINGKEVLNGKKTNGRLTTDKNGVIIK
FT                   IN"
FT   gene            207826..208560
FT                   /locus_tag="Fjoh_0197"
FT   CDS_pept        207826..208560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0197"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03234"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNI4"
FT                   /protein_id="ABQ03234.1"
FT                   /translation="MIKIIIHITKFLIATITALLFASCNFNMNAIEGSGNVTTEKRIVQ
FT                   GDFKNISVSNAIDVVVQQSDSVEVTVEADDNLQKEIITKVENGTLVIECKYSSFRNITQ
FT                   KKVTVKMPHIGKIEASSASSVTSKNTLQGENIELETSSAASMNIEVESDNVSFHASSGS
FT                   SIDIKGKALKIKTSAASGSSIEAGQLLANDVDAEVSSGAVIKVHPILSLKAQASSGGNI
FT                   NYNNVPKTIDKTASSGGSISQS"
FT   sig_peptide     207826..207915
FT                   /locus_tag="Fjoh_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.452 at
FT                   residue 30"
FT   gene            208607..209479
FT                   /locus_tag="Fjoh_0198"
FT   CDS_pept        208607..209479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03235"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNI5"
FT                   /protein_id="ABQ03235.1"
FT                   /translation="MIFLYLLKSKLELMKKHTALFLLLLVTTLTFAQKREKVKGSKIVT
FT                   TSIKETGSFDAIEVDDNLEVYLEKGEKNEIKIEADDNLHEIIAMDLRDKTLRLYTSKES
FT                   TIFKKLAVKVTYTSSLNKVISKNDSKIYAIQELQLDNITFNSFDYSKLYLNVNSKKFTL
FT                   FADDKSKTELNLKTEDGSLQLSKNSSIKTLVSAIKFKCDLYQKAIAAIEGIAEKATIRL
FT                   DNNSVFTGTKFTLKDANVTAENYAVGTIFADTTLSLAVGDKAEISLFGSPAITLNRFSE
FT                   EAKLFKKIK"
FT   sig_peptide     208607..208705
FT                   /locus_tag="Fjoh_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.913 at
FT                   residue 33"
FT   gene            complement(209629..210576)
FT                   /locus_tag="Fjoh_0199"
FT   CDS_pept        complement(209629..210576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0199"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03236"
FT                   /db_xref="GOA:A5FNI6"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNI6"
FT                   /protein_id="ABQ03236.1"
FT                   /translation="MSDTIEKIKCLIIGSGPAGYTAAIYAARANMNPVLYQGMQPGGQL
FT                   TTTNEVENFPGYVDGVTGPEMMIQLQEQAKRFGADIRDGWATKVDFSGGIHKVWINDSI
FT                   ELHCETVIISTGASAKYLGLPSEQHYLNMGGGVSACAVCDGFFYRNQEVVIVGAGDSAC
FT                   EEAHYLSKLCKKVTMLVRSEKFRASKIMEERVRKTENIEILMNHDTLEVLGDNNVVHAI
FT                   KALNKTTGETIEIPATGFFVAIGHKPNTDIFKDYITLDETGYIINTPGTSKTNVEGVFV
FT                   AGDAADHVYRQAITAAGTGCMAALDAERYLASQE"
FT   gene            210753..210830
FT                   /locus_tag="Fjoh_R0011"
FT                   /note="tRNA-Pro1"
FT   tRNA            210753..210830
FT                   /locus_tag="Fjoh_R0011"
FT                   /product="tRNA-Pro"
FT   gene            complement(211044..213224)
FT                   /locus_tag="Fjoh_0200"
FT   CDS_pept        complement(211044..213224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0200"
FT                   /product="beta-1,3-glucanase-like protein"
FT                   /note="related to beta-1,3-glucanases; predicted
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03237"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNI7"
FT                   /protein_id="ABQ03237.1"
FT                   /translation="MNILMTKKAISVFTAFLFMLTLCSFISSYPSNEKKQESTTERKIV
FT                   YNKKKHSITLSWSAFGSSGNYIITRGGSRLASDFVSAGSTSKLEFTDNKPNADKYENYY
FT                   KITRGSEFIIISLENQIFGDNMYFYDRKYEKAETARKEINSQFESIGLGGANGEWTTKR
FT                   QAYYFKANVKGQTYDSGGSGSASGAEANSIELGFYSHIGGLGKVPSDVKLGSIFTRPHL
FT                   SGGANATCTFWRSVENVEVMRDFAWTVSQSTSARRLLIDSTSKYISDVGNTNFWGSGGF
FT                   IADTHYTSSRPNWGGQQQWYTRNTVFPSGSGAMGGSYNMVWQGCVNPPQADNANSPVPT
FT                   TPIIREKPFLFIDNDGEYKVFVPAWQKDRVGVSWSSKDMGKGQVQDLLTKWYVAKEGDT
FT                   DVEINNALKAGKNIFFTPGHYALNAPIQVNRKDAILLGAGIASVTLEPTEKNIWGCIYA
FT                   DDKDGVIVAGLLMDSFNSTTYQIRIGNEGANADHAADPILLADITCRVGGVQSKNIQIQ
FT                   ASMQINGNNVVGDHFWLWRADHGSQKGGDARWQRDRCKNGLIVTGNDVTLYALFTEHYQ
FT                   EYEVLWLGERGRTYFFQNEPPYDAPNQASWSSQGGRVDGYAAFKVANTVKEHHTIGMGS
FT                   YAVFTGTDGNVNKKNGFEAPNSPNVKLEKMCITRFAGPGNIQNVINGTGGSTANGTKRV
FT                   ADYNNGEGAQPYDEEFILPNRESYPVYINMEK"
FT   sig_peptide     complement(213138..213224)
FT                   /locus_tag="Fjoh_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.558 at
FT                   residue 29"
FT   gene            213436..213837
FT                   /locus_tag="Fjoh_0201"
FT   CDS_pept        213436..213837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0201"
FT                   /product="rare lipoprotein A-like protein"
FT                   /note="lacks cysteine residue required for bacterial
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03238"
FT                   /db_xref="GOA:A5FNH6"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNH6"
FT                   /protein_id="ABQ03238.1"
FT                   /translation="MKKIILSMALAVSSAVLSQEVPASANTDVVNEEQNFYKKDAHASY
FT                   YHDKFNGRKTASGRKFNNNDLTAAHKTLPFGTMLKVTNEANNKFVIVEVTDRGPFVKGR
FT                   EIDLSKRAFMSIASNKKSGVVYVTIEILK"
FT   sig_peptide     213436..213492
FT                   /locus_tag="Fjoh_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.966 at
FT                   residue 19"
FT   gene            214057..214824
FT                   /locus_tag="Fjoh_0202"
FT   CDS_pept        214057..214824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0202"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03239"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNH7"
FT                   /protein_id="ABQ03239.1"
FT                   /translation="MGKIIAIANQKGGVGKTTTSVNLAASLGVLEKKVLLIDADPQANA
FT                   TSGLGIDVETVETGTYQILEHTVTPKEAILKCTSPNVDVIPAHIDLVAIEIELVDKENR
FT                   EYMLKKALEEAKEEYDYIIIDCAPSLGLLTLNALTAADSVVIPIQCEYFALEGLGKLLN
FT                   TIKSIQKIHNPDLDIEGLLLTMYDSRLRLSNQVVEEVQKHFNDMVFDTVIQRNVKLSEA
FT                   PSFGESIINYDATSKGAVNYINLAQEIIKKNSK"
FT   gene            214830..215738
FT                   /locus_tag="Fjoh_0203"
FT   CDS_pept        214830..215738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0203"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03240"
FT                   /db_xref="GOA:A5FNH8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNH8"
FT                   /protein_id="ABQ03240.1"
FT                   /translation="MTKAIKKQALGRGLSALLKDPENDIKSVEDKNADKVVGNIIELEI
FT                   SAIEINPFQPRSNFNEESLRELATSIKELGVIQPITVRKLDFNKYQLISGERRLRASTL
FT                   IGLTHVPAYIRIANDNESLVMALVENIQRHDLDPIEIALSYQRLIDEIQLTQEQMSERV
FT                   GKKRSTISNYLRLLKLDPIIQTGIRDGFISMGHGRAIINIEDLDVQTDIYQKIVSQNLS
FT                   VRETEALVKNYHEGQQPKEEGEGKAKPDSAFIVRETQKNTFNDYFGSKVDIKVAGNGKG
FT                   KITIPFNSEADFNRIIKLING"
FT   gene            215738..216298
FT                   /locus_tag="Fjoh_0204"
FT   CDS_pept        215738..216298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03241"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNH9"
FT                   /protein_id="ABQ03241.1"
FT                   /translation="MNKIVPISLLFFLLGTVSLFAQVKEETVLVAKDSIALEEIDPLTP
FT                   AKAAFYSAILPGLGQAYNKKYWKIPLVYGAIGTSLYFYIDNNNKYRDYRNAYKRRLEGY
FT                   NDDKYQYLDESRLVAGQKFYQRNRDLSALFVVGFYVLNIIDANVDAALIQFNVNERLSM
FT                   RPEIYPNDVTFKPNVGLTFNYRF"
FT   sig_peptide     215738..215803
FT                   /locus_tag="Fjoh_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.699 at
FT                   residue 22"
FT   gene            216337..217038
FT                   /locus_tag="Fjoh_0205"
FT   CDS_pept        216337..217038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0205"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03242"
FT                   /db_xref="GOA:A5FNI0"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNI0"
FT                   /protein_id="ABQ03242.1"
FT                   /translation="MKIALLGYGKMGKVIERIALERGHEIVLKKDEFNTYDGLSTADVA
FT                   IDFSVPSAAVSNISASFNANVPVVSGTTGWLEHYDEMIALCNEKKGGFISSSNFSLGVN
FT                   IFFGLNEYLAKIMNQFDSYKVSMEEIHHVHKLDAPSGTAISLAQGVIQNSNYAEWTLEE
FT                   AKSNQIHIEAKRIGEVPGTHTVNYDSVIDSIEIKHTAHNREGFALGAVIAAEWLAGKQG
FT                   IFTMKDVLNLQ"
FT   gene            217103..218656
FT                   /locus_tag="Fjoh_0206"
FT   CDS_pept        217103..218656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0206"
FT                   /product="signal peptidase I; peptidase subfamily S26A"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24,
FT                   S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03243"
FT                   /db_xref="GOA:A5FNI1"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNI1"
FT                   /protein_id="ABQ03243.1"
FT                   /translation="MTLYSWFVFFLAVQIIHFAGTWKLYLAAGRKSWEAAIPVYNSIVL
FT                   MKIISRPTWWTLLLFIPIINLIMFPVVWVETLRTFGKKSTVDTLLGIFTLGFYIYYVNY
FT                   TQKLEYNANRKLTPENKTADTVSSLLFAIIVATLVHTYVIQPYTIPTSSLEKSLLIGDF
FT                   LFVSKLNYGPRVPMTTVALPMVHDSIPLTKRKSYLSWPQLPYFRLPAFEKIKRNDIVVF
FT                   NWPVDTVHYFYEPKGRPGVIKPIDKKSNYVKRCVGIPGDSLSIKDGFVFINGKKLVLPE
FT                   RAKPQYSYSVALDGKTSIDFESLFKELDITDPAGFRTEKRDTLYFRALTEAGAERLKNT
FT                   PGVTAVKREIDHGNDNAIFPHINKWSQDNFGPIYIPEAGKTVALTNESLPFYKEIITNY
FT                   EGNTLELQGSKFLINGKETNTYTFRQNYYWMMGDNRHNSEDSRYWGYVPENHIVGKPVF
FT                   IWMSWDTNGKGINKIRWSRVFTTVDGEGQPQSYFKYFLIILALYFVGEFFWKKRKQNKA
FT                   "
FT   gene            218744..219358
FT                   /locus_tag="Fjoh_0207"
FT   CDS_pept        218744..219358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03244"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNG8"
FT                   /protein_id="ABQ03244.1"
FT                   /translation="MNSLILPTYFPSISHFAVMAQSENITFEMEDNFQKQTNRNRTYIY
FT                   SPNGIQLLNIPVKHSKAAHQKTKDILIENEFDWQKQHFKSLEAAYRSSPFFEYFEDDIV
FT                   PIFEKKHNFLMDLNFEVLDTVTKCLRMKLEFGKTTEYFHEVENISDFRHLANGKKDQNS
FT                   FEKYTQVFDDKHGFINNLSVLDLLFNEGKFAMDYLKTQKII"
FT   sig_peptide     218744..218806
FT                   /locus_tag="Fjoh_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.677) with cleavage site probability 0.623 at
FT                   residue 21"
FT   gene            complement(219355..220272)
FT                   /locus_tag="Fjoh_0208"
FT   CDS_pept        complement(219355..220272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0208"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03245"
FT                   /db_xref="GOA:A5FNG9"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNG9"
FT                   /protein_id="ABQ03245.1"
FT                   /translation="MPAFFVANGLFFVYWAIQFKKRLILSGLVLLTGITFISKFYKFSA
FT                   KEYSKDERDFSVMSYNVRLFNVFKWLDRDDIPENIKGFIDEKDPDILCIQEYSNSAHLD
FT                   LKVYPHRYIFIDGKQIKTGQAIFSKFPIIDEGKIVFPKSDNNVVYADIKRGKDIIRVYN
FT                   MHLQSIKISPDVSEISDDIDNVNQKKSQRIYARISKGFTQQQEQAEIFKEHIKKCKYPI
FT                   IICGDMNNSPFSYVYRNIKGKLKDAFEEAGEGFGATYKFKYYPARIDYIFTDTKMKVKQ
FT                   FESFPDFENSDHYPIMTRLSIDQF"
FT   gene            complement(220424..221287)
FT                   /locus_tag="Fjoh_0209"
FT   CDS_pept        complement(220424..221287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0209"
FT                   /product="Peptidase; family S54, Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03246"
FT                   /db_xref="GOA:A5FNH0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNH0"
FT                   /protein_id="ABQ03246.1"
FT                   /translation="MNILDDLKLQYKLGGIALRVIYWNIACFLISLVFFYQFSNGSFAF
FT                   PNWLALSSDPQVFMFKPWTFLTYAFFHFGFMHLLFNMLVLNFASNLFLTFFSQKQYLGL
FT                   YILGAIFSGIVFALSFYVLGTSASIVGASAAIMAILVAATTYQPLMNVRLFLFGNVKLW
FT                   HITGVILVLDLMQFRLDNMGGHISHLAGAFFGFIFIKLLQNGTDLSTVITRILDFFANL
FT                   FRKSPTTPFKTVHKNYKKPTEKTTSKIVTKDKTQQQIDEILDKISQSGYDCLTKEEKEF
FT                   LFKAGK"
FT   gene            complement(221334..222083)
FT                   /locus_tag="Fjoh_0210"
FT   CDS_pept        complement(221334..222083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0210"
FT                   /product="Peptidase; family S54, Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03247"
FT                   /db_xref="GOA:A5FNH1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNH1"
FT                   /protein_id="ABQ03247.1"
FT                   /translation="MMNMTPVVKQLLIINIIVFIGAQLVPVSYEYLALFFPENPGFKVW
FT                   QPITHMFMHGGFAHIAFNMFALYSFGSTLEHFWGGKKFLFFYISCGLGAALVNFAVNYY
FT                   FYQDSLNILLANGYHKADILNLLNDGKIDTRWQQILTVSEFKHFMNAYLGTVVGASGAI
FT                   YGLLVAFTFMFPNAELGIMFIPIPIKAKYFVPIYMLLFDGFFGIFGSSLMGIDSGIAHY
FT                   AHIGGAFFGFMIMWYWKKNQFNNNRWN"
FT   gene            complement(222080..224014)
FT                   /locus_tag="Fjoh_0211"
FT   CDS_pept        complement(222080..224014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0211"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM: DNA
FT                   mismatch repair protein, C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03248"
FT                   /db_xref="GOA:A5FNH2"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNH2"
FT                   /protein_id="ABQ03248.1"
FT                   /translation="MSSIIQLLPDHVANQIAAGEVVQRPASVVKELLENAVDAKATDIK
FT                   LIIKDAGKSLVQVIDNGVGMTVTDARLCFARHATSKIRQAEDLFSLGTKGFRGEALASI
FT                   AAIAHMEMKTKQEQDELGTHIVIEGSKFVSQEVAVLPKGTSFAVKNLFFNIPARRNFLK
FT                   SDTVEFRHVMDEFQRVALAHPNIHFSFYHNGSELYNLPAAGYRQRIVGIMSGKTNEKLV
FT                   PVNEDTEIISIQGFVCKPEFAKKNRGEQFFFVNDRFIKSGYLHHAVMAAYDGLLKDGSQ
FT                   PSYFLYLQVPPNTIDINIHPTKTEIKFDDEQALYAILRASIKHSLGQFNVAPVLDFDRD
FT                   SNLDTPYHYKDVEAEVPTIQVDGTFNPFTDDKTNQHYTKAGSGSGSGYSSGSSSSSGSG
FT                   SGSSYSGYSKRVEPTVSWESLYVGLDTENPETIESSPFIFENEEVTSSLFNDDEVEQAS
FT                   QKTYQIHKKYIVSPIKSGMVIVDQHRAHQRILYEQFLLNMTVNQASSQQLLFPLDLFYS
FT                   SSEMKLIEELKPSLETTGFVFEEAQTDHVVISGIPVNITESEVSLVIEQLLSDLQDGIP
FT                   ASSYSQNDTIAKSMAKSLAVKTGSYLTEKEQDNLVNGLFACKDPNISPFQKPTFITMRV
FT                   EDIDKKFAL"
FT   gene            complement(224178..224750)
FT                   /locus_tag="Fjoh_0212"
FT   CDS_pept        complement(224178..224750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0212"
FT                   /product="Riboflavin synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03249"
FT                   /db_xref="GOA:A5FNH3"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNH3"
FT                   /protein_id="ABQ03249.1"
FT                   /translation="MATENKNLSEYDKNTIPNAKDFRFGIVVSEWNDVITEGLYNGAFE
FT                   ALIDCDVPAQQIIRWNVPGSFELIYGAKKMLQTQNVDAVIVIGCVIQGETKHFDFVCEG
FT                   VTQGIKDLNVQTDIPVIFCVLTDNNMQQSIDRSGGVHGNKGTEAAIAAIKMAYIRQQAS
FT                   ISHPFNQPLLSSGALQIEETPIKIEKE"
FT   gene            complement(224829..225608)
FT                   /locus_tag="Fjoh_0213"
FT   CDS_pept        complement(224829..225608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0213"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03250"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNH4"
FT                   /protein_id="ABQ03250.1"
FT                   /translation="MATYNKRGYKAPKEKEVKEVTEEQQVVIDEKDSTTAGVFSKLDET
FT                   ASRTEDWVAKNQKIIIGLVAGIAVATIGYLAYQKFIETPKQDEAANEMFVAQQNFQKAV
FT                   DGVASDSLYKLALNGSEGKFGFVKIADEYSGTDAGNLANYYAGMAYLNTGKFDDAIKYL
FT                   GEFKSEDMILGALAKGAIGDAYSQKNNQKEALDYYVKAAESNKNDFTTPRFLLKAAKTA
FT                   LALGQKEDALKYLNNIKDNFDAAPEAASVEALIGLAQ"
FT   gene            225847..226926
FT                   /locus_tag="Fjoh_0214"
FT   CDS_pept        225847..226926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0214"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03251"
FT                   /db_xref="GOA:A5FNH5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNH5"
FT                   /protein_id="ABQ03251.1"
FT                   /translation="MHLNKLSLFNYKNFSEAGFDFDIKINCFVGKNGIGKTNVLDAIYH
FT                   LAYGKSYFNPLAVQNIKHGEEFFVIDAELEKNDRTEQIVCSLKKGQKKVLKRNGKAYDK
FT                   FSDHIGFIPLVIISPADRDLIVEGSETRRKFMDSVISQLDSTYLHQLIQYQKVIVQRNA
FT                   LLKYFALNHTFDNDTLSIYNEQLNEFGKSIFEKRKEFLEEFIPIFNVHHQAITGSEESV
FT                   QLVYESHLFEKDLLTLLQENINKDRALHYTSSGIHKDDLSFEIDSHPIKKFGSQGQQKS
FT                   FLIALKLAQFEFLKKQSGVKPILLFDDIFDKLDETRVAKIVEMVNSETFGQLFISDTHP
FT                   ERTEAIVKSTHQTYKIFNL"
FT   gene            227126..227803
FT                   /locus_tag="Fjoh_0215"
FT   CDS_pept        227126..227803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0215"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03252"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNG1"
FT                   /protein_id="ABQ03252.1"
FT                   /translation="MLTKESLQFLDDLKKNNNRDWFQDNKKRYEVFKKDYHQLVSDFLD
FT                   AMKPLDPSLELLEVKNCTFRINRDIRFSKDKSPYKAHLGVWMSTGAKGANRAGYYVHIE
FT                   KGASFIAGGFYSPDPEDLKKVRKEIAFFYDDLQEILNDKNFKKEFGSLDINENNSLKSM
FT                   PRGYEKDHPAIEFLKLKSFTATQKYDISEVTQKDFVSKVSKKLIALKPLNEFINRALDT
FT                   EEF"
FT   gene            227895..228953
FT                   /gene="remC"
FT                   /locus_tag="Fjoh_0216"
FT   CDS_pept        227895..228953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="remC"
FT                   /locus_tag="Fjoh_0216"
FT                   /product="RemC; Candidate alpha-glycosyltransferase;
FT                   Glycosyltransferase family 4"
FT                   /note="Protein involved in gliding motility;
FT                   Glycosyltransferase family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03253"
FT                   /db_xref="GOA:A5FNG2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNG2"
FT                   /protein_id="ABQ03253.1"
FT                   /translation="MKRKILFLGESYRADAITWVKGLKEFRDFEIITWELQTPNNSKLN
FT                   RFKRILEYFFSPVSIRKIIRNQKPDMVIAERTTSYGFLAALSGSKTIAIAQQGRTDLWP
FT                   EGSVLYPFKKFIQKYAFKKAHLIHAWGPVMTIHMKAIGVDMSKVLVLPKGIDLSLFTPS
FT                   TNNSNKIEAIVTRSLQPEYRHDSILKAFGILHQKGIDFSLTIVGDGTRLQYLKDLAKEL
FT                   QIENKVTFTGRIPNTELPKLLQQSNIYISMPITEGVSASLFEAMACNCYPVVSDIPGNQ
FT                   SWITHRENGQLIEIDNIEMLANELMWSFENAEFRNQAILRNRKFVEENANYDTNMKVIA
FT                   DRYHELLDSRNN"
FT   gene            229106..230209
FT                   /locus_tag="Fjoh_0217"
FT   CDS_pept        229106..230209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0217"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class V; aminotransferase,
FT                   class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03254"
FT                   /db_xref="GOA:A5FNG3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNG3"
FT                   /protein_id="ABQ03254.1"
FT                   /translation="MSNRRNWLKQIGLGAIGLSFTQFETFANPSAENYVSLDLDKSPIL
FT                   LRSNENPYGPSPLARAAMQKSVNSSNRYGWDLSGELISLIAKKNSVSDNNILLGAGSTE
FT                   ILDLVLQYTALKKGNFILAETTFNYWTFPFEKLGLKKITVPLTADKKHDLTAMLKAIDS
FT                   DTKMIYICNPNNPTGTICNYEQLVSFVKEVPKNIIVFVDEAYLDFTKEKSLSGLVIENQ
FT                   NLIITKTFSKMYGLAGARIGYAIAAASTIDELSALKSSPNLSVSSVSTAAALASLNDDK
FT                   FIQQVQTANEEVKKYTIEQLTKLNLTCIPSQANFIYFSLDNYKKDYFKQLENNNIQGTK
FT                   IYEENGKWTRITIGTMKEMQQFIEAVK"
FT   sig_peptide     229106..229189
FT                   /locus_tag="Fjoh_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.782 at
FT                   residue 28"
FT   gene            230382..231395
FT                   /locus_tag="Fjoh_0218"
FT   CDS_pept        230382..231395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0218"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03255"
FT                   /db_xref="GOA:A5FNG4"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNG4"
FT                   /protein_id="ABQ03255.1"
FT                   /translation="MEIQSNFSLKNYNTFGIEAKAKQFIAVHSVEELKTILKENKNEKK
FT                   FILGGGSNMLLTKDIDALVIHIDLKGKEIIKEDDDFVWVESQAGETWHDFVLWTIDNNF
FT                   GGLENMSLIPGNVGTTPVQNIGAYGTEIKDTFVSCNAINIETQETKTFTNAECNFGYRE
FT                   SIFKNEVKDQFIITSVIYKLTKRNHKINTSYGDILAELAKNNISEPTLKDVSNAVIAIR
FT                   QSKLPDPKELGNSGSFFKNPILLKSDFEQIHKKFPEMKFYEVSETEVKVPAGWLIEQAG
FT                   FKGKRFGDAGVHKNQALVLVNYGNATGQEILNVSKEVQKTVFETFGIKIEAEVNVI"
FT   gene            231435..231893
FT                   /locus_tag="Fjoh_0219"
FT   CDS_pept        231435..231893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0219"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03256"
FT                   /db_xref="GOA:A5FNG5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNG5"
FT                   /protein_id="ABQ03256.1"
FT                   /translation="MTEDISIKIINPDDEKAAPILEELSANLYLRFGSDGRNSFTDWQN
FT                   NNAKFVFVAAELNNEIIGCGAIRPIEGNIGEVKRMYSKFRGKKIGQTILTFLEKEAKKI
FT                   GFTELVLETRVKNIEAVEFYKKQQYNIIPNYGKYIDRPEAICFGKSLI"
FT   gene            231904..232518
FT                   /locus_tag="Fjoh_0220"
FT   CDS_pept        231904..232518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0220"
FT                   /product="negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03257"
FT                   /db_xref="GOA:A5FNG6"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNG6"
FT                   /protein_id="ABQ03257.1"
FT                   /translation="MYTPDLYKNENQEEIRTFLKENSFGILINQTNGKLYATHIPMELG
FT                   INAEGKEILEGHISKLNPQAEGFAANDQVLAVFSGPHSYISSSWYDHENVPTWNYIAVH
FT                   VYGRIKIVDYDTSVDQLKKLVDKYEANSANPVRVENLSDKTMREARGIFGLEIEIDEIQ
FT                   ATKKLSQNRDDHNYKNIISELEKTENPQSIAVAKEMSKCRK"
FT   gene            232603..233709
FT                   /locus_tag="Fjoh_0221"
FT   CDS_pept        232603..233709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0221"
FT                   /product="Candidate beta-glycosyltransferase;
FT                   Glycosyltransferase family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03258"
FT                   /db_xref="GOA:A5FNG7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNG7"
FT                   /protein_id="ABQ03258.1"
FT                   /translation="MLITLFYFFIAVVFIQLFYYLGIFGKFAFAKPQEVTPKNIPVSVI
FT                   VCAKNEEENVKKFVPLLAEQNYPDFEIVLIDDASSDETLEVFEEFEQKYPNIRLVKVEN
FT                   NEAFWGNKKYALTLGIKAAKKEYLLFTDADCYPTSKDWITSMTSQFTESKTIVLGYGGY
FT                   EKRERSFLNKIIRFETVLTAVQYFSWAKAGLPYMGVGRNLAYKKEEFFNVNGFIDHIQV
FT                   RSGDDDLFINQAANKSNTTISYNPESFTYSNPKESFKDWFTQKRRHISTAEHYKFFDKF
FT                   QLGLFFCSQLFFFLSVIVLLAFQFQWIAVVAILATRYTVVWTVIGFSAGKLKEKDIKIW
FT                   FPIVEIALILTQINIFITNIFSKPVYWK"
FT   gene            233700..234251
FT                   /locus_tag="Fjoh_0222"
FT   CDS_pept        233700..234251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0222"
FT                   /product="ECF subfamily RNA polymerase sigma-24 subunit"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03259"
FT                   /db_xref="GOA:A5FNF4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNF4"
FT                   /protein_id="ABQ03259.1"
FT                   /translation="MEINSKIEKAKKGDQVAFTFLLDYFWNEVYSFMLKRTENETTAED
FT                   VTIETFSKAFDKIASYNPEFQFNTWLIAIAKNVYIDLLRKKKTSLFIEITDTEDQQAYN
FT                   IADTTPSAEDALIKEQNLSRLLLCIKELKPHYQEVIQLRYFQELSYQEIADKIDEPLSN
FT                   VKVKILRAKKLLAEIINRNR"
FT   gene            234407..235237
FT                   /locus_tag="Fjoh_0223"
FT   CDS_pept        234407..235237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03260"
FT                   /db_xref="GOA:A5FNF5"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNF5"
FT                   /protein_id="ABQ03260.1"
FT                   /translation="MSKLSIYESKWTDLVFENKNKEYGAYQLRQENSKTTVNALFTALL
FT                   LITAVGSVSMLVNKFSIDNAVDTEPVIYKPLVVTDLNDIVKPKVEEYIAPPAQKQEPAS
FT                   QAPVTSSQLTNPVITHADQAVTEIATNRENTPVVDNTTAGPGTGVNTMPTTGGPGTGEI
FT                   DTPVVQGPYTPAALDKMPEFPGGIKNFYTYVGKNFTRPELDEERTLRVYVSFVIERDGS
FT                   MTDILVKNDPGYGLGKEAVRVLKSLKTKWAPGMIDGKAVRTAYNLPITIQTQPE"
FT   gene            235426..235806
FT                   /locus_tag="Fjoh_0224"
FT   CDS_pept        235426..235806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0224"
FT                   /product="protein of unknown function DUF1696"
FT                   /note="PFAM: protein of unknown function DUF1696"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03261"
FT                   /db_xref="InterPro:IPR012544"
FT                   /db_xref="InterPro:IPR037063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNF6"
FT                   /protein_id="ABQ03261.1"
FT                   /translation="MGIFSALMGNAGTVSQEDLLKKYGQLLTDNEEIEMGFKLIRDTFI
FT                   FTNKRLILVDVQGLTGSKTEYKSIAYKSITRFSVETAGTFDLDAELKIWVSSELNPSIV
FT                   KQFNKSVNVYDVQKVLAHHVLG"
FT   gene            complement(235863..236735)
FT                   /locus_tag="Fjoh_0225"
FT   CDS_pept        complement(235863..236735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0225"
FT                   /product="Peptidase subfamily M48-like protein"
FT                   /note="classified as 'non-peptidase homologue' by MEROPS;
FT                   may not have peptidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03262"
FT                   /db_xref="GOA:A5FNF7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNF7"
FT                   /protein_id="ABQ03262.1"
FT                   /translation="MKKKIIIAGFLFAAFGFTNMNAQINLGDKAIGALQKGVASFTLSN
FT                   ADAAALSKEAVRKLDSTNEVAGPNDGYTLRLNRVFGKHTAGEGFTLNYKVYKLKEVNAF
FT                   ATADGSVRVYSGLMDIMDDNELLAVIGHEIGHVANNDSRDAMRAAYQKEALIDGASSQS
FT                   AKISAVTDSQLGKIGSALIDSKHSRKQETEADLYSYNFLKKNGYNVNAEESAFRILAKM
FT                   SEGAEASFIDQMMSSHPDSKKRADDAKARAEKDGVYKPYVQQKIDNTVPKAATVKKTTT
FT                   TKKTTTKKK"
FT   sig_peptide     complement(236670..236735)
FT                   /locus_tag="Fjoh_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.760 at
FT                   residue 22"
FT   gene            complement(236943..237812)
FT                   /locus_tag="Fjoh_0226"
FT   CDS_pept        complement(236943..237812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0226"
FT                   /product="Peptidase subfamily M48-like protein"
FT                   /note="classified as 'non-peptidase homologue' by MEROPS;
FT                   may not have peptidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03263"
FT                   /db_xref="GOA:A5FNF8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNF8"
FT                   /protein_id="ABQ03263.1"
FT                   /translation="MKKRFTVLGILLAAFSFTQMNAQILSDKAMGALSKGVSGFTFSDA
FT                   DAAALAKESIAEMDANNPVAGPEDGYSIRLNRVFGKHISSEGVTLNYKVYLVKDINAFA
FT                   CADGSVRVFAGLMDIMDDNELLAVIGHEIGHVVNHDSRDAVKAAYKKEALLDAASSQSG
FT                   KIETMTKSQLGQIGSAMIDSKHSRKQESEADSFSYDFMKRNGYDVNAVEAAFRILQNLS
FT                   EGAEASFMTKMMSSHPDSGKRADDAKKKATKDGLYKAYVQQKIDNTAPVKAKTPAKTTA
FT                   KKTTAKKK"
FT   sig_peptide     complement(237747..237812)
FT                   /locus_tag="Fjoh_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.785 at
FT                   residue 22"
FT   gene            238108..238974
FT                   /locus_tag="Fjoh_0227"
FT   CDS_pept        238108..238974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0227"
FT                   /product="lipoic acid synthetase"
FT                   /note="TIGRFAM: lipoic acid synthetase; PFAM: Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03264"
FT                   /db_xref="GOA:A5FNF9"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNF9"
FT                   /protein_id="ABQ03264.1"
FT                   /translation="METVIENIPPAKPKWLKVKLPIGQKYTELRGLVDKYSLNTICTSG
FT                   SCPNMGECWGEGTATFMILGNVCTRSCGFCGVKTGRPETVDWDEPEKVARSIKIMNIKH
FT                   AVITSVDRDDLKDGGSIIWMETVRAIRRMNPNTTLETLIPDFQGIERNIDRIVEANPEV
FT                   VSHNMETVRRLTREVRIQAKYDRSLEVLRYLKEKGINRTKSGIMLGLGETEEEVYQTMR
FT                   DLRDANVDVVTIGQYLQPTKKHLPVKEFITPELFAKYEKYGIELGFRHVESGPLVRSSY
FT                   KAQKHIL"
FT   gene            239051..240049
FT                   /locus_tag="Fjoh_0228"
FT   CDS_pept        239051..240049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0228"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; PFAM: glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03265"
FT                   /db_xref="GOA:A5FNG0"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNG0"
FT                   /protein_id="ABQ03265.1"
FT                   /translation="MKTRIAINGFGRIGRNLFRLLINHPEIEVVAINDIADNKTMSHLI
FT                   KYDTIHGVLPFAVSFDEEGIIVNEKHYLFFHEKSISNLDWKSHSIDFVIESTGKYKTHE
FT                   ELNAHIEAGAKKVILSAPSEVDTIKTVVLGVNENILDGTENIVSNASCTTNNAAPMIKI
FT                   IEELCGIEQAYITTIHSFTTDQSLHDQPHKDLRRARGASQSIVPTTTGAAKALTKIFPK
FT                   LHEKIGGCGIRVPVPDGSLTDITFNVKRAVTIEEINIAFQKASKTNLKGILDYTEDPIV
FT                   SVDIIGNTHSCLFDAQLTSVIDKMVKVVGWYDNEIGYSSRLIDLILLIRKT"
FT   gene            240076..242250
FT                   /locus_tag="Fjoh_0229"
FT   CDS_pept        240076..242250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0229"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: TPR repeat-containing protein; response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03266"
FT                   /db_xref="GOA:A5FNE5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNE5"
FT                   /protein_id="ABQ03266.1"
FT                   /translation="MKYYYLLIVVCFLNPFLYSQTKQNTDSISYYNKLANKKLNSKEYN
FT                   EAVLLTKKSIDFCETNHIPEDLGNQTFKLGKIYYNQRKYDEALKNFHKSAASFDSIKPT
FT                   CTKILALHYIGAANTAQGDYKTADIYYLKAQKLLKELGVVDSSEILNFQKAMAFKANKN
FT                   YPLALKTFQKIIKKPDNSSVIKTKIKSYYQLGLIETQLKRNDSAMIYFDKALDYNEKTN
FT                   DLAQKSKIVLAISRYYKQNKNYDLAYSYLDEHYQLENYILKLKNAKIDFNEFEKFKKNQ
FT                   NLNNTIKRESEEKIQLKTYRYSKLVSILAIALISILSLLSLALYKNNIIRNQNNLLLRE
FT                   KNKELILAKNKAEKASKARSEFLSTVSHELRTPLNAINGITHLLLEDNPKKAQLKYLES
FT                   LKFSGNYLTTFINEILEINKIDSTKVEVENISFNLKELLFNIQSSLKELATANKNYFNL
FT                   EIDKAIPDILIGDPTKLSQIILNLINNALKFTQNGQVSVIAKLFAEEDENATVYFEIVD
FT                   TGIGIPEDKLQTVFESFSQGSIEVNRKYGGTGLGLTIVKKLIELLGGEIKLKSEVGKGS
FT                   TFTFKLNFKINNEPLEAVTEEKPYNDKQLKHKSILLIEDNKINQMITRKMLENKAITCE
FT                   ILDNGEEAVELLKVKRFDMILMDVHLPGINGTTATQQIREFDKTTPIIALTAISLDENR
FT                   DMLLSFGMNDVITKPFVPDVFYSTIAKFFD"
FT   gene            complement(242264..243286)
FT                   /locus_tag="Fjoh_0230"
FT   CDS_pept        complement(242264..243286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0230"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03267"
FT                   /db_xref="GOA:A5FNE6"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNE6"
FT                   /protein_id="ABQ03267.1"
FT                   /translation="MNLLRKILFPFAILYGLITSIRNFLFDKGILKSTSFDLPVIAVGN
FT                   LSVGGTGKTPQIEYLIRLLSNKYRAATLSRGYKRKSEGFVLADENSNAEILGDEPFQFY
FT                   QKFPDVQVAVDANRTNGITQLLSQNVKPQVILLDDAYQHRKVKAGFYILLTSYDDLYAD
FT                   DFMLPTGNLRESRSGANRANIVVVTKCPKNLSEEKQAEIRLKLKLSCSQQIFFTYIDYD
FT                   VEIYGKDEKISAAEIKSESKLLLAGIAKPKPFFEYLKNENDECLTFPDHHHFSDADLES
FT                   IQNKANGRKIITTEKDYVRLKDSKLVSQLYYLPIKSTFINHQQNFDVSILQYIKENLEP
FT                   "
FT   gene            complement(243291..243572)
FT                   /locus_tag="Fjoh_0231"
FT   CDS_pept        complement(243291..243572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0231"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
FT                   PFAM: Addiction module toxin, Txe/YoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03268"
FT                   /db_xref="GOA:A5FNE7"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNE7"
FT                   /protein_id="ABQ03268.1"
FT                   /translation="MGKFRVEVTKVANQDIEKHKKSGNKISIKNIAKILIDLTENPYEG
FT                   FGNPEPLKYEYSGLWSRRINQKDRLIYRVDDEVVTVFVISAMGHYSDK"
FT   gene            complement(243548..243796)
FT                   /locus_tag="Fjoh_0232"
FT   CDS_pept        complement(243548..243796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03269"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNE8"
FT                   /protein_id="ABQ03269.1"
FT                   /translation="MTTIKIDEKTKTGKAFMAMFETFFKGVEGIEIVEPDYGQVNEEPS
FT                   IYSSEFVEKVKKAEENIKNGETTTLNPDDIWGSLGLK"
FT   gene            244018..245112
FT                   /locus_tag="Fjoh_0233"
FT   CDS_pept        244018..245112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0233"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03270"
FT                   /db_xref="GOA:A5FNE9"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017221"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNE9"
FT                   /protein_id="ABQ03270.1"
FT                   /translation="MKIKDIITVLEEMAPLAYAEDFDNVGLLVGNPETESTGILVCHDA
FT                   LENVIEEAKTKNCNLVVCFHPILFSGIKKITGKNYVERAILKAIKNDIAIYAVHTALDN
FT                   HLQGVNKIFSHALGLINTRILIPKQQFIQKLVTYTVPDNAEKVRNAMFEAGAGTIGNYD
FT                   NCSFNSEGFFTFKGNEKSNPVIGEKGKLHTGTEIKIEVIFEKHLQSRVLKALLTNHIYE
FT                   EVAYEIYDLQNAHQNIGLGMIGELENEMDEKEFLLYAKDIMIARGIRHSAFTGKKIKKV
FT                   AVLGGSGSFAIKNAIQAGADAFLTADLKYHQFYEAENKLLLADIGHFESERYTKNYIVD
FT                   YLRKKILNFAIILSEENTNPVKYL"
FT   gene            245116..245895
FT                   /locus_tag="Fjoh_0234"
FT   CDS_pept        245116..245895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0234"
FT                   /product="protein of unknown function DUF164"
FT                   /note="PFAM: protein of unknown function DUF164"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03271"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNF0"
FT                   /protein_id="ABQ03271.1"
FT                   /translation="MTNTKELSVEDKLRAIYDLQLIDSRIDEIRNVRGELPLEVEDLED
FT                   EVAGLSTRSEKLKGELEVIEEQIKAKKIAIEEHKEVIKKYTKQQESVRNNREFNSLTKE
FT                   VEFQELEIQLAEKQIKEMKASIEHKKEVISNLKEKLDAKSSHLKHKKSELDAIMAETQK
FT                   EETFLTEKSAEYSAQIEDRLLAAYNRIRSSVRNGLAVVSIERGASAGSFFTIPPQTQVE
FT                   IASRKKIITDEHSGRILVDTQLAEEEKEKMEQLFSKF"
FT   gene            246063..246926
FT                   /locus_tag="Fjoh_0235"
FT   CDS_pept        246063..246926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0235"
FT                   /product="hydrolase or acyltransferase (alpha/beta
FT                   hydrolase superfamily)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03272"
FT                   /db_xref="GOA:A5FNF1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNF1"
FT                   /protein_id="ABQ03272.1"
FT                   /translation="MKIKKGIRFITLKSVGTYINFLSYVRPQKALELSYALFSQPRIGR
FT                   LQKEKLPKVLQNTETEIFHHNEHHFQTYVWKGNETKILLVHGWESNSSRWKKTLPHLQK
FT                   SGSTIIALDAPAHGQSSGKEFNVPLYAEFINKAVEKYQPEIIIGHSIGGAACVYHQYLF
FT                   PNTSINKMVILGAPSELKTLIDNYVSMLSLNTKMFSLLESKFLDRFNFKLEDFSGQKFA
FT                   SQFTIPGFIAHDTSDKIVAFDEGKKIASNWKNSQFIETSGLGHGMHDDELYDKVIEFLF
FT                   SSEERK"
FT   gene            247015..247833
FT                   /locus_tag="Fjoh_0236"
FT   CDS_pept        247015..247833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0236"
FT                   /product="ribosomal large subunit pseudouridine synthase F"
FT                   /EC_number="5.4.99.-"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03273"
FT                   /db_xref="GOA:A5FNF2"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNF2"
FT                   /protein_id="ABQ03273.1"
FT                   /translation="MEENLKRLNKFIGETGYCSRREADKLIEEGRVTINGAAAEMGTKV
FT                   SSDDEIRIDGKLIVEKHEKLVYLAFNKPVGIECTTNLEVKNNIVDYINYPKRIFPIGRL
FT                   DKASEGLIFMTNDGDIVNKILRARNNHEKEYTVTVNKPITERFIQRMGNGVPILDTVTK
FT                   KCKVEQISKYTFKIILTQGLNRQIRRMSEYLGYEVTALKRIRIINISLDVPVGRYRDLT
FT                   DAEIKELNKLIEPSSKTEEASLPKAAAPTPSRRSTFISKNDPRFRKRGNN"
FT   gene            complement(247897..249804)
FT                   /locus_tag="Fjoh_0237"
FT   CDS_pept        complement(247897..249804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03274"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNF3"
FT                   /protein_id="ABQ03274.1"
FT                   /translation="MKKITMILFLTFAGFTGFAQRTADEVLKMNSKIEDLMQNPITGVI
FT                   VVKEGNVVKGINPETKAEAWSFDADKAVGEGTTLEALSKLDTDNLFASKRILKNIDGTP
FT                   YIEALVNYKTVLINTLDGKVVYNSANYKYTVFNSQFLYGENQYLVKGAENGKVIASLID
FT                   LNTGNVLWKTEQGDAKSAFASMFTFKANFSNEAEVSANTIYSLYMGRLSAIDRNTGALK
FT                   WVGELEYTKVFPTQNDKNLVVINSKGLISFKQYLNVLDAETGKPIWEDAIKTKYIVYLE
FT                   DWGDKILVAHNSGFNFYNLKDGSKVWKKDARGDGLKKVISIDGDYLYVAENEMMLIDKD
FT                   GQKKWKSFIEISDDKEDAINYLGKVDDKVLYLTATYGNMVDYKTGKKLWRGNLKFNAKR
FT                   PLLNVFDEENNQFLVYNDEELFKFNTTVKDKPDPFAKVNIKKEKELNSIELFSWGVALS
FT                   GPTEVMGVSKEGKVLYHRIYTQPGDGGRAWGQALATAGSIGLGVSAGYNAAVGSEWRMV
FT                   YIDPATGQETGSSVIKKQNDKQLNRAAKQAAGSAALADVSKRFSQRFDAMRQSRDFSYI
FT                   FAKDEATQKKVLVKVRKDDGTELDKILFENMRPIYEVDFATQSVYYIFENELRIFNNKI
FT                   "
FT   sig_peptide     complement(249733..249804)
FT                   /locus_tag="Fjoh_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.646 at
FT                   residue 24"
FT   gene            complement(249947..251335)
FT                   /locus_tag="Fjoh_0238"
FT   CDS_pept        complement(249947..251335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03275"
FT                   /db_xref="InterPro:IPR025231"
FT                   /db_xref="UniProtKB/TrEMBL:A5FND8"
FT                   /protein_id="ABQ03275.1"
FT                   /translation="MKKHQIILACTVIFTLLFYNQSPGVNLSIFGVMLTLLISYFFQEK
FT                   FVDRSHLVLVVTSILSCFAFAWYGDAASFFALALSILFLQFKTHDGELKIVQIFPLIFL
FT                   NGITSLGRVFLFNQWLPERKIHNDLAKKIVAFFVIPLLFLGLFFIVYSFGSNHFSSLFT
FT                   DYTLDIDIFQLILISILGFYVSFSFWNYWVPDACYEFNPKLSNEFSNISEVKNQSTFSF
FT                   LDLDFERKSGEITLFLLNIMLLVFIATYNYEQFFEVIEKTNLSADTHERVNAVIFSILM
FT                   AVGVILFYFKGGFNFDEKAHLLKKLAKVWIVLNVVLIVSAMIKNTEYVSFYGLTYKRLG
FT                   VYAFLILAIIGLVYSFLKITKQKTNAYLVNQMVWYFYSTILICSFFNWGNLITNYNISV
FT                   NKGVEPKFLSSLNFNDEARREYFKKNNLDGQYPEAVREEMIGNYQEAGFLSKALYYDFV
FT                   EVKR"
FT   gene            complement(251394..251684)
FT                   /locus_tag="Fjoh_0239"
FT   CDS_pept        complement(251394..251684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0239"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03276"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FND9"
FT                   /protein_id="ABQ03276.1"
FT                   /translation="MGIIDKLNKDFESRVRLGIMSVLMVNDWVDFTEMKTLLNITDGNL
FT                   ASHSSALEKSEYIEIKKEFVGKKPKTSYQVTPLGRAAFKEHLSYLEKLMKS"
FT   gene            complement(251689..252303)
FT                   /locus_tag="Fjoh_0240"
FT   CDS_pept        complement(251689..252303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03277"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNE0"
FT                   /protein_id="ABQ03277.1"
FT                   /translation="MNQKHQEDLAHIRSMMERSSRFISLSGLSGVFAGLSALIGGIYVY
FT                   QLFKANGMDYLNDEHRLYSANLVSELFWIGITILVFAFAFGIFFTIRKSRKYNLPIWTS
FT                   ATKKMVFNLAVPLFAGGIFCLALMHHGYFGLVAPSTLIFYGLAVINAEKYTFSDIKYLG
FT                   FSELILGCIALFNIGYGLIFWILGFGILHIVYGLVMFKKYK"
FT   gene            complement(252411..255200)
FT                   /locus_tag="Fjoh_0241"
FT   CDS_pept        complement(252411..255200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03278"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR041700"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNE1"
FT                   /protein_id="ABQ03278.1"
FT                   /translation="MIKTFKFHALFFHLILLNKFFSIRSRIKMLHFFVFFLYSISSFAQ
FT                   KSTVISGKVVTEKDSPIESATIYLMHPKDFSIVVYTLSDKNGHFRLETKSGSQNNILKI
FT                   SAEGYLEFSDTIEKRTQNIDLGVVRLMKYDVELDEVIIKNDAPIRIKKDTIEFNASSFK
FT                   LRPDANVEALLKELPGVTIDMDKKIMVNGKKVNQVLVNGKPFFDADGKIALQNLPAELI
FT                   KKVQVSDTKTKEQEFTKQASTSENVSINLTIDKKKNKGFFGKLLGGYGSSERYESSALL
FT                   SYFKDKRRVSFLASSNNINASGFSMNEVFDNMGGGRNDGSDGSFGSRGGITKSNMIGIS
FT                   YTDEWFKGESTDLNYYFNNSNTDNTNKTSELTLLPTGSLLSKSASKSDQDFNRHNVSLN
FT                   FEYKVSPSIKVFFAPAIQTGKTVSVNAFDRKTWDENNQLINSSNSFNTTQSNNTNFRNN
FT                   LRFFLNAKKEGRYFTASFENENSRNDLDSKVNSLTVFAEGTSPDDLRNQNVTQKNNRDK
FT                   YIGNLQYFEPVTDSLRLNFSVITDYEKTSDDKKTFDRNGQDMEYDVFNESLSNFNSFNS
FT                   FGVNPKVGFSMSIKKLDLSASAGTSVIRTENHAFYLNETIDLNKNYFIPNGTISANYSI
FT                   SQSQSVLMMYERKYTIPSGNQVLAVADLDNPLVVRTGNPNLKASTFHFLQTGFSSYNFE
FT                   SDSGYFLHFSTTYFDNQIVGASAYNSSGKQISTFDNVEGTYDMLLAGEWNKRIKKDVNT
FT                   FGLRFSLYANYNLNKGFTNNQLYEAKAFRLNPGFGFTYEYGELLNIQPYYNFTYNDIRY
FT                   NNTSLSSTSNTTHNFNVEITNFWPKNWVFGNDFGYNYNSNISGPYKRDFYLWNTSLSYK
FT                   FAKQFTFKVKVYDLLNQNQSTSRTITSTAVVDSESNVLKRYVMFSLLYKFKNFVTNES"
FT   sig_peptide     complement(255066..255200)
FT                   /locus_tag="Fjoh_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.725 at
FT                   residue 45"
FT   gene            complement(255587..256513)
FT                   /locus_tag="Fjoh_0242"
FT   CDS_pept        complement(255587..256513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0242"
FT                   /product="Mg2+ transporter protein, CorA family protein"
FT                   /note="PFAM: Mg2+ transporter protein, CorA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03279"
FT                   /db_xref="GOA:A5FNE2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNE2"
FT                   /protein_id="ABQ03279.1"
FT                   /translation="MKAFYTNNNGLIEIQKWTSNCWIHIESPTESDKNYLLEELQIPEA
FT                   FYNDIEDIDERPRIEIEDGWTLIIMRIPIKSGDVKIPFHTVPLGIIFKDGICVTISFYK
FT                   TEIIQDFVAYSQRKNIEIEDNFNLVLRLLLSSSVWYLKYLKQINQKIKLAEDNLEKSIK
FT                   NEELQALLQIEKCFVFFITSLKANDVLFQRIKNLKAHKANYDPELLEDVEIELNQAQDT
FT                   ANIYNNILTGMMDAYASVISNNMNNIMKQMTSISIILMIPTLIASLYGMNVPNGLEESR
FT                   YGIWILLLVSIILSTFGVFLFKRRRWF"
FT   gene            complement(256930..257817)
FT                   /locus_tag="Fjoh_0243"
FT   CDS_pept        complement(256930..257817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0243"
FT                   /product="Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03280"
FT                   /db_xref="GOA:A5FNE3"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FNE3"
FT                   /protein_id="ABQ03280.1"
FT                   /translation="MQLLDGKKTSNDIKNEIAAEVQSIKAAGGKVPHLAAVLVGNNGAS
FT                   LTYVGSKVKSCQEIGFDSTLVSLPETITEDELLAKIKELNEDDNLDGYIVQLPLPKHID
FT                   EQKILLAIDPDKDVDGFHPTNFGRMALEMESFIPATPFGIMELLERYKVETAGKHTVVI
FT                   GRSHIVGRPMSILMSRKGNPGDSTVTLTHSRTKDLAEFTKNADIIITALGVPEFLKADM
FT                   VKEGVTVIDVGITRVEDASNAKGYVIKGDVDFEGVSKKASFITPVPGGVGPMTIAMLLK
FT                   NTLLARKMRSAKNK"
FT   gene            complement(257956..259308)
FT                   /locus_tag="Fjoh_0244"
FT   CDS_pept        complement(257956..259308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0244"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="TIGRFAM: signal recognition particle protein; PFAM:
FT                   GTP-binding signal recognition particle SRP54, G- domain;
FT                   Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54, helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03281"
FT                   /db_xref="GOA:A5FNE4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNE4"
FT                   /protein_id="ABQ03281.1"
FT                   /translation="MFDNLSDKLDKAFHILKGHGKITEVNVADTLKEVRRALLDADVNF
FT                   KIAKDFTTKVKEKAIGQDVLTTLQPGQLLVKLVKDELTELMGGDVAGVNLSGNPSVILM
FT                   SGLQGSGKTTFSGKLANFLKTKKNKKPLLVACDIYRPAAINQLHVVGDQIGVEVYSEPE
FT                   NKNPVEIAQNAIKHAKANGFNVVIVDTAGRLAVDQEMMDEIARVHKAIQPQETLFVVDS
FT                   MTGQDAVNTAKAFNDILNFDGVILTKLDGDTRGGAAISIKSVVNKPIKFVGTGEKMEAI
FT                   DVFYPDRMAERILGMGDVVSLVERAQEQFDEEEARKLQKKIAKNEFGFDDFLTQIQQVK
FT                   KMGNMKDLVGMIPGASKAMKDVEIEDDAFKHIEAIIHSMTPGERSKPAIIDVKRKARIA
FT                   KGSGTKVEQVNQLMKQFDQMSKMMKMMQGPGGKNLMKMMGGMKGMPGGMPR"
FT   gene            complement(259667..261349)
FT                   /locus_tag="Fjoh_0245"
FT   CDS_pept        complement(259667..261349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0245"
FT                   /product="membrane bound O-acyl transferase, MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase, MBOAT
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03282"
FT                   /db_xref="GOA:A5FND1"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:A5FND1"
FT                   /protein_id="ABQ03282.1"
FT                   /translation="MTTIDSINNWFIQNFGAITIEQVESWFVYNPDEKLLFNTGLFLGL
FT                   FLVFYFVYGFLRKTFYLRLTYVILFSLFFYYKSSGIYFLLLLLSSVVDYGLSQIIYKET
FT                   KDSTKKIYLVISVILNLGLLGYFKYMNFMIGTYNDMFNGNLKFHDIFLPVGISFYTFQS
FT                   MSYIIEIYREEIKPTKNYIEYLFFVSFFPQLVAGPIVRAKDFLPQIYQKLNLTKQDVNN
FT                   ALFLIIGGLIKKTVISNYISVNFVDRVFDTPMNYTSFENLMASYGYAIQIYCDFSGYSD
FT                   MAIGIALLLGFKLPANFRTPYKSTSITDFWRRWHISLSTWLKDFLYISIGGNREGSFAG
FT                   YLFPSLFFFGLLLWGITNYNISIIPLIVASVSIAVFCLSFLLSSKKKQTLVTNLNLFTT
FT                   MLLGGLWHGAGAQFIVWGALHGLALAVHKIFLEFFPARKDGKSNFLWTFFSIIITFHFV
FT                   VFCWIFFRARDFETALQVINNIGQLTFEPEHWQAIVLGYKNVFLLMLFGYVWHFLPEVI
FT                   TNKMKFVFDRTPLLIKAIILGFVYWIVYATAVAGSQPFIYFQF"
FT   gene            complement(261351..262772)
FT                   /locus_tag="Fjoh_0246"
FT   CDS_pept        complement(261351..262772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0246"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family;
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03283"
FT                   /db_xref="GOA:A5FND2"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A5FND2"
FT                   /protein_id="ABQ03283.1"
FT                   /translation="MNKLLIFFCCLFFSTNDKPETTVSLPITKNMVSKIDSTSVETYTG
FT                   NHIYNAKVLESVFKRLRDNESDNNQKINIVHIGDSHIQGDLMTNKIRKLLQQKFGNAGR
FT                   GFVFPYQLAKTNGSYNERFSCNRIWESYRNIYPVRNYPVGLSGIGLWRDTGGFVMEMSV
FT                   KDAAYKFNTIQIITPKNENMFDLASGSQTKFVETTERKVITHKIKKGEAISVIADKYDV
FT                   SVAEIKRANQLKSNNIRAGRILKIPTNQTQPKNIKTSEFVPLNLESDAFCHYYKSEKAL
FT                   DRIFLIPNKEAKDFELNGLVLEKNAPGITYSGIGVNGAKFSDYNKYPLFFEQLKALHPD
FT                   LLIFSLGTNESFDKLEASEYIRRLREFIKNIKEQNINVPIIVMTSPPSLFRGRKPNHFV
FT                   GEYAQRINDIAEKDGFAVWDLYDELGGLSGIGQLKAEGLIGKDWVHYSKKGYEKQGSLF
FT                   TEAFLKAYDNFKLKK"
FT   gene            complement(262765..264237)
FT                   /locus_tag="Fjoh_0247"
FT   CDS_pept        complement(262765..264237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03284"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A5FND3"
FT                   /protein_id="ABQ03284.1"
FT                   /translation="MNTKSYFFQSFAIVALAFVAFIGFKQILPDKIFSEGKVDSKNVLI
FT                   DSLLLESVAKDSLSLDGDNIADKSGQEKIVYDASEGIEFPSETFDNYKGYQYLISFYEK
FT                   LYQLEQNPQGHVRIAYYGDSMTDGDLIVQDVRMNYQEHFGGNGVGFVSIISESSASRGS
FT                   VKTLFSKNWKIQSYLNVKKPTSPFGVNGHVFFANDKSNTTWVQYEAGLNKYSTSLDNPT
FT                   LFYGRSAKKGNVNFIIGKDTLRKNLSPNNLVNSLKVTSGSIKSFKANFIHADSIPIFGF
FT                   NFDNGIGVHVDNFSQRGNSGLPISMFDANVMQAFNNSLKYDLVILHYGTNVLNYGTKNY
FT                   SWYQKGMTKTVNKIKESFPGVSILIVSTADKSTKYDLEMKTDSAVVPLMNAQKRYALDT
FT                   ESGFVNLYTLMGGDGSMVKWVDESPAKANKDYTHFNQRGAKAIGNLLYSQLNKGYEEYK
FT                   ILREKRDGSVKPKAIRKPKADSVSVKKDSVNE"
FT   sig_peptide     complement(264160..264237)
FT                   /locus_tag="Fjoh_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.689) with cleavage site probability 0.682 at
FT                   residue 26"
FT   gene            complement(264603..265223)
FT                   /locus_tag="Fjoh_0248"
FT   CDS_pept        complement(264603..265223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0248"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03285"
FT                   /db_xref="InterPro:IPR025921"
FT                   /db_xref="UniProtKB/TrEMBL:A5FND4"
FT                   /protein_id="ABQ03285.1"
FT                   /translation="MKTKFLKLSLLALFIFTASCSSDDDKNEVVPVVTTKVSNIAAPQT
FT                   GGQGQPAGGAFAKFSFSQNKLVTDNSWDIAFRGTTIIVNGGAKIGIADEPERTGSGAVS
FT                   IVSGTFASVTAFPAASTFAQDAAAVYSIPTGSGKGWYSYNADTHIISPIAGKVFVVKTH
FT                   DGKYAKFEILSYYKDAPASPTQTSESPYYTFNFAYQANSATTF"
FT   sig_peptide     complement(265155..265223)
FT                   /locus_tag="Fjoh_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 23"
FT   gene            complement(265251..267317)
FT                   /locus_tag="Fjoh_0249"
FT   CDS_pept        complement(265251..267317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0249"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03286"
FT                   /db_xref="GOA:A5FND5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A5FND5"
FT                   /protein_id="ABQ03286.1"
FT                   /translation="MKIKITLFAVLLLSQVSVSQEVKKDSVSANELSEVKVTTATRTER
FT                   VLSSLPLPMTIITSEAIIKSGVTRLNEILSEQTGIILIPDESGFEGIQMQGLDAAYTMI
FT                   LIDGVPLVGRSAGVLDLSRVSVGNIERIEIVKGASSALYGSEAMGGVINVITKKPKKDM
FT                   FSGSLSYRYATFNTNDANTNLLWKKKKFSANLFANFYSTDGYDLDKSTPLKNVEPFYNF
FT                   TIQPKIYYDFSENLKLIVSNRFYDMKMDNVAIIDSENYKGDAKEKEWNSQVKFEHKWSS
FT                   KLYSEYEFYTTNYKNDSFLNDANNVLYESAYYNQWLLRPEIRTTLSIKNDKLTGGLGLN
FT                   YETLDRTYFDKKVEFNSQYFFLQYDCNPTERWNIIAGFRYDNHSVYASQFSPKLAVNFK
FT                   INENFSLKSSVGYGYKAPDFRQLYFDFTNPSVGYTVLGYNVAEARLNQLQEQGQILSRV
FT                   DGVNFNNPLEAESSINFNFGTFYKKNKLRLDVNAFYNSIENLIDARVVAQKTNGQNVFS
FT                   YFNISQIFTYGLEFNSTYDFTKQLSVSFGYQYLTAKDKSVVDNFEDYQYIRNSDLQTVQ
FT                   IKKSDYFGLYNRSKHTANVKVAYSIPKIKTDINLRVFYRSKYGMFDTNGNQILDKYDKF
FT                   VSDYFITNLSISKYIGDKFMLQAGANNLLDFTDPSQISNLAGRQLFARIQYNF"
FT   sig_peptide     complement(267258..267317)
FT                   /locus_tag="Fjoh_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.985 at
FT                   residue 20"
FT   gene            267421..268322
FT                   /pseudo
FT                   /locus_tag="Fjoh_0250"
FT   gene            complement(268806..270584)
FT                   /gene="argS"
FT                   /locus_tag="Fjoh_0251"
FT   CDS_pept        complement(268806..270584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="Fjoh_0251"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03287"
FT                   /db_xref="GOA:A5FND6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FND6"
FT                   /protein_id="ABQ03287.1"
FT                   /translation="MSLSQILTPSIQKAIQVLFDVSVDKIEFQTTRKEFEGDITMVIFP
FT                   LLKVIKSNPAELGNKIGTYLVENVSEVARFNVVSGFLNIVISDSYYVDFFNGIKDQKQF
FT                   GFLSPNPEEKAVMVEYSSPNTNKPLHLGHVRNNLLGYSVAEILKASGKKVYKTQIINDR
FT                   GIHICKSMLAWEKFGNGETPESSDLKGDKLVGKYYVEFDKAYKTEINQLIETGKTEEEA
FT                   KKQAPIIIEAQEMLKKWEAGDEQVIALWKKMNQWVYDGFATTYTNLGVNFDKYYYESNT
FT                   YLLGKDVVQVGLDKGVFEKDPDGSVWIDLTDEGLDRKIVLRSDGTAVYMTQDIGTAIQR
FT                   VKDMPDVGGMVYTVGNEQDYHFKVLFLILKKLGFDWASSLYHLSYGMVDLPSGKMKSRE
FT                   GTVVDADDLMQDMTDTAKQIAEDLGKLDSYSADEKAKLYKTIGLGALKYYILKVDPKKR
FT                   ILFNPEESVDFAGNTGPFIQYTYARIQSIIRKADFDFSNKIEIEELHEKEKELVKQIEL
FT                   FPEVIQNAAQNHSPALIANYTYDLVKEYNSFYQSVHILGEADLTKKIFRVQLSQKVAEV
FT                   IKSAFSLLGIEVPERM"
FT   gene            270907..273324
FT                   /locus_tag="Fjoh_0252"
FT   CDS_pept        270907..273324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0252"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03288"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR041700"
FT                   /db_xref="UniProtKB/TrEMBL:A5FND7"
FT                   /protein_id="ABQ03288.1"
FT                   /translation="MKLKFFLFAILGIIATAQAQNSGSVSGKIVEKSNNAPISYATVSL
FT                   KENGKVVTGVNTDDNGDFTFKNLALKSYTIEIQYIGFRKYVGSVILNDNKKTATVNVSL
FT                   EEEATQLKGVNIVAERSTIEQKIDRKVVNVGKDLTTAGASASDIMNNIPSVNVDQDGKL
FT                   SLRGNDNVRVLIDGRPSNIDPAQLLKQIPSTSIKKIELITNPSAKYNPEGMSGIINIIL
FT                   HKNANTGFNGSYSGGITFGETAKYNQSLDLNYKTGKVNFFGNAGNNFGTYFNNGNIQRL
FT                   DQDVVQKLKISNDNDNYLYKVGMDYLINDHNTLSFYTNQNKSSGTGIVNTDIDYNNGDP
FT                   NIKNIYQKSRYQGPNQTGTYNLAYKHIFKKEGHTLDFEGNYSKTAESQDANFDTQTTNP
FT                   ANAVNSVIYNDYIHESRKLGTFNVDYVNPLNDKTTLEAGAEARITRTDNDYNTSNPSVP
FT                   TAEQISNYKYDTDIYSAYVTFGQKYKKFSYQLGARFESYKVAANLNSGQSKFDDDYITL
FT                   YPSAYLTYNLNEKNVLQLSYSRRVDRPSLEQTKPIREFSTPLVTSYGNPELRPQFTNSV
FT                   EVNYTKTLEKGSITAGVFVRSINDQISRTLSPDPNDASGYKQILSFANYDHNSAYGFDV
FT                   SLNYKLTKWWDIQPAIDFSSIKQEGVVFQFDPATNTSSPFQRSVTTSAFNARMNSNFKP
FT                   TKRLSFLLFGFYRGPVDEIQQKRNEMYKIDIGSRYTLLDNKMNISVRFNDVFNTMKFSF
FT                   DGIYPYPQTGQFTWESQTVYLGLTYNFGGAKIKKLERKQREDNTNQGGGGMF"
FT   sig_peptide     270907..270966
FT                   /locus_tag="Fjoh_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 20"
FT   gene            complement(273423..274094)
FT                   /locus_tag="Fjoh_0253"
FT   CDS_pept        complement(273423..274094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0253"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03289"
FT                   /db_xref="GOA:A5FNC3"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNC3"
FT                   /protein_id="ABQ03289.1"
FT                   /translation="MKKNQLEIACFNYESAIIAQENGADRIELCENMKLGGTTPNSILV
FT                   VKVRESLNIKMHVIIRPRGGDFVYSDEELTEMKQDIKQYKKLGVDGFVFGILKDSGNIN
FT                   KRQNKELVHLAHPLPCTFHRAFDVVKNVEKSLEDVINCGFKTILTSGQAVNVEEGILAL
FT                   ERIQELAKNRIEIMPGGGLRSSNIKLLQEKLDLTFYHSSAITNNSETANPEEVKELKNF
FT                   L"
FT   gene            complement(274199..274522)
FT                   /locus_tag="Fjoh_0254"
FT   CDS_pept        complement(274199..274522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0254"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="PFAM: Excinuclease ABC, C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03290"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNC4"
FT                   /protein_id="ABQ03290.1"
FT                   /translation="MKRYYVYILKCSDNSYYTGFTNNIERRLNEHNSGINKECYTFNKR
FT                   PLELVFYAEFNDVHQAIAFEKQVKGWSRKKKEAIINDKWEDLKKLAECLNKTSHKNFYK
FT                   KEV"
FT   gene            complement(274837..275844)
FT                   /locus_tag="Fjoh_0255"
FT   CDS_pept        complement(274837..275844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0255"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase
FT                   III C terminal domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03291"
FT                   /db_xref="GOA:A5FNC5"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNC5"
FT                   /protein_id="ABQ03291.1"
FT                   /translation="MYHSKIAGLGYYVPSNVVTNDDLSKIMDTNDEWIQERTGIQERRH
FT                   IIRGEDTTTSMGVKAAKIAIERSGVAKEDIDFVVFATLSPDYYFPGPGVLVQRDLGLKT
FT                   VGALDVRNQCSGFVYAISVADQYIKTGMYKNILVIGSEVHSTGLDMTTRGRGVSVIFGD
FT                   GAGAAVLSREEDVTKGILSTHLHSEGQHAEELALQAPGMGARWVTDILADNDPNDESYY
FT                   PYMNGQFVFKNAVVRFAEVINEGLEANELQVSDIDMLIPHQANLRISQFIQNKFKLTDD
FT                   QVHNNIQKYGNTTAASIPIALTEAWEQGKIKSGDTVVLAAFGSGFTWASAIIKW"
FT   gene            complement(276105..276887)
FT                   /locus_tag="Fjoh_0256"
FT   CDS_pept        complement(276105..276887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03292"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNC6"
FT                   /protein_id="ABQ03292.1"
FT                   /translation="MQDADFLLNKLTSMPSSWSVESVASWLEDVNNINIFEKLESLLDI
FT                   DLSKNQWRGVLTFLNQKYSNSTEPTHDFNNAFEKFSDNIILDKFSSVYLLDDKSKVIDF
FT                   SKLSNLKKAKAVMAYQCQELTFNNPDLEMLNAGFLPKLNKITNLQSAIDLRYLTIVKCN
FT                   KLNDFSFVGQLKKLIYLDLSNNKLIENLDFIPEDSEIKVLYLLESNIIKNKETIARLSS
FT                   MKNLKYLYIKANKLEEKELRECLPNCFVNGEEPVARQL"
FT   gene            complement(276963..277913)
FT                   /locus_tag="Fjoh_0257"
FT   CDS_pept        complement(276963..277913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0257"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03293"
FT                   /db_xref="GOA:A5FNC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNC7"
FT                   /protein_id="ABQ03293.1"
FT                   /translation="MLDIQNISFSYTDKPVINNVSFTINKGENIAIIGESGCGKSTLLK
FT                   LMYGLFDLDEGKIFYNEKPILGPKYNLIPGMPYMKYLAQDFDLSPYETVAENVGKFLSN
FT                   GFANMKKLRVQELLEMVEMDQFSNVKAKFLSGGQQQRVALVRVLALEPEVILLDEPFSQ
FT                   IDAFRKNALRRNLFKYLKQKEITCIIATHDSTDALSFADEAIVMRHGEIVVKGDPSKIY
FT                   EDPQTKYVASLFGEVNEVATHLLLPYEDETHKTLVYPHQFKMVAESKLPVKIRRTYFRG
FT                   SHYLIETVYKRQLIFFESEIDLPLEQEIFLGLNYL"
FT   gene            complement(278020..278715)
FT                   /locus_tag="Fjoh_0258"
FT   CDS_pept        complement(278020..278715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0258"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03294"
FT                   /db_xref="GOA:A5FNC8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNC8"
FT                   /protein_id="ABQ03294.1"
FT                   /translation="MKKITVLSLSALFIFTSFFTSCDSVKNANNTQKGAGIGAVAGGVI
FT                   GAVLGNNLGKGGNAALGAAIGAAVGGGTGALIGNKMDKQAREIDQALPGASVERVGEGI
FT                   HLTLNENSVRFDTNKSTLTPTAKANLDKLVPVFNEYGDTDIQIFGYTDNTGKPEYNLTL
FT                   SGQRAASVQAYLVSKGLKSSRFKTSGLGIADPIATNDTPEGRAQNRRVEFSITANDKMV
FT                   NDAKAEAGK"
FT   sig_peptide     complement(278641..278715)
FT                   /locus_tag="Fjoh_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.394 at
FT                   residue 25"
FT   gene            complement(278734..279231)
FT                   /locus_tag="Fjoh_0259"
FT   CDS_pept        complement(278734..279231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0259"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03295"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNC9"
FT                   /protein_id="ABQ03295.1"
FT                   /translation="MKKSILMCMIAAMFFACKSASSTASTDTTLSKKLDRPTQVALKGN
FT                   WVLTNVSYPGSDYIKVNSFDLADSKCFIGSTWSFISNNNKGTMALTSPSCTSFSSPIVW
FT                   SINNQGMFILKILDAGEKAKKVRDGYLLKVAGVTESSFQLIDNINVGGQVKDVVYQFQR
FT                   AN"
FT   sig_peptide     complement(279157..279231)
FT                   /locus_tag="Fjoh_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.680 at
FT                   residue 25"
FT   gene            279436..281319
FT                   /locus_tag="Fjoh_0260"
FT   CDS_pept        279436..281319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0260"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region,
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03296"
FT                   /db_xref="GOA:A5FND0"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5FND0"
FT                   /protein_id="ABQ03296.1"
FT                   /translation="MTTGKINVSVENIFPLIKKFLYSDHEIFLRELVSNGTDATLKLKH
FT                   LISIGEAKVEYGNPIIAIKIDKEGKKIHIIDQGLGMTADEVEKYINQVAFSGAEEFLDK
FT                   YKDSAKDSGIIGHFGLGFYSAFMVAEKVEIITKSYKDEPAAHWTCDGSPEFTLEPADKT
FT                   SRGTEIILHIAEDSLEFLEDSKISGLLNKYNKFMPIPIKFGTRTETLPKPEDAPEDYVN
FT                   ETVEIDNIINNPNPAWTKQPSELSDEDYKNFYRELYPMQFEEPLFHIHLNVDYPFNLTG
FT                   ILYFPKLGTDMQIQKDKIQLYQNQVYVTDNVEGIVPEFLTMLKGVIDSPDIPLNVSRSG
FT                   LQADGAVKKISNYITRKVADKLKSLFNENRADFEAKWNDIKIVLEYGMLSEEKFYEKAG
FT                   AFVLYPTVDDTYFTLDELKEKLKENQTDKDGKLVVLYAGNKDAQHSYIEAAKDKGYEVL
FT                   LLDSPIISHLIQKIENDNSGLTFVRVDSDHIDNLIKKEENTISRLSDDEKAALKTSLEA
FT                   YIPKAYSVQLEAMDSQAAPFIITQPEFMRRMKEMSQTGGGGMFGMGNMPEMYNLVVNTN
FT                   SDLASSILNTEDKTHQEHLVKQALDLAKLSQNLLKGEALTAFVKRSFEMIK"
FT   gene            281523..281939
FT                   /locus_tag="Fjoh_0261"
FT   CDS_pept        281523..281939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03297"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNB7"
FT                   /protein_id="ABQ03297.1"
FT                   /translation="METFETKEPKKSKLFLQVNFDYKYLSRTWVEKEDTETWKKTTIKD
FT                   STPGNGNIDFFEAGKSSDYQDKFRILIKTYFDLQKIKDTDEFIKKLKINYNLLEDDDKP
FT                   GNFHQSIIYNCKADEMIISDNKMILLVTKIIEIK"
FT   gene            281936..283045
FT                   /locus_tag="Fjoh_0262"
FT   CDS_pept        281936..283045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03298"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNB8"
FT                   /protein_id="ABQ03298.1"
FT                   /translation="MKIRLIIILFLITIKLFSQAANEIKITDLELPNAPAFTILDYSPT
FT                   IINTPSTTQAFTLSVINSVNESKGFPTDYALEFTPYWIFSKKKRNLTDYVIKENQKAYS
FT                   KPYKNLSFSLAAVKKDTIQNVSIGIRTNLITVNRKERQAFVDTLLKKLDKFAEIVDKNL
FT                   MLDTNPYQSGTPEYNQWDLDKINKLSTIDEYKKFTAEIYTSIDTLETIKPLFTADFGTA
FT                   YNHFFDQNEFKSGKFGRYGAWLTLNTNVKLGKSSKNYLNFYQYTRYLIDETIFDPAVLA
FT                   YKKEKNLDVGAKIEFQFNDFSIAYEYINRTNQKDNYRSVGNLKYKINERFTINGGFGKN
FT                   FEKTDNLVSFLGISWGIASNNDLDLVAKK"
FT   sig_peptide     281936..281998
FT                   /locus_tag="Fjoh_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.915 at
FT                   residue 21"
FT   gene            283283..284095
FT                   /locus_tag="Fjoh_0263"
FT   CDS_pept        283283..284095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0263"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03299"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNB9"
FT                   /protein_id="ABQ03299.1"
FT                   /translation="MKKTAILITAFCASALMYISCTSNDDVVNQADTTTVSASLVIDAI
FT                   NEMDIKTALSATNSNPAAKPSEVSPGTCANITIPSETTYPKVFTVDYGTGCTINQITRK
FT                   GKLKITLSGPVITTGSKMTVERIDYYVGPYKIEGTIEYTNTTTVATVPQWTRKVTNGKL
FT                   TDNSGRVFTSSGTETVKQTAGVDTPYVLEDNVYEMPEGNHTIISDKGTLTLTVQETLIK
FT                   KYSCEYISKGKLKIEGGSLNGVIDYGNNACDAQYTYTHQNGAIYNLGM"
FT   sig_peptide     283283..283354
FT                   /locus_tag="Fjoh_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.528 at
FT                   residue 24"
FT   gene            284230..284994
FT                   /locus_tag="Fjoh_0264"
FT   CDS_pept        284230..284994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0264"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03300"
FT                   /db_xref="InterPro:IPR025380"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNC0"
FT                   /protein_id="ABQ03300.1"
FT                   /translation="MKKSIIAFVTLAMLASCDKKESADNLHITGNIKGLKTGTLYIQRI
FT                   VDTSLVAIDSIKIDGNSAFERDIKLESPEMLYLFLDRGVTNSLDNNILFFAEPGNMNIE
FT                   TNLDNFIASAKITGSKNQELYEEYQKINTRFRDENLSMVEAKFKALKRQDQKTLDSLDA
FT                   KQQSNIKRKYLYATNFAINNKDHEVAPYIALAEIYDINLKFLDTIQKSMTPKVAQSLYG
FT                   KKLTKYVADIKKEEQKAPAAAQTETTAAEAQK"
FT   sig_peptide     284230..284289
FT                   /locus_tag="Fjoh_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.689) with cleavage site probability 0.440 at
FT                   residue 20"
FT   gene            complement(285239..285315)
FT                   /locus_tag="Fjoh_R0012"
FT                   /note="tRNA-Thr4"
FT   tRNA            complement(285239..285315)
FT                   /locus_tag="Fjoh_R0012"
FT                   /product="tRNA-Thr"
FT   gene            complement(285421..285497)
FT                   /locus_tag="Fjoh_R0013"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(285421..285497)
FT                   /locus_tag="Fjoh_R0013"
FT                   /product="tRNA-Thr"
FT   gene            complement(285574..285840)
FT                   /locus_tag="Fjoh_0265"
FT   CDS_pept        complement(285574..285840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03301"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNC1"
FT                   /protein_id="ABQ03301.1"
FT                   /translation="MANVKNLKKDINFVLGDIIEAVYLFEMSTTGNPTPETNALIDEAI
FT                   AAFDTLITKVNAKNVENKKAHFKQINVELEQTANQLIEKINAL"
FT   gene            complement(285898..286866)
FT                   /locus_tag="Fjoh_0266"
FT   CDS_pept        complement(285898..286866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0266"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /EC_number="5.3.1.8"
FT                   /note="TIGRFAM: mannose-6-phosphate isomerase, class I;
FT                   PFAM: mannose-6-phosphate isomerase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03302"
FT                   /db_xref="GOA:A5FNC2"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014628"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNC2"
FT                   /protein_id="ABQ03302.1"
FT                   /translation="MKPNLYPLQFEPILKERIWGGEKLKTVLNKPITSKITGESWELST
FT                   VEGDVSTVANGELKGKSLMDLINETPDEILGTRVYERFGKQFPLLFKYLDAREDLSIQV
FT                   HPNDKLAKERHNSFGKTEMWYVMQADADSRIIVGFKENSSKEEYLKHLHDNTLVSILDD
FT                   VKAKAGDVFFLETGTVHAIGAGLVVAEIQQTSDITYRLYDFDRVDAQGNKRELHVDLAL
FT                   DAINYNKVDTQKKYDSKANTSNTVVDCPYFTTNFIPLEDKVQVSKSGETFTVYMCIEGS
FT                   FEIEYDGFKHTYIKGDTVLVPAAINAFVLSGKASILEIYIS"
FT   gene            complement(286930..287388)
FT                   /locus_tag="Fjoh_0267"
FT   CDS_pept        complement(286930..287388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0267"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03303"
FT                   /db_xref="GOA:A5FNA8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNA8"
FT                   /protein_id="ABQ03303.1"
FT                   /translation="MSLKIGDIVPNFTAKDSHGEVFESKNVLGRKPLVIYFYPKDNTPG
FT                   CTTEACSFRDQYEDFKDLGAEVIGISADSVKSHHKFANKHQLPFILLSDEDKRLRHLFG
FT                   VKNNLFGLIPGRVTFIIDRNGVVIYIFDSMNAAKHIPKALEIIKELVL"
FT   gene            complement(287392..287802)
FT                   /locus_tag="Fjoh_0268"
FT   CDS_pept        complement(287392..287802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0268"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03304"
FT                   /db_xref="GOA:A5FNA9"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNA9"
FT                   /protein_id="ABQ03304.1"
FT                   /translation="MRVTISRKAHFNAAHRLHRKDWSLEKNNAVFGKCNNPNFHGHNYG
FT                   LTVSVTGKIDPETGFVLDVKVLADIILEEVEIPFDHKNLNLDVPEFQDLNPTAENIAVV
FT                   IWNKIRKRIQPDFDLEVVLYETDRNFVTYKGE"
FT   gene            complement(287824..288351)
FT                   /locus_tag="Fjoh_0269"
FT   CDS_pept        complement(287824..288351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0269"
FT                   /product="isopentenyl-diphosphate delta-isomerase, type 1"
FT                   /EC_number="5.3.3.2"
FT                   /note="TIGRFAM: isopentenyl-diphosphate delta-isomerase,
FT                   type 1; PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03305"
FT                   /db_xref="GOA:A5FNB0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNB0"
FT                   /protein_id="ABQ03305.1"
FT                   /translation="MTEENVILVNQNDEQIGLMPKLEAHEKALLHRAFSVFILNSKNEV
FT                   MLQQRAHHKYHSPLLWTNTCCSHQREGETNIEAGSRRLFEEMGFKAELKELFHFIYKAP
FT                   FDNGLTEHELDHVMIGYYNEEPNINPDEVEDWKWMSIEDVKADIEKQPEIYTVWFKIIF
FT                   DEFDHYLEDHKL"
FT   gene            288646..289200
FT                   /locus_tag="Fjoh_0270"
FT   CDS_pept        288646..289200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0270"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="possible lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03306"
FT                   /db_xref="GOA:A5FNB1"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNB1"
FT                   /protein_id="ABQ03306.1"
FT                   /translation="MKSKNLIFSLCFLIPLFVFQACGQNTKKQPAKTAVMENKISKPGN
FT                   PYYSNTDTTKLNVSNAEWKKVLPEDVYAVMREADTERPFTGKYWNTDEKGTYYCASCGN
FT                   LLFRSTAKFSSSCGWPSFFEQENKKSIVFKDDNSLGMERTEALCGRCGGHLGHIFDDGP
FT                   EPTGKRYCMNSIALDFVPDTK"
FT   sig_peptide     288646..288717
FT                   /locus_tag="Fjoh_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.986 at
FT                   residue 24"
FT   gene            289208..289813
FT                   /locus_tag="Fjoh_0271"
FT   CDS_pept        289208..289813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0271"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03307"
FT                   /db_xref="GOA:A5FNB2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNB2"
FT                   /protein_id="ABQ03307.1"
FT                   /translation="MKNIFLICLLAFSLNGISQNKKANLETITLGGGCYWCVEAVYENL
FT                   DGVKSVVSGFSGGKTANPSYEEVCTGTTGHAEVVQITYDKNITDINEIFKVFFTVHDPT
FT                   TLNRQGADVGTQYRSVIFYKNDEQKKAAESIIAELNKAKVYNNPIVTKVEPFKVFYKAE
FT                   DYHQNYYANNKNQPYCKMVIQPKLEKFEKVFKDKLKKK"
FT   sig_peptide     289208..289270
FT                   /locus_tag="Fjoh_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.461 at
FT                   residue 21"
FT   gene            290445..290897
FT                   /locus_tag="Fjoh_0272"
FT   CDS_pept        290445..290897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0272"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03308"
FT                   /db_xref="GOA:A5FNB3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNB3"
FT                   /protein_id="ABQ03308.1"
FT                   /translation="METRLNLFEQGQKAVSTLFGISGYLKKATIESSLMELINFRISQI
FT                   NNCGYCLDMHSKEALAAGETTQRLFGLSVWREAPYYTKRERVALALAEAVNACDVPDEI
FT                   YEIAKAEFTEQELIDLTLAVAAINAWNRLNITFVNTPGTYRVGQFG"
FT   gene            290979..291317
FT                   /locus_tag="Fjoh_0273"
FT   CDS_pept        290979..291317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0273"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03309"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNB4"
FT                   /protein_id="ABQ03309.1"
FT                   /translation="MNEFLLIFRRDFKTKETQPSPEELQQHLQQWQNWFGSLAAQDKLA
FT                   RPLQRWDGQGKLVNSNKGITDGPFVEIKESIGGLIIIKAKDYDEATEIAQGCPVLNFGG
FT                   NVEIRMAV"
FT   gene            291380..292618
FT                   /locus_tag="Fjoh_0274"
FT   CDS_pept        291380..292618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0274"
FT                   /product="RNA polymerase sigma-70 type factor"
FT                   /note="PFAM: sigma-70 region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03310"
FT                   /db_xref="GOA:A5FNB5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNB5"
FT                   /protein_id="ABQ03310.1"
FT                   /translation="MEHKELIPNLFRTEYQKIVSVLCSLFGIQHIEIAEDIVSDTFLTA
FT                   SETWAIKGIPENPSAWLYTVAKNKTKNYLKRNNLFETKIVTEIKHNTPLNNPQIDIDLS
FT                   DQNIADSQLAMIFTVSNPCNSEEAQIALALNLLCGFGVGEISDAFLSNKEVIYKRINRA
FT                   KEKLKEENIKIQHPNSSEIKDRIQTVLKTIYLLYSEGYYSISQNTTLRKDLCTEAMRLT
FT                   YLLIENESTNLPQTNALMALMCFHSSRFDARTGLKGEIILYEDQDQSLWNQELINKGTY
FT                   FLSQSSTGNSLSKYHLEAGIAYWHTIKKETIEKWENILELYNNLIILEYSPIAALNRTY
FT                   ALSKVKGKEEAIKEAEKLNLTDNHFYYSLLGNLYSEVDPNKALPHFETAFGLAKTASDK
FT                   NIISKNIEQLKTN"
FT   gene            complement(292884..293321)
FT                   /locus_tag="Fjoh_0275"
FT   CDS_pept        complement(292884..293321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0275"
FT                   /product="hypothetical lipoprotein of unknown function
FT                   DUF306, Meta and HslJ"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03311"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNB6"
FT                   /protein_id="ABQ03311.1"
FT                   /translation="MKKYTIAVLSVLTLLFASCKTAKTDKNADDLFGTTWELEYISGPR
FT                   IAFQGLYPNKKPQLTFDQKETKVYGNNGCNGYSASYTLKGKSLTFGEEGPTTMMFCEGG
FT                   GEQVFLKQIRQITSYSIDKDGKLNLIQGDIPVMRFKKVAKQ"
FT   sig_peptide     complement(293256..293321)
FT                   /locus_tag="Fjoh_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.509 at
FT                   residue 22"
FT   gene            293582..294985
FT                   /locus_tag="Fjoh_0276"
FT   CDS_pept        293582..294985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0276"
FT                   /product="peptidase family M24"
FT                   /note="PFAM: peptidase M24; peptidase M24B, X-Pro
FT                   dipeptidase/aminopeptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03312"
FT                   /db_xref="GOA:A5FN99"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN99"
FT                   /protein_id="ABQ03312.1"
FT                   /translation="MKQFLFLFVFALTTSLVQSQENLPTDYLTKEFHQGRREAFRNLMP
FT                   ANSAAVVFSYPERVFSKDVNYNYHANPDMYYLTGYKEPDAVLLLFKEPQGTEKYTEVLF
FT                   VRERNAQKETWTGRRLGIEGAKSKLGFTKVYNGKDFNTFEIDFKKFDKIIYDNIPTDVE
FT                   ASKNIDNLYSLLQSFKTKTGIIAEDKASVDLFNNITNSLREIKTPEELVVMRKTVKLSC
FT                   IAHNEVMKAVGPDMSENEADGIHAYVHRHYGAEGEGYPPIIGAGGNGCILHYNDNNATK
FT                   IDNQLLLMDVGSEYHGYSADVTRTIPANGKFTEEQKAIYQIVYEAQEEVFKLCKEGTPI
FT                   QDLNKRSKEVVAAGLIKLGIITDPKDARIYYPHGCSHFLGLDVHDKGNYMGTLKENMIL
FT                   TVEPGIYIPANSKCDKKWWNIGVRIEDDILMLKDSYENLSADSPRKWQDIEALAKQKST
FT                   FNDMKFPKI"
FT   sig_peptide     293582..293641
FT                   /locus_tag="Fjoh_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.987 at
FT                   residue 20"
FT   gene            295088..296047
FT                   /locus_tag="Fjoh_0277"
FT   CDS_pept        295088..296047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0277"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03313"
FT                   /db_xref="GOA:A5FNA0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNA0"
FT                   /protein_id="ABQ03313.1"
FT                   /translation="MKALTFSTFGDSDVLEYIEIPNPQLKNDEILVEMKAIGLNFADVY
FT                   RRKGNYHLKGNPPFIAGYEGAGIVVNANNHSEYKVGDRVAFADAPFANAELVAVNINHV
FT                   LPLPENISFETAASVLLQGLTAHYLATDSHKTQKGETVLIHAVAGGVGQILTQISKLLG
FT                   ASIIGLTSSAEKAKVGFDQGADHIFLYNDDWKSQVFKVAANGVDVVYDSIGSTLMESFE
FT                   VTKECGQVVFFGMAGGDPAPVDPRMLMDGSKTLTGGDLWSYLNSKEERIKRAAQLFNWI
FT                   IEGKIKLSEPTSFKLSEGKLAHDFLESRKSTGKIILIP"
FT   gene            complement(296158..297246)
FT                   /locus_tag="Fjoh_0278"
FT   CDS_pept        complement(296158..297246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03314"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNA1"
FT                   /protein_id="ABQ03314.1"
FT                   /translation="MKNFFSNLFNRNNDPKSIISFDVIDPIYSYLYNQQSSLEFKVKRI
FT                   KDNVTVNLFYFPGSLDHEEGRAEIKKAGFNNSYEVLNELYKKMNIGILSDEQIKEGLEY
FT                   DFIHIQFYSEPTSDEKKFFKQSIKNFVIFFCCTNSLEINDFKILYSGTHFFDYTKGLLE
FT                   SELLDFNNPKNESQVIGVKDFKLVLQGISQYLNLEIPESVELPSQENLIETEEVKLETF
FT                   EEFINLVSRGSIEEKELKKQSKKLFKNYQKDTDEYHDIVEGHFDFFESIDAWNSDWKFD
FT                   PEDAEYFISKMIGENLNFEYPEETYSHDLFPYIQSALEKRGLELMSYNTNGDNYLFFVA
FT                   NKEDVGRILELSEITKIEIDQL"
FT   gene            complement(297320..298879)
FT                   /locus_tag="Fjoh_0279"
FT   CDS_pept        complement(297320..298879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0279"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03315"
FT                   /db_xref="GOA:A5FNA2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNA2"
FT                   /protein_id="ABQ03315.1"
FT                   /translation="MPRELLLQVTPEIAANEILLKDYLSKQIKVSAQEIQHVSILKRSI
FT                   DARQKAIKINLKVLIYLKGEPFQETKIELPIYKDVSSAQEVIVVGAGPAGLFAALQLIE
FT                   LGLKPIVLERGKDVRGRRRDLKAINREHIVNEDSNYCFGEGGAGTYSDGKLYTRSKKRG
FT                   DVTRILELLVAFGASEDILVEAHPHIGTNKLPKIIEDIRNKIIEFGGEVLFDTRVTDIL
FT                   VKNNEVEGIVTQNGDKIHANKLILATGHSARDIFELLDKKKILIEAKPFALGVRAEHSQ
FT                   ELIDSIQYSCDFRGEHLPPAPYSIVKQVNGRGMYSFCMCPGGVIAPCATSPGEVVTNGW
FT                   SPSKRDQSTANSGIVVELKLEDFKPFAKFGALAGMEFQKSIEQKAWHLAGQTQKVPAQR
FT                   MVDFTQNKASADIPKTSYVPGTTSVEMGQVFPGFLSQIMREGFREFGKSMRGYLTNEAI
FT                   LHAPESRTSSPVRIPRDPMTLEHLQIKGLYPCGEGAGYAGGIISAAIDGEKCALMIAES
FT                   LK"
FT   gene            299137..299376
FT                   /locus_tag="Fjoh_0280"
FT   CDS_pept        299137..299376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03316"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNA3"
FT                   /protein_id="ABQ03316.1"
FT                   /translation="MSRKIKLIWDFRGPASAKTAEHHEIHLKEYIAIEKLPLNITGFSI
FT                   LNDMHATAFMVVTDENMIQVRDALKPHRGEVYEG"
FT   gene            complement(299475..301670)
FT                   /locus_tag="Fjoh_0281"
FT   CDS_pept        complement(299475..301670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0281"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   PFAM: helicase domain protein; HRDC domain protein;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03317"
FT                   /db_xref="GOA:A5FNA4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNA4"
FT                   /protein_id="ABQ03317.1"
FT                   /translation="MNSNEIEIHKELKKYFGFSQFKGLQEQVITSILGKTNTFVIMPTG
FT                   GGKSLCYQLPALIQDGTAIVVSPLIALMKNQVDAIRSLSSENGIAHVLNSSLTKTEIAQ
FT                   VKKDISSGLTKLLYVAPESLTKEEYVAFLQSVPISFVAIDEAHCISEWGHDFRPEYRNL
FT                   RTIIKQLGKVPIIGLTATATPKVQEDILKNLDMSDANTFKASFNRPNLYYEVRTKTKSI
FT                   ESDIIRFIKQHKGKSGIIYCLSRKKVESIAEVLQVNGISAVPYHAGLDAKTRAKHQDMF
FT                   LMEDVDVVVATIAFGMGIDKPDVRFVIHHDIPKSLESYYQETGRAGRDGGEGHCLAYYS
FT                   YKDVEKLEKFMSGKPVAEQEIGFALLQEVVAYAETSMSRRKFLLHYFGEEFDSETGEGA
FT                   DMDDNVRNPKNKIEAKEQVVKLLEIVRDTKHIYKSKEIVFTLIGRINAVIKAHKTDTQS
FT                   YFGSGSDHDEKYWMALLRQVLVTGYLSKDIETYGVIKITQEGLDFIKKPVSFMMSEDHE
FT                   YTEADDETIVTGGKSSGTADEVLTGMLRELRKKVAKKLGVPPFVVFQDPSLEDMALKYP
FT                   ITLQELYNIHGVGEGKAKKYGSEFVALISRYVEDNDIIRPDDLVVKSTGVNSANKLYII
FT                   QNIDRKLPLSDIASAKGLTMDALIKEMEQIVYSGTKLNIKYWLDDILDDDQQEEIHDYF
FT                   MESESDKIEDALKEFDGDYDIDELRLMRIKFISEVAN"
FT   gene            301759..302724
FT                   /locus_tag="Fjoh_0282"
FT   CDS_pept        301759..302724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0282"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="TIGRFAM: KpsF/GutQ family protein; PFAM: CBS domain
FT                   containing protein; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03318"
FT                   /db_xref="GOA:A5FNA5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNA5"
FT                   /protein_id="ABQ03318.1"
FT                   /translation="MISKENILAIAKKTILSESEAITKLIDFLDENFFEAVQRIYETKG
FT                   RLIVTGIGKSAIIAQKMVATFNSTGTPSMFLHAAEAIHGDLGMIQNDDIIICISKSGNS
FT                   PEIKVLVPLLKRFGNTLIAITGNTTSFLAKGSDFVLNTTVDTEACPINLAPTNSTTAQL
FT                   VMGDALAVCLMEMRDFKPEDFAVYHPGGALGKKLLLRVKDMIEHSLKPTVTPDTSVKKV
FT                   IFEISEKRLGVTAVIENDKIVGIITDGDIRRMLNDVDTIADLTAKDIMSKNPKVVSSET
FT                   MAVDALNILEDFSITQLIVADNGEYKGVLHLHDILKEGIV"
FT   gene            302724..303539
FT                   /locus_tag="Fjoh_0283"
FT   CDS_pept        302724..303539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0283"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03319"
FT                   /db_xref="GOA:A5FNA6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNA6"
FT                   /protein_id="ABQ03319.1"
FT                   /translation="MAKKNLGEMSFLDHLEELRWLLVRSTIAICIMAFVTYFISDYLFD
FT                   EIILGPTRPTFFTYVWFCDLSHQLGFADSICITELNFIIQNTEMEGQVNIFVWMCLLAG
FT                   FILSFPYILWELWKFISPALYEKERKHAKIFIFTSSLLFFLGVVFGYYVVIPMSVNFVA
FT                   TFSISDVVVNQFTLDSYMGMVKTSILASGLFFELPIIIYFLTKLGLVTPQFLRKYWKYA
FT                   VVIILIIAAIVTPPDVVSQTIVAIPMLIIYEISIWISKVVYKNKLKENV"
FT   gene            303532..303882
FT                   /locus_tag="Fjoh_0284"
FT   CDS_pept        303532..303882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0284"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03320"
FT                   /db_xref="GOA:A5FNA7"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FNA7"
FT                   /protein_id="ABQ03320.1"
FT                   /translation="MSDLVQEFNDYRSKMNEKLLADNNKIVKRIFNLDTNAYAPGALDV
FT                   KTKELLGLVASAVLRCDDCVKYHLETSYKEGISKEEMMEAMGIATLVGGTIVIPHLRRA
FT                   YEFWEALEEAGK"
FT   gene            304043..304783
FT                   /locus_tag="Fjoh_0285"
FT   CDS_pept        304043..304783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0285"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03321"
FT                   /db_xref="GOA:A5FN91"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN91"
FT                   /protein_id="ABQ03321.1"
FT                   /translation="MKLRADNLIKTYKGRSVVKGISVEVNQGEIVGLLGPNGAGKTTSF
FT                   YMIVGLVKPNQGNIYLDDLNITDYPMYKRAQQGIGYLAQEASVFRKLSIEDNILSVLQL
FT                   TKLSKEAQIAKMESLIEEFSLEHIRTNRGDLLSGGERRRTEIARALATDPKFILLDEPF
FT                   AGVDPVAVEDIQRIVAQLKNKNIGILITDHNVQETLAITDKTYLMFEGGILKAGVPEEL
FT                   VEDEMVRRVYLGQNFELRKKKLEF"
FT   gene            complement(305139..305978)
FT                   /locus_tag="Fjoh_0286"
FT   CDS_pept        complement(305139..305978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0286"
FT                   /product="Lysozyme-like protein; Glycoside hydrolase family
FT                   25"
FT                   /note="related to lysozymes"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03322"
FT                   /db_xref="GOA:A5FN92"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018077"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN92"
FT                   /protein_id="ABQ03322.1"
FT                   /translation="MARRTTRKTKQGGSFFGRVIRFIVFSLLAVLFFGTIYHYRAGLAY
FT                   YLGFKTDKVLDEDEVDKHLSDVRNIRVLENHKGKVVGIDVSEFQGKVDWEEVEILDEKY
FT                   PVQFVFIRATAGNDRVDRQFKRNWEGAKENKIMRGAYHYYRPNENSIEQADLFIKTVKL
FT                   QKGDLPPVLDIEKLPKNQSLDSLKKGLKRWLTKVEKHYQVRPIIYSGERYYSDFLKEEF
FT                   GEYLFWIANYNFYREKIEDDWLFWQFTEKASLPGIKHRVDVNIYNGDIEQLQFITVE"
FT   gene            complement(305989..306756)
FT                   /locus_tag="Fjoh_0287"
FT   CDS_pept        complement(305989..306756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0287"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03323"
FT                   /db_xref="GOA:A5FN93"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN93"
FT                   /protein_id="ABQ03323.1"
FT                   /translation="MSLIYAKFVIQNLSNLNMNIKKHIPNLITLINLFCGCVAIVFISE
FT                   ANYEMAFYMVCLGIFFDFFDGFFARLFKVSSPLGLQLDSLADMVTSGVAPGYVMYSLFL
FT                   KSANPNDVISSVYIPFLGFIVTLGSCYRLANFNIDTRQTDSFIGLPTPANSLFILSLPL
FT                   VIKFSESLMIFEMLTNHWVLLGITLCSAYILNAEIPLFSLKVKKFNFKDNALQIVFLII
FT                   SFILVLLLHFTAVPLIIIIYVLLSIVNNIFLKK"
FT   gene            307023..308006
FT                   /locus_tag="Fjoh_0288"
FT   CDS_pept        307023..308006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03324"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN94"
FT                   /protein_id="ABQ03324.1"
FT                   /translation="MNIGVDAAALGMSSAVTASTNDVNAVYWNPAGLTNLEDHQLSLMH
FT                   ASYFANIAQYDFIGYASPIDDRSAWGISMIRFGVDDIMDTTQLIDSQGNIDYNRIRLFS
FT                   TADYGFTFSYARKLPVEGFQYGINAKVIRRVIGKFANSWGFGFDVGLQFTHNDWKFGLM
FT                   LRDITTTYNVWNIDEEEYKKIADAIPGENNELPESTEITLPKAQLGVSRKFEFHNDYSL
FT                   LAAANLNMRFEQTNDIISSKAVSIDPAVGFEFGYTDLVFLRAGAGNFQNVMQLDNTEKL
FT                   SFQPNIGLGFKYKGIQIDYALTDLGNQSAALYSNIFSIKVDLGIFR"
FT   sig_peptide     307023..307079
FT                   /locus_tag="Fjoh_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.700 at
FT                   residue 19"
FT   gene            308045..309184
FT                   /locus_tag="Fjoh_0289"
FT   CDS_pept        308045..309184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03325"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN95"
FT                   /protein_id="ABQ03325.1"
FT                   /translation="MKKVLFQKILFSLVLFLSFTISFGQNVPLSNYAKISVITCGLGNE
FT                   TYSYFGHTAIRVADPINNLDVVYNYGAFDFRTPNFVAKFAKGDLQYFVVAHSFADFVND
FT                   YTYEKRSVFEQELLISQDLKQKLFDKLNAVLLSDERYYTYKFIDKNCTSMVVDVINSTL
FT                   GSRVIVKKEDTNKTYRSILFPYFNGHFYDQLGTSIIFGTKVDQLGTRIFLPFELKNSLD
FT                   ETTFQGHLLAAKSKTLLNFEKETPSSWWNNIYTYLFILGFVVLAHNKIVDKIYLLILSL
FT                   MGVFFVSVGFYSFHQELAMNYNVLLFSPLLLVLLLFSIAKNKKWTYRFAVLHLLFLIIY
FT                   SIFIINKAHFLIVLPMIITSCFALVRVAIRNKKRIPIII"
FT   sig_peptide     308045..308119
FT                   /locus_tag="Fjoh_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.986 at
FT                   residue 25"
FT   gene            complement(309185..310579)
FT                   /locus_tag="Fjoh_0290"
FT   CDS_pept        complement(309185..310579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0290"
FT                   /product="sugar phosphotransferase"
FT                   /note="PFAM: sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03326"
FT                   /db_xref="GOA:A5FN96"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN96"
FT                   /protein_id="ABQ03326.1"
FT                   /translation="MRSKSKMHFEISERKVLLFAFDALFVAAILYLLNLFFEFNYFTFE
FT                   STTFYRPIIFVGYLLVFGTIFEMYNLQVASNQFQILKSVVLSVSAAVLVYLLTPVLSPE
FT                   LPKQRLVIVIFYFAVLLMMLLWRFFYAIFLASHRFSQNVILICDKDQVEELVSGLENVD
FT                   PHYRIIGFVNSDSNSDSNTNFHYVKEIKKNYLERFVSRYNVSEIVIASQKTDGITADLY
FT                   QQLLHLLESGNVIREYTQVYESKTQRIPVQYIERDFYRFFPFSRSNNNKLYLFLIRFLE
FT                   LLFSFTGLLVCFVFIPFIFIGNLLANKGSLFYTQERVGKNGVVFKIYKFRTMIAASETN
FT                   GAVFAVSNDKRVTPFGKFMRKSRIDELPQFYNVLKGDMAVIGPRPERPFFVEEIARIMP
FT                   FYETRHVIKPGLTGWAQVNYSYGESIDESLIKLQYDLYYIKHRSVFLDLSITFKTITTV
FT                   LFYRGQ"
FT   gene            complement(310637..311986)
FT                   /locus_tag="Fjoh_0291"
FT   CDS_pept        complement(310637..311986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03327"
FT                   /db_xref="GOA:A5FN97"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN97"
FT                   /protein_id="ABQ03327.1"
FT                   /translation="MKNTQLSYYYILIIHAVIALAIFVAPFLSKLYAILIFIIGFLIVY
FT                   RNKNKNNEVLLVAAYLVGAEVFLRMTGANLNNEYVKFSVIFFMLMGMVYSNFSSNSIIY
FT                   LFFLVLLLPGILITINEADISVDIKKVLFFNLSGPVCLAVCALYMFKRRISFSELQNIF
FT                   LAIGFPIVTTTMYLFLYTPSIKDVVTGTQSNFETSGGFGPNQVSTILGLGMFVFFAQFI
FT                   LFSKSKKLMLINAGLLIMISYRAIVTFSRGGVISALGMIICLLFILYFSSNTKGRAKFT
FT                   YVFIVTGLITAGIWSYSSLQTNGLIGKRYANKDALGREKKDRLGGREEVMDADIKLFLE
FT                   NPVLGVGAGLSKEKRIQLLGEEVASHNEITRMFCEHGVFGIFGLLILFVTPFMLYINNR
FT                   QHLYFLSCFVFWLLTINHAAMRTAAPAFVYALCLLSVQVRNPEKTENPTR"
FT   gene            complement(311983..313080)
FT                   /locus_tag="Fjoh_0292"
FT   CDS_pept        complement(311983..313080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0292"
FT                   /product="Candidate alpha-glycosyltransferase;
FT                   Glycosyltransferase family 4"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03328"
FT                   /db_xref="GOA:A5FN98"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN98"
FT                   /protein_id="ABQ03328.1"
FT                   /translation="MRIVQMIDSLEAGGAEKMAVNYANALTKNIAFSGLVVTRKEGQLL
FT                   SQINQNVDYLFLNKKNKIDFKAVFKLRKFLKNNKVDILHAHSSSFFTAVLVKLTLIKIK
FT                   IIWHDHYGINQDLRLRKSLILKYSSLFFKGVISVNTALKDWAVSYLLCSNVKYFPNFIE
FT                   DFYASNQKIALAGEEGKRIICVANLRPQKNHLFLLDTANLIKDKFPDWSFHLFGKDFKD
FT                   SYSAEFFDKIQDLQLCETVFFYGSIDDVSNVLTQCDVAVLPSLSEGLPLAVLEYGLHKL
FT                   PVIATNVGEIKKIITSENNGVIIEANNTYQFTQALTDLIIQKDKRVKMGKNLNEFIQLN
FT                   FSEVSIIKNYLSWINSSNFAGRKSL"
FT   gene            complement(313077..314195)
FT                   /locus_tag="Fjoh_0293"
FT   CDS_pept        complement(313077..314195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0293"
FT                   /product="Candidate alpha-glycosyltransferase;
FT                   Glycosyltransferase family 4"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03329"
FT                   /db_xref="GOA:A5FN81"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN81"
FT                   /protein_id="ABQ03329.1"
FT                   /translation="MKLLIISTAPLIYKDNKVFAYGPYTSELIVYKKYIEKISFACPVW
FT                   TSDKELLVSEIPFSIENHYKLIDSNLNSFTNIFKSFFQSIYNLMILFKAIKDADHVHLR
FT                   CPGNVGLIGSFAQIFFPSKIKTAKYAGNWDPKSNQPWTYKLQKYILSNTFLTKNIQVLV
FT                   YGEWPGQSKNIKSFFTATYYESEKKIVSKPALSTFVNFIFTGSLVKGKNPLYALRLVNE
FT                   LIKSGNNIVLNMYGEGIERKILEDYITTNSLEQNVFLHGNQKKEILKLAYEKSHFVILP
FT                   SKSEGWPKTIAEGMFLGCVPVATKISCVPFMLDHGKRGILLEMDLEKDRIQIQNLLSNP
FT                   NDFLIKSELAQNWSQKYTMEVFETEIKNLLKK"
FT   gene            complement(314195..314749)
FT                   /locus_tag="Fjoh_0294"
FT   CDS_pept        complement(314195..314749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0294"
FT                   /product="Serine acetyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03330"
FT                   /db_xref="GOA:A5FN82"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN82"
FT                   /protein_id="ABQ03330.1"
FT                   /translation="MQLFRFIKSDFNKYKKYGANPFVILFFTQGFWAIVQYRFANAIHK
FT                   NVKWKFFRFLLLAFAVLWQKWIEILTGISIPYSVQIGHSFYIGHFGGIIINSNVIIGDN
FT                   CNISQGVTIGVSGLNENRGTPTVGNNVYIGANAVLAGKIVIGNNVLIGACSMVKDSFPD
FT                   NSVVLGVPAVLISQKGSEGYI"
FT   gene            complement(314785..315789)
FT                   /locus_tag="Fjoh_0295"
FT   CDS_pept        complement(314785..315789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0295"
FT                   /product="Candidate beta-glycosyltransferase;
FT                   Glycosyltransferase family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03331"
FT                   /db_xref="GOA:A5FN83"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN83"
FT                   /protein_id="ABQ03331.1"
FT                   /translation="MKLFRFSLIVCTYMRPKPLIKLLKSVQEQVLYPDEIIIIDGSTDD
FT                   KTEVLLNEIHFENLKYVKAKDEDRGLTRQRNLGISNVQNNSEIICFLDDDVILEPDYFE
FT                   NLLSTYTIYPDALGVGGYISNEVKWERIQENYVSTIHDFTFDGWKRKDGSRFVLRKKLN
FT                   LDSDCPPGFSPLFSHGRSVGFLPPSDKTYRVEQLMGGVSSFKKSVFDMFSFSHYFEGYG
FT                   LYEDADFSLRVAKKGNLYLNTSARLAHYHDPSGRPNQYKYGKMVVRNGWYVWRIKNPKP
FT                   NFKDRLKWNSITILLTLIRYSNILTEKNKKAVITEAFGRTIGWWTLLIKKPQI"
FT   gene            complement(315796..316665)
FT                   /locus_tag="Fjoh_0296"
FT   CDS_pept        complement(315796..316665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03332"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN84"
FT                   /protein_id="ABQ03332.1"
FT                   /translation="MNHKIKTVLFKTLALLPNKVDDYCYHKIQSFFDKTTLESRLKSVE
FT                   STYLRLIKVLNDLDIDLKDKTVFELGSGWFPSMPYFFKYKIGAKEIITVDVNEHFKKAT
FT                   VLELNDLFLNIHNCEVIPDAKSKYGLPNEIKYLPNYNVVKQELPDVDFVFSRYVLSHMN
FT                   ENDVDRLHEAMKTQLKKGTYVVHFISPSDLRQHGDANLSLQDFLQYSKEEWNKVHTKYD
FT                   YHNRLRLPHFLEIFKKYDYEILHLDYESLHEGTKKYDLFKKIKLHDDFTRFSDEELTAG
FT                   NILVVLKT"
FT   gene            complement(316672..318291)
FT                   /locus_tag="Fjoh_0297"
FT   CDS_pept        complement(316672..318291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03333"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN85"
FT                   /protein_id="ABQ03333.1"
FT                   /translation="MIKSVSLLTTSEKHNIPFEKNQKHKIVIDFNDFNLSKVNSFDIEI
FT                   VFSESIAQFRNHDYTWVNCNEDRIANEYCPKIIRLQNGQLVQANITNGIWEVNKKDSFK
FT                   LLWRFNPEFAGSITNYLGHSNRKNISQSNKKNHFPERLTLLFPENSALEFSRSKYPFTA
FT                   IACFTDHCDFDTKENLEQQRAFFKDNKVKVTKGFFLNHYSKRSNNASFQNEKDELLKWK
FT                   EDGHELCYHSLSQSLKSESESYEDFQNFVPPLNNIKVWIDHGFQPYNFSLLKNNTLSEK
FT                   DFEENLKCKNINVLWNYIDSGVSTTGVINQFNTKHFTLSSFLKGNKDLGLVKKMQLMIK
FT                   NIIFHYYNDEDMILKYKNTAGNFKKVIFQKKIKSFFPFVKDFLSLFSCIFSVILCWKSA
FT                   KNKPYKLAKYSPVVFKHIIQDEEFYIFQTLEMLDFQKSLSKQNIEDLINEKGVFIAHTY
FT                   FSVPMEYHRGKLFSSENKIDQKVSENFKILGEKVQNKEIWNPTLSELIEYWNDFEKAIF
FT                   DIEPNGSVFVSNNIDLQIRHVI"
FT   gene            complement(318310..319848)
FT                   /locus_tag="Fjoh_0298"
FT   CDS_pept        complement(318310..319848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0298"
FT                   /product="glycosyl transferase-like protein"
FT                   /note="distantly related to glycosyl transferases"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03334"
FT                   /db_xref="GOA:A5FN86"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN86"
FT                   /protein_id="ABQ03334.1"
FT                   /translation="MIVIYHQNNRVVEVLTEGKNIDFSNKSIAENLFSIAKEYPDHLMI
FT                   WCRLDLKSYLNYSNLQDIFHHDKIMASYTLSTNFFLPETIGYVDESPFLNVKKDVSYPT
FT                   WQMSGDVGGISALVLNALYKEVQKDSNFDYFLNSLAKLAMLRGLLCYSEPKLLSEKKTI
FT                   KEKSEKRSFLLFRFVKQHYKTRWTFLLFLNLLIYEKELAIFPFISSLFFKKRILKETTL
FT                   HKIESQYKNNKIIEKTIDVIIPTIGRKECLYDVLKDLSNQTLLPQKVIIVEQNPDLNSV
FT                   SELDYISDENWPFQIKHKFINQAGACNARNLALTEVEHEWVFMADDDIRISNDFLDQAF
FT                   KVLEKRICEQITFACFEPNYPQNKKEKEIFQWETFGSGCSIVRTKNVKSLFYNKSFEFG
FT                   FGEDSDFGMQLRNLGHDILYSPKPEILHLKSPIGGFRTKPILVWQKEVIQPKPSPTVML
FT                   YKILHLTKQQIKGYKTVLFFKYYRVQTIKNPIKYFLKFNKQWDSSIFWANQIKK"
FT   gene            complement(319845..320999)
FT                   /locus_tag="Fjoh_0299"
FT   CDS_pept        complement(319845..320999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0299"
FT                   /product="Candidate alpha-glycosyltransferase;
FT                   Glycosyltransferase family 4"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03335"
FT                   /db_xref="GOA:A5FN87"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN87"
FT                   /protein_id="ABQ03335.1"
FT                   /translation="MHIAFLTPEFPHAKVAYAAGIATSINNLANALVSEGASVTVFVYG
FT                   QKTQEIIVENGVSIHLIKNKKFKFLSWFFYRKYIQNYCNVIIKKEKIDLIEAPDWTGIT
FT                   AFMKFKAPLIIRFHGSDTYFCHLENRKQKKKNFWFEKKALQKAKACIAPTTFAGALSKE
FT                   LFKIKNKEIKTIHNGLELEKFTNYSAEDYQKGLMLYIGTLIRKKGVLELPEIFAKVRNQ
FT                   FPEAKLVLIGADSNDIKTGSASTWQLVKERFRVEDLKNIEYLGKIPYEEVRNYIQKANV
FT                   CIFPTFAETLGMVTIESMAMQKVVVNSNIGWSQELIEDEESGFLVHPANHNLYAERIVQ
FT                   VLKDQKITLEIGKQARLRIEDKFDIKKLVKENIEFYCKIIKSNK"
FT   gene            complement(320999..321877)
FT                   /locus_tag="Fjoh_0300"
FT   CDS_pept        complement(320999..321877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03336"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN88"
FT                   /protein_id="ABQ03336.1"
FT                   /translation="MKKFLFFLSKIFAIILLLAVVLDVVYTKAYLQTNKRGKIGYVYNS
FT                   KPKTIDIVILGSSRAYYHLVTPMFLKEGFNTFNYGMEGSKLFESDLILKLLLAKENKIK
FT                   NVILEVDLSLSSETEYSEANTLKFMPYFWDSKIIRDQFEHLPENNIEYFLPYYRFMKYE
FT                   TKLGFREMLSNAIDKKGSDQNDGGYLGLFYSNPELKLDLSNVEPRRNKYYEEIKSLCKK
FT                   NDINLIAIMTPVCKSTKGMDYFQKINKIYPEIHNYEDVIIEDKYFSSCAHLTDEGAKIF
FT                   TARILKDFFNK"
FT   sig_peptide     complement(321788..321877)
FT                   /locus_tag="Fjoh_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.737 at
FT                   residue 30"
FT   gene            complement(321907..322788)
FT                   /locus_tag="Fjoh_0301"
FT   CDS_pept        complement(321907..322788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03337"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN89"
FT                   /protein_id="ABQ03337.1"
FT                   /translation="MKRFLIYTAKIIVVIVLGAIVLDGLYTAIFLQSKNRGKIETVVNS
FT                   DAQNYDVVILGSSRANNHFVAPMFEEKGLKTFNYGMSGGHLFEASLMLKLMMERKYKIK
FT                   NVILEADLNLSNEHDAEGISAYFLPYIHNSEVIKNHFSTLENFNELYYIPFYRYIKFDA
FT                   RIGVRETFFTLIHKKTNSLDNLGYYPLEKHKNGNMKNNIVSLNPLPHNKYYEEIKSICK
FT                   ANNIKFIAVMTPMCENVKGMNYFEKVKKAYPEIYNYESVVKEDKYFSSCGHMTNEGAKI
FT                   FTARILKDFFKK"
FT   gene            complement(322788..324221)
FT                   /locus_tag="Fjoh_0302"
FT   CDS_pept        complement(322788..324221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0302"
FT                   /product="membrane bound O-acyl transferase, MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase, MBOAT
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03338"
FT                   /db_xref="GOA:A5FN90"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN90"
FT                   /protein_id="ABQ03338.1"
FT                   /translation="MFFNSIAFAIFLPIVFFLYWFVFNKTKSTQNALLIIASYYFYSCW
FT                   DWRFLFLLVFSTFLDYFTGIQIEKSESERKRKFWFWLSISVNLGFLGVFKYYNFFAASF
FT                   AELFTSLGFKASPILLNVILPVGISFYTFHGLSYVIDIYYKRIKAEYNFIDYSLFVSYF
FT                   PLLVAGPIERATHLLPQVKVKREFDFEKAKEGVCQIIWGLVKKVVIADTCATYANAIFD
FT                   HYQSMNSFSLILGAIYFAFQIYGDFSGYSDIALGTSKLFGLDLLRNFNYPYFSRDIAEF
FT                   WRRWHISLSSWFRDYLYIPLGGSKGGLWMKIRNTFIIFVVSGFWHGANWTYIAWGFINA
FT                   VYFLPLLLSKKNRNNMDTVELKWNFDSVKVALSILSTFIITCIAWVFFRAKTITDALLY
FT                   LKRMVLNGDFNFQYLDNERYNYELILLIGVFTIVEWNCRTKTEPLSGRRNILKIALAIL
FT                   AIMAFGTFSDYKEFIYFQF"
FT   gene            complement(324236..325642)
FT                   /locus_tag="Fjoh_0303"
FT   CDS_pept        complement(324236..325642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03339"
FT                   /db_xref="GOA:A5FN72"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN72"
FT                   /protein_id="ABQ03339.1"
FT                   /translation="MPDKKIFILLPDGVGLRNFAFSNFYEIGLEKNFDITYWNNTPFDL
FT                   TGLGFNEIKINNAKSNPLTDSYKNARKHIELNLNIKKEKDHVYDTYRFPFSYKNIKIAL
FT                   KSYIARFLISLYNSEKGLSKVREKIKNGEKKTDFYKDSLKTLEIERPDFIFCTNQRPVL
FT                   AIAPILAAKELKIPTGTFIFSWDNLPKATMVVETDYYFVWSEHMKSELLKYYSYINENQ
FT                   IFVVGTPQFEGHFDKNSIIDKVEFFNKYKLDLSKKYICYSGDDITTCPDDAQYLADVAD
FT                   ALRKINEENTNSLGIIFRRCPVDFSNRYDKVLERNKDLIVSIDPNWKKIGEEWNTVLPT
FT                   KDDVSLLANTIYHTEMVVNLGSSMVFDYICFKKPCAFINYDVTNRIDKNWSVSKIYNYI
FT                   HFRSMPDKKSVIWLNSADEIVDKIKSGLEQNDEIVQNAQKWFEIINQHSPEKASNRIWQ
FT                   AIESIADNLV"
FT   gene            complement(325642..326763)
FT                   /locus_tag="Fjoh_0304"
FT   CDS_pept        complement(325642..326763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0304"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03340"
FT                   /db_xref="GOA:A5FN73"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN73"
FT                   /protein_id="ABQ03340.1"
FT                   /translation="MKKILFLTGTRADFGKIKSLISILEKQKEFEVFVFVTGMHLQEEY
FT                   GYTLIEIERCNFKNIHTFVNHTHETTMDLTLAKTIEGFSAYCNTITPDMIVVHGDRVET
FT                   LAGAIVGSLNNILVAHIEGGEISGTVDELIRHSVSKLSHIHFASNTEAEKRLIQMGEIK
FT                   ESIFTIGSPDIDIMFSNQLPNIEIVKDYYKIPFENFSVVMFHPVTTEIQNMKQYAENFV
FT                   SALLKDNHNYVVIYPNNDLGSQFVLDSYEKLKNNDRFRVFPSLRFEYFLTLLKNSQFII
FT                   GNSSAGVREAPYYGIPIINIGTRQQNRAIHADIINVNYSETEIAGALSIIDSHKIQKTN
FT                   DDFGQGNSAELFLNCLQKSDIWQLNHQKQFRDS"
FT   gene            complement(326769..327812)
FT                   /locus_tag="Fjoh_0305"
FT   CDS_pept        complement(326769..327812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0305"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.56"
FT                   /note="PFAM: N-acetylneuraminic acid synthase, N-terminal
FT                   domain; SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03341"
FT                   /db_xref="GOA:A5FN74"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN74"
FT                   /protein_id="ABQ03341.1"
FT                   /translation="MKYPYIEIAGRKIGPDYPPLVIAEIGINHEGLLIAAKEMVDAAYR
FT                   AGVEVVKHQTHIVEDEMTGAAKKVIPGNADVSIYEIMERCSLNEADELELKKYVESKGM
FT                   IFISTPFSRAAAERLKKFDIPAYKIGSGECNNYPLLEHIASFGKPVILSTGMNTIESIT
FT                   KAVAVFDKHNIPVALLHTTNLYPTPIHLVRFGAMLELHQAFPDKVFGLSDHTLNNNACL
FT                   GAVALGASILERHFTDHMQRTGPDIVCSMDEKACQELIISSAEIAQMRGGSKKPANEEQ
FT                   VTIDFAFATVCSIAPIKKGEVFSKENIWVKRPGTGKILAEHFNDLIGKTAARDIDNDEQ
FT                   LIWEDIQ"
FT   gene            complement(327835..328935)
FT                   /locus_tag="Fjoh_0306"
FT   CDS_pept        complement(327835..328935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0306"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03342"
FT                   /db_xref="GOA:A5FN75"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN75"
FT                   /protein_id="ABQ03342.1"
FT                   /translation="MIKSNNYFSNLNGVRCIAASMVIISHIELGKSYFGIANKFESLKH
FT                   LGALGVSLFFVLSGFLITFLLLEEKSKNGQINIKFFYLRRILRIWPLYFLIVILSIFIL
FT                   PHIKWFDIPNFSLDFDSNFEFIKVIVLFLFFLTNILISIKLVPFATQTWSIGTEEQFYL
FT                   IWPLIINRTEKLEKLFILIIFFYNLLNVVIRNSIFSEIKYFSLFQNYISLIQLDSLAFG
FT                   ALGACLLFKKSKILSRIINNFSFFFFLLLLVIGVIFYSHIIYFRSIFTAICFVVIILNL
FT                   VRNEMLTNVLENKFFFKMGEISYGLYMYHQIVIAMCMNVLLKYDKFNNSLLYIFTFAIT
FT                   ILISILSYKFLEKPFIQKKKHYTFKS"
FT   gene            complement(328922..329587)
FT                   /locus_tag="Fjoh_0307"
FT   CDS_pept        complement(328922..329587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0307"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /note="PFAM: acylneuraminate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03343"
FT                   /db_xref="GOA:A5FN76"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN76"
FT                   /protein_id="ABQ03343.1"
FT                   /translation="MKTIAIIPARGGSKRLPDKNILLFGGIPLIAHSILYAKANAVIDE
FT                   VYVSTNSEPIKEIALKFGAKVIDRPENISGDLEPTVSALKHVLETIEMNVENIILLQPT
FT                   NPLRPDNLLNDAFNIYQKESYNSLFTVSRNHQKFGKIKDSKFIPFNYEIGQRSQDLEPL
FT                   FFENGLLYITKSKLIFENIIISEDAFPFEVNHIFAATDIDTQEDFDYAQYLYLLSDKK"
FT   gene            complement(329587..330681)
FT                   /locus_tag="Fjoh_0308"
FT   CDS_pept        complement(329587..330681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0308"
FT                   /product="Candidate alpha-glycosyltransferase;
FT                   Glycosyltransferase family 4"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03344"
FT                   /db_xref="GOA:A5FN77"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN77"
FT                   /protein_id="ABQ03344.1"
FT                   /translation="MSKVILISQIPLPYDKIGSWSTLYKNYLQNNHKIDYIVCVEPELK
FT                   FENVQYSFVKNDFVEKIIKRITKNPYAGYLKALEKIIKPEEKYIIQIVDNFGIVKRLIH
FT                   FLEQNNKRSQFYIQFFYHGFPPFYENFYGNWFFENIDEMVLLTHDSYKVHKQTYTVLPT
FT                   KFSVLHNGIDTSKFHKISSEDKAGLKKELGITNKKIFVWCSQDRPKKGLNFILDAWKRI
FT                   NRKDKDAVLLVIGANREFKIEGVTFLGRIPNNELPKYYQIADCYLFPTLWHEGFGLSLI
FT                   EALHCGCYCIASANGGVPEVLQYGKLGKLIEKPNFVEEWVTEIEAFLNQDETYNLLIPD
FT                   NLYSMKNWNEGMNEIIENAKKNLS"
FT   gene            complement(330711..331781)
FT                   /locus_tag="Fjoh_0309"
FT   CDS_pept        complement(330711..331781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0309"
FT                   /product="Candidate beta-glycosyltransferase;
FT                   Glycosyltransferase family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03345"
FT                   /db_xref="GOA:A5FN78"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN78"
FT                   /protein_id="ABQ03345.1"
FT                   /translation="MKISIIYTFRNRDSRRVKNSLDSLAKQTKQNFDVIFIDYGSDEDT
FT                   ALEIKNLLKKYDFASYIYLNTNKQPWNKCKALNFAIKQIKSKYCFIADADIIFHSKFTL
FT                   ELERLTEPNKAVYFQVGFLSEEESSKNIPFEEYKIKFLTNNEATGMTLFPVENLYSING
FT                   FDEFFHFWGAEDTDIHNRLKNAGCEIEYYDQELLLLHQWHKNFRSRETKELGKELQLSG
FT                   IVEINHQHLIYNLENKITKVNDENWGNLADEKEFNELVASSPLVLPDKKSSIDHFLYYE
FT                   LPNSKNKVLSVQIKENKSEMKNKLKRILGKKIIEHYTLKEINDLFLLHIVSFYHNFPYS
FT                   YKISEDLKSITFKIKK"
FT   gene            complement(331781..332608)
FT                   /locus_tag="Fjoh_0310"
FT   CDS_pept        complement(331781..332608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0310"
FT                   /product="Candidate beta-D-/alpha-L glycosyltransferase;
FT                   Glycosyltransferase family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03346"
FT                   /db_xref="GOA:A5FN79"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN79"
FT                   /protein_id="ABQ03346.1"
FT                   /translation="MQFKISIITINYNNASGLEKTIESVINQTYKDFEFIVIDGGSTDE
FT                   SKEIILKAGSSISYWVSEKDAGIYNAMNKGIKTASGDYLLFINSGDYLYNEKVVENLVN
FT                   HLLETDEIVYGNVLLRNETKNWEIIQEHPDKLNFSYFYNRTICHQVCLFKRSLFDNIFF
FT                   FNEDYKIASDWEFLIYAIYIQKVNCRKIDLLISVYDTTGISGNPNFKKIAASERKKTME
FT                   KFFPLFEDDYKLLSKYSSNRSKQLLQIEKSVFFRKIVSVFFMAVLLFIPKKDK"
FT   gene            complement(332644..333663)
FT                   /locus_tag="Fjoh_0311"
FT   CDS_pept        complement(332644..333663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03347"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN80"
FT                   /protein_id="ABQ03347.1"
FT                   /translation="MRVGFNPHKDQLNLKSEYFHQIIIPVYIPNHEDYFKDSFEILKLC
FT                   LESLFLTTHQKTYITVVNNGSTKNVSNYLSQLYFDKKIQEVVETTDIGKLNSILKGLAG
FT                   HNFPLITISDFDVLFLNNWQKETYSIFENFEKAGAVCPTPSSRSLRTYTSNIYWEKFFS
FT                   KDLVFSDVRNPEALQNFAHSVGNSNFYNKHHLEKYFTVFKNNKKAVIGAGHFVATYRGD
FT                   IFDNIIKYSHYKLGGNSENAILDVPVVKKGLWRLSTEDNFAYHMGNVLEDWMYDHIQKL
FT                   NKNMDEDSFYLKEAKSSSLLYNFIKNRLFSKIILNKKVMKYFIRWKGLNKQQARDYLV"
FT   gene            complement(333654..334796)
FT                   /locus_tag="Fjoh_0312"
FT   CDS_pept        complement(333654..334796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0312"
FT                   /product="alpha-glycosyltransferase-like protein;
FT                   Glycosyltransferase family 4"
FT                   /note="Related to alpha-glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03348"
FT                   /db_xref="GOA:A5FN63"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN63"
FT                   /protein_id="ABQ03348.1"
FT                   /translation="MKILLVSMPSIHVIRWIENLKDTKYQLYWFDVLDRGTVETLHSVK
FT                   QFTGWKKRKWPYIKGEYFLSKNFPGIYQKIIPTLEITANEALEKIIKEIQPDVIHSFEM
FT                   QNCSYPILKTMLKFSKMKWLYSCWGNDLFYYMNFKNHNLKIKKVLKRVDYLHTDCKRDF
FT                   HLAQKLNFSGKYLGLVPGGAGYKLKELEAFKLPVSERKIILVKGYEHTLGRGLNIIKAL
FT                   HSLQDEIKNYQVIIFGAHQNVTDYIKFNDLDFQSFNRHELLHDELTKLMGKSLLYIGNS
FT                   ISDGMPNTLLEAVLMGAFPIQSNPGRVTEEIIINGSNGLLINDPESVSEIKELILKSLS
FT                   DLTMLQEALVKNQKIAADRLDYFDNKRKIVAMYKTVLECE"
FT   gene            complement(334793..335698)
FT                   /locus_tag="Fjoh_0313"
FT   CDS_pept        complement(334793..335698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0313"
FT                   /product="GDP-Fuc: alpha-L-fucosyltransferase-like protein;
FT                   Glycosyltransferase family 11"
FT                   /note="Related to GDP-Fuc: alpha-L-fucosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03349"
FT                   /db_xref="GOA:A5FN64"
FT                   /db_xref="InterPro:IPR002516"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN64"
FT                   /protein_id="ABQ03349.1"
FT                   /translation="MLTFKSLGKKGNLGNQLFHIASTIGIAKKNKHEFVFPNWYYTDFF
FT                   NYSFPIIKEYEDYNFVQVVEKSYSFHEWDLGQGNYDVNGALQSEKYFDKVFTKKIFEFK
FT                   AEFLKELLNKYKYLFDKNTIFISVRRGDFVYHPDYYQLPYQYYFLALEEYFPDWKERNL
FT                   IFMSDNINYCKYHYSFLKNAIFLENLSAIEQLAIGSQGKDFIISNSTFSWWTAWLGEKE
FT                   DSKIIRPLKNFRGSLAKLNDDSDFFPEQWIKFDYKKNRIGLKYFSLTIKGRIYQIADFL
FT                   QFSIKKIFFLMKKAVNKIFK"
FT   gene            complement(335725..336696)
FT                   /locus_tag="Fjoh_0314"
FT   CDS_pept        complement(335725..336696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0314"
FT                   /product="Candidate beta-glycosyltransferase;
FT                   Glycosyltransferase family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03350"
FT                   /db_xref="GOA:A5FN65"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN65"
FT                   /protein_id="ABQ03350.1"
FT                   /translation="MKTLISIIIPTFNRAHLIGDTLNSILNQTYTSWECIIVDDGSIDN
FT                   TQDVVNEFVKKDNRFQYHKRPAYKSKGPNSCRNYGFEKSVGSLIQFFDSDDLMKLNCLE
FT                   VKSSYFLENIDLVICKLSLYDFEKNIEIKQSNIISKDLIYDYFAGKVALYICGPLWNRS
FT                   FLETKRFLFNESIVNCDDWDFNMNMLYFNPKYIIVNEALIFYRRHHSSLSKEIEEQHLS
FT                   EIRNVSNLLDQHLTLIKKNKISKLRKFYKYAIDYNKYYLKEAIVKKDKIQYLFLFRISK
FT                   YCLAYNFWNIFFRIWMLKVFYLFFGKIFKIFKNNNFTVIRRS"
FT   gene            complement(336693..337595)
FT                   /locus_tag="Fjoh_0315"
FT   CDS_pept        complement(336693..337595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0315"
FT                   /product="Candidate beta-glycosyltransferase;
FT                   Glycosyltransferase family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03351"
FT                   /db_xref="GOA:A5FN66"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN66"
FT                   /protein_id="ABQ03351.1"
FT                   /translation="MLAIIIPYYKLTFFEETLKSLENQTNKRFKVYIGDDASQESPILL
FT                   LEKFQSKFEFIYHKFEKNLGSISLTKQWDRCIDLAKEEKWLMILGDDDLLAENVVEEFY
FT                   LNCSEFENKANVVRVASKIVSENNQNISEKFQHPKWETASNFYYRKYKGLTRSSLSEYI
FT                   FAKNTYLKYGFKDYPLAWFSDDMAWIDFAEDRSIYTINNSQVMVRISNINITGKKDNFS
FT                   VKNQAEELFYTDLVHKKIHLFNSIQKNDLLMTYEISIKKNRKVVFKEWKFLLKSYFRNG
FT                   KIVPFLKCFRRFFRDFVLS"
FT   gene            complement(337596..338441)
FT                   /locus_tag="Fjoh_0316"
FT   CDS_pept        complement(337596..338441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03352"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN67"
FT                   /protein_id="ABQ03352.1"
FT                   /translation="MISIIICSRTSVISDNLLDNILLTIGADHELIVIDNSENKYSIFE
FT                   AYNIGINKSKGEIVCFIHDDINFLTLNWGGILIEIFNENKKVGLIGVAGAKSKTKMPSA
FT                   WWNCGDKDLYMNINQYLANGNKEYWYKGFDKSTIEEVVVIDGVFMAARKDNSISFNTKL
FT                   TGFHNYDLNLSFEYLKKGYIVVVTNNILLDHFSIGVLNESWYKSALQIHKLYNDFLPLN
FT                   KSNNSYSSLKSYEFNNGVKFISNLLKFKLRKEAFCLWIKLFLIKPVSKFHFYFFKSLFQ
FT                   "
FT   gene            complement(338438..339427)
FT                   /locus_tag="Fjoh_0317"
FT   CDS_pept        complement(338438..339427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0317"
FT                   /product="Candidate beta-glycosyltransferase;
FT                   Glycosyltransferase family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03353"
FT                   /db_xref="GOA:A5FN68"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN68"
FT                   /protein_id="ABQ03353.1"
FT                   /translation="MIVDFPLISIIVPNYNHENYLKQRLDSIFKQTYQNFEVILLDDCS
FT                   TDESRKILSEYALNPKVTHCIFNAENSGNTFVQWKKGIELAKGDFVWIAESDDYCDVDF
FT                   LEKVSIPLINDTQVMLSYCQSNKVDNTGSITGNWIEHTDSLDKESFKKDFVIDGNLFIE
FT                   KYLIFLNAIPNASAALLRKNNLDISQVLLSNTNLKTCGDWLIYFDQIINYKIAFIAASL
FT                   NNFRYHTNSVIAKTVILDNRNLIVDINLQMRKVIFTILKFKKPLNYNLVAAKNKEIIKA
FT                   LKYEKSFLLIHDDKKLKGFFILAGVLGQFIQKYQFRKNLKIKLKKFFS"
FT   gene            complement(339424..340281)
FT                   /locus_tag="Fjoh_0318"
FT   CDS_pept        complement(339424..340281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0318"
FT                   /product="Candidate beta-D-/alpha-L glycosyltransferase;
FT                   Glycosyltransferase family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03354"
FT                   /db_xref="GOA:A5FN69"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN69"
FT                   /protein_id="ABQ03354.1"
FT                   /translation="MQSDNSLFLAIYMITYNHGAFIEETIESLMNQNTSFKYKLFIGED
FT                   LSSDNTRAICLKLKEKYPNKIDLFLNTQNLGPNLNAKQIFKACFESGAKYIALCEGDDY
FT                   WTDKLKLQKQVDFLEANPDYVICYHKVKVLRNGILEEDSITRKAPETTTIKDLAKGNYL
FT                   HTCSVVFRNKLFEKFPSYFHKSPIGDYFLHMLNARYGKIKFIDEYMGVYRLHETSVWSS
FT                   KTQVKREQIWLKFLKNIRKNFDKEVQNILDDQIKQYKILRNKRRVARLKKVIKRFLFLK
FT                   EIKK"
FT   gene            complement(340268..341197)
FT                   /locus_tag="Fjoh_0319"
FT   CDS_pept        complement(340268..341197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03355"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN70"
FT                   /protein_id="ABQ03355.1"
FT                   /translation="MWKKKGLLFNVSHYKNDFIKSHASIPFAYHVEENMFRIYFSSRNE
FT                   AGKSFPFYINAIVNNGNIEVISDVVGPILELGRLGTFDDSGIMPSCLIKSNDKLLMYYI
FT                   GWNPQITVSYRLSIGLAISYDNGLTFQKFSEGPICDRNISEPYFNTAPYIIIENNVWKM
FT                   WYISCTGWEIINNYPEPSYHVKYAESDDGINWERKGTISLDYDEKAKALGRPCVLKEDN
FT                   KYVMYFSYRNTSEYRTSSQDGYKLGLALSYDGVIWEKKYEDVGIALSNFGWDSQMMEYC
FT                   HVFEHMGFTYMLYNGNDFGKEGFGYAVR"
FT   gene            complement(341200..341853)
FT                   /locus_tag="Fjoh_0320"
FT   CDS_pept        complement(341200..341853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0320"
FT                   /product="Acyl-(acyl carrier protein)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03356"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN71"
FT                   /protein_id="ABQ03356.1"
FT                   /translation="MANVIIFGIQDFAELAHYYLENDSEHHVIAFAVNECYLPDNKMFK
FT                   GLPVVAFENIEKKYSPKEFKFFAPMAPQKMNTLRENIYNNIKSKGYDLISYISTKATVF
FT                   NGSIGDNCFILENNTIQPFTTIGNNVVLWSGNHIGHHSLIKDHVTFTSHVVLSGHCIVE
FT                   SYCTFGVNSTIRDGLHIAEGTFVGMSATIIKNTESWSIYKGNPAQKSEISSKKI"
FT   gene            complement(341857..342489)
FT                   /locus_tag="Fjoh_0321"
FT   CDS_pept        complement(341857..342489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0321"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03357"
FT                   /db_xref="GOA:A5FN55"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN55"
FT                   /protein_id="ABQ03357.1"
FT                   /translation="MKKYTKIIEHYESCFDKHGDNHLGVDWPNKEDVDIRYKIMLDIIK
FT                   LNDRNDKQVSLLDFGCGTSHLLEYIHKNEMSTIDYSGLDISQKFINVAKNKYPNNTFYC
FT                   LDIFESENCLGNFDYIIMNGVFTEKNSLSYEEMWEYFTNMLRVIYKKADKGFAFNVMSK
FT                   NVDWERQDLFHVPHDQLSSFLCNNLTRNYIIRNDYGLYEYTVYVLKK"
FT   gene            complement(342499..343182)
FT                   /locus_tag="Fjoh_0322"
FT   CDS_pept        complement(342499..343182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03358"
FT                   /db_xref="InterPro:IPR014985"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN56"
FT                   /protein_id="ABQ03358.1"
FT                   /translation="MKVAIMQPYFLPYIGYFKLIKEADTFVVYDDVNFIKKGWINRNNI
FT                   LVNEQQFLFTIPLQYVSQNKLINEIEIDENSEWKKGLLKTINHAYSKAPFFKEVYPLIK
FT                   KIIEFQETNIAKFILYSLEQVCCFLEIKTNIIISSDIKKINILKGQEKIIDICQKLGAT
FT                   YYLNASGGKSLYDENQFLNGNIFLKFIEPPQITYPQFKNTFIPYLSIIDVLMFNSLESI
FT                   QDFLK"
FT   gene            complement(343182..344255)
FT                   /locus_tag="Fjoh_0323"
FT   CDS_pept        complement(343182..344255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0323"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03359"
FT                   /db_xref="GOA:A5FN57"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN57"
FT                   /protein_id="ABQ03359.1"
FT                   /translation="MINVTKTFLPLLEEYNKQLQRAWEKQWLTNRGELVLELEQKLKEY
FT                   LNTSNIIVTNNGTVPLQIALKLLGNQGEIITTPFSYVATSAAIVWENCTPVFVDIHAEY
FT                   LSIDETKIEAAITNKTTAILATHVFGNPCNVEAIEVIAQKHNLKVIYDAAHSFGVTYKR
FT                   KSLFNYGDISTCSFHATKLFHTGEGGAMFTNCETLYNKMFYSHNFGHNGALDFYDVGIN
FT                   GKMSELQAAMGLSVLPYIENIILERKKVVDYYNSNLDLSKIQTLKLRDHTQWNFSYYPI
FT                   IFESEEKLLKVERKLNESQIFPRRYFYPSLNTLGYMKGNKMDISENISCKILCLPLYVG
FT                   LLDVELQKIVSIINYNL"
FT   gene            complement(344255..345025)
FT                   /locus_tag="Fjoh_0324"
FT   CDS_pept        complement(344255..345025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0324"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03360"
FT                   /db_xref="GOA:A5FN58"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN58"
FT                   /protein_id="ABQ03360.1"
FT                   /translation="MKKKIKKAAKLVLNKLGYNLTKISATNIDLINTSHKNYLLFNFYN
FT                   TLKEFNFQPKHIVDVGANHGTWTREALLHFPDAYYTLLEPQEWLKESFQDILDSNPKVR
FT                   FHAVGAGQKKGSFLFTIVDRDDSCSFRYTKEEALEAGFKQLEIPVVTLNELLLENKMPV
FT                   PDIIKIDAEGLDIEVLKGADSFFGKTEIFMVESGIVNKTLNNNLFSLVNFMDENGYRLF
FT                   EITDLNRPFALKVLWLAELVFVKKDGFIDSQRII"
FT   gene            complement(345026..346294)
FT                   /locus_tag="Fjoh_0325"
FT   CDS_pept        complement(345026..346294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0325"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03361"
FT                   /db_xref="GOA:A5FN59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN59"
FT                   /protein_id="ABQ03361.1"
FT                   /translation="MKDIILKAENISKQYRLGQVGTGTLKHDLNKWWHQIRGKENPYLK
FT                   IGETNDRSTKGTSDYVWALQNIDFEVERGEVLGIIGKNGAGKSTLLKILSKVTAPTTGT
FT                   IKSRGRIASLLEVGTGFNGEMTGRENIYLNGAILGMTKKEIASKLDEIIEFSGCERYID
FT                   TPVKRYSSGMTVRLAFAVAAFLEPEILVVDEVLAVGDAEFQKKAIGKMQDISRGEGRTV
FT                   LFVSHNMAAVKSLCTRGLVLINGKVAMAGSVENAVNFYLSQDSESMNAKVFDSNYDKNE
FT                   FTIHEISLNAVGKSSEAPLDEYQEIEINTLFTLKDDSRKLHLTFVLNNDFGEPLFTFSH
FT                   VNKNLKLNKGTNKIKCLLPEGFLNVGTYYLSLYIIEDSKSALFIEKDIISFVIQEGERP
FT                   VGSWMGREPGFIKPKFDWSIEVN"
FT   gene            complement(346382..347509)
FT                   /locus_tag="Fjoh_0326"
FT   CDS_pept        complement(346382..347509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0326"
FT                   /product="Candidate alpha-glycosyltransferase;
FT                   Glycosyltransferase family 4"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03362"
FT                   /db_xref="GOA:A5FN60"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN60"
FT                   /protein_id="ABQ03362.1"
FT                   /translation="MRIILDPQIYNLQRYGGISRYYTEVFTLLAKDKNVTIITPLNNST
FT                   NIYFNNSVLNSFKQNIYGIIIKYFKKIKLYQRLKIQYIANLNFEKRLISAKYDLFIPTY
FT                   YDVNFLKYIGSKPFVLTVYDMIHELFPEYFTNSEVLLKNKLLLMEKATRIIAVSENTKK
FT                   DILKLYPHINESKIDVIYHGASIKIKNNIENILPDKYILFVGNRSIYKNFLFFINSISN
FT                   LLKNEENLFLVCAGGGNFTNAENEYISRLGLKNKILFKSFVDDELGYFYKHAECFVFPS
FT                   QYEGFGIPVLESMICGCPVVLGNHSSFPEVAGDAGVYFELNNSDDLVEKINTLIKNKSV
FT                   REYFSKKGIEQAKKFSWEKAAVECITVYNIACKTN"
FT   gene            complement(347563..348429)
FT                   /locus_tag="Fjoh_0327"
FT   CDS_pept        complement(347563..348429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0327"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03363"
FT                   /db_xref="GOA:A5FN61"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN61"
FT                   /protein_id="ABQ03363.1"
FT                   /translation="MNNTKESNDWLFEIAPKNKFLSVNLKETWQYRDLLFLFVKRDIIT
FT                   VYKQTILGPLWYLIQPLFTSVTFTIIFNNVAGISTGSVPPFLFNLAGITIWNYFTACLT
FT                   GTSDTFKANASIFGKVYFPRIITPLSVVISNLIKFGIQFIIFIFFYLFYYFNGFDLSLN
FT                   ISVFFFPLLICIMGVLGLGLGMLISSMVTKYRDFSYLISFGIQLLMYLSAVMYPMELVK
FT                   DKLPKFGWLVEYNPLAYTIETTRYMLLNIGNISTLGLVYTVFFTVIVFFIGLLIFNRTE
FT                   KSFIDTV"
FT   gene            complement(348576..350417)
FT                   /locus_tag="Fjoh_0328"
FT   CDS_pept        complement(348576..350417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0328"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03364"
FT                   /db_xref="GOA:A5FN62"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN62"
FT                   /protein_id="ABQ03364.1"
FT                   /translation="MVLIFSFTFTYMLFEGTALGYIITSHQFAFVGGLLFINIFFFWLF
FT                   RTYSGIIRHSSYIDAIKLLFSQMSVLVFFLFFNLVFELYTGHKAFLNTALFINLVLSFC
FT                   GLFLYRVIVKQTFEMYFSEKTNSKLIRTVIYGTDANAISVANALKFETPSRFKIVGFVD
FT                   KNNQNASKRMLDLPILILRKKLPALMRSVAAEGVIIADKSLTKDEQLIIVDQCLEFNYR
FT                   VYTVPLISDWENQKEISQKVKNIQIEDLLERKPIVLDSKSISKQLKDKTVLITGAAGSI
FT                   GSEIVRQVLGFNPKIVIILDHAETPLHNLCLETLSMNPTAKIVAVIADIKSKKALEKVF
FT                   KNYNPHVVYHAAAYKHVPLMEENPSQAILTNIRGTKNLADLSCKYHVKKFVMVSTDKAV
FT                   NPSNVMGASKRIAEKYVQSLSLKNQKENIPGVTKFITTRFGNVLGSNGSVVPLFTKQIA
FT                   EGGPVTITHQDIIRYFMTIPEACQLVLEAGAMGNGGEIYIFDMGKPVKIIDLAKKMIKL
FT                   AGFIPDKEIKIKIVGLRPGEKLYEELLNDTSKTLPTYHNKIMIAQEIQDEYEDLHNDID
FT                   ELIGIADFYENEDIVAKMKKIVPEFKSMNSAFEVLDK"
FT   gene            complement(350690..351625)
FT                   /locus_tag="Fjoh_0329"
FT   CDS_pept        complement(350690..351625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0329"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03365"
FT                   /db_xref="GOA:A5FN44"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN44"
FT                   /protein_id="ABQ03365.1"
FT                   /translation="MNKSDKIYIAGHRGMVGSAILRQLKIKGYTNFVLKTSSELDLTQQ
FT                   QDVADFFLKEKPDYVFLAAAKVGGILANNIYKGDFIYANLMIQSNVIHHAYLNNTKKLM
FT                   FLGSSCIYPKMAPQPLKEEYMLTGELEPTNEPYAIAKIAGIKMCDAYRSQFGCNFISVM
FT                   PTNLYGPNDNYDLTNSHVLPAMLRKFITAKRNNDTSVTIWGSGSPKREFLHVDDLADAC
FT                   LYLMENYDDQGLVNVGVGEDISILDLAVLIKKIVGFEGEILNDISKPDGTPRKLMDVSK
FT                   LSSLGWKAKTSLEEGIQKVYKEIKDSNWDK"
FT   gene            complement(351644..352756)
FT                   /locus_tag="Fjoh_0330"
FT   CDS_pept        complement(351644..352756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0330"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03366"
FT                   /db_xref="GOA:A5FN45"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN45"
FT                   /protein_id="ABQ03366.1"
FT                   /translation="MKIALITGITGQDGAYLADLLLKKGYEVHGIKRRSSLFNTDRIDH
FT                   LYQDPHEKNIRFKLHYGDLSDSTNLIRIIQEVQPDEIYNLGAMSHVKVSFDTPEYTANA
FT                   DGIGTLRLLEALRILNLTKKTKIYQASTSELYGLVQAVPQSENTPFYPRSPYAVAKLYA
FT                   YWITVNYREAYGIFACNGILFNHESPLRGETFVTRKITRAVSKMALGLQDCLYLGNLDA
FT                   RRDWGHAKDYVEAMWLILQQDQPEDYVIATGVTTTVRDFVKMSFNEVGIEIEFKGEGID
FT                   EKGYIRSCSNPAYQIEAGKEVVVVDTAYFRPTEVDLLIGDPTKAKTKLGWEPKYDLPSL
FT                   VKEMMAADVEHFQKEKVLKDAGYFIKNQFE"
FT   gene            complement(352791..353666)
FT                   /locus_tag="Fjoh_0331"
FT   CDS_pept        complement(352791..353666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0331"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03367"
FT                   /db_xref="GOA:A5FN46"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN46"
FT                   /protein_id="ABQ03367.1"
FT                   /translation="MKGIILAGGSGTRLHPLTLAMSKQMMPVYDKPMIYYPLSTLMMSG
FT                   INEILIISTPHDLPNFKKLLGDGSSLGCKFSYAEQVIPNGLAQAFVIGEKFIGKDKVAL
FT                   VLGDNIFFGTNMQQLLKDNADPEGGVIFAYHVADPERYGVVEFDENKNAISIEEKPIEP
FT                   KSNYAVPGLYFYDNSVVEIAKSIKPSPRGEYEITDVNKAYLEKGKLKVGILSRGTAWLD
FT                   TGTFNSLMQAGQFVQVLEERQGLKVGCIEEIAWRQGFIDDNQLEKLAQPLLKSGYGTYL
FT                   LGFLNKRRSK"
FT   gene            complement(353699..354544)
FT                   /locus_tag="Fjoh_0332"
FT   CDS_pept        complement(353699..354544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0332"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03368"
FT                   /db_xref="GOA:A5FN47"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN47"
FT                   /protein_id="ABQ03368.1"
FT                   /translation="MKKILVTGANGQIGSELFVLSTSYPEFEWIFADRIKITLDNLELL
FT                   KIQLNEIKPNVIFNCGAYTDVDKAETEKELAFIINYLAVELIAKYTYENNVKLIHVSTD
FT                   YVFDGSSSSALNEEAETNPINVYGESKLKGELACLKENPNSIIIRTSWVYSKFGKNFVK
FT                   TMQRLMLERDEINVVNDQIGSPTYAADLAQVLINIVRFCGWFPGVYNYSNEGEISWYEF
FT                   ALSIKEFGGYSCKVEGIASSLYHTPAKRPRFSLLDKKKIKETYNLEIPCYKKSLKNMFI
FT                   "
FT   gene            complement(354544..355092)
FT                   /locus_tag="Fjoh_0333"
FT   CDS_pept        complement(354544..355092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0333"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="TIGRFAM: dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase related"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03369"
FT                   /db_xref="GOA:A5FN48"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN48"
FT                   /protein_id="ABQ03369.1"
FT                   /translation="MKIEKTFIKDLLIVEPTIFGDERGYFFESYSKTKFEDLDIHIDFV
FT                   QDNQSFSKRGTLRGLHYQNPPFAQTKLVRVLEGEIIDVAVDLRKDSATYGKVFSVLLSS
FT                   ENKKQLLVPQGFAHGFSVISETASVMYKCDQFYNKASEGGIRFDDSSLNIDWGMDLKDA
FT                   IVSEKDQKLPFLDNCNSLF"
FT   gene            complement(355120..356253)
FT                   /locus_tag="Fjoh_0334"
FT   CDS_pept        complement(355120..356253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0334"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03370"
FT                   /db_xref="GOA:A5FN49"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN49"
FT                   /protein_id="ABQ03370.1"
FT                   /translation="MDNSRIYLSLSAQSGFEQKYVQKALETNWITSGGPNVDDFEIKLE
FT                   NYFNKKSFVTALNSGTSAIHLALILLNVKAGDEVICQSMTFSASANPILYQGAVPVFVD
FT                   SESDTWNICPENLEIAIKDRIAKGKKPKAIIAVHLYGIPYKVDEVHAIADRYEIPIIED
FT                   SAEALGSTYKGKKCGSFGSFGILSFNGNKIITTSSGGALITDSKKIKDKAIFYSNQSKD
FT                   IAVHYQHSEIGYNYRMSNICAGIGLGQIKILDKNVEARRKNHFFYKEIFKEIENVELSE
FT                   VLDETHFSNFWLNTILIKPSNNINKEGLRTALENANIESRPLWKPMHLQPIFCKYPYYG
FT                   GKIAEGLFDNGLCLPSGSNLTIEDKDRIRKVIEEFFN"
FT   gene            complement(356246..356671)
FT                   /locus_tag="Fjoh_0335"
FT   CDS_pept        complement(356246..356671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03371"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN50"
FT                   /protein_id="ABQ03371.1"
FT                   /translation="MIPKIIQGGNFSDHRGTISYVNDFNFKGIERFYIISNSDENPIRA
FT                   WQGHKLDSKNFYCLNGSFNIHFIKIDNWENPAKNLIIESIFVSAGDSKIVHIPAGYANA
FT                   IESLETNSKLISFSTLPLANVTEDDVRYPSDYWLING"
FT   gene            complement(356661..357632)
FT                   /locus_tag="Fjoh_0336"
FT   CDS_pept        complement(356661..357632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0336"
FT                   /product="protein of unknown function"
FT                   /note="PFAM: glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03372"
FT                   /db_xref="GOA:A5FN51"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN51"
FT                   /protein_id="ABQ03372.1"
FT                   /translation="MQYIILGIILMIVMLLYFKVADRFNIIDKPNLRSSHTEVTLRGGG
FT                   IIFWVSALLYFVQHLKTNYCFFTGITLVSLISFWDDIQSLSNKIRISIHFLAITLIFFD
FT                   LELFNLIPIWSILIAYVVAIGLINAYNFMDGINGITGLYTLVVMGSLLYVNVNIQLFTD
FT                   GEFIKYVIIASLVFLFFNYRKKAKCFAGDVGSIAIAFWIIFLTLKLILITNSVIWLLFL
FT                   AVYGVDAGCTIIHRLFLGQNIFEAHRLHLYQILSNEYRMQHRFVSLLYALVQTGVSFLV
FT                   ITLYSKVEDSIIFLIVLIPLFFAYTSKFYLLKKNNLKLKHDS"
FT   gene            complement(357676..358572)
FT                   /locus_tag="Fjoh_0337"
FT   CDS_pept        complement(357676..358572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0337"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03373"
FT                   /db_xref="GOA:A5FN52"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN52"
FT                   /protein_id="ABQ03373.1"
FT                   /translation="MNRILITGSTGFVGSYLQDYFKSYYELDILSVRYKKEQQFEILSE
FT                   AIIHLAGKAHDLKKVSTPQDYYEANFELTKQLFDAFLTSESSVFVFMSTVKAASDEVKG
FT                   ILKEDVIPNPKTHYGISKHQAEEYILNKKLPQGKRVYILRPCMIHGDGNKGNLNLLYQL
FT                   VSKGFPWPLGAFENQRSFLSIENLCFIVKELLENQSIPSGIYNVADDKSLSTNELIELL
FT                   GESLNKKVHILNLSKDIIKSLVKFGDFLHLPLNSERLQKLTENYLVSNEKIINAIGKSL
FT                   PVSAEEGLKRTFASFRN"
FT   gene            complement(358565..359743)
FT                   /locus_tag="Fjoh_0338"
FT   CDS_pept        complement(358565..359743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0338"
FT                   /product="alpha-glycosyltransferase-like protein;
FT                   Glycosyltransferase family 4"
FT                   /note="Related to alpha-glycosyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03374"
FT                   /db_xref="GOA:A5FN53"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN53"
FT                   /protein_id="ABQ03374.1"
FT                   /translation="MKKKCLIIIPGIPYPPVDGHKLKIYNLILILSKYFDLHIITISRE
FT                   NLSDKQVNFINQNSYKSKHFKLNTFKSLFRLFGSIFSKIPFQVKYFSLTSVKKYISDNS
FT                   KNDEFAVLNLIRTCGYIDILKDKSIIIDMVDALSKSYLKSNKTTSSLIFNLIYGIEAKR
FT                   LVEYEKKCLSKADLTLCVNQKDALNLSDYGEVKWLPNGVNEKLFNYTEKSSEYNNCIVF
FT                   FGAMFYQPNIDAMVWFEKNVMDYLNPNIKVIVIGPRPSSSVLNLAKKRKNIVVTGFLND
FT                   PYLIINSCFAVIAPMQNGGGIQNKILETMGMGKVNILTSYAADPIVGAETNTHFIVEND
FT                   PLIMAEKINEVYLNPSSFIKMGEDAAVLIRNKYTWDSYEKKLISHIKEIKDE"
FT   gene            complement(359745..360488)
FT                   /locus_tag="Fjoh_0339"
FT   CDS_pept        complement(359745..360488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03375"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN54"
FT                   /protein_id="ABQ03375.1"
FT                   /translation="MTSESEYQSKVKEILFNDEFIDLLFKNGIPSYVKDQFRFERALKL
FT                   LKYPKNKTIFELGAFPGTGFYYFGEFNNMIGIGKTNLDFSKKAISLGHDLIDVDFESIK
FT                   KGDIHVQADVVLVMEVLEHIRMPYKFIEAILGNIKPGGLLYLTTNNQSYIGYLVKLLFN
FT                   KEILDPIESENTFYPGHCRYYGLKELVRVFDKFGFIILESNYINFLPKYKLYKSEKFGF
FT                   IKNLFVKLFPNRFSTHIEILIKKPE"
FT   gene            complement(360544..361644)
FT                   /locus_tag="Fjoh_0340"
FT   CDS_pept        complement(360544..361644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0340"
FT                   /product="Candidate alpha-glycosyltransferase;
FT                   Glycosyltransferase family 4"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03376"
FT                   /db_xref="GOA:A5FN35"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN35"
FT                   /protein_id="ABQ03376.1"
FT                   /translation="MKFDVEIVYDATFAINQHRGMGKYINNFVGVLKNNIGLRALGLLR
FT                   TGTKVDSNEYHSFGFSIYILWEQFSMYFFTKRIESMVIYPYNTSTIFLRKSSKNVLIIH
FT                   DLIYFNNSKDRSLRQKVGAVYRRFVVPRIINKFEHIITVSEYSKQQLLNRFDLDKNMVN
FT                   VIPNSIGFNKSDIILNPKYYERGNYILHIGGEPSYKNSKSLLYAFSKLPDHIKEIYKVK
FT                   MIGIRDNKVLHQYKKIASDLAITEAIEFLPYQSDEQINDLYKNAKMFIFPSFDEGFGIP
FT                   IIESFKFGCPLLCSHSSCFPEIAGNAARYFDPNDENSIASAIVLTIEDEEETISKIELG
FT                   YKQVEKYSSDMFVENVKSWYNKNFKV"
FT   gene            complement(361634..362668)
FT                   /locus_tag="Fjoh_0341"
FT   CDS_pept        complement(361634..362668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0341"
FT                   /product="Candidate alpha-glycosyltransferase;
FT                   Glycosyltransferase family 4"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03377"
FT                   /db_xref="GOA:A5FN36"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN36"
FT                   /protein_id="ABQ03377.1"
FT                   /translation="MGKKVAILDLTPFFGGGQKFLLTIQKHLSNKDNYYFLVKDQSTFD
FT                   QLQGENKYLIKEDNFLLQIKRINSLILLHDIEIVIFNGNRPIYFSPFIKVKNKIAYKHT
FT                   SNNAFQFYKRQLGHLILNLCYLCCDRIVLLYDNAKNEVFWNKKKIRIINNGVESFNFIE
FT                   HKNRSSILNVLCISRLDSNKGIDWLINVFWETFGDDKNIQLTIAGAGPLYESLNNFINS
FT                   NSVPNIKLVGFVEDIQSILSQADIFVLPSKFESFPLSLLEAMSFGLPIISTDTGGTKDI
FT                   VSDNKNGYLINYHNDKELRDALYTLYDNLDLRKSQGDNSLEIFNEKFTISKCVEKIEKL
FT                   IYEI"
FT   gene            complement(362674..363978)
FT                   /locus_tag="Fjoh_0342"
FT   CDS_pept        complement(362674..363978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03378"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN37"
FT                   /protein_id="ABQ03378.1"
FT                   /translation="MFKEGNLFYIKKSFLLKSIFALINIGLMLLSNFFALGKTLLIMAI
FT                   LTNVFIIWEMRRIQPAVLMGVFFLSYLLYLIPYYYGDYIISAHTQYYRRDLYDQMLGIH
FT                   LLFLSSFLLFLKSNLNKSSLKIRDLIKPNNNIILFSFLYLIMLGIILSIKGNSVIGGSY
FT                   STYIDNLEGQGGSVEYFYIFFVIAFFFTDKPFLRKSLLLLVVYYCFMTITRGYRIQFVQ
FT                   MVIVVFVLFFDGKFKTVYMMIFAFLGFIIAEIVNLLKMMGSLTVEDTLALFEKSDKGII
FT                   ISNQTDVFYSSVVFLGLIKDDIFSLGLRIWSTIGFIWNWFVPSSFVWIEARVPMFAGTF
FT                   TSLGGGGLVSAYFYVWFGYLGPILIGFCLAFLFNKTYSSADKKVFKIIAILVLSLYPRW
FT                   FAYDPANFLIRLSLYIYVVYIGFILIHNQMKGVKK"
FT   sig_peptide     complement(363865..363978)
FT                   /locus_tag="Fjoh_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.974 at
FT                   residue 38"
FT   gene            complement(364138..365046)
FT                   /locus_tag="Fjoh_0343"
FT   CDS_pept        complement(364138..365046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0343"
FT                   /product="Candidate beta-glycosyltransferase;
FT                   Glycosyltransferase family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03379"
FT                   /db_xref="GOA:A5FN38"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN38"
FT                   /protein_id="ABQ03379.1"
FT                   /translation="MFSIVVPLYNKEKSVSRAIKTVLEQNYSNFELIIVNDGSTDNSLD
FT                   VVEKIKDERVKIINKKNGGVSSARNLGVENASTDWICFLDADDYWKPNHLEIIAELQNK
FT                   YQDGKIYSTLVCENSEKGVQFIENSLPDDFEGYINDYFSLASKGTIFHSSSVCVSKKAL
FT                   LEVGCFDTNLKHGEDLDVWFKLMMNNIAVVKKTGTAVYDLLGENRAMNLKCMYEKHLLS
FT                   KIDNYRSIKVPNLNEFIDYYILRNSVPYYFSMDKNKVYPVLYNVKEKKETKLIWKCIYS
FT                   EKLFLGNFFLYRLYKKLRMIL"
FT   gene            complement(365050..366162)
FT                   /locus_tag="Fjoh_0344"
FT   CDS_pept        complement(365050..366162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03380"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN39"
FT                   /protein_id="ABQ03380.1"
FT                   /translation="MKILFVLNKLKLDSGGAVVNNRNLYLLQNVYGEENIIIHEFEKED
FT                   KNTSILYSKYLSFFGGISNKTLKDISSILKKEDIQVVFISNSIYGLISKSIKRQFKNII
FT                   VITFFHNVEYLYIKDLFKSSKLKSRYFLPPFIKRVEQLSVNYSNLIIALNERDSKKLFS
FT                   IYGRKADFLLPTSLETKKIEQPLLDEKFISETNNLELLFVGSNFYANIHGINWFINNVM
FT                   TKVQNVNLSIVGNGLNDNIITNNKNTTIYGRVESLDLFYKKAQIVILPIFLGSGMKTKT
FT                   AEALMYGKPILATSEALEGYDIKKIKDIGAQCETAEEFIEQINYFNQNRTELFDKGINS
FT                   KNFFLENYSNEAITGLFKKTIDVRLKELMK"
FT   gene            complement(366411..367817)
FT                   /locus_tag="Fjoh_0345"
FT   CDS_pept        complement(366411..367817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03381"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN40"
FT                   /protein_id="ABQ03381.1"
FT                   /translation="MLLSKKDVFWGYFAQIFSIASGVITLPLILRMLTKEEIGLNYLLI
FT                   TFGSLVSLFDFGFASQFGRNISYVFGGAQNLKKEGLEVLDSPTEINYRLLSTMIKTAQY
FT                   VYRRIALVVLTTMLSLGTWYIYEVTDGFKSVDNAFIIWLFFSFSIFFDIFYSYYTSLLV
FT                   GKGMIMESRKAIVYSKLVYILLAFVFLYMGFGLVGVVIANFVAPFFNRIISYRFFFTND
FT                   LRGKLDSYIITKEEKIKLFNIVWHNSRRLGLVFIGSYAINKFSLFLAGLYLPLSDIASY
FT                   GLMLQLFGLVSAVAGTFFSINQSRFSVLRVNGKLDELLKEFAYSMNLYYVLFILGAFFI
FT                   IFICPWFLTVIGANAKLPSLLIMGVFTVIVLLEGNHSNFSTLIVIKNEIPFVKPSLIAG
FT                   GAIILGDYFSLAYTGWGILGLVLVQGLVQIAYANWKWPYVVCKEFRISFFMFIVIGAQE
FT                   SLIKLRRQQL"
FT   gene            complement(367932..368918)
FT                   /locus_tag="Fjoh_0346"
FT   CDS_pept        complement(367932..368918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0346"
FT                   /product="WavE lipopolysaccharide synthesis"
FT                   /note="PFAM: WavE lipopolysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03382"
FT                   /db_xref="InterPro:IPR011122"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN41"
FT                   /protein_id="ABQ03382.1"
FT                   /translation="MKIQSSDFSIIIQGPVLGKPDDEDEKQLTKKCIASVKNVLPGSEI
FT                   IISTWINTDVSHLDYDKIVFNEDPGSISYNDYNLKNKFNNNNRQIVSTNNGLKVASRKF
FT                   AIKLRGDCKLSHNGFIDFLSEYPNRGKYCFFDQRIITSNVFSLNPRKAPVLFHISDIFQ
FT                   VGLTSDMKQLWDIELQLEPQTTRAVQSGWIKWNDPYSEGGYEMKFASEQYIWFAFCKKY
FT                   NLNLNLKFYSEIPLNKIVKSELSIINNFVIASPNELGFVLPDKMIEFLNYPLIYSSQEW
FT                   IELYDKYCVKGISIFDKIELICKTILNSYKFRCIFLMLKLKKLFKKA"
FT   gene            complement(368915..369652)
FT                   /locus_tag="Fjoh_0347"
FT   CDS_pept        complement(368915..369652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0347"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03383"
FT                   /db_xref="GOA:A5FN42"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR016873"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN42"
FT                   /protein_id="ABQ03383.1"
FT                   /translation="MINMSKINIVIPMAGLGSRFANVGYEKPKPFIDVDGKPMIVRVLD
FT                   NLSYPDANYILIARKEHLEKEKELVVQIEKEYNAKFIGIDKLTEGTVCTVLYARKYINN
FT                   ELPLLIANSDQIVDISIPDFINDCFDRDLDGSILTFKDIELNPKWSFAKLNDDLVIEVK
FT                   EKEAISEFATVGIYLFNKGAQFVDSAIDMIIENDRVNNEFYTCPVYNYLIKDGARIGIY
FT                   DIEFSNMHGIGTPEDLEVYLKRL"
FT   gene            complement(369630..369959)
FT                   /locus_tag="Fjoh_0348"
FT   CDS_pept        complement(369630..369959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03384"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN43"
FT                   /protein_id="ABQ03384.1"
FT                   /translation="MVVEKYNLDEMFKGWFIGNFEPSLYKTNEVEVGVKKYKKGEFENP
FT                   HFHKIATEFTVIVNGIVEMNGIQYGENEIIKIVPGVTTNFKALTDVITVVVKLPGANND
FT                   KYEQD"
FT   gene            complement(369969..370691)
FT                   /locus_tag="Fjoh_0349"
FT   CDS_pept        complement(369969..370691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0349"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03385"
FT                   /db_xref="GOA:A5FN27"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR016873"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN27"
FT                   /protein_id="ABQ03385.1"
FT                   /translation="MLKIIIPLAGSSEIFHKAGFPYPKPLVEIKGKPMIEWVIEKTSSI
FT                   TIPNQIVFVIKDEDATKYHLDNTLKLLSPNCEIVKIKNETKGGLCSVLMTIDKIDNDDS
FT                   ILILNSDQIIQKDLSEFNSYWLDKKADVGVVTFKSVHPRWSYILTDGENVIQTAEKNPI
FT                   SNRAIAGYYYFNSAKLFFECAFQTIINDVQSDGMFFISPVINEFILRNKKVNFYEIENK
FT                   DYHSFYSPKLITEFENYN"
FT   gene            complement(370684..371310)
FT                   /locus_tag="Fjoh_0350"
FT   CDS_pept        complement(370684..371310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0350"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03386"
FT                   /db_xref="GOA:A5FN28"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN28"
FT                   /protein_id="ABQ03386.1"
FT                   /translation="MKIKAVIFDMDGVLIDARDWHYESLNKALGLFGTEITRYDHLVTF
FT                   DGLPTKKKLEMLSLEGGLPTKLHDFINDLKQEYTWEIVYTTCKPIFHHRYALSKLKNDG
FT                   YLLSVCSNSVRKTIELMMERSGLIEYLDFFLSNQDVEKGKPDPEIYSKAINRLGFQPDE
FT                   CLIIEDNQNGIKAALASGAHLLKVENPDDVTYQNIIKRIKEIENA"
FT   gene            complement(371317..371946)
FT                   /locus_tag="Fjoh_0351"
FT   CDS_pept        complement(371317..371946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03387"
FT                   /db_xref="GOA:A5FN29"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN29"
FT                   /protein_id="ABQ03387.1"
FT                   /translation="MNIISHRGYWKSQEEKNKQISFDRSFKLRYGTETDIRDYKGELVI
FT                   SHDIPDENSLKIDDFFKIYNTYSNSNLTLALNIKSDGLQVKLKEKLIEFGIENYFVFDM
FT                   SIPDTIGYLKNNLMTFTRQSEYEPIPPFIEKCEGIWLDSFESTWYDKHILSKHLQSGKK
FT                   VAIVSPELHKRNHLDLWKYLKENNYHKSDDIILCTDLPEDATEFFK"
FT   gene            complement(372125..373198)
FT                   /locus_tag="Fjoh_0352"
FT   CDS_pept        complement(372125..373198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0352"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03388"
FT                   /db_xref="GOA:A5FN30"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN30"
FT                   /protein_id="ABQ03388.1"
FT                   /translation="MNDKLIENDEISLKELLLKISDWYNYLLSQWKIIVLAGIFGALAG
FT                   LTYSFLKKPIYTATLSFVVEDEKSTGGLGGALGLAGSLGLDIGGNGSSIFSGSNLTELF
FT                   KSRSMVEKTLLTPVHYNNKVISLAEMYIQIHKWRDKWNDQPKFKNIKFLPNLNRDYFTR
FT                   ENDSILGVIYRNLSQNSLSVAQKDKKNAIISIDVSSTNELFSLYFCEALAKQVGKFYVE
FT                   TKSKKARMNMDILEHQVDSVRSELNGAITSVAVANDNTFNLNPALNVRRAPSSRRQVDV
FT                   QANTAILTELVKQSELAKVTLRKETPLIQVIDRPILPLSKEYFGKAKGFIIGSILASFI
FT                   IMIILIVRRLFKQVLFS"
FT   gene            complement(373206..375698)
FT                   /locus_tag="Fjoh_0353"
FT   CDS_pept        complement(373206..375698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0353"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03389"
FT                   /db_xref="GOA:A5FN31"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN31"
FT                   /protein_id="ABQ03389.1"
FT                   /translation="MKKIIYVLTLFLALTTFNATAQDIIKSKDLSTVRVDYMSDDDLAK
FT                   ISVQLKSNNTTIDQVESMALSKGMSQAEFDKLRTKLKEYEKKISKDSDKNKEKEDKLKN
FT                   GEKDSEFGRKQEKIKNDKVKDSLNALIFGSELFDNPTLNFEPDLKLATPLNYVLGPGDE
FT                   LQISIYGVQEYNASLPVSVEGKIAIEYVGQIAVSGMTIEAATQKIKGAIARVYSTVRSG
FT                   QSQVSVSLSGIRTIKVTIVGGKQPGNYSISSLATVYNALHLAGGPGKNGSYRNIELLRN
FT                   NRVYKNIDIYAFLVKGDQSDNVALKDNDVIRIPAYSQRVTVEGEVKRPGIFEMKKGEKF
FT                   SDLLNFASGFNEFAYTASVNVLQKTGKEFKVHDINESEYNSYQPQSGDVFKVTKILNRF
FT                   ENRIKIEGAVFRPDYYSFTEGMRIYDLITRAEGLKEDAYTKRARIIRLKTDLTTEIVNV
FT                   DLEAALSGDINADILLKREDIVTVYSILDFREEYKITIDGEVKNPGEYEYFENLTLNDL
FT                   VVQVGGLTGSASKRVEIARMIKSDAIDDTDPKRIELVELEITADNNEQIKNFVLKPFDV
FT                   INVRRMAVYEKPEMVKISGAVTYPGKYVLANKKEKVYNVVMRAGGLTSIANLDGMKIKR
FT                   PIKEEQIEQLESVNLNFDKKDISGKDISGNESNLKQNDTLKSRLSKRLRDELKYTTIPV
FT                   NWEKIVKDKNHYSNVTLFPGDEIEVAVYNEGVKVTGNVLLTSEIPYRSGKGFKYYINSV
FT                   GGVDSKGWKRKAYIIYPNGKAAVTSSFLFFKSYPKVEPDSQIVVPERPERKKMSAGEWA
FT                   GLGTAFASLALLIVTAFK"
FT   sig_peptide     complement(375633..375698)
FT                   /locus_tag="Fjoh_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(375741..376787)
FT                   /locus_tag="Fjoh_0354"
FT   CDS_pept        complement(375741..376787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0354"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03390"
FT                   /db_xref="GOA:A5FN32"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN32"
FT                   /protein_id="ABQ03390.1"
FT                   /translation="MKKILITGGAGFIGSHVVRRFVNKYPEYQIYNLDALTYAGNLENI
FT                   IDVENKSNYTFVKGDVVNEDFINELFNIHNFDGVLHLAAESHVDRSIEDPLAFVKTNVI
FT                   GTINLLNAAKNQWKDNFEGKRFYHISTDEVYGSLGIDGLFTETTSYDPNSPYSASKASS
FT                   DHFVRAYGETYGLPYVLTNCSNNYGSYHFPEKLIPLFINNIINNKPLPVYGDGNYTRDW
FT                   LFVEDHAIAIDLVFHEGKNHETYNIGGFNEWKNIDLVRLLCQIMDRKLGRKKDASEKLI
FT                   TYVKDRPGHDLRYAIDASKITKELGWKPSVTFEEGLEKTIDWYLNNQEWLQNVTSGAYK
FT                   DYYKKQYL"
FT   gene            complement(376790..377797)
FT                   /locus_tag="Fjoh_0355"
FT   CDS_pept        complement(376790..377797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0355"
FT                   /product="mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /EC_number="2.7.7.22"
FT                   /note="PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03391"
FT                   /db_xref="GOA:A5FN33"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN33"
FT                   /protein_id="ABQ03391.1"
FT                   /translation="MEKNSSIIHVILTGGVGSRLWPLSRKSQPKQYLEIFENKSLFEMT
FT                   VERNNHLADKVMVVGNVDNHHLSGKVMDKTKTSYLNIVEATPRNTAAAIAFAAFAADSE
FT                   DILIITPSDHIIDKMDDYNIAIQDAILKAKEGYIVTFGIIPTKPETGYGYIESKGDNVI
FT                   SFREKPNETTAKEFIARGNFLWNSGMFCFKAGVLLDELKQFQPDVYEKSKQVWDQSKEG
FT                   LLDLNLSMKIPSISIDYAVMERSKKIKVVPASFSWSDLGSFESVYEYLVSKGHPIDANG
FT                   NMVIGCDSHTTFLGLKNTIFVHTETANLILQKENSQDVKDVYSSLEKQNSDLLN"
FT   gene            complement(377834..379123)
FT                   /locus_tag="Fjoh_0356"
FT   CDS_pept        complement(377834..379123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0356"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03392"
FT                   /db_xref="GOA:A5FN34"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN34"
FT                   /protein_id="ABQ03392.1"
FT                   /translation="MKLEQNIKIAVIGLGYVGLPLARLFATKYSVIGFDINETRVKSLS
FT                   SGFDTTLEVDQETLKAVLVDNSNSEIGLYCTNVLEDIAACNYFIVTVPTPVDKNNRPDL
FT                   TPLYKSSESVGKILKKGDVVIYESTVYPGVTEEQCVPVLEKVSGLKFNKDFFAGYSPER
FT                   INPGDKEHTVEKILKVTSGSTPEVGLKVDALYKSVIIAGTHLAPSIKVAEAAKVIENSQ
FT                   RDINIAFVNELAKIFNLMNIDTQEVLTAAATKWNFLPFKPGLVGGHCIGVDPYYLAQRA
FT                   QEFGYHPEIILAGRRLNDSMGEYVASQIVKLMIKKGISVNGASLLMLGITFKENCPDVR
FT                   NTKIVDVIKALKEYGIIVTIYDPLANVEEVKREYKLETTNSSPIEKFDAIVLGVSHKEF
FT                   LKLSFSEFQKENSLLYDVKGVLGTIADNRL"
FT   gene            complement(379416..379880)
FT                   /locus_tag="Fjoh_0357"
FT   CDS_pept        complement(379416..379880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0357"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="PFAM: transcription antitermination protein NusG;
FT                   SMART: NGN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03393"
FT                   /db_xref="GOA:A5FN19"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN19"
FT                   /protein_id="ABQ03393.1"
FT                   /translation="MNWYVVYTKPKWEKKVAEKLTQIGIECYCPLITQVKQWSDRKKKV
FT                   EMPLFNSYVFIQIEDADRNSVFEVAGIVRYLFWLGKPAVVRDEEINVIKNSLKASNIAD
FT                   ISVSQIQVGDKIKLETGAFSNQNAIVQEVSKTHYILVLESLGCVLKIKYK"
FT   gene            complement(379974..381365)
FT                   /locus_tag="Fjoh_0358"
FT   CDS_pept        complement(379974..381365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0358"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03394"
FT                   /db_xref="GOA:A5FN20"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028356"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN20"
FT                   /protein_id="ABQ03394.1"
FT                   /translation="MEITKICCIGAGYVGGPTMAVIAQKCPHIQVTVVDLNEQRIKDWN
FT                   DPNTDNIPIYEPGLSEIVAEARGRNLFFSTEVEKAIDEAQVIFISVNTPTKTYGKGKGM
FT                   AADLKYIELCARQIAKVAKQNKIVVEKSTLPVRTAEAIKSILDNTGNGVQFQILSNPEF
FT                   LAEGTAVTDLLNPDRILIGGDSSPEGESAIDALVNVYANWVNRDKILTTNVWSSELSKL
FT                   TANAFLAQRISSINAMSELCEKTGANVNEVAKAIGMDSRIGPKFLKASVGFGGSCFQKD
FT                   ILNLVYIAKSYGLNEVADYWEQVIIMNDHQKRRFSNKIVQTLYNTVADKKITFLGWAFK
FT                   KDTNDTRESAAIYVADDLINEQAKISVYDPKVSRNKMLSDLDYLETRSEVENAEALTIF
FT                   DNAYEACKESHAIAILTEWDEFTTYDWQKIYEFMHKPAFVFDGRNILNAKELESIGFIY
FT                   NGIGS"
FT   sig_peptide     complement(381303..381365)
FT                   /locus_tag="Fjoh_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.600) with cleavage site probability 0.560 at
FT                   residue 21"
FT   gene            complement(381390..382373)
FT                   /locus_tag="Fjoh_0359"
FT   CDS_pept        complement(381390..382373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0359"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03395"
FT                   /db_xref="GOA:A5FN21"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN21"
FT                   /protein_id="ABQ03395.1"
FT                   /translation="MEISNQNTILITGGAGFIGSNLSEHFLGLGHKVICLDNFSTGHRH
FT                   NLKDFIENPNYKLIEGDIRNLEDCTKAVQGVDYVLHQAALGSVPRSINDPITTNEVNVS
FT                   GFLNMLVASRDAKIKRFIYAASSSTYGDSEGLPKVEEVIGKPLSPYAITKYVNELYAEI
FT                   FSRTYGLETIGLRYFNVFGRKQDPDGAYAAVIPKFVRQLINLESPLINGDGNYSRDFTY
FT                   IDNVIQMNELAINTKDSAAINTVYNTAFGDRNTLNDLVKYLKQYLSEFDPNIADVEISY
FT                   GLNRVGDIPHSLASIEKAKKMLGYKPEFSLQDGLKEAVSWYWNNLK"
FT   gene            complement(382383..384830)
FT                   /gene="wzc"
FT                   /locus_tag="Fjoh_0360"
FT   CDS_pept        complement(382383..384830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wzc"
FT                   /locus_tag="Fjoh_0360"
FT                   /product="Wzc"
FT                   /EC_number="2.7.10.2"
FT                   /note="protein involved in gliding motility and
FT                   polysaccharide export; Non-specific protein-tyrosine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03396"
FT                   /db_xref="GOA:A5FN22"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN22"
FT                   /protein_id="ABQ03396.1"
FT                   /translation="MLDIKDFSIFENQSNFDFKGFLLKIISYWKWFLLSLIIAFTIAYR
FT                   VNVRKEKIYGMQTMISIKEESNPFFTSNTSLVFNWGGVSDKVNGISTILQSRSHNEMVV
FT                   SKLSFYVDYLEQGKYNLIDSYGAVPFYVEIDKTKGQLANNLISIKFLSENEYQIKIPFE
FT                   NPSVSLITYSDNTYSNTSVQPAIFLKRYKVGEQASLPFLNWKLQIIDNPGFYIGKEYFV
FT                   RFNDFNGTVSRYRGISVDGDKGGGSILTLSMQGTNKARMVEYLNATVRMLIKIQLDGKN
FT                   QFATNTIRFIDSTLVSMEAQLKQTGNELKTFSKDKNIFDIEGGGEKFSNKIMDFDVQKD
FT                   QVTRKIAYYNSLRAYLNNSVDYSRLPAPSVAGIEDANIIAGVAKLITLSTQRSEMAYAV
FT                   KSDKIFKDFDNQMQAVKNVLIENISSAKNSLLYDLSLVNAKIGEAESTVKRLPQEQQEL
FT                   LKIKRKYDLNDNIYTEFLQKRNEAEIVKASNLSDIHFIDPAKDIGGGLIGPKTSVNYIL
FT                   ALFLGILVPLMFIFILFFINNSIQNIDDISKLTNIPIIGVIGFNKESVNLAVFDKPKSA
FT                   LSEAFRGVRSSLQFLYKKQQLEGSKTLMITSSISGEGKTFCSINIATVFALSEKKTVIV
FT                   GLDLRKPRLADEFCLTNHQLGVVNYLIKQNTLEEITNSTQISNLDVILSGPIPPNPSEL
FT                   ILGDAMGELINELKQKYDYIILDTPPVGLVSDALELIQYTDVTLYIVRQNYTKKDMITL
FT                   LNNRVKRGELTNTSVIFNGFENKTKYGSNYGYGYGYGAYSNGYHEEEKKGFLKVISKVF
FT                   RKK"
FT   gene            complement(384842..385633)
FT                   /gene="wza"
FT                   /locus_tag="Fjoh_0361"
FT   CDS_pept        complement(384842..385633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wza"
FT                   /locus_tag="Fjoh_0361"
FT                   /product="Wza"
FT                   /note="protein involved in gliding motility; polysaccharide
FT                   export protein; predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03397"
FT                   /db_xref="GOA:A5FN23"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN23"
FT                   /protein_id="ABQ03397.1"
FT                   /translation="MTKNSFYILLIVSIFFTSCIPVKDLIYLQDKNNSGEQNNNIAQVE
FT                   SKPYRLQVNDVLSVTIKAIDPKFVSIFSPTESGADGKSESALYFDGFTVDDHGNIRMPI
FT                   LGEINVIGYTLEEVRLKIEKQLLEEYFKSEANIFVTVKLAGFRYTINGEVGSTGTKTLF
FT                   QERVNVLEAIANAGDIKTVGDRKSVVIIRQSPTGVQMNSIDLTDVNVMKSPYYYLQPND
FT                   YIYVKPLRQKTWGTGETGLQSIGTIITLLSLATTVYFIVKN"
FT   gene            complement(385704..386324)
FT                   /locus_tag="Fjoh_0362"
FT   CDS_pept        complement(385704..386324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0362"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: RecR
FT                   protein; TOPRIM domain protein; SMART: Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03398"
FT                   /db_xref="GOA:A5FN24"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN24"
FT                   /protein_id="ABQ03398.1"
FT                   /translation="MEFSSKLIEKAVNEMSQLPGIGKRTALRLVLHLLKQPKEQTGFLS
FT                   QALLNMREDIKFCENCHNISDTKVCEICANSVRNHQTICVVEDIRDVMAIENTGQYKGI
FT                   YHVLGGKISPIEGVGPSQLNISSLVEKVKSGKVVEIIFALSSTMEGDTTNFYIYKQIAE
FT                   SEIIISTIARGISVGDELEYADEITLGRSILHRVPFEKTFKNN"
FT   gene            complement(386490..386858)
FT                   /locus_tag="Fjoh_0363"
FT   CDS_pept        complement(386490..386858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03399"
FT                   /db_xref="GOA:A5FN25"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN25"
FT                   /protein_id="ABQ03399.1"
FT                   /translation="MMKNKKTLLLGATTKTDRYAFRAINALTQKGHTVIAIGQNAGEVA
FT                   GVKIHTKAIPVKNIDTVTLYLNPTRQRDYYNYIIEAQPKRVIFNPGTENPELYQLLELN
FT                   NIEAEVACTLVLLATNQY"
FT   gene            386941..387636
FT                   /locus_tag="Fjoh_0364"
FT   CDS_pept        386941..387636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0364"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03400"
FT                   /db_xref="GOA:A5FN26"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN26"
FT                   /protein_id="ABQ03400.1"
FT                   /translation="MIIFICMQLLKFDYFYFTNQYFMDLFIYLFAALFSVLNPIGTVPI
FT                   FVGLTQHDSQKERSRISLWTAINVGIILLVSYFIGQYVLTFFGISIDALRIAGGIVIVN
FT                   SGFSLLSGKFNKKRGINKKIENEVQQRNDIALTPLAIPMLAGPGSISLLIAFYQEHHQM
FT                   EEILFSCLAILAIAVVIFVILKSAHYLARILGASGIVAISRIVGFIVISIGIQYIVSSI
FT                   VNIIKGNLM"
FT   gene            complement(387706..388641)
FT                   /locus_tag="Fjoh_0365"
FT   CDS_pept        complement(387706..388641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0365"
FT                   /product="Uncharacterized protein containing a pentein-type
FT                   domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03401"
FT                   /db_xref="InterPro:IPR014541"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN09"
FT                   /protein_id="ABQ03401.1"
FT                   /translation="MKQTTNAIVMIRPVAFRMNEQTAVNNYYQKVLDGLLPSTVNAKAQ
FT                   QEFDAFVEKLRAVGVDVTVIEDTLETDTPDSIFPNNWVSFHENGDVALYPMFAENRRQE
FT                   RREDILDTLEEKGFEISNIMDYTSAEDDGYFLEGTGSLLLDRANAKAYCALSPRADEEL
FT                   FIEFCEDFDYAPVIFEAFQTVDGERKLIYHTNVMMCLGETFAVICADCIDDKKERKMVL
FT                   DNLKDDKKEIILITEDQVNNFAGNMLEVRGTNDKKYIVMSASAHQSLTPKQIQQLEKHA
FT                   EILSSSLDTIEACGGGSARCMMAEVFLPRN"
FT   gene            complement(388724..389638)
FT                   /locus_tag="Fjoh_0366"
FT   CDS_pept        complement(388724..389638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0366"
FT                   /product="amidinotransferase"
FT                   /note="PFAM: amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03402"
FT                   /db_xref="GOA:A5FN10"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN10"
FT                   /protein_id="ABQ03402.1"
FT                   /translation="MLQLNVKNETSRLRAVVLGSAVHNGPTPTIDEAYDPKSLEHIKAG
FT                   TYPIEKDMVAEMDAFNAVFQKYNVTVYRPELIENYNQIFARDIGFVIDDVFVKSNILPD
FT                   RERELDAIQYVIDQINPVKVVRPPEEVHIEGGDVMLWNDHIFIGTYKGSDYKDYITART
FT                   NMHGVNYIKELFPNKIVKEFDLVKSKLEARDNALHLDCCFQPVGKDKGIIYKRGFREEA
FT                   DYLYLVKLFGKENLFHIEREEMYNMFSNVFSIDTNVVVSEKNFTRLNNWLRAKGFTVEE
FT                   IPYAEIAKQEGLLRCSTLPLIRD"
FT   gene            complement(389700..390977)
FT                   /locus_tag="Fjoh_0367"
FT   CDS_pept        complement(389700..390977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0367"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="TIGRFAM: citrate synthase I; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03403"
FT                   /db_xref="GOA:A5FN11"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN11"
FT                   /protein_id="ABQ03403.1"
FT                   /translation="MSKIATLEIDGKKIELPVITGSENESAIDINKLRDLTGVITIDPG
FT                   YKNSGSCTSEITFLDGEEGILRYRGYSIEDLAEKASFLEVSYLLIFGELPTAAQLEDFE
FT                   NNIRKHSLVNEEMKNIIDGFPKTAHPMGVLSALTSALTAFNPKAVNVDNEKEMYEAICK
FT                   TMAKFLVIATWTYRKSMGYPLNYYDNTKGYVESFMQLMFKLPTGPYAANPVIVNALDKL
FT                   FILHADHEQNCSTSTVRMVGSSHAGLFASVSAGVSALWGPLHGGANQAVLEMLEEINKD
FT                   GGDTDKFLAKAKDKNDPFRLMGFGHRVYKNFDPRAKIIKKAATEVLETLGVEDPILDIA
FT                   RKLEKAALEDDYFKSRNLYPNVDFYSGIIYRALGIPTDMFTVMFAIGRLPGWIAQWKEM
FT                   RENKEPIGRPRQIYTGHPLREFKSNK"
FT   gene            complement(391131..392423)
FT                   /locus_tag="Fjoh_0368"
FT   CDS_pept        complement(391131..392423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0368"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03404"
FT                   /db_xref="GOA:A5FN12"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN12"
FT                   /protein_id="ABQ03404.1"
FT                   /translation="MSIIIKVHARQILDSRGNPTIEVDVVTENGVLGRAAVPSGASTGE
FT                   HEAVELRDGGKAYLGKGVLNAVNNVNTVIAEELVGTSVFEQNTIDQLMIDLDGTPNKSK
FT                   LGANAILGVSLAAAKAAANELGLPLYRYVGGVSANTLPVPMMNIINGGSHSDAPIAFQE
FT                   FMIFPVKATSFTHAMQMGTEIFHSLKKVLHDRGLSTAVGDEGGFAPNLAGGTEDALDTI
FT                   KLAVEKAGYTFGDEIMIALDCAASEFYVDGKYDYTKFEGETGKIRTSAEQADYLAELAA
FT                   KYPIISIEDGMYEDDWDGWKALTEKIGNKVQLVGDDLFVTNVARLSTGIEKGIANSILV
FT                   KVNQIGTLTETIAAVNMAKNAGYTSVMSHRSGETEDNTIADLAVALNCGQIKTGSASRS
FT                   DRMAKYNQLLRIEEELGSTAYFPGLNAFKIK"
FT   gene            complement(392526..393644)
FT                   /locus_tag="Fjoh_0369"
FT   CDS_pept        complement(392526..393644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0369"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase, small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03405"
FT                   /db_xref="GOA:A5FN13"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN13"
FT                   /protein_id="ABQ03405.1"
FT                   /translation="MKYTTRQSAILLLSDGTIFHGKSIGISGKTFGEVCFNTGMTGYQE
FT                   IFTDPSYFGQIMVTTNPHIGNYGVNDLEVESEDVKIAGLVCKNFSFNYSRVGASGSLED
FT                   YFAKQNLICISDVDTRALVSYIRDNGAMNAVICTDGTSIEDLKKELANVPNMEGLELAS
FT                   KVSTKEPYFVGDENATYRISALDLGIKKNILRNFAKRDCYIKVFPYDATYEDLNSFNPD
FT                   GFFLSNGPGDPDPLHGVIEVAKKIIADDRPLFGICLGHQIIALANGVQTYKMFGGHRGI
FT                   NHPVKNLLTGKGEITSQNHGFAVKREALEGHPELELTHIHLNDDTVAGMRMKNKNCFSV
FT                   QYHPEASPGPHDSSYLFDQFVENIKLAVSKTM"
FT   gene            complement(393885..394376)
FT                   /gene="rplQ"
FT                   /locus_tag="Fjoh_0370"
FT   CDS_pept        complement(393885..394376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="Fjoh_0370"
FT                   /product="50S ribosomal protein L17"
FT                   /note="PFAM: ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03406"
FT                   /db_xref="GOA:A5FN14"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN14"
FT                   /protein_id="ABQ03406.1"
FT                   /translation="MRHGKKINHLSRQTGHRKAMLANMACSLIEHKRINTTVAKAKALK
FT                   QFVEPLITKSKEDTTHNRRIVFAYLRSKYAVTDLFRDVAAKVGDRPGGYTRIIKVGNRL
FT                   GDNADMAMIELVDFNELYNGGKKEVKKAKSRRGGKAKKAEGTAPEAPAAESESTTEASE
FT                   "
FT   gene            complement(394413..395405)
FT                   /locus_tag="Fjoh_0371"
FT   CDS_pept        complement(394413..395405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0371"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase, alpha subunit domain protein; RNA
FT                   polymerase, dimerisation; RNA polymerase, insert; SMART:
FT                   RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03407"
FT                   /db_xref="GOA:A5FN15"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN15"
FT                   /protein_id="ABQ03407.1"
FT                   /translation="MAIFNFQKPDKVIMIDSTDFEGKFEFRPLEPGYGLTVGNALRRVL
FT                   LSALEGYAITSVRIEGVDHEFSTISGVVEDVTEIILNLKQVRFKRQIEDIDNESVTISV
FT                   SGKDQLTAGDFQKFISGFQVLNPDLVICNLDSKIKLNFDLTIEKGRGYVPAEENKKQNA
FT                   AIGTIFTDSIFTPVKNVKYAIENFRVEQKTDYEKLVFEIKTDGSINPKDALTEAAKVLI
FT                   HHFMLFSDERITLEADEIAQTESYDEESLHMRQLLKTKLVDMDLSVRALNCLKAAEVDT
FT                   LGDLVSFNKNDLMKFRNFGKKSLTELDELVAVKNLTFGMDLAKYKLDKE"
FT   gene            complement(395427..396032)
FT                   /gene="rpsD"
FT                   /locus_tag="Fjoh_0372"
FT   CDS_pept        complement(395427..396032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="Fjoh_0372"
FT                   /product="30S ribosomal protein S4"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03408"
FT                   /db_xref="GOA:A5FN16"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN16"
FT                   /protein_id="ABQ03408.1"
FT                   /translation="MARYTGPKTKIARKFGEAIFGDDKSFEKRNYPPGQHGMAKKRGKK
FT                   SEYAVQLMEKQKAKYSYGILEKQFRNLFEKASATKGVTGEVLLQLCEARLDNVVFRMGI
FT                   APSRRGARQIVSHRHITVNGEVVNIPSYHLKPGDKVAVREKSKSLEAIERSLSNSSHVY
FT                   EWITWNNDLKEGTFVSVPARLQIPENIKEQLIVELYNK"
FT   gene            complement(396125..396508)
FT                   /locus_tag="Fjoh_0373"
FT   CDS_pept        complement(396125..396508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0373"
FT                   /product="30S ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03409"
FT                   /db_xref="GOA:A5FN17"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN17"
FT                   /protein_id="ABQ03409.1"
FT                   /translation="MAKATAKKRKVIVESTGEAHISSTFNNIIISLTNKKGEVIAWSSA
FT                   GKMGFRGSKKNTPYAAQMAAEDCSKVALEAGLKKVKVYVKGPGNGRESAIRSIHNGGIE
FT                   VTEIIDVTPMPHNGCRPPKRRRV"
FT   gene            complement(396517..396891)
FT                   /gene="rpsM"
FT                   /locus_tag="Fjoh_0374"
FT   CDS_pept        complement(396517..396891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="Fjoh_0374"
FT                   /product="30S ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03410"
FT                   /db_xref="GOA:A5FN18"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN18"
FT                   /protein_id="ABQ03410.1"
FT                   /translation="MARIAGVDIPKNKRGVIALTYIFGLGKSRAIEILEKAQVSQDKKV
FT                   QDWNDDEIGAIRDAVSFYKIEGELRSEVSLNIKRLMDIGCYRGIRHRSGLPLRGQRTKN
FT                   NSRTRKGKRKTVANKKKATK"
FT   gene            complement(396894..397010)
FT                   /gene="rpmJ"
FT                   /locus_tag="Fjoh_0375"
FT   CDS_pept        complement(396894..397010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="Fjoh_0375"
FT                   /product="50S ribosomal protein L36"
FT                   /note="PFAM: ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03411"
FT                   /db_xref="GOA:A5FMZ9"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMZ9"
FT                   /protein_id="ABQ03411.1"
FT                   /translation="MKVRASVKKRSAECIIVRRKGRLYVINKKNPRFKQRQG"
FT   gene            complement(397023..397238)
FT                   /gene="infA"
FT                   /locus_tag="Fjoh_0376"
FT   CDS_pept        complement(397023..397238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="Fjoh_0376"
FT                   /product="translation initiation factor IF-1"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1, IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03412"
FT                   /db_xref="GOA:A5FN00"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN00"
FT                   /protein_id="ABQ03412.1"
FT                   /translation="MAKQSAIEQDGSIIEALSNAMFRVELENGHIVIAHISGKMRMHYI
FT                   KLLPGDKVKLEMSPYDLSKARITYRY"
FT   gene            complement(397247..398593)
FT                   /gene="secY"
FT                   /locus_tag="Fjoh_0377"
FT   CDS_pept        complement(397247..398593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="Fjoh_0377"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03413"
FT                   /db_xref="GOA:A5FN01"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN01"
FT                   /protein_id="ABQ03413.1"
FT                   /translation="MKKFIESLSNVWKIEELKNRILITLGLLLVYRFGAHVTLPGIDAT
FT                   QLTGLAGQTKNGLGSILDMFTGGAFSKASVFALGIMPYISASIVVQLMGIAIPYLQKLQ
FT                   NDGESGRKKINQITRWLTIAITLVQGPTYIYNLYRTLPGSAFLLGFNSPEFLFSSVIIL
FT                   VTGTIFAMWLGEKITDKGIGNGISLLIMVGILARLPQAFIQEFTTRVTNNNGGPMLLVI
FT                   EIIVWLLVIISCVLLTMAVRRIPVQYARRTTTGDYEQDLAGGNRQWIPLKLNASGVMPI
FT                   IFAQAIMFIPAAVAGLSKSDTSQSIVGAFSNMFGFWYNFVFATLIIVFTFFYTAITVPT
FT                   NKMADDLKRSGGFIPGVRPGAETSDFLDKVMSLITFPGSLFLALIAVFPAIVVSIMDVQ
FT                   QSWAMFFGGTSLIIMVGVAIDTIQQINSYLLNKHYDGLMKTGKNRKAVA"
FT   gene            complement(398607..399059)
FT                   /gene="rplO"
FT                   /locus_tag="Fjoh_0378"
FT   CDS_pept        complement(398607..399059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="Fjoh_0378"
FT                   /product="50S ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03414"
FT                   /db_xref="GOA:A5FN02"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN02"
FT                   /protein_id="ABQ03414.1"
FT                   /translation="MNLSNLQPAEGSTHNQNKRVGRGEGSGKGGTAARGHKGAKSRSGY
FT                   SKKIGFEGGQMPLQRRVPKFGFKNINRKEYEGVNLDTLQLLVDNGVITDSVSMTDFVAN
FT                   RLASKNEIVKILGRGELKAKLKVTAHKFTATAKAAIEAAGGEAVTI"
FT   gene            complement(399071..399253)
FT                   /gene="rpmD"
FT                   /locus_tag="Fjoh_0379"
FT   CDS_pept        complement(399071..399253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="Fjoh_0379"
FT                   /product="50S ribosomal protein L30"
FT                   /note="PFAM: ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03415"
FT                   /db_xref="GOA:A5FN03"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN03"
FT                   /protein_id="ABQ03415.1"
FT                   /translation="MAKLLVKQVRSKINCPLSQKRGLEALGLRKLGQVVEHESNPAILG
FT                   MINKVKHLVSVEEAK"
FT   gene            complement(399265..399786)
FT                   /gene="rpsE"
FT                   /locus_tag="Fjoh_0380"
FT   CDS_pept        complement(399265..399786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="Fjoh_0380"
FT                   /product="30S ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03416"
FT                   /db_xref="GOA:A5FN04"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN04"
FT                   /protein_id="ABQ03416.1"
FT                   /translation="MSKYKNVELVKPSGLELKDRLVSVNRVTKVTKGGRAFGFSAIVVV
FT                   GDENGVVGHGLGKSKDVSEAIAKAVEDAKKNLVRIPLNGQSVPHEQKGKFGGARVFLIP
FT                   ASHGTGVIAGGAVRSVLESVGIHDVLSKSQGSSNPHNVVKATFDALLQMRSAHTVAKQR
FT                   GVSLEKVFKG"
FT   gene            complement(399793..400143)
FT                   /locus_tag="Fjoh_0381"
FT   CDS_pept        complement(399793..400143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0381"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03417"
FT                   /db_xref="GOA:A5FN05"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:A5FN05"
FT                   /protein_id="ABQ03417.1"
FT                   /translation="MSLTKSERRQRIKFRIRKTISGSAAKPRLSVFRSNKEIYAQLIDD
FT                   VNGVTILAASSREKEIAKGTNVEIAAAVGKLVAEKALKAGIDTITFDRGGYLYHGRIKS
FT                   LAEGARAAGLKF"
FT   gene            complement(400155..400697)
FT                   /gene="rplF"
FT                   /locus_tag="Fjoh_0382"
FT   CDS_pept        complement(400155..400697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="Fjoh_0382"
FT                   /product="50S ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03418"
FT                   /db_xref="GOA:A5FN06"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN06"
FT                   /protein_id="ABQ03418.1"
FT                   /translation="MSRIGKSPIVIPAGVTVEVKDGIITVKGKKGQLVQEFSDVNVTVE
FT                   GDQVLVERSSDHKDHRAKHGLFRSLISNMVVGVSEGFTKELELVGVGYRASNQGQKLDL
FT                   ALGYSHNIVLEIAPEVSLETISEKGKNPIVKLTSFDKQLLGQVAAKIRGFRKPEPYKGK
FT                   GVKFVGEVLRRKAGKSA"
FT   gene            complement(400716..401114)
FT                   /gene="rpsH"
FT                   /locus_tag="Fjoh_0383"
FT   CDS_pept        complement(400716..401114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="Fjoh_0383"
FT                   /product="30S ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03419"
FT                   /db_xref="GOA:A5FN07"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN07"
FT                   /protein_id="ABQ03419.1"
FT                   /translation="MYTDPIADYLTRVRNAVAANHKVVEIPASNLKKEITKILFDQGYI
FT                   LSYKFEQNTVQGSIKIALKYDKDTKEPVIKDIQRISKPGLRKYAGAAKLPRILNGLGIA
FT                   IVSTSKGLMTGKQAKQLNVGGEVICYVY"
FT   gene            complement(401192..401461)
FT                   /gene="rpsN"
FT                   /locus_tag="Fjoh_0384"
FT   CDS_pept        complement(401192..401461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="Fjoh_0384"
FT                   /product="30S ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03420"
FT                   /db_xref="GOA:A5FN08"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FN08"
FT                   /protein_id="ABQ03420.1"
FT                   /translation="MAKESMKAREVKREKTVAKYAEKRKALLEAGDYEGLQRLPKNASP
FT                   VRLHNRCKLTGRPRGYIRQFGISRVTFREMANNGLIPGVKKASW"
FT   gene            complement(401465..402016)
FT                   /gene="rplE"
FT                   /locus_tag="Fjoh_0385"
FT   CDS_pept        complement(401465..402016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="Fjoh_0385"
FT                   /product="50S ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03421"
FT                   /db_xref="GOA:A5FMY8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMY8"
FT                   /protein_id="ABQ03421.1"
FT                   /translation="MAYTPRLKEEYKSRVISALKEEFGYTNVMQVPKLEKIVLSRGVGA
FT                   AVSDKKLIDYAVDELTKITGQKAVSTISKKDVASFKLRKGMPIGAKVTLRGERMYEFLD
FT                   RLITSALPRVRDFGGIKATGFDGRGNYNLGVLEQIIFPEIDIDKVNKISGMDITFVTTA
FT                   KTDKEAKSLLAELGLPFKKN"
FT   gene            complement(402019..402333)
FT                   /locus_tag="Fjoh_0386"
FT   CDS_pept        complement(402019..402333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0386"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; SMART: KOW (Kyrpides, Ouzounis, Woese) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03422"
FT                   /db_xref="GOA:A5FMY9"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMY9"
FT                   /protein_id="ABQ03422.1"
FT                   /translation="MIKLKIKSGDIVRVIAGDHKGAEGKVLRVYREKNKAIVEGVNLVS
FT                   KHTKPSAKNPQGGIVKKEASIQISNIALIDPKTKETTRVGIRVEGDKKVRFSKKSNQVL
FT                   "
FT   gene            complement(402345..402713)
FT                   /locus_tag="Fjoh_0387"
FT   CDS_pept        complement(402345..402713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0387"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03423"
FT                   /db_xref="GOA:A5FMZ0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMZ0"
FT                   /protein_id="ABQ03423.1"
FT                   /translation="MVQQESRLKVADNTGAKEVLTIRVLGGTKRRYASVGDKIVVSIKD
FT                   ATPNGNVKKGAVSTAVVVRTKKEVRRADGSYIRFDDNACVLLNAAGEMRGTRVFGPVAR
FT                   ELREKQFMKIVSLAPEVL"
FT   gene            complement(402716..402976)
FT                   /gene="rpsQ"
FT                   /locus_tag="Fjoh_0388"
FT   CDS_pept        complement(402716..402976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="Fjoh_0388"
FT                   /product="30S ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03424"
FT                   /db_xref="GOA:A5FMZ1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMZ1"
FT                   /protein_id="ABQ03424.1"
FT                   /translation="MEEKRNLRKERIGVVTSNKMDKSIVISEVRKVKHPLYGKFVLKTK
FT                   KYVAHDETNDCNIGDTVRISETRPLSKTKCWRLVEILERAK"
FT   gene            complement(402994..403185)
FT                   /locus_tag="Fjoh_0389"
FT   CDS_pept        complement(402994..403185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0389"
FT                   /product="50S ribosomal protein L29"
FT                   /note="PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03425"
FT                   /db_xref="GOA:A5FMZ2"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMZ2"
FT                   /protein_id="ABQ03425.1"
FT                   /translation="MKQSEIKDLSAAELQEKLSQTKKVYADLKMAHAISPIANPLRIRS
FT                   VRRTVARLATELTKRELQ"
FT   gene            complement(403198..403623)
FT                   /gene="rplP"
FT                   /locus_tag="Fjoh_0390"
FT   CDS_pept        complement(403198..403623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="Fjoh_0390"
FT                   /product="50S ribosomal protein L16"
FT                   /note="PFAM: ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03426"
FT                   /db_xref="GOA:A5FMZ3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMZ3"
FT                   /protein_id="ABQ03426.1"
FT                   /translation="MLQPKRTKYRKVQKGRMKGNSQRGHELSNGMFGIKSVHEDGMFLT
FT                   SRQIEAARIAATRYMKREGQLWIKIFPDKPITKKPLEVRMGKGKGAVEYWAAVVKPGRI
FT                   MFEVGGVPLSVAKEALRLAAQKLPVKTKFVVARDFEA"
FT   gene            complement(403643..404401)
FT                   /gene="rpsC"
FT                   /locus_tag="Fjoh_0391"
FT   CDS_pept        complement(403643..404401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="Fjoh_0391"
FT                   /product="30S ribosomal protein S3"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3-C-terminal domain protein; KH, type 2 domain
FT                   protein; Ribosomal protein S3, N-terminal domain; SMART: KH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03427"
FT                   /db_xref="GOA:A5FMZ4"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMZ4"
FT                   /protein_id="ABQ03427.1"
FT                   /translation="MGQKTNPIGNRLGIIRGWDSNWYGGNDYGDKLAEDHKIRKYIHAR
FT                   LSKASVSKVIIERTLKLVTVTITTARPGIIIGKGGQEVDKLKEELKKVTDKEVQINIFE
FT                   IKRPELDAYLVATSIARQIESRISYRRAIKMAIAASMRMNAEGIKVLISGRLNGAEMAR
FT                   SEGFKEGRIPLSTFRADIDYALAEAHTTYGRMGIKVWIMKGEVYGKRDLSPLAGMDKKQ
FT                   SGTGGGKGGDAPRGKSNFNKGGKPDARKRK"
FT   gene            complement(404407..404820)
FT                   /gene="rplV"
FT                   /locus_tag="Fjoh_0392"
FT   CDS_pept        complement(404407..404820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="Fjoh_0392"
FT                   /product="50S ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03428"
FT                   /db_xref="GOA:A5FMZ5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMZ5"
FT                   /protein_id="ABQ03428.1"
FT                   /translation="MGVRKRETADARKEANKSIAFAKLNNCPTSPRKMRLVADLVRGQK
FT                   VERALNILRFSSKEASRKLEKLLLSAINNWEQKNSEGNLEEAGLFVKEIRVDGGMMLKR
FT                   LRPAPQGRAHRIRKRSNHVTIVLGAINNTQSNS"
FT   gene            complement(404829..405107)
FT                   /locus_tag="Fjoh_0393"
FT   CDS_pept        complement(404829..405107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0393"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03429"
FT                   /db_xref="GOA:A5FMZ6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMZ6"
FT                   /protein_id="ABQ03429.1"
FT                   /translation="MARSLKKGPFVHYKLDKKVQENVESGKNSVVKTWSRASMITPDFV
FT                   GQTIAVHNGRQFVPVYVTENMVGHKLGEFSPTRSFRGHAGAKNKGKK"
FT   gene            complement(405114..405938)
FT                   /gene="rplB"
FT                   /locus_tag="Fjoh_0394"
FT   CDS_pept        complement(405114..405938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="Fjoh_0394"
FT                   /product="50S ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03430"
FT                   /db_xref="GOA:A5FMZ7"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMZ7"
FT                   /protein_id="ABQ03430.1"
FT                   /translation="MSVRKLKPITPGQRFRVVNGYDAITTDKPERSLIAPIKNSGGRNS
FT                   QGKMTMRYTGGGHKQRYRIIDFKRTKDGIPATVKSIEYDPNRTAFIALLAYADGEKTYI
FT                   IAQNGLKVGQKLVSGPESQPEIGNTLPLSRIPLGTVISCIELRPGQGAVIARSAGTFAQ
FT                   LMARDGKYATIKMPSGETRLILLTCSATIGAVSNSDHQLVVSGKAGRTRWLGRRPRTRP
FT                   VAMNPVDHPMGGGEGRSSGGHPRSRNGLPAKGYRTRSKKNPSNKYIVERRKK"
FT   gene            complement(405948..406238)
FT                   /gene="rplW"
FT                   /locus_tag="Fjoh_0395"
FT   CDS_pept        complement(405948..406238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="Fjoh_0395"
FT                   /product="50S Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03431"
FT                   /db_xref="GOA:A5FMZ8"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMZ8"
FT                   /protein_id="ABQ03431.1"
FT                   /translation="MSIIIRPIVTEKVTKESEVLNRFGFVVDKKANKVQIKKAVEAAYG
FT                   VTIVSVNTMNVRPDRSTKYTKSGLISGKTNAIKKAIVQVQEGETIDFYNNI"
FT   gene            complement(406246..406875)
FT                   /gene="rplD"
FT                   /locus_tag="Fjoh_0396"
FT   CDS_pept        complement(406246..406875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="Fjoh_0396"
FT                   /product="50S ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03432"
FT                   /db_xref="GOA:A5FMY0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMY0"
FT                   /protein_id="ABQ03432.1"
FT                   /translation="MEVKVLDFNGKDTGRKVQLSDSVFAIEPNNHAVYLDVKQYLANQR
FT                   QGTHKAKERAEVTGSTRKIKKQKGTGTARAGSVKNPLFKGGGTVFGPRPRSYSFKLNKN
FT                   LKRLARKSAFSIKAKESNIIVLEDFNFEAPNTKNFINVLKALGLENKKSLFVLGESNKN
FT                   VYLSSRNLKASNVVTSSELSTYAILNTNNLVLLEGSLELIEENLSK"
FT   gene            complement(406875..407492)
FT                   /gene="rplC"
FT                   /locus_tag="Fjoh_0397"
FT   CDS_pept        complement(406875..407492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="Fjoh_0397"
FT                   /product="50S ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03433"
FT                   /db_xref="GOA:A5FMY1"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMY1"
FT                   /protein_id="ABQ03433.1"
FT                   /translation="MSGLIGKKIGMTSIFDENGKNIPCTVIEAGPCVVTQVRTNEVDGY
FT                   EALQLGFDDKNEKHSTKAALGHFKKAGTVAKKKVVEFQDFATEQKLGDLIDVSIFEEGE
FT                   FVDVQGVSKGKGFQGVVKRHGFGGVGQATHGQHNRLRAPGSVGASSYPSRVFKGMRMAG
FT                   RMGGDNVKVQNLRVLKVVAEKNLLVVKGCIPGHKNSYVIIQK"
FT   gene            complement(407899..408204)
FT                   /gene="rpsJ"
FT                   /locus_tag="Fjoh_0398"
FT   CDS_pept        complement(407899..408204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="Fjoh_0398"
FT                   /product="30S ribosomal protein S10"
FT                   /note="PFAM: ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03434"
FT                   /db_xref="GOA:A5FMY2"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMY2"
FT                   /protein_id="ABQ03434.1"
FT                   /translation="MSQKIRIKLKSYDHMLVDKSAEKIVKTVKTTGAVVTGPIPLPTHK
FT                   KLFTVLRSPHVNKKAREQFEVMSYKRLIDIYSSSSKTIDALMKLELPSGVEVEIKV"
FT   gene            complement(408215..410371)
FT                   /locus_tag="Fjoh_0399"
FT   CDS_pept        complement(408215..410371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0399"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03435"
FT                   /db_xref="GOA:A5FMY3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMY3"
FT                   /protein_id="ABQ03435.1"
FT                   /translation="MARDLKYTRNIGIAAHIDAGKTTTTERILFYTGKSHKIGEVHDGA
FT                   ATMDWMAQEQERGITITSAATTCTWNFPTEQGKVIPQSLPYHFNIIDTPGHVDFTVEVN
FT                   RSLRVLDGLVFLFSAVDGVEPQSETNWRLADQYRVPRMGFVNKMDRQGANFLAVCGQVK
FT                   DMLKSNAVAITLPIGDEADFKGIVDLVKNQAIVWHDETQGATFDIVDIPADMVDEVKHY
FT                   RSILIEEIATYDENLLDKYMEDENSISEEEINNALRAATIDMAIIPMLAGSSFKNKGVQ
FT                   FMLDAVCKYLPSPLDKEGIEGIHPDDADLLEEDQTKILRKPDVKEPFAALAFKIATDPF
FT                   VGRLAFFRAYSGRLDAGSYVLNTRSGNKERISRIYQMHANKQNPIEFIEAGDIGAAVGF
FT                   KDIKTGDTLCDEKNPIVLESMKFPDPVIGIAIEPKTKADVDKMGMALAKLAEEDPTFTV
FT                   RTDEASGQTIISGMGELHLDILVDRMKREFKVEVNQGEPQVEYKEAFTRSATHRETYKK
FT                   QSGGRGKFGDIVFTIEPADEVDGKVPVGLQFINAVKGGNVPKEYIPAVEKGFREAMKTG
FT                   PLAGYAVDSLKVTLTDGSFHPVDSDALSFELAARMGYKESGRAAGAVILEPIMKIEVIT
FT                   PEENMGDIVGDLNRRRGQVNDMGDRNGAKTIKADVPLSEMFGYVTTLRTLSSGRATSTM
FT                   EFSHYAETPSNISEEVIKKAKGNA"
FT   gene            complement(410383..410859)
FT                   /locus_tag="Fjoh_0400"
FT   CDS_pept        complement(410383..410859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0400"
FT                   /product="30S ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03436"
FT                   /db_xref="GOA:A5FMY4"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMY4"
FT                   /protein_id="ABQ03436.1"
FT                   /translation="MRKRAAKKRPLLPDPRFNDQLVTRFVNNLMWDGKKSTAFKVFYDA
FT                   IDIIETKKQNDEKTSLEIWKDALTNVMPHVEVRSRRVGGATFQIPMQIRPDRKISMAMK
FT                   WLILYARRRNEKSMAQRLASECLAAAKEEGAAVKKRMDTHKMAEANKAFSHFRF"
FT   gene            complement(410884..411267)
FT                   /gene="rpsL"
FT                   /locus_tag="Fjoh_0401"
FT   CDS_pept        complement(410884..411267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="Fjoh_0401"
FT                   /product="30S ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03437"
FT                   /db_xref="GOA:A5FMY5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMY5"
FT                   /protein_id="ABQ03437.1"
FT                   /translation="MPTIQQLVRTGRTQITKKSKSVALDSCPQRRGVCTRVYTTTPKKP
FT                   NSAMRKVARVRLTNGNEVNAYIPGEGHNLQEHSIVLVRGGRVKDLPGVRYHIVRGALDT
FT                   SGVAGRTQRRSKYGAKRPKEAKK"
FT   gene            411451..413151
FT                   /locus_tag="Fjoh_0402"
FT   CDS_pept        411451..413151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03438"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMY6"
FT                   /protein_id="ABQ03438.1"
FT                   /translation="MKLFFQTFFFILISTSAYTQNFYLKINGSNILENKTIDSLSYTTI
FT                   HHNTKSLFDEIKNISKKLSKEGYIDNKIIETKKTNDSTYISVFELKNKIKYIHIYIGTN
FT                   YTISNFKKKQNDTVIIPYSEIESYLEKETSIAEKSGYSLNKIKLENIQRKNAIIYADLN
FT                   FKKEKKRVINSIILNYTNQSSTDFFPKGHLKQLNKKYLNKTFNQETLKELYEDINNFEF
FT                   VSQTKYPEILFTNDSTKIYTYIEKRKANTFDGFIGFSNNEDKKIRLNSYLDASLINTLH
FT                   AGEHFSLYWKSDGNQQKTFNTKLEIPYIFKTSLAIKAQLNIFKRDSTFQNTKTAIELGY
FT                   LLNYNSKIYLGYQATESSDIQNTNNSKISDFKNSFITSNYEYKKIDQTNTLFPLKSFFN
FT                   CTLGYGKRNTNNLPETAEPSSQFYTNLNLAYNIELNKKNLIYINPQLLYLKSTNYINNE
FT                   LFRFGGMNSIRGFAENSLQGNSINLLLTEYRFLANQNLYLHSILDYGLYQDQTSPENKK
FT                   FNNLVSVGIGVGILTSNGLLKLTIANGTINNSNIKFYNSILNLSYNVKF"
FT   sig_peptide     411451..411510
FT                   /locus_tag="Fjoh_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.918 at
FT                   residue 20"
FT   gene            413623..416874
FT                   /locus_tag="Fjoh_0403"
FT   CDS_pept        413623..416874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0403"
FT                   /product="SusC-like TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03439"
FT                   /db_xref="GOA:A5FMY7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMY7"
FT                   /protein_id="ABQ03439.1"
FT                   /translation="MKLKFNGFLVLLLVLVAQLSFAQERAVSGTVSDNAGMPLPGVSVL
FT                   VKGTKAGTQTDFDGKYSIKASSSQVLVFSYIGMKTQEIAATSSTVNVKLAGDAQELESV
FT                   VVTTALGVKREKKSLGYATQEVKGGDLRNGTSSGNFLNELSGKVAGVNITRNSNFGGST
FT                   SAISRGVKAIGQSNEMLIVIDGMPINNGNNTNDGTTAQSSGGRGFDYGNNAMDINPEDI
FT                   ESVNVLKGATASALYGYLAGNGVLMITTKKGKAKRGLGITVSSEVVTGSPDKSTFVKYQ
FT                   KDYGAGYGGSFGEQDIDGDGIPDLVVAMGDDASVGDAFDPTLNVYQWDAFSLYPGNNNY
FT                   GKATPWKAAANDPFKFFKNSLSLVNSISFEDGNEKTNVVFNYTNTKQTGILPNSELRKN
FT                   NFSLKLNHQFTDRLSLSTFANFSAQETLGRNMTGYSANLISGFRQWWQTNVDIKELERA
FT                   YNNSGGENITWNRKSVANGAPAYWNNPYFERYQNYQNDSRNRFIGYANFTYKIADWLSA
FT                   TAKVSTDTYAEIREERVAVGSVAKTFGINALDETSGYQRYNGNFSEQNYNLLLNFKHNF
FT                   GENVSLTGVAGGTIRNTYFNQITASTQGGLIIPGIYSLSNSRAASPYPYERETKTSVNS
FT                   YYASASLGFLDTYFIDATARRDAFSNLPADDNSLISSSVSGSWVFSKNIDASWLSFGKL
FT                   RGGYSESPLGTPALALVDTYTKYDPFNNNQMYSVNSIKNNPDLRPIKTNTTEVGLEMQF
FT                   LNRRIGFDVSLYKNINDGEAVRVPYSTATGYTSKYVNAAKIENKGIEVQFNVTPVKTNN
FT                   FAWDINVNWSKNENMVTALADGVSNLQISSFPGTVTLNAVVGQPFGVLKGTDYTYTADG
FT                   QRVINPATGRYVINTSTNNIIGNINPDWIGGIRNKFTYKSLSFSFLIDTKHGGDIFSTD
FT                   QWYGVGTGLTNETAGNNDLGIPKRNTLVNGGGVILEGVYADGTPNTTRTAYSTGGAITN
FT                   AYTNGPRSQYVYDAGFIKLREVNITYSLPSSLVQKMKLVDAKISLIGSNLWIIQKNIPD
FT                   ADPESGLGSNVGSQGLSIGSLPTTRNIGCNLTIKF"
FT   sig_peptide     413623..413691
FT                   /locus_tag="Fjoh_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            416878..418344
FT                   /locus_tag="Fjoh_0404"
FT   CDS_pept        416878..418344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0404"
FT                   /product="RagB/SusD domain protein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR041662"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMX2"
FT                   /protein_id="ABQ03440.1"
FT                   /translation="MKNRLIILISFIALFSSCSDDFGNMNQDTKNPTVTTPEFLFTNAE
FT                   KFMVDQVTSTSVNFNVFRLYAQQWTEVQYPQETQYDLTGRTIPDRHWATYYRDVLRDFK
FT                   EAKQLLLTQKANFTGTPDGLIVIENKIAIIDILSSYCYNILVDTFGDVPYTEALDIDGH
FT                   PQPKYDDAQTIYKDLLSVLTAASHKLDHSEGSFDSADLIYGGDTQKWAKFANSLRFRMA
FT                   ITMADVDLTYATTEALAAQADGLILTSADGTYMPYTTNTTNNNPLYLDLVASGRDDFLP
FT                   ANTFVNKMNALSDPRRAKYFTEYPAGSGQYKGGVYGTVNVYGDFSHLTPTIKDPVYPGV
FT                   LFTYSEVEFLLAEAAERGIAVGGTAESHYNAAITASLQDWGVASGDITTYLARPDVAYA
FT                   TATGTWKQKIGEQAWIAYYNRGFEAWTSYRRLDFPVLAAPAVTFGDITEVPKRYSYPGI
FT                   EQTLNAANLEAAVAKLGNNAVTTKLFWDKF"
FT   sig_peptide     416878..416937
FT                   /locus_tag="Fjoh_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.906 at
FT                   residue 20"
FT   gene            418362..419180
FT                   /locus_tag="Fjoh_0405"
FT   CDS_pept        418362..419180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0405"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03441"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMX3"
FT                   /protein_id="ABQ03441.1"
FT                   /translation="MKKYIKQIAAFALIAVLASCDSADDNVNLTSVGGNAVPTTSSISR
FT                   LDNNYVLPFNTFTQEGVTVSKVELFKNTAKTTSDPIIFGDKVTDLTLSEGKGTFNTSVL
FT                   GSFDVFPVTSGGVTTLTGKTGSYSLAILATYSDGSTTRAPWTLTVGKGISWQGFNDEGK
FT                   LANTTSSGISTITYGDTTPALVYIAPVKKSTTTITSIVGYWSKNDSGTFAALPLTLTNG
FT                   AQPVNLAAIPYTTYGGLVAGDKITYRFVITATGGQTDQISTTVTFDADAI"
FT   sig_peptide     418362..418433
FT                   /locus_tag="Fjoh_0405"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.786 at
FT                   residue 24"
FT   gene            419281..420015
FT                   /locus_tag="Fjoh_0406"
FT   CDS_pept        419281..420015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0406"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase, substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03442"
FT                   /db_xref="GOA:A5FMX4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMX4"
FT                   /protein_id="ABQ03442.1"
FT                   /translation="MEKEHQIFGIRAIIEAIQAGQEVDKVFIQKEISGELMKDLMKVMK
FT                   RANINFSYVPVEKLNRLTPNNHQGAVATISPIGFIDIEHLVESTIASGSKPLFLILDQI
FT                   SDARNFGAIIRTAECTGVNGIIVQKAGSAPVNGDTVKTSAGAVFNVPICKVEHIKDAIF
FT                   YLQGSGIKTVAATEKTDQNIYDLSLNEPLAIIMGSEDRGINPSVLKIVDEKAKLPMFGS
FT                   IGSLNVSVACGAFLYEAVRQRS"
FT   gene            420056..420856
FT                   /locus_tag="Fjoh_0407"
FT   CDS_pept        420056..420856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0407"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03443"
FT                   /db_xref="InterPro:IPR019619"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMX5"
FT                   /protein_id="ABQ03443.1"
FT                   /translation="MSLNPNHTILNKKACSILVMLLITSISCGQTIHYNQFWGEVQFNR
FT                   TINEKWSTELNLGTSYSSTESSPNIFEQNTQRSFRGWGHYYLNPRWKLSSFIAYYNNKD
FT                   VPEIGQFESPEWRFALQGIYYFHKTGYTLSTRMRTELRHMRNQDDTYENVIRYRQQIKY
FT                   LKPINSKVLRSGVVYAIASDEIFLKSETKVTGLSFFDRNRLNLGAGYLFTDDIQIEITY
FT                   ANEYLPRDNGNQIVNAGSLTLTFNNLFKNLSKKLLHQTPQENDE"
FT   sig_peptide     420056..420145
FT                   /locus_tag="Fjoh_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.990 at
FT                   residue 30"
FT   gene            complement(420859..421362)
FT                   /locus_tag="Fjoh_0408"
FT   CDS_pept        complement(420859..421362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03444"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMX6"
FT                   /protein_id="ABQ03444.1"
FT                   /translation="MKKLFFTGLILLILGNKSFAQCEIKNRVLADGSMIYYSYPEVFYT
FT                   TKSKSLKINIVTDKESYFVALQPTPFPEKKIGKKITDDLVIHLADKNAYKLTHYDTQYI
FT                   QNDSVMQVLYLIDSKDLEAFSKFEALVATINMKGTEFIRDYNFKLHKDEIVKQLACFLK
FT                   KEDK"
FT   sig_peptide     complement(421300..421362)
FT                   /locus_tag="Fjoh_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.968 at
FT                   residue 21"
FT   gene            complement(421433..422197)
FT                   /locus_tag="Fjoh_0409"
FT   CDS_pept        complement(421433..422197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0409"
FT                   /product="Peptidase family S54; Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03445"
FT                   /db_xref="GOA:A5FMX7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMX7"
FT                   /protein_id="ABQ03445.1"
FT                   /translation="MNDNHFKFSNAVVGLPLFFVLFLWIIYWIQIRFDVDFYQNGIYPR
FT                   DFSGLQGVLFSPFIHENLEHLYNNSIPLLVLLAALQFFYPKQSFVVIVFGILFSGLITW
FT                   IIGRANFHIGASGLIYVLVSFIFFKGIQTKYYRLVALSLSVILLYGGMIWYVFPDVDKT
FT                   ISWEGHLAGFITGFGLSLYYKTPEYTKPIIYDWQRPDFDPSADPFMKHFDEDGNFVNTE
FT                   VVEEETENLDSFFNSNITVNYIVTKSESGDKG"
FT   gene            422361..423638
FT                   /locus_tag="Fjoh_0410"
FT   CDS_pept        422361..423638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0410"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03446"
FT                   /db_xref="GOA:A5FMX8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMX8"
FT                   /protein_id="ABQ03446.1"
FT                   /translation="MEAPLAERIRPRTLEDYISQSHLVGPNGSLTQQISKGIIPSLIFW
FT                   GPPGTGKTTLAQIIAQESKRPFYELSAINSGVKDIRDVIEKAKQSGGLFTAKNPILFID
FT                   EIHRFSKSQQDSLLAAVEKGWITLIGATTENPSFEVIPALLSRSQVYILNAFTKDDLEA
FT                   LLHRAIKIDKELSSKNITLKETEALLRLSGGDGRKLLNIFELVVNASASDEIVITNDRV
FT                   LALVQQNTVLYDKTGEQHYDIVSAFIKSIRGSDPNGAVYWLARMIEGGEDVKFIARRML
FT                   ILSSEDIGNANPTAFIMANNTFQAVSTIGYPESRIILSQCAIYLATSPKSNASYMAIGN
FT                   AQQLVKQTGDLPVPIHLRNAPTKLMKELGYGEDYKYSHDYANNFAEQEFLPDAIKETVL
FT                   YNPGSNSRENSNREFLKNRWKDKYGY"
FT   gene            complement(423652..424386)
FT                   /locus_tag="Fjoh_0411"
FT   CDS_pept        complement(423652..424386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03447"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMX9"
FT                   /protein_id="ABQ03447.1"
FT                   /translation="MKLKVLLTLLLCSVIGFSQSINDYKAVIIPVKYDFMKTENQYRLA
FT                   TLTKSNLLKAGFKAYYANEEMPAGLGDRCELLYVDVKKDNAFLVTKLFVEFKDCYGKIV
FT                   YTSETGKSREKDYEAAYKESLDNAFISIIAQHYKYNGKTVTTQVAQTSTPVVSTVAATT
FT                   VIPTPDVSDPNLLYAQPTENGYQLIDKTPKVVMKLLKTSRQDSFIAIKDGVQGSLNAKD
FT                   NGWYFEYYQNDKLVSEKISVKF"
FT   sig_peptide     complement(424324..424386)
FT                   /locus_tag="Fjoh_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.673 at
FT                   residue 21"
FT   gene            complement(424389..425075)
FT                   /locus_tag="Fjoh_0412"
FT   CDS_pept        complement(424389..425075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0412"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03448"
FT                   /db_xref="GOA:A5FMW4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMW4"
FT                   /protein_id="ABQ03448.1"
FT                   /translation="MNTNITDIFFDLDHTLWDFDKNSQMAFDRIFKNNFEGIKIEDFIE
FT                   KYLPINQECWRLYQNDQITHQELRYNRLKLSFDALNYSMTDENIDQISNDYIEFLTDNN
FT                   YLFDGAIEVLEYLKPKYKLHIITNGFAHVQEKKINNASLGGYFTTITNSELAGVKKPNS
FT                   IIFDYAVNLAQSSKENSIMIGDDFDADVNGALNAGMDAIFFNVKNIETPQNYKQINHLL
FT                   ELKKYL"
FT   gene            complement(425079..425768)
FT                   /locus_tag="Fjoh_0413"
FT   CDS_pept        complement(425079..425768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0413"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03449"
FT                   /db_xref="GOA:A5FMW5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMW5"
FT                   /protein_id="ABQ03449.1"
FT                   /translation="MEGSHFAIKDWSEDDKPREKLMLKGKEALSDAELMAILIGSGSRN
FT                   ESAVALSQRILASAKNLNSLWKMSVSQLIKFKGIGEAKAVSIVAALELGRRQRAEDILK
FT                   LKKITSSKDAFTIMQPIIGELPHEEFWVLFLNNSNKVISKAQLSKGGIAGTIVDVRLVF
FT                   KLGLENGATGLILCHNHPSGELNPSQADKQITKKIKTAGEILDVKILDHLIITETKYYS
FT                   FVDEGIF"
FT   gene            complement(425965..427320)
FT                   /locus_tag="Fjoh_0414"
FT   CDS_pept        complement(425965..427320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0414"
FT                   /product="cytoplasmic peptidoglycan synthetase domain
FT                   protein"
FT                   /note="PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03450"
FT                   /db_xref="GOA:A5FMW6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMW6"
FT                   /protein_id="ABQ03450.1"
FT                   /translation="MKTHFIAIGGSAMHNLALALHNKGYQVTGSDDAIFEPSKSRLEKK
FT                   GILPAELGWFPEKITADIDAIILGMHAKADNPELLKAQELGLKIYSYPEFLYEQSKNKT
FT                   RVVIGGSHGKTTITSMILHVMHYHNIAVDYMVGAQLEGFDTMVHLTEENDFMVLEGDEY
FT                   LSSPIDRRPKFHLYQPNIALISGIAWDHINVFPTYENYVEQFEIFIEKITNGGILVYNE
FT                   NDPEVKRVSEAATNPIRKLPYSTPEYSVADGVTLLKTPEGDMPIEVFGAHNLNNLAGAK
FT                   WICQNMGVDEEDFYEAIASFKGASKRLEKIAEGKGKVAYKDFAHSPSKVAATTKAVKEQ
FT                   YPNRTLVACLELHTYSSLNAAFLKEYEGALEYADVAVVFYSPDAVKIKQLEEVTYEQIA
FT                   AAFNRKDLIIYTNPTEFKEYLFHLNLDNSALLLMSSGNYGGLNFDEVKGLIN"
FT   gene            427525..433779
FT                   /locus_tag="Fjoh_0415"
FT   CDS_pept        427525..433779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0415"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03451"
FT                   /db_xref="GOA:A5FMW7"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMW7"
FT                   /protein_id="ABQ03451.1"
FT                   /translation="MKNMLFVFTLISSTLFAQQNDKNWAKVIAFENEGKIKSANELVAK
FT                   IYKKATAKKNETEMIKCFFYQAKYLMVIDENAKTKILDNLKTDINRVSIPSKAILTLIY
FT                   AKCLNHYSNYDDYAVVVDSAAAVVDDEASLIDQAAATIDTAAVDGIAHDNASIYLTPEK
FT                   EIIALYNKTVENEEILKKTPLNNYALIFEFTSDKFKNASLYDYVLDENITFYKEKIESW
FT                   NIPYSDLFQHSDKLLGSSESFLTLNFDFIKEEYLKKTLELYQKKEKDNPSLENQFERVK
FT                   YCNNALIHSDETFSQYLDKVEKIAKDENLLQKIKLEKAELLANKASKEFYPKNNIEALK
FT                   ILDEIIQINKKTNTANLALLKKRELTEKSVSIQLEKYIYDNENTRTYISYKNLNGLKVS
FT                   YYKINLSQVKKFQKQSETARDSLCKSTIKNQTPVVSQNYDLKNKNDYFEYNTELLLPKL
FT                   TIGNYLVYFESDSDIKNKKASAYEVITVSNISVLATRQDKIENYQVLDRKTGKPLENVT
FT                   VKSSTSTAKTDSKGIVSLQLKNESYNYEPVEFSIGNDSILIHKNYLRYVSDYGLSENER
FT                   ASAKVEFYLDRAIYRPGQTVYFKGIAIQKSKNKSSVVPNTPFKIVVNDVNYQKINEFEL
FT                   TTNEFGSFSGEFVLPKNGLTGDFHISVQRPDDYTKKETAAAFWNTTNFNYSTTYFSVEE
FT                   YKRPKFEVTFDAKKESFKLNESVKIKGTAIAFAGSSISDAVVKYSVNRYTTYFRNYYGR
FT                   EENETLAVGETKTDASGKFTIDFMALPSNNNSKEQRPVFNYEINVSVTDINGETHTAVT
FT                   TVKVGYHDLIIDALVPNSIETKDKNEIILNSTNLNGEFLPAKGEIKLYFVSPFPNKFKP
FT                   RIFNRPEIETISAKEFEALFPYEINENPFAEKSREVLLFSKKVDTQKDKKIILDFISNY
FT                   KSGNYKIVFTAKDSFQNTIESTTNFNIKQSKDKFHSDRLFSAEQMNDDPKKDGFVLVKL
FT                   SSVIPELYITANGNYQNKVYFEDTFHLQNHEAVIKIPLKSEFEKEIKIGFESIFDNASF
FT                   TDAITVDLKTQEQKLEWIVETFRNKIQPGSAETWSFKLNSKSAKIEAEVLASMYDSSLD
FT                   QFTKKDWNLLKLDPYYYNSVMTRSVLGFDMAYLSLENLNEIFPQIDFHSDEIKLNWFGF
FT                   DFYNSRFGTAYAGITIAELKDKKVGGAMIQEEADSGRRVSLALAAPSVMKEESNFDEGT
FT                   VKANKTAPALRIRGNSNIAGNEPIYVVDGEIMTTIKDIDPKEILSIETLDPEKATALYG
FT                   SKAANGAIIVTTKKALEALSQVKARKNLSETAFFLPNLKTDSKGKVSFNFTSPEALTAW
FT                   KFRLLAHNKDAVSGYLEKSVITQKELMVVPNFPRFFREKDEIVINAKISNMTDQAKTGI
FT                   ASLQFFDAVTMQPIDDKMLNTKNIKNFTISSHGNTSVSWTITIPEGLQGVQYKIIAKAG
FT                   NFSDGEENILPVLTNNMLVTESIPVWVRENSTKEYTFENLKNNNSTTLKNHQFTFEYTS
FT                   NPTWLAIQSLPYLMEYEHECAEQTFARYYANSLASEIISSNPKIASVFEEWRKSGKPVS
FT                   KLEENEELKSLILAETPWLNDAQSEDEKKKNLALLFDLEKMKTSLESAFEKLKQKQNTS
FT                   GAFSWFEGGYENEYITRHILAGLGHLNKLTKTAGNKADEIAKNGIPFLDSKFIEYHKTR
FT                   TKNLKEVDKLIWYNPYSDLHYLYTRSFYLEKYPQSDTLKKTIQLYLDKAKKDWLNYSIY
FT                   EKGLAAITLNRFGEKETAKKIVESLKETSSNNEDWGMYWIANKSGWYWYQAPIETQALL
FT                   IEAFAEISNDTKSVDAMKVWLLKNKQTKNWPTTKSTTEAVYALLMQGTDWLSVKDNTII
FT                   KLGDEKIMTKKLAENQKEAETGYIKLNWKAEEVKKEMASISIQNKSKVPGFGGVYWQYF
FT                   EDLDKIKNNSGAVLSVSKELYIKKSSLKGDQLHRITSKDPLKTGDLVTVRLIITAKEDS
FT                   EYVHLKDMRASCFEPVNVLSEYQYKNRLGYYMSTKDAATHFFFDQINKGTYVLEYDIRV
FT                   NNSGEFSNGITTIQSMYAPEFASHTKGIRVKVQ"
FT   sig_peptide     427525..427578
FT                   /locus_tag="Fjoh_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.952 at
FT                   residue 18"
FT   gene            complement(433946..436090)
FT                   /locus_tag="Fjoh_0416"
FT   CDS_pept        complement(433946..436090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0416"
FT                   /product="Peptidase family S46; dipeptidyl-peptidase 7"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03452"
FT                   /db_xref="GOA:A5FMW8"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR019500"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMW8"
FT                   /protein_id="ABQ03452.1"
FT                   /translation="MKKIVLFLTMCLMTFPMRADEGMWFLMFIERLNHRDMEKMGLQLT
FT                   AEEIYSINHHSLKDAIVQFNGGCTAEIVSKEGLVLTNHHCGYNAIAELSTAEQNYLKDG
FT                   FWAKQKSAEMKPKSLYVRFFVRMDDVSKRILSKVNDQMTETERNKIIQQEISLIEKENS
FT                   ENGKYTVSVRPFFQGNEYYYFVYQDYTDVRLVGTPPESVGKFGGDTDNWEWPRQTGDFS
FT                   MFRVYADKDGNPAAYSKDNVPLKPKHYLPVSIKGVKENDFAMILGYPGRTNRWMPAGGI
FT                   EQNIKYAYPAWVEGAKTGMDVMKKYMDKDATVRLQYASKYASTANYWKNRQGMIDALTK
FT                   AGTVDTKAEQEDKFYEWASKPANKEKYENVIPTINDYYRETNLKARHDNYLMQLLRTSS
FT                   YATGPANLGNSLIAYFNENDAKKAEMLPKINAMIENIYGEFYEPLEKDILIAQLNLYAS
FT                   KASEYGLATQIAAMKAANNGDFTSDVTKGAEMSYFSSKEKIQAFMANPKPLAIVHDPLY
FT                   IISNDLLTKYRSKTDDQAKADDGFATAYRELVEGLRESKLNAIKYPDANSTLRLTYGKV
FT                   RALPADPRNDAAINNYTTMESMVKKYKAGDQEFDLPARLLELNKKKDFGQYADKAGYMP
FT                   VNFLTDNDITGGNSGSPVLNGKGELIGIAFDGNIEAMAGDVIFDSKLQRTINVDIRYVL
FT                   WLIDKYAGAKNIIDELTIAK"
FT   gene            436403..436933
FT                   /locus_tag="Fjoh_0417"
FT   CDS_pept        436403..436933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03453"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMW9"
FT                   /protein_id="ABQ03453.1"
FT                   /translation="MKKLLFAVVLLITTIASAQKNSILLGGNVGYASEKLGDSKLENFE
FT                   FSPRVGYQFAEKCTAGVEGSIMNVKTTGIDKTEKYKIGGFVRYSTPLSQMFSVFADLGA
FT                   GYQNTSVNNAKGFYASLTPALFINMKNGFGLNFSIGGINYDNLDGKNDPRQENLGFNFG
FT                   KTLNIGISKNFGL"
FT   sig_peptide     436403..436459
FT                   /locus_tag="Fjoh_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.912 at
FT                   residue 19"
FT   gene            complement(437051..438052)
FT                   /gene="obgE"
FT                   /locus_tag="Fjoh_0418"
FT   CDS_pept        complement(437051..438052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obgE"
FT                   /locus_tag="Fjoh_0418"
FT                   /product="GTPase of ObgE type"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; GTP1/OBG sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03454"
FT                   /db_xref="GOA:A5FMX0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMX0"
FT                   /protein_id="ABQ03454.1"
FT                   /translation="MTEGNFVDYVKIYVSSGKGGKGSTHLHREKFIEKGGPDGGDGGRG
FT                   GHVYLVGNKGLWTLFHLKFARHIKAGHGGDGGSDRSTGADGEDKFIEVPLGTVVKDKET
FT                   GEVLFEITEDGEKRILAKGGKGGLGNWHFRSSTNQTPRYAQPGLPGLEMDVILELKVLA
FT                   DVGLVGFPNAGKSTLLSVLTSAKPKIADYPFTTLKPNLGIVAYRDFQSFVIADIPGIIE
FT                   GAAEGKGLGHYFLRHIERNSTLLFLVPVDTPDIKAEYDILVNELTKYNPEMLDKERLLV
FT                   ISKCDMLDDELKAELKAELDVSFKDIPYMLISSVAQQGLTDLKDKLWKMLNE"
FT   gene            complement(438195..439418)
FT                   /locus_tag="Fjoh_0419"
FT   CDS_pept        complement(438195..439418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0419"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03455"
FT                   /db_xref="GOA:A5FMX1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMX1"
FT                   /protein_id="ABQ03455.1"
FT                   /translation="MSEIALISARKNRLETAAKKGNKSAKTALDLANSPNKFLSTVQIG
FT                   ITLIGILTGIYSGDKITADVEVFVAGFAALKPYAHSIAVGIVVVVLTFFSLVLGELLPK
FT                   RIGLNYPESIAKMVAMPMKVISIITAPFIWLLTSSTDFLLNIFQIKPTADGKVTEEEIK
FT                   AIIKEGTEVGEVQEIEQDIVERVFHIGDRKVSSLMTHRKSVDMLPLNADKTKIKELVVQ
FT                   DLHAVYPVYNENYDDIVGVVTLKNIFANIENDNFDFASIMTDAPYLMEQTTAYKALENF
FT                   KKTGVHYALVSDEYGVFQGMITLNDILEALVGDASEFYKDEFQLIEREDGSWLVDGHYS
FT                   LHDFLTYFELDELTNDYEVNTVSGMIMTELSHIPKEGEKLVWQKFVLEVVDMDGVKIDK
FT                   VLVKTLKE"
FT   gene            complement(439540..440112)
FT                   /locus_tag="Fjoh_0420"
FT   CDS_pept        complement(439540..440112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0420"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="PFAM: adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03456"
FT                   /db_xref="GOA:A5FMV7"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMV7"
FT                   /protein_id="ABQ03456.1"
FT                   /translation="MINIVLFGKPGAGKGTQAEFLKEKYNLTHLSTGDIFRFNLKNDTE
FT                   LGKQARVFMDNGELVPCEVTTAMLIDEVKKHPDSAGFLFDGYPRTLDQAEALDKFLPTI
FT                   GSSVTATIALEADDEILVKRLLERGKTSGRADDQDEEKIRVRYQEYNEKTAPLIGYYKD
FT                   QNKFYAVDGIGTIEQITERLTSVIDNL"
FT   gene            complement(440184..440714)
FT                   /locus_tag="Fjoh_0421"
FT   CDS_pept        complement(440184..440714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0421"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03457"
FT                   /db_xref="GOA:A5FMV8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMV8"
FT                   /protein_id="ABQ03457.1"
FT                   /translation="MIQLHDKQFVPFISAKEIDFALTKLVAQVEDDFGDDTPIFIGVLN
FT                   GAFMVVSDFLKKYKKPCEVSFIKMASYEGTETTNSVKELIGINQDLSGRSVVIIEDIVD
FT                   TGNTIEELKHLFKAQNVKHFKVATLFFKPEAYKKDMKIDYVGIRIPNKFIVGYGLDYDG
FT                   LGRNLTEVYKLAE"
FT   gene            440902..442173
FT                   /locus_tag="Fjoh_0422"
FT   CDS_pept        440902..442173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0422"
FT                   /product="Glucose/sorbosone dehydrogenase-like protein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03458"
FT                   /db_xref="GOA:A5FMV9"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMV9"
FT                   /protein_id="ABQ03458.1"
FT                   /translation="MKKSLTLFSIPLLALMTACNGQVKKEEKEALAKQLGNVVKTAVGD
FT                   ITLPPPYATESKTNNSKVIGWPKDKTPKAPEGFTVTKFADGFENPRWTYIAPNQDIFVV
FT                   ESGTRTSKNQITVLRDKDKDGKFETREVFISGLNKPFGMLVLKDFFYIANTDGLYRYPY
FT                   KNNPLKLETKGEKILELPAGGYNNHWTRNLLASPDGSKIYVSVGSGSNNAEHGVDKEVR
FT                   RAGILEINPDGTGEKIYASGLRNPVGMDWNPVNKELWTAVNERDELGDDLVPDYITSVK
FT                   RDGFYGWPYSYFGSIPDPRMKGERKDLVEKAIVPDVPVGAHTASLGLAFYTKDAFPAKY
FT                   KNGVFVGQHGSWNRSKISGYKVLFVPFKDGKPSEKPEDFLTGFISDENKAEVYGRPVAV
FT                   TVMNDGSLLVNDDSSNTIWKVTAK"
FT   sig_peptide     440902..440967
FT                   /locus_tag="Fjoh_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.918 at
FT                   residue 22"
FT   gene            442372..444462
FT                   /locus_tag="Fjoh_0423"
FT   CDS_pept        442372..444462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0423"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03459"
FT                   /db_xref="GOA:A5FMW0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMW0"
FT                   /protein_id="ABQ03459.1"
FT                   /translation="MILKKYCFLVFVLFVFQNIEAQKKGSKTIDSLKTEKLKEVVISSL
FT                   HINNSLLNTPASIGILSKKDLLQNNTTDITTVINTIPGVFMQSSNFTTSRISIRGIGAR
FT                   TTYGTNKIRAFYGSIPLTSGNSETVIDDIDLENLNQIEIIKGPLSSVYGAGLGGAILIS
FT                   PQLSNNGNQSAGISTVFGSFGLLKNSLNFGLDEKSGSLNISYHNLKTDGWRENSSYNRE
FT                   GITLAGELFRKENSKLTYFSNYTYLKAFIPSSISKEVFNTNPKAGAPTWVASKGYKEYK
FT                   SVLGGLAYDFNINENLKNSTSVFINYKDSNEPRPFDILRQYTFATGARTQFSGNFKIGR
FT                   VENQFIAGAEYFTDTYSGNTFQNLYQQNNGLGSLQGNQLTETDQKRHFYNIFSQLRTLL
FT                   SDQLEIQAGLNYNKTRFDLNNYTENINEEYSYDGIFSPQISFLYKPHSLKTLYFSVSRG
FT                   FSLPATEETLTSEGKINPDIKPENGYNFEVGGKFYFFNKRLYTEISLYRMEIKDLLVAK
FT                   RVGDDQYVGANAGKTFHEGIEITLNHNWPINRFLVLNSYLAGSIGNYKFKEFIDSGNDF
FT                   SGNKLTGVAPQKINAGITLNTNIGVYFSTDYQFVGEIQLNDANTAYSDSYTILNLKTGY
FT                   RFEILRGLTSHISAGVNNVTNEKYASLILPNAVPTGNSSPRYYYPGLPVNYYGAVSLNY
FT                   LF"
FT   gene            444463..445044
FT                   /locus_tag="Fjoh_0424"
FT   CDS_pept        444463..445044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03460"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMW1"
FT                   /protein_id="ABQ03460.1"
FT                   /translation="MLETKTNSMTVLSELQEKLDYVSAYRENRLKCAQDVLENPYLFNE
FT                   LISICFSPEDKNNHKACWILEFVSYEELLWLQPHLDFFFSNLKVLKDESSIRPIAKVVQ
FT                   LLVKSHYKKDENSIHLSEKNLQDCIEASFDWLINDVKVATKAYSIRTLYVLGNHYDWIH
FT                   PELQIILNKDYGDHSAAYKAVAREVLKKIE"
FT   gene            445258..446412
FT                   /locus_tag="Fjoh_0425"
FT   CDS_pept        445258..446412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0425"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; PFAM: ATP-dependent carboxylate-amine
FT                   ligase domain protein, ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03461"
FT                   /db_xref="GOA:A5FMW2"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMW2"
FT                   /protein_id="ABQ03461.1"
FT                   /translation="MNYFSSDFKLGILGGGQLGKMLLFDTRKFDIQTYVLDPSDEAPSK
FT                   IACNKFFKGDLMDYETVYNFGKQVDVLTFEIELVNLEALTQLENEGVKVYPSPKTLKGI
FT                   QNKGTQKDFYTQSNIPTASYLRFESPAHLQKSVGNNEITIPFVWKCTEFGYDGNGVKVI
FT                   RQISDMDDLPNVECIAETMVPFKNELAVIVVRNPSGEIKTYPVVEMEFHPEANQVEYVI
FT                   CPARIDEKVAEKARAIALNVSEKFNHVGLLAVEMFQTQDDEILVNEVAPRPHNSGHYSI
FT                   EASYTSQFENHLRAILDLPLGNTDSKVAGIMVNLVGAEGHSGNVVYENIETILGWDGVT
FT                   PHIYGKKETRPFRKMGHVTIVNENMQEARRIAQEVKNTIKVISA"
FT   gene            446513..446998
FT                   /locus_tag="Fjoh_0426"
FT   CDS_pept        446513..446998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0426"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03462"
FT                   /db_xref="GOA:A5FMW3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMW3"
FT                   /protein_id="ABQ03462.1"
FT                   /translation="MSKVAIIMGSISDMPVMQDAIDILKQFNVEVEVDIVSAHRTPEKL
FT                   FDFSKNAHTRGISVIIAGAGGAAHLPGMVASMSPLPVIGVPVKSSNSIDGWDSVLSILQ
FT                   MPGGVPVATVALNGAKNAGILAAQIIGSHDKKVLDTIISYKEELKAAVNKAAEGLKK"
FT   gene            447160..447387
FT                   /locus_tag="Fjoh_0427"
FT   CDS_pept        447160..447387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03463"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMU7"
FT                   /protein_id="ABQ03463.1"
FT                   /translation="MNIQTSKIELAKIVLDIDNPDLIQEIVEFIQSKESLSEKLKNNIS
FT                   EAIYSLDNNEGISHDVVMEETKNRYSKYFK"
FT   gene            447387..447674
FT                   /locus_tag="Fjoh_0428"
FT   CDS_pept        447387..447674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03464"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMU8"
FT                   /protein_id="ABQ03464.1"
FT                   /translation="MNVIWAPQAKQDFWNNIDYLEAEWSEKVAQNFIDKVNATIKLLKN
FT                   DNVLFIKTNYKSVYKIVITKHISLYYRIENTNLELLRFWNTFQDTEKFKL"
FT   gene            447711..449738
FT                   /locus_tag="Fjoh_0429"
FT   CDS_pept        447711..449738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0429"
FT                   /product="Peptidase family M3; Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B, thimet/oligopeptidase
FT                   F"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03465"
FT                   /db_xref="GOA:A5FMU9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMU9"
FT                   /protein_id="ABQ03465.1"
FT                   /translation="MSILTQYFNTKHNTAPFSQIKIEDYVPAFNEGIALAKAEIDAIVN
FT                   NPDVPTFENTIVAMDYSGDILDRLSSIFFNLNSAETNDEMQKIAQEVSPLLSEFGNDIR
FT                   LNADLFARVKAVYDQKESLNLNPEQTTLLDKKYKSFSRNGANLPEDKKNQLREIDKELS
FT                   KLSLQFGENVLAETNNFELHLTDEKDLSGLPEGTIEAARLLAKNQEKEGWIFTLDHPSY
FT                   IPFLTYADNRELRKKMAIAFGAKAFQNNEFNNEENVLKIAKLRHERANLLGYKTHAHFV
FT                   LEERMAESPEKVFSFLNDLLAKAKPAAQKEFAELTAFAKELDGIEQLEKWDGAYYSEKL
FT                   KQQLFNLDDEKLKPYFQLEKVLDGAFTVAKKLYGLTFTEVFDIDKYHEEVTTYEVKDAN
FT                   DNLVSIFYADFFPRKGKRNGAWMTSFKSQYVKDGVNERPHISNVCNFTKPTETKPSLLT
FT                   FNEVTTLFHEFGHGLHGMLADTVYPSLSGTSVYWDFVELPSQIMENWCYEPEALALFAN
FT                   HYETGEIIPIEYVQKIKESASFQEGLATLRQLSFGLLDMAWHGQDPTNITDLKAFETEQ
FT                   FANTQLYPDVKENAMSTAFSHIFQGGYSSGYYSYKWAEVLDADAFEYFHENGIFNEEIA
FT                   KKFKDNVLSKGGTEHPMTLYKRFRGQEPKPEALLKRAGLL"
FT   gene            449872..450531
FT                   /locus_tag="Fjoh_0430"
FT   CDS_pept        449872..450531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0430"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03466"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMV0"
FT                   /protein_id="ABQ03466.1"
FT                   /translation="MKKYFKIAFYLAIIGLIAVVTVNYWVKSSTETKIYYSIKKLPKND
FT                   VGIIFGAGINGDQPSKYLKDRLDAGIMLWKAKRINKILLSGDNGRDEYDELTVMKNYCY
FT                   NQGVDTTKIFVDYAGFDTYSTMYRAKHIFKIKKATLISQEYHLNRAVYIGNKLEIKSVG
FT                   FSANNGEYLGYKYVTFREYLSVFKSFFDVLRNREPRFLGGEININGESNYSKEDKR"
FT   sig_peptide     449872..449952
FT                   /locus_tag="Fjoh_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.643) with cleavage site probability 0.418 at
FT                   residue 27"
FT   gene            complement(450568..450918)
FT                   /locus_tag="Fjoh_0431"
FT   CDS_pept        complement(450568..450918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0431"
FT                   /product="HicB family protein"
FT                   /note="PFAM: HicB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03467"
FT                   /db_xref="GOA:A5FMV1"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMV1"
FT                   /protein_id="ABQ03467.1"
FT                   /translation="MKNYLEYNGYIGTLEFSADDKIFFGKIQGINDLITFEGSSVTELE
FT                   ESFKEAVDDYLETCKVLNKVPDKTYKGSFNVRVSQELHQKIALLASKKGLNLNEIVKEA
FT                   LSYVVKHEEILS"
FT   gene            complement(450920..451162)
FT                   /locus_tag="Fjoh_0432"
FT   CDS_pept        complement(450920..451162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03468"
FT                   /db_xref="GOA:A5FMV2"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMV2"
FT                   /protein_id="ABQ03468.1"
FT                   /translation="MSKIDKLIERLKSKPKDFSWDEMLKVLNHFGYNQISQGKTGGSRR
FT                   KFVNENKVIISLHEPHPQKILKGYQLDIIIEHLEL"
FT   gene            complement(451357..452619)
FT                   /locus_tag="Fjoh_0433"
FT   CDS_pept        complement(451357..452619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0433"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03469"
FT                   /db_xref="GOA:A5FMV3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMV3"
FT                   /protein_id="ABQ03469.1"
FT                   /translation="MELYYTFSVLIVLASFFAYLNLRFLKLPGTIGIMIIAMLVSVGIR
FT                   LLGDSYFPATTRHFFDLIKEFDFNEILMGAMLNFLLFAGALHVNMADLKEQKVPIMIYS
FT                   TVSVVLSALIISMLLYYIAPFLGINIPYVFCLVFGTLISPTDPIVVLGVLKEAKVPKRI
FT                   ETKIVGESLFNDGVAVVMFAVVLKMATDPTFDVSFSSIAWLFAKEGIGGLLLGAVFGFT
FT                   ASKVMKKIDDYKVSVLITLSIVTGGFLVAQSLHVSSPLAMVVAGLIIGNYGKKVAMSEV
FT                   TKDYLGKFWELIDEILNAVLFLFIGFELLLLPDLNKQLLTGFVAIFIVLFSRLTSIVLP
FT                   WKFFDIFKFFGIKSAYNKGSLMVLVWGGIRGGVSIALVLSMPEGEYKNLLLEVTYIVVL
FT                   FSIVVQGLTVGKLAKRVLEKE"
FT   gene            complement(452822..454294)
FT                   /locus_tag="Fjoh_0434"
FT   CDS_pept        complement(452822..454294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03470"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMV4"
FT                   /protein_id="ABQ03470.1"
FT                   /translation="MKKKTIITTAVALTAAAGSLFFLNKEKIMDKTAYADNAAESCNCE
FT                   ASWFPHEQTPAPAEGDGSPFDSSSTTNCIFHQWSWQKFLWATKPLPSGNPLFLDSLDIV
FT                   TPEMERVSPQLGVKLVLTSIAQAGPAGVLVSNPKVVPGKTAGDTVFYSIHVNKILFDKA
FT                   IIAASEINSGKTPYSNLETFPVGSLELKVSWISTASIPKEKLGDYFITKAAVKNKAGQY
FT                   EAKSVALLGMHVVGVVKNHPEFIWATFEHKDMAPIYDWKNNSVTSKDEKLLYESGTDSG
FT                   LKSITWDRTNKKPLVPGKAFVLYEYGVPKVVETNAYMKTSQSEPVNFNNIDFINKCVAS
FT                   KLNDVFKNYFYNGSIWLDTDGMSPSDQAKAIVKRQISSVLPDSLARGSSNLANITMETY
FT                   TQTFKDSIHKINAGNLVNCFTCHQSQNFDKTRGIGKSPLYLSHIFESYLYTTKPKPVTG
FT                   KNTGNANLKVQRIEETESLKLKQFDEFVRNNK"
FT   sig_peptide     complement(454241..454294)
FT                   /locus_tag="Fjoh_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.715 at
FT                   residue 18"
FT   gene            complement(454436..454849)
FT                   /locus_tag="Fjoh_0435"
FT   CDS_pept        complement(454436..454849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03471"
FT                   /db_xref="InterPro:IPR014992"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMV5"
FT                   /protein_id="ABQ03471.1"
FT                   /translation="MSDLLAGAYLAKGTIGNVGTPGAPIASFSLVVVPSQNSVSGTVVI
FT                   TQAVHGPDSHIVVPVTGKIYATGFGQFTQVVSLKGQYVHTFPPPAIGAFLADFDAHLAI
FT                   DGSWNGTGGFSYYQHDIENVPVKAAANLQAELA"
FT   gene            complement(455167..455535)
FT                   /locus_tag="Fjoh_0436"
FT   CDS_pept        complement(455167..455535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03472"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMV6"
FT                   /protein_id="ABQ03472.1"
FT                   /translation="MLYTNNPEKGCYVVDNRSKYSEFEGTDQLQTCVVSGSKICWSILP
FT                   VDPQYSGKLIITSINVEFAYNDPPLPYDDNLNVWTGIAAVTLTLKSIPGNLTFSYNDSS
FT                   LSRTVVLPICVRPSTSGC"
FT   gene            complement(455758..456228)
FT                   /locus_tag="Fjoh_0437"
FT   CDS_pept        complement(455758..456228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03473"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMT9"
FT                   /protein_id="ABQ03473.1"
FT                   /translation="MNNRTNLAFSASSVIPARVINIAVDTVFLYSQTSGPYAGTGIYMM
FT                   DNNAVGGSTGEGGLELSSQVTAGFGIAFNVFPIDAAGQQGDTVQIVGLEISNGTNIFGN
FT                   WGWPAPQATGSYQWLGTAMVQGQCTYQIKIGVSVGGAPMQYYWWDPFLTCTA"
FT   gene            complement(456251..456667)
FT                   /locus_tag="Fjoh_0438"
FT   CDS_pept        complement(456251..456667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03474"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMU0"
FT                   /protein_id="ABQ03474.1"
FT                   /translation="MSIPTNQCTVFVQVWADVNSLKQGSTNGCYAVSNKSQQSTGEGSA
FT                   NLTTKVITGSNVCWSVLPIDPQFANEFAITQVGAQSGWATPPAPVPGSPNMFTGQLTTS
FT                   TVGGNVNSNIVFSYNGGGQSITVTLPVTIIPVTA"
FT   gene            456972..457475
FT                   /locus_tag="Fjoh_0439"
FT   CDS_pept        456972..457475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0439"
FT                   /product="transcriptional regulators-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03475"
FT                   /db_xref="GOA:A5FMU1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMU1"
FT                   /protein_id="ABQ03475.1"
FT                   /translation="MEFKEAKNKFVQTWGALGSQWGINKTMAQIHALLMVSNEPVSMEE
FT                   IMEELQISRGNASMNLRGLMDWGIVYKEFKAGERKEFFTAEKDLDELAVKISRERSKRE
FT                   IKPTLKILKEVSTIEPKDSAEEKHFVDQTEKLYDFVLKVDNMLDKVTEMNENWLGRMVI
FT                   KLLK"
FT   gene            457536..458273
FT                   /locus_tag="Fjoh_0440"
FT   CDS_pept        457536..458273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03476"
FT                   /db_xref="InterPro:IPR018644"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMU2"
FT                   /protein_id="ABQ03476.1"
FT                   /translation="MDFLKAEWKNLALFNYEVDREILEKYLPEGTEIDIWNNKCYVSLV
FT                   GFMFKNTKVLGIKVPFHVDFEEVNLRFYVKRFENGEWKRGVVFIKEIVPKKAITFIANT
FT                   LYQEHYETQKMRHEIIESNNTNTFIYQWKNDKEWNTIELETKNVLTQIETNSEAEFITE
FT                   HYFGYTKIDQETTFEYEVIHPRWEQYEVLNHRIDIDFEKNYGRDFGFLQTQKPTSVFLA
FT                   KGSKITVKNKRKLQVIPVLEEMY"
FT   gene            458294..458653
FT                   /locus_tag="Fjoh_0441"
FT   CDS_pept        458294..458653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03477"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMU3"
FT                   /protein_id="ABQ03477.1"
FT                   /translation="MNYNIIGYFIYLIITIFIILKVGKICYKNGNVFVLELIPNHADLC
FT                   QKINQVLLLAYYLLNIGYCAMTLISWQKIISSTQLIETICIKTAVIIFIISILHYLNIL
FT                   IITKYAQKLIHNNKN"
FT   gene            458659..459045
FT                   /locus_tag="Fjoh_0442"
FT   CDS_pept        458659..459045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03478"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMU4"
FT                   /protein_id="ABQ03478.1"
FT                   /translation="METTKILIGYGIYLPVALLLTYYVSKTLFKNGKIFMLDIFKGRED
FT                   IAQATNKLFETGFYLLNIGFALMILEMQLNRDSYQELIENLSYKIGGFSIYLGIMLFFN
FT                   LYFFFRGKRKAKEAQREERLVFKA"
FT   gene            459183..460088
FT                   /locus_tag="Fjoh_0443"
FT   CDS_pept        459183..460088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0443"
FT                   /product="domain of unknown function DUF1731"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; domain of
FT                   unknown function DUF1731"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03479"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMU5"
FT                   /protein_id="ABQ03479.1"
FT                   /translation="MKKLIIAAGTGFLGQVLVHHFKNKFDEIVILTRGKSQSINGIKYV
FT                   NWNAGTFSGWEKELENATVLINLAGKSVDCRYTKKNKKEILLSRIESTKILNKAVLNCQ
FT                   NPPRHWLNSSTATIYRYSLDKKMDEDDGEIGNDFSINVALSWEKAFFKTETPKTLKTAL
FT                   RTSIVLGKNGGALIPLKTLAKIGFGGKQGKGIQFVSWIHEDDFANAIDFIIEKEMTGVI
FT                   NIVSPKPIRNVDFMQKLRKAVGFPFGISMNNFFLEIGSFIIRTETELVLKSRNVVPKRL
FT                   LENEFQFKFDTLEKALQNLI"
FT   gene            complement(460244..461056)
FT                   /locus_tag="Fjoh_0444"
FT   CDS_pept        complement(460244..461056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03480"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMU6"
FT                   /protein_id="ABQ03480.1"
FT                   /translation="MKLLKQIFNFYLNSSIHVALSCYALVRITFHVFHIQYDAPMALFV
FT                   FFGTIVGYNFVKYDALVRVKKNPIGTQLKIIAVLSFISVILVGYYFFHLKRITQIVSVV
FT                   IFLITALYTLPFFPNRRNARNWAGVKIYIVALCWVGATLVLPLINAEIPFTTDFLIKCI
FT                   QRFVLVFVLILVFEIIDLANDDPHLQTVPQTIGVKKTKLLGFLLLIPFWFLEVFISTFN
FT                   YHDAIINLIMVIMLMLFIFFANSNRSKYYTSFWVESVPIFWWLMIVFL"
FT   gene            461280..464129
FT                   /locus_tag="Fjoh_0445"
FT   CDS_pept        461280..464129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0445"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: glycine dehydrogenase; PFAM: glycine
FT                   cleavage system P-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03481"
FT                   /db_xref="GOA:A5FMT0"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMT0"
FT                   /protein_id="ABQ03481.1"
FT                   /translation="MKTDAFALRHIGPRETDLQHMLQTIGVDSIEQLVYETLPDDIRLK
FT                   APLNLDPAMTEYEFANHIQELGKKNKVFKSYIGLGYHPTIVPAPIQRNIFENPGWYTAY
FT                   TPYQAEIAQGRLEAILNFQTTVIELTGMEIANASLLDEGTAAAEAMALLFDVRTRDQKK
FT                   NNTHKFFVSEEILPQTLSVLQTRSTPIGIELVVGNHETFDFSTEFFGAILQYPGKYGQV
FT                   NDYGAFVAKAKENEIKVAFAADILSLAALTSPGEMGAAVVVGTTQRFGVPMGYGGPHAA
FT                   YFATKDEYKRSMPGRIIGVSVDANGNRALRMALGTREQHIKREKATSNICTAQVLLAVM
FT                   AGMYAVYHGPKGLKYIANKVHASAVTTAEALNKLGVFQTNTAFFDTILVKADAQKVKAI
FT                   AEKNEVNFFYPDAESVSISLNETTSVSDINQIIAIFAEALGKEAVTVSELTTASQLPAS
FT                   LERTSSFLTHDVFNNHHSESQLMRYIKKLERKDLSLNHSMISLGSCTMKLNAASEMLPL
FT                   SMPNWNSIHPFAPVEQAEGYITMLKKLEQQLNVITGFAGTTLQPNSGAQGEYAGLMAIR
FT                   AYHLSRNEGHRNVCLIPSSAHGTNPASAAMAGMKIIVTKTTPEGNIDVEDLREKAIEHK
FT                   DDLSCLMVTYPSTHGVFESSIIEITKLIHENGGLVYMDGANMNAQVGLTNPATIGADVC
FT                   HLNLHKTFAIPHGGGGPGVGPICVNEKLVPFLPTNPILKVGGEQAITAISSAPYGSALV
FT                   CLISYGYITMMGAEGLKSATEHAILNANYMKSRFEGHYPILYTGECGRAAHEMILDCRA
FT                   FKENGIEVGDIAKRLMDYGFHAPTVSFPVAGTLMIEPTESEDLAELDRFCDALISIRKE
FT                   IEAATADDKNNVLKNAPHTLAMLTSDSWDFPYSREKAAYPLEYIADNKFWPSVRRVDDA
FT                   YGDRNLVCSCAPIEAYMEN"
FT   gene            464517..465575
FT                   /locus_tag="Fjoh_0446"
FT   CDS_pept        464517..465575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0446"
FT                   /product="Beta-ketoacyl-acyl-carrier-protein synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III C terminal domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03482"
FT                   /db_xref="GOA:A5FMT1"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMT1"
FT                   /protein_id="ABQ03482.1"
FT                   /translation="MKIKIIGIGSYIPNLEVKNTDFDKHVFLNEDGTPFGYPNEVVIKK
FT                   FKGITGIQNRRYAEPQYTASDLAFFAAQKAIANAGIDAETLDYIIFAHNFGDVKTATHQ
FT                   TDILPSLATRVKNKLGIKNPKCVAYDILFGCPGWIEGVLQANAFIKSGMAKRVMVIGAE
FT                   TLSRVVDDHDRDSMIYSDGAGVSILEASTDEAGLLSYESATYANDEANYLFFGKSYNPD
FT                   LDPDIKYIKMYGRKIYEFALSNVPCAMKSCLDKSGIAIDEVKKILIHQANEKMDEAIIE
FT                   RFYKLYDKTPPKDIMPMSIHDLGNSSVATVPTLFDLILQGKIENQEINKGDVIIFASVG
FT                   AGMNINAFVYRY"
FT   gene            465735..466262
FT                   /locus_tag="Fjoh_0447"
FT   CDS_pept        465735..466262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03483"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMT2"
FT                   /protein_id="ABQ03483.1"
FT                   /translation="MYEKTFPNKRFKLTLEFLQKHVNTSETIFDFGVPNPFSKIMEENG
FT                   YTVKNTKGEDLDNDHTALQTEEYTVFTAFEIFEHLLNPYTILENVKCDKLLISIPLRLW
FT                   FSPAYRSKTDMWDRHYHEFEDWQLDWLLEKTGWKITDRLQFTHPVKKLGIRPLLRYFTP
FT                   RYYIVAAEKVKN"
FT   gene            466351..467199
FT                   /locus_tag="Fjoh_0448"
FT   CDS_pept        466351..467199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0448"
FT                   /product="Candidate beta-glycosyltransferase;
FT                   Glycosyltransferase family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03484"
FT                   /db_xref="GOA:A5FMT3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMT3"
FT                   /protein_id="ABQ03484.1"
FT                   /translation="MKYYIVIPAHNEQDLIGLTLQSLVTQTVLPAKVVVVNDNSTDKTE
FT                   EVVLSFAKDNPYISVVNKTSDAIHLPGSKVIQAFQKGFETLGSDYDIIVKIDGDLIFPP
FT                   NYFETIIKHFESDPKIGMAGGFCYIDKNGEWVLENLTDKDHIRGALKAYRKETFQQIEG
FT                   LRPAMGWDTVDELLCKYYDWKIVTDESLHVKHLKPTGANYNKTARYKQGEAFYTLGYGF
FT                   WITAIASAKLAMMKKKPFLFLDYIKGFLKAKKAKTPLLVTPEQAKFIRNYRLKKMKEKL
FT                   F"
FT   gene            467279..468025
FT                   /locus_tag="Fjoh_0449"
FT   CDS_pept        467279..468025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0449"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03485"
FT                   /db_xref="GOA:A5FMT4"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMT4"
FT                   /protein_id="ABQ03485.1"
FT                   /translation="MMLIRYLSQIGKYFLMLKEIFNKQTKWPVMKNLIFKEIDDLIIDS
FT                   LGIVCFISFFIGGVVAIQTALNLTNPLIPKYLIGFATRQSVVLEFAPTFISVIMAGKMG
FT                   SYITSSIGTMRVTEQIDALEVMGVNSVNYLVFPKIIALLMYPFVIGISMFLGIFGGWLA
FT                   CAYGGFSTGADFIMGAQKDFIPFHITYAFIKTLIFAMLLATIPSFHGYYMKGGALEVGK
FT                   ASTTSFVWTSVTIILLNYILTQLLLG"
FT   gene            468025..468789
FT                   /locus_tag="Fjoh_0450"
FT   CDS_pept        468025..468789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0450"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03486"
FT                   /db_xref="GOA:A5FMT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMT5"
FT                   /protein_id="ABQ03486.1"
FT                   /translation="MIEVKNIEKSFGDSKVLKGVSTVFETGKTNLIIGQSGSGKTVLLK
FT                   TLLGIHTPDSGTIEFDGRVYSDLDKDEKRELRTEIGMVFQGSALFDSMTVEENVAFPLK
FT                   MFTKNNKAQIQERVDFVLERVNLIDAHKKLPSEISGGMQKRVAIARAIVNNPKYLFCDE
FT                   PNSGLDPNTSTLIDNLIQEITKEYNITTVINTHDMNSVMEIGENIVFLKKGLKAWQGTK
FT                   EEIFKTDNKDIVKFVYSSNLFKKVREAYLRGL"
FT   gene            complement(468887..469483)
FT                   /locus_tag="Fjoh_0451"
FT   CDS_pept        complement(468887..469483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03487"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMT6"
FT                   /protein_id="ABQ03487.1"
FT                   /translation="MSDTLAKYIPEHAVKPVFDLIVANQVHLKIVNERQTRHGDYRRGP
FT                   SGKHEITVNASLNKYRFMITLIHEIAHLVAFEKFGRNIKPHGNEWKFTFQRLMVPFIRP
FT                   EIFPSQILPLLARHFKNPSASSDTDTTLSLALKQFDTDNDKSYVFEIPFGSVFRIKNGK
FT                   VFKKLAVRTKRFECIEISSGKTYLFNPNAEVELMD"
FT   gene            complement(469496..469768)
FT                   /locus_tag="Fjoh_0452"
FT   CDS_pept        complement(469496..469768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03488"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMT7"
FT                   /protein_id="ABQ03488.1"
FT                   /translation="MSKQFLRSITSVGANFREAVNAQSKPDFIHKLSIAQKECDESMYW
FT                   LEILIATNYITNTEFESMHKQCEEALKIIKSIIITTKKKLITYNS"
FT   gene            complement(469892..470569)
FT                   /locus_tag="Fjoh_0453"
FT   CDS_pept        complement(469892..470569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0453"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03489"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMT8"
FT                   /protein_id="ABQ03489.1"
FT                   /translation="MKNIIVTGTSRGIGYELALQFANAGNQVLAISRKTPKSLLEHQNV
FT                   TCLAIDLADETALEEVEKFLSSSWKKVDALVHNAGTLLLKPFAETTQADFESIYKVNVF
FT                   AVANLTRICLPYLQKGSHVVTISSIGGVRGSLKFAGLAAYSSSKGAVITLTELLAEEYK
FT                   EQGISFNVLALGSVQTEMLNEAFPGYQAPISAEGMAAYIYDFTLNGNKYFNGKVLEVSS
FT                   TNP"
FT   gene            complement(470605..471582)
FT                   /locus_tag="Fjoh_0454"
FT   CDS_pept        complement(470605..471582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0454"
FT                   /product="peptidase family M28"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03490"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMS1"
FT                   /protein_id="ABQ03490.1"
FT                   /translation="MKKLYFLLPFVFLACKSGTSTVNEKESKTEAKPVEISYKVEESEV
FT                   SDFLKYLSSDELEGRDTGTKGIEKAAVFLEDFFKKNNVKPYFKTYRDTLTNFKLPAFNI
FT                   VGVLEGTDPVLKNEYVVLSAHYDHIGIEKKQQPDQIYNGANDDASGVTAVAQMAKYFSK
FT                   TKSNKRSILFVFFAGEEKGLLGSKSMVQKLKAQNFNLYTQLNIEMIGVPMKRDYLAYIT
FT                   GFDKSNMAEKINEYTGKKTIGFLPKEAEYKLFYRSDNYSFYDVFKKPCQSLSTFDFENF
FT                   DFYHHVSDEFKVMDIPHITNFIQELLPAVTKISTSPTQEIVMNK"
FT   gene            complement(471726..472868)
FT                   /locus_tag="Fjoh_0455"
FT   CDS_pept        complement(471726..472868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0455"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03491"
FT                   /db_xref="GOA:A5FMS2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMS2"
FT                   /protein_id="ABQ03491.1"
FT                   /translation="MDFNLTEEHLMIQQAARDFAQNELLPGVIERDEKQIFPTEQVKKM
FT                   GELGFMGMMVDPKYGGSGLDAISYVIAMEEISKIDASASVVMSVNNSLVCWGLQEFGTE
FT                   EQKQKYLPGLASGQIHGAFCLSEPEAGSDATSQKTTAIDMGDHYLVNGTKNWITNGNTA
FT                   SVYLVIAQTHPELKHKGINALIMTKDMPGFSVGPKEQKMGIRGSDTHSLMFTDVKVPKE
FT                   NRIGEDGFGFKFAMKTLAGGRIGIASQALGIASGAYELALKYSKERKAFGTEICNHQAI
FT                   AFKLADMAVNIEAARHLCMKAAWDKDNHKNYDVSGAMAKLFASQVAMDTAVEAVQIHGG
FT                   NGYVKEYHVERLMRDAKITQIYEGTSEIQKIVISRAVIAG"
FT   gene            473350..473925
FT                   /locus_tag="Fjoh_0456"
FT   CDS_pept        473350..473925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03492"
FT                   /db_xref="GOA:A5FMS3"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMS3"
FT                   /protein_id="ABQ03492.1"
FT                   /translation="MRKILLVLTLLLSLQFSEVSAQTHLEVNGVTVPRKIEFQGKTLQL
FT                   NGAGGRSKMWLEVYVQALYLSQLSQDPQFIIDSDTEMAIRIEITSSMVSSNKLTKAMNT
FT                   GFEKSAGSNLEELRPRIEQLKSYLSDAITEKDVFVLAYNPLDQNVYVSKNEILKGKIQG
FT                   FDFKKALFGIWLSDKPVDETLKKHLLGQ"
FT   sig_peptide     473350..473415
FT                   /locus_tag="Fjoh_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.637 at
FT                   residue 22"
FT   gene            474068..475294
FT                   /locus_tag="Fjoh_0457"
FT   CDS_pept        474068..475294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0457"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase, C terminal"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03493"
FT                   /db_xref="GOA:A5FMS4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMS4"
FT                   /protein_id="ABQ03493.1"
FT                   /translation="MKDLLQQFENKAPEIVFNWKDSETEAEGWTVINSLRGGAAGGGTR
FT                   MRKGLDMNEVLSLAKTMEVKFSVSGPAIGGAKSGINFDPNDPRKKGVLQRWYKAVSPLL
FT                   KSYYGTGGDLNVDEIHEVIPMTEECGVWHPQEGVFNGHFKPTEADKINRIGQLRQGVIK
FT                   VIENPKFSPDVTRKYTVADMITGFGVAEAVRHFYATYGGDIKGKKAIVQGFGNVGSAAA
FT                   FYLAEMGAKVIGIIDRDGGLIKEDGFSFEEIRTLFLNKDGNKLVAENMIPFEEINSKIW
FT                   TIGAEIFTPCAASRLVTQGQIDNLIANGLEVISCGANVPFADKEIFFGSIMEEVDRKVS
FT                   LIPDFISNCGMARVFAYFMEKKVQMTDEAIFNDTSETIKNAIVKAHALSSSKTNISATA
FT                   FEIALKQLV"
FT   gene            475622..476524
FT                   /locus_tag="Fjoh_0458"
FT   CDS_pept        475622..476524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03494"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMS5"
FT                   /protein_id="ABQ03494.1"
FT                   /translation="MSFTISSDKKKSLLFTTAIYAVIILLLFFIRFWPPYNPENNSALA
FT                   EGGGGGGVTVNFGDSDVGSGANYKSEVLDVKNNAKQAPAKATPDESILSQENAETDETD
FT                   VVIPTKEKPKKNTPVVKPETKVVPEKPKVSNSTNDALASIMKGSNKGGDGDDKAAGNKG
FT                   KSNGSLGSSGYYGSGGSGGGTGGGNGTGNGIGTGSGYGAGSGGGSGGGSGYSLGNRKAL
FT                   SKPAPKYTCNEEGKVVVEVTVDQNGKTISATPGIKGTTNTASCLLEQAKIAAMNTKWQS
FT                   DDNAPVKQVGKIIYNFSLN"
FT   gene            complement(476708..477040)
FT                   /locus_tag="Fjoh_0459"
FT   CDS_pept        complement(476708..477040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0459"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03495"
FT                   /db_xref="GOA:A5FMS6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMS6"
FT                   /protein_id="ABQ03495.1"
FT                   /translation="MFFLLLFFLIISTLANPNVIKMTLPKAKSNEKTNKQLISLSVTED
FT                   KQFYIDKQPVPFEELETTLMNKIGADKTQTVVVRIPFNLQVQDLVDVLQIGVKNNLKFV
FT                   IATSPK"
FT   sig_peptide     complement(476975..477040)
FT                   /locus_tag="Fjoh_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.686) with cleavage site probability 0.484 at
FT                   residue 22"
FT   gene            complement(477107..477799)
FT                   /locus_tag="Fjoh_0460"
FT   CDS_pept        complement(477107..477799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0460"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03496"
FT                   /db_xref="GOA:A5FMS7"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMS7"
FT                   /protein_id="ABQ03496.1"
FT                   /translation="MFSYIQLQADTLANASNVVIEKIAPETEISVLGFILKGGFFLIPI
FT                   ALLLFYTIYVIFERYLYIQKASRIDSRLMQDVGDKLHAGNIELARTIVERNDTAVGNIL
FT                   KEGVLVIGRPIAEIESNMDRAADIEIGEMERRLGHLGLIAGIAPTLGFIGTISGVIKIF
FT                   YSISVTENISIGNISGGLYEKMISSGSGLIVGIIAYSAYHLLNGKIDDFALKIQKQILE
FT                   FVNIIQRS"
FT   gene            477931..479157
FT                   /locus_tag="Fjoh_0461"
FT   CDS_pept        477931..479157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0461"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03497"
FT                   /db_xref="GOA:A5FMS8"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMS8"
FT                   /protein_id="ABQ03497.1"
FT                   /translation="MNYQETTNWMFNQLPMYQLQGASAYKEDLTNIKLLAEHLGNPEKK
FT                   LQTIHVAGTNGKGSTSHMLASVLQEAGYKVGLYTSPHLKDFRERIKINGQEITEDFVCE
FT                   FIAKHKDFFEANDMSFFEMSVGLAFDYFAAEKTDIAIIEVGLGGRLDATNIITPLVSVI
FT                   TNIGLDHTQFLGNTLEAIAGEKAGIIKPNVPVVIGEYTPETQPVFLAKAEANKAPIYFA
FT                   SDLISEVFPSDLIGDYQFHNKKTVQQTIKIVNETTDFKISDENLKSGLLNTVKNTGLQG
FT                   RWQQLGENPKIVCDTAHNKHGLSVVMNQLRNEKYEKLHIVLGVVNDKDLDSILPLFPKE
FT                   AQYYFCSPNSSRGLPTEVLQNAAKNFGLIGEKYDSVESAFAKAKQNASKNDFIYVGGST
FT                   FVVAELPLS"
FT   gene            479336..479413
FT                   /locus_tag="Fjoh_R0014"
FT                   /note="tRNA-Val1"
FT   tRNA            479336..479413
FT                   /locus_tag="Fjoh_R0014"
FT                   /product="tRNA-Val"
FT   gene            479795..480442
FT                   /locus_tag="Fjoh_0462"
FT   CDS_pept        479795..480442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0462"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03498"
FT                   /db_xref="GOA:A5FMS9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMS9"
FT                   /protein_id="ABQ03498.1"
FT                   /translation="MDRYKETFETWNKIASLYQDKFMDLDLYNDTYDFICSSIDTINPK
FT                   ILEIGCGPGNITKYLLSKRPDFDIFGIDIAPNMIELASKSNPKASFAVMDSRQIDEIKT
FT                   KYDGIVCGFCLPYLSPSDSRKLISNCYNLLNENGLIYMSFVEGDPNKSDFQAGSSGDRI
FT                   YFYFYTLDDLKTQFFENKFEEIQTFKVEYRKSETEVDIHTILTARKRHNITL"
FT   gene            480588..480947
FT                   /locus_tag="Fjoh_0463"
FT   CDS_pept        480588..480947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0463"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03499"
FT                   /db_xref="GOA:A5FMR1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMR1"
FT                   /protein_id="ABQ03499.1"
FT                   /translation="MKELTFASLQVKNLEASKDFYEKKLGFEVGNTNPQACIFKYDEGK
FT                   ASFAIRTPLEPLEDRELGIGVALWFAVNENVDELKEKYIENGITTAGPIIDTPFGRAFH
FT                   VKDLDGYKLTFLETK"
FT   gene            481038..481499
FT                   /locus_tag="Fjoh_0464"
FT   CDS_pept        481038..481499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0464"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03500"
FT                   /db_xref="GOA:A5FMR2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMR2"
FT                   /protein_id="ABQ03500.1"
FT                   /translation="MAKEINFHFKSPKDSPGYLLGQLTMLWQRKLKKVLDPLDLTQTQF
FT                   VLLAALGWLSKKSDSVTQIDIANQSNADRMMVSKVLRTLEEKGFITRHEHETDTRAKTI
FT                   RLTNTGETILQKGLIEVENADLDFFSSLDENLPLFNSNMANLIDRNKTE"
FT   gene            481635..482051
FT                   /locus_tag="Fjoh_0465"
FT   CDS_pept        481635..482051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0465"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03501"
FT                   /db_xref="GOA:A5FMR3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMR3"
FT                   /protein_id="ABQ03501.1"
FT                   /translation="MSTLSRPKHIGRNISRIRELRDMKQEALAQALGTSQQTISAIENS
FT                   ETIDDAKLEEVAKALGVTPEGIKNYSDENILSIINNTFNSHDSSTLNAVNFQPTFNPLD
FT                   KVVELYQEKEKLYERLIQTEKDKVEYLEKIVKGK"
FT   gene            complement(482105..482467)
FT                   /locus_tag="Fjoh_0466"
FT   CDS_pept        complement(482105..482467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0466"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03502"
FT                   /db_xref="GOA:A5FMR4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMR4"
FT                   /protein_id="ABQ03502.1"
FT                   /translation="MLINELSKRTGLSIHTIRYYENLGMIEGFTNEKVKSNNYKHYNDN
FT                   VIERLEIIIEAKEVGFTLAEIKKILTAWFESTDSKPETLELFKAKIKEIDNKIKYFKQT
FT                   RSLLEKVCEKLQNDEC"
FT   gene            complement(482563..484125)
FT                   /locus_tag="Fjoh_0467"
FT   CDS_pept        complement(482563..484125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0467"
FT                   /product="beta-lactamase; peptidase family S12"
FT                   /note="PFAM: beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03503"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR021860"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMR5"
FT                   /protein_id="ABQ03503.1"
FT                   /translation="MKKVNSFLVSVICICFSSATAFAQLTSQQIDVLMESALTKFKVAG
FT                   ASIAVVKDGKIIHLKGYGVGSVETKKAVNENTNFQIASNSKAFTTAALSILEDEGKIKW
FT                   TDKVRDYLPEFKMYNDYVTENFNIQDLLTHRSGLGLGVGDLMFFPDGSNFTIKDVLTSF
FT                   QYFKPVSAFRTKFDYDNLLYIVAGEVIARVSGMSYEEFVQKRIITPLQMNNTFVGSRLI
FT                   KDKSNFAVSHSSESGTIKTIDGFGDQMNAAAGGIFSNASDMAKWMIVRLNKGQYGEDPK
FT                   TTLFSLKNHKEMWRIHTVQESDENSRYNFHFNGYGLGWQVSDEKGNLKVSHTGGLPGML
FT                   SIVTMYPDLNLGIVVLTNTENGGAGLFSAVSNTISDSYLGLDDFGWTDKLVEWMKEDRN
FT                   TGDDVTKKVWEKVKLSKNVKIKNEDFIGVYADKWFGEIEVFEKNKQLWFKSYRSPKLNG
FT                   PMAFYNANTFAVKWEYQAMNCDALAMFSLDENGKAQSIKMKGISPNIDFSFDFQDLDLI
FT                   RVK"
FT   sig_peptide     complement(484054..484125)
FT                   /locus_tag="Fjoh_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            complement(484122..485492)
FT                   /locus_tag="Fjoh_0468"
FT   CDS_pept        complement(484122..485492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03504"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMR6"
FT                   /protein_id="ABQ03504.1"
FT                   /translation="MKNRFLLAFLFLTIFAFGQKTTFKIKYSEQLAVFVFLQNLSENYP
FT                   DNVFKTEFQKSKYNTDKYKNVISKFEQLRIDYSYRFEEFPYGSKKTMQTEDILKKNLIE
FT                   TGNLGSFKIRSVGIIPNKTLIDLAESISEFTPIYNELIYNPNKEKFEKQLEEITKYSNE
FT                   HQIENYFNTGLVFYNSSWDNAIPFEIAFYPLPNSKGFTAQAFCNNFISAIQTDLKSYKD
FT                   LFSVMLHETYHIIYDEQSLEVKTQIDTYFKENKSKCSNYAYQLMNEVLATALGNGYVYG
FT                   QLDGKMDTYDWYNKKYINLMAKQIYPLVKEYIDEKKPMDKNFIDNYIQAYEVNFPNWIN
FT                   ELDNIMTYRYVISENEKDFDVINKMFRYRSRTQYEDQITETSIEKMQETPLTKVIIISK
FT                   NNSQKLKLIKSKFMELKKWQFKADKEFAEKILLDDKSQLIVINQKESTIESLIKTIK"
FT   sig_peptide     complement(485436..485492)
FT                   /locus_tag="Fjoh_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.961 at
FT                   residue 19"
FT   gene            complement(485626..486960)
FT                   /locus_tag="Fjoh_0469"
FT   CDS_pept        complement(485626..486960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0469"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03505"
FT                   /db_xref="GOA:A5FMR7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMR7"
FT                   /protein_id="ABQ03505.1"
FT                   /translation="MFKTLQTYKLLFFRLLAIIAAIEISIYFFKINLFFTGIFGFFIVF
FT                   LLIREMYFYVRNFVLIYNKTIASILQDDFSSDFKKHKENSNYNDLFQLYDTLKNRQNEQ
FT                   ISKDIIYRSILNNIETGIIILQKHDNDWDIFLMNDYFSSHFNVPKVSKWKYLKNQLPSL
FT                   CEIIEVDDFHEIKTSVEISINEQNNQTFVLQASRTEIFERDYYIVLLDSIQNVVEKKEK
FT                   DAWVNLMKVISHELLNSITPIRSICQNLQDLVEQDSLSAEDLEDIKNSVETMLRRSDHL
FT                   QKFVEGYRKLAMLPSPKKEKTELKDLIDNCLQIMNPLFKKDGIEVENLISLKRLINVDA
FT                   QQTEQVIINLLTNSINALKNTSKKQILISAEAKENRIFIKITDNGNGIEKEIENKIFLP
FT                   FFTTRNEGAGIGLTLSKNIIEAHGGYISFKTENEKTVFEICLVEG"
FT   gene            complement(486962..488311)
FT                   /locus_tag="Fjoh_0470"
FT   CDS_pept        complement(486962..488311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0470"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03506"
FT                   /db_xref="GOA:A5FMR8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMR8"
FT                   /protein_id="ABQ03506.1"
FT                   /translation="MKKTNASILIIDDQEDILFASKVYLKKYFENIHTLNNPKKIVELL
FT                   SQNSIDVVLLDMNYRIGFEDGREGLYLLKEIKTLSPKTVVILMTAFGKVETAVEGLKAG
FT                   AFDYILKPWENKKLLESVKQAVDKSRKEQKKNKEIENENDFFVGTSEIIKKAYSLADKV
FT                   AKTDANVLILGENGTGKFVLAHHIYSQSERKNNPFIAVDLGSLNSNIFESELFGYAKGA
FT                   FTDAKIDTPGRFEMAQNGTIFLDEIGNVPLHLQSKLLQVIQTKTVTRLGETKARPLNVR
FT                   IITATNLNLKLEVADKNFREDLYYRINTMEIVLPPLRERNEDKIPLAEYLLEKMRDKYG
FT                   RGEITFDKKVLEQIENHAWNGNIREMENKIERAVILCENNKITVSDLDLEIITPYDENP
FT                   DDIQLSTVEKAAIEKALLKHNNNISKTAEELGLSRGSLYRRLEKYNININ"
FT   gene            488590..489300
FT                   /locus_tag="Fjoh_0471"
FT   CDS_pept        488590..489300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0471"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03507"
FT                   /db_xref="GOA:A5FMR9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMR9"
FT                   /protein_id="ABQ03507.1"
FT                   /translation="MITIKNLSKIFRTEEVETKALSEVSLTINEGDFVSIMGPSGSGKS
FT                   TLLNIIGLLDSATDGSYTLLDQEMVGLKENLKSKARKKNIGFIFQNFNLIDELSVYDNI
FT                   ELPLLYNKIHAFERKKKVEDIANILGISHRLKHFPQQLSGGQQQRVAVARALINNPKII
FT                   LADEPTGNLDSKNGNEVMELLTDLHASGSTILMVTHSDYDASFSQRTILMKDGVILSEK
FT                   LNHKNVDVLVTSKN"
FT   gene            489305..491728
FT                   /locus_tag="Fjoh_0472"
FT   CDS_pept        489305..491728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0472"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03508"
FT                   /db_xref="GOA:A5FMS0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMS0"
FT                   /protein_id="ABQ03508.1"
FT                   /translation="MLKNWINIFIYHIKNNKLFTALNVLGLSIGIAGLIFAILYWNDEQ
FT                   SYDQWNPNKDNIFLVANQMDATTYWASSSAPIGPAIKEINPEVASYCYLSGDYDNEIIR
FT                   FNNKKVQSDKIIAAQKNFFEYFPYSFIEGNSKTALPDINSICLSQDLAAQLFGNETALG
FT                   KQVVLKGKNLIVTGVYKLDKKSAYNPSCVVNFMDERLKGNAQAWGDFQFVLLLKLKNPS
FT                   EQKRVTQNLQKIYFENMTSRYAKNQGISPEEFIKKYGEVKPCLESLSSIRLHTKTGGLA
FT                   EPKGNYQFLLIMVGLSVLILILSIVNYVNSATANAVKRAKEVGVRKIIGASKTAIVKQF
FT                   IFETAVIALLSILISLVIVELSLPYYNAFLEKSLALQSSQFYLQLVVIFVITVILAGIF
FT                   PAVYVSNFESLKVLKGNFGRSKSGVWLRNGMLIFQFAVAAFFIVGSYVVYEQIDLMNSK
FT                   DLGFNGKQILNISYRNIYGEGITNKDRFERYTIIKNQLQHIKGVQQVSSAGFVLGNGAR
FT                   SVISYHYKDLNIDGSNMPIDFGLLEMMKIKIVKGRSFNPEFAQDTISSMLINETALKLL
FT                   NEKDPIGKKVHWNGLDAIIVGVVKDFNVGNPGEPIPPMSFFHFKTVPWFTANLNNIYIT
FT                   ADPKTMQQTIAGIENLWIKKVDPDYPFVYDFVDKQYKRSFSSYVKQKNLFSLLNIIVIT
FT                   IALLGLFALASYSIERRMKEIAIRKTLGAETNVLLKELCKQYILFSVVGFLIALFPAYY
FT                   LLNKWLENFSYRITISIYPFLIGFTALLILTLLVVLSRAYQATKVDVLKYLKYE"
FT   sig_peptide     489305..489418
FT                   /locus_tag="Fjoh_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.500 at
FT                   residue 38"
FT   gene            491775..494198
FT                   /locus_tag="Fjoh_0473"
FT   CDS_pept        491775..494198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0473"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03509"
FT                   /db_xref="GOA:A5FMQ2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMQ2"
FT                   /protein_id="ABQ03509.1"
FT                   /translation="MILNYINIFIYQLKHNKLFSTLNILGLSIGIAGLIFALLYWNDEH
FT                   SYNKWNPEKDNVYQVLVQLSDMPAVAENSVRLKAYLENDPNVENIVYADNWYKKDKITY
FT                   KGKKETVNKIINVESDFFSIFPFKIIHGNAASALKDGSSIAISEDISKRVFGNENPIGK
FT                   QINCLSAMFTVRAVYRVPDNSSIMPNVVVNNMKDLVDINKNRGLFVLKILLKIKDPSKI
FT                   DVTKRMLEKVYYDEIIVKSSKEAGMTPAEMEKKIGHFKIFLEPLSDARLHSIADGYPEG
FT                   RGNYQFLWIMAGLSVLILILSIVNYINMATANAIKRAKEVGVRKILGASKKDIVLQFIF
FT                   ETVLICSFSILLALVIVELTLPYYNNFLDKNLMIIGSQFYLQLILIFILTILTAGIFPA
FT                   LYVSNFETIKVLKGNFERSKNGIWLRNGMLIFQFAIAAFFIIGSNIVYEQIQYLTNKDL
FT                   GFKGSQVLAVSLNFPPSYYEGDEIGKKIFSRYTAIKEELSKIKGVDKVSTGLVSFDGND
FT                   TSLAPIWYKDELFKQKAIGLDYGMLDLMKIKIIKGRDFDKKIASDTTSSVLINETALKL
FT                   MNIKDPINTEIRIGNQPMKIIGIVKDFNLLSPESAVLPMTFYHIKSLDMAGEINTVYIK
FT                   LKSDNIQNTISSIEDFWKTKVDTEYPFQYDFVDKQYARTYETYTKQKNLFSLLNIVVIL
FT                   IALFGLFSLASYSIQRRMKEIAIRKTLGAETNTLLKELSKQYVFYCIIGFLTALFPVYY
FT                   FLKKWLDNFAFRIEISVFPFILGFTILMVLTLLIVLSRAYAAAKTDVLKYLKYE"
FT   gene            complement(494303..495043)
FT                   /locus_tag="Fjoh_0474"
FT   CDS_pept        complement(494303..495043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0474"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03510"
FT                   /db_xref="GOA:A5FMQ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMQ3"
FT                   /protein_id="ABQ03510.1"
FT                   /translation="MKSVLITGANRSIGLEITKQLSKQGLFVYLGSRDLEKGNEIVKEL
FT                   NKDGFQNIKAIQIDVTNPDSILAAKKIVENEQGKLDILINNAGISGGQFPQTASDTSVK
FT                   DIKNVFETNFFGVISVTQAFLELLKKSDSPRISNITSGLGSLTLHSDASWKYYDFKSAA
FT                   YGTSKTALNAYTIVLAYELKDLSFKVNAIDPGYTATDFNHYSGPGTVESAASFIIKHTL
FT                   TDENGPTGQFFSNDIEDETGVSPW"
FT   gene            complement(495122..495691)
FT                   /locus_tag="Fjoh_0475"
FT   CDS_pept        complement(495122..495691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0475"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03511"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMQ4"
FT                   /protein_id="ABQ03511.1"
FT                   /translation="MKEFIDYILQFGTLNQHQLDLIASKTTVLELQKDEYFSEAGKIAQ
FT                   QVGFVLEGITRVCYYNNKGEEITKYFIDENNLVVDMESFDNDICSNAYVQAITDCKLLV
FT                   FSKKDWKELLETIIGWDAIVHRIISKALRQKVERRSPLVSEDATTRYLMFLKIYPNVIN
FT                   RIPLSYVASYLGITQSSLSRIRKNIR"
FT   gene            complement(495761..496084)
FT                   /locus_tag="Fjoh_0476"
FT   CDS_pept        complement(495761..496084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03512"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMQ5"
FT                   /protein_id="ABQ03512.1"
FT                   /translation="MASINFEQLKERSLEIRKRYHELELSHHGSEWTIEEDALAFLTDA
FT                   GLIGRNVMSQQGRWPKGNTEQELKHKLGESIWWLTVLAERMNIDIEKATEDFLTSTENL
FT                   LGK"
FT   gene            complement(496088..497002)
FT                   /locus_tag="Fjoh_0477"
FT   CDS_pept        complement(496088..497002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0477"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03513"
FT                   /db_xref="GOA:A5FMQ6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMQ6"
FT                   /protein_id="ABQ03513.1"
FT                   /translation="MKNQPKIFHSISELHKAMGQPKPMHPLISILNYGEAVFDPKDFEN
FT                   GIILDFYKISFKTHFSGKLRYGHGFYDFEEGGMSFVSPGQILKMQEEEADYSGMSLNIH
FT                   PDFIRPYTLNANIKKYGFFSYTASEALYLSENEKETILGVFANIQNELKERIDTFSQDV
FT                   LISQIELLLNYSNRFYNRQFITRKAVNNDVLSKLEILLEDYFNNEKTLENGLPTVQFVA
FT                   DELGLSARYLSDLLRNLSGQNTQQFIHDKLIEKAKDYIMKGTFSMSEIAYKLGFEHPQS
FT                   FNKLFKKKTNLSPIAFQEQFNKN"
FT   gene            complement(497004..497309)
FT                   /locus_tag="Fjoh_0478"
FT   CDS_pept        complement(497004..497309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03514"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMQ7"
FT                   /protein_id="ABQ03514.1"
FT                   /translation="MKNQAIELTTFKLNGFTTQQFIEANKEIDEFLKRQKGFRSRTIFE
FT                   LKKGIVYDMLVWDSAAEGTDAMHKLMTELSDSVVHNMIDQSTVSWNIAPVEHFINL"
FT   gene            complement(497321..498127)
FT                   /locus_tag="Fjoh_0479"
FT   CDS_pept        complement(497321..498127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0479"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03515"
FT                   /db_xref="GOA:A5FMQ8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMQ8"
FT                   /protein_id="ABQ03515.1"
FT                   /translation="MQKTIFITGASTGLGKSTAKLFQSKGWQVIATMRNPEKETELTSL
FT                   ENVIVLPLDVTNSEQITETIKSITEKYSVDVVLNNAGYGLIGALESLSEIQIERQIVTN
FT                   LFGVIRISKAFTPHFREKKSGTFINVTSTFGLIGFPTCSIYSATKFGVDGFSESLASEL
FT                   TQFGIQVKVVAPGGMKTDFAIRSMEVGQHQAYEKLTAEVSKGYSAEQLENYTKAEDVAQ
FT                   IIYEAATDNKNQLRYVAGNDANALYNERLKNGAEAQVQNIKAMFTF"
FT   gene            complement(498232..498732)
FT                   /locus_tag="Fjoh_0480"
FT   CDS_pept        complement(498232..498732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0480"
FT                   /product="Deoxyinosine 3'endonuclease (endonuclease V)-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03516"
FT                   /db_xref="GOA:A5FMQ9"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMQ9"
FT                   /protein_id="ABQ03516.1"
FT                   /translation="MILAFDTYYFDNKAKTVCLEFENWNEDKNFKVHTEIIDNVSEYIP
FT                   GEFYKRELPCILSLLNQIDLKNIEAIIVDGFVYLDDDKKYGLGGHLYEKLNNEIPIIGV
FT                   AKTNFASIEKDKKALLRGDSAKPLFITSIGIDLEEAFQKVEIMAGEFRMPTLLKELDRL
FT                   TKE"
FT   gene            complement(498747..499310)
FT                   /locus_tag="Fjoh_0481"
FT   CDS_pept        complement(498747..499310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03517"
FT                   /db_xref="InterPro:IPR025352"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMR0"
FT                   /protein_id="ABQ03517.1"
FT                   /translation="MSQTNKLSSEQQESLLNVLEKRFENNKHRHQNIEWEKVLLKLKAN
FT                   PEKLWSLDEMERTEGEPDVVGFDEKTNEYIFYDCAAESPKGRRSICYDHEALEKRKENK
FT                   PKDSAINMAQEMGIQILNEEEYRNLQKLGKFDTKTSSWILTPVNIRKLGGAIFSDFRYD
FT                   TVFVYHNGADSYYAARGFRGSLKV"
FT   gene            complement(499366..499957)
FT                   /pseudo
FT                   /locus_tag="Fjoh_0482"
FT   gene            complement(500480..500585)
FT                   /locus_tag="Fjoh_R0015"
FT   rRNA            complement(500480..500585)
FT                   /locus_tag="Fjoh_R0015"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(500740..503605)
FT                   /locus_tag="Fjoh_R0016"
FT   rRNA            complement(500740..503605)
FT                   /locus_tag="Fjoh_R0016"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(503808..503884)
FT                   /locus_tag="Fjoh_R0017"
FT                   /note="tRNA-Ala6"
FT   tRNA            complement(503808..503884)
FT                   /locus_tag="Fjoh_R0017"
FT                   /product="tRNA-Ala"
FT   gene            complement(504025..504098)
FT                   /locus_tag="Fjoh_R0018"
FT                   /note="tRNA-Ile5"
FT   tRNA            complement(504025..504098)
FT                   /locus_tag="Fjoh_R0018"
FT                   /product="tRNA-Ile"
FT   gene            complement(504224..505730)
FT                   /locus_tag="Fjoh_R0019"
FT   rRNA            complement(504224..505730)
FT                   /locus_tag="Fjoh_R0019"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(506610..507731)
FT                   /locus_tag="Fjoh_0483"
FT   CDS_pept        complement(506610..507731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0483"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03518"
FT                   /db_xref="GOA:A5FMP7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMP7"
FT                   /protein_id="ABQ03518.1"
FT                   /translation="MMIVSVATGIGLQQKIREKVSAFNGQIIISNYDNNNSEITLIPIS
FT                   KKQDFYPKFKSVPEVSHIQAIASKAGIIRTENAFEGIVFKGVGADYNWNNIKEYLVEGR
FT                   LPDFSKSLNEEVIISRFLADRLNLKLGDSFNTFFVKEEQGKLPNIRRFKIAGIFSSGFQ
FT                   DFDASYIIGDIRHIQRINKWNADQIGAFEVFVKDFTQIKETGNHIYEQIPSNLDTKTIT
FT                   EKYNYIFDWLQLFDFNIVVILGIMILVATINMVVALLVLILERTQMIGILKALGADNWT
FT                   VRKVFLYNAFYLIVRGLFWGNLIGISLLLIQQQFGIVHLNPENYYVNQAPVYLNWTYIV
FT                   LLNLLTITVCFLVLLIPSYLITKISPVKAIRFD"
FT   gene            complement(507955..508449)
FT                   /locus_tag="Fjoh_0484"
FT   CDS_pept        complement(507955..508449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0484"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03519"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMP8"
FT                   /protein_id="ABQ03519.1"
FT                   /translation="MKQILNNLNKLAKDKHIENKKYFDKLKKKQPKNLDYVMQDLHDAE
FT                   FKKTDCLQCANCCKTTGPLFTLADIERISKSFRQKPQQFIEQYLRIDEDKDYVLKSVPC
FT                   TFLDSENYCMIYDVRPKACREFPHTDRKKFHQISDLTLKNVAICPAAYNIVEEMKKKLP
FT                   L"
FT   gene            508524..509231
FT                   /locus_tag="Fjoh_0485"
FT   CDS_pept        508524..509231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0485"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03520"
FT                   /db_xref="GOA:A5FMP9"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMP9"
FT                   /protein_id="ABQ03520.1"
FT                   /translation="MKDLFGKAMYDFQTNNSPEDIITETSISEEDEMSVEYLFRSYDEM
FT                   PKIEQKALQLATGKILDVGCGAGSHSLSLQNDRNLDVVSIDISEKAIETCRLRGLKNTQ
FT                   VQNVLDFEGEKFDTILLLMNGTGIFGKLENCNKYLSKLKSLLNPSGQILIDSSDIIYMF
FT                   DEDEDGGKWIPSETEYYGELTFTISYKGEKEETFDWLYLDYNTLQNAAIANGLKCELIM
FT                   EGEHYDYLAKLSI"
FT   gene            509246..509791
FT                   /locus_tag="Fjoh_0486"
FT   CDS_pept        509246..509791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03521"
FT                   /db_xref="InterPro:IPR023774"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMQ0"
FT                   /protein_id="ABQ03521.1"
FT                   /translation="MENLDLEKLKYPIGKFNAPNEYSSEYISDKIREIAALPEKLRNET
FT                   FDLNEEQLDTPYRPDGWTVRQVIHHCAESHMNCYIRLKWALTENNPIIKPYDEKLWSEM
FT                   PDSLSMPIAPTLSLLEGLHFRLSYIMKNLSENDLEKSFIHPENNSEYRIKQIIGMYAWH
FT                   GNHHLAHITNLKKHKNWK"
FT   gene            complement(509874..510506)
FT                   /locus_tag="Fjoh_0487"
FT   CDS_pept        complement(509874..510506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0487"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03522"
FT                   /db_xref="GOA:A5FMQ1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMQ1"
FT                   /protein_id="ABQ03522.1"
FT                   /translation="MLPKEIQLEVNKGAMLPLMEEFYTIQGEGFHTGTAAYFIRIGGCD
FT                   VGCHWCDVKESWNAELHPPTNIDIIVNNASSYANTVVVTGGEPLTWDMTLLTQQLKDKN
FT                   LKVHIETSGAYPLSGTWDWICLSPKKNKLPTPDVYANAHELKVIIYNKHDFIFAEEQAE
FT                   LVNDNAILFLQPEWSKKEEMTPLIVDYVMNNPKWRVSLQTHKYLNIP"
FT   gene            complement(510609..512279)
FT                   /locus_tag="Fjoh_0488"
FT   CDS_pept        complement(510609..512279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0488"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03523"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMN9"
FT                   /protein_id="ABQ03523.1"
FT                   /translation="MNKFKIFSLALVATASVAKAQDIKEAKKAIDAEQFQKAKSLLKSI
FT                   IKAKPSDGEANFVLGNVYLNQSVVDSAKIYFLNGIEASDKKNLNYIGLGQLDLDNKNVA
FT                   GAQANFALATKDIKRKDVDEFIYIGKAYMNSVHPDYNNAIASLKKALAIDPQNATALLA
FT                   IGDAYYGANNQNEAYKSYRDAFTADPTLLRAKMQLGVLLKGAKSYDEAIKAFNEVIALN
FT                   ASYGPVYRELAETYYKWGRNKPSTAKVNLQNAITNYEKYLSLTDYSLDSKMRHADFLIL
FT                   VKDYKSLETVANKMIAEDKVNPRIFRYLGYAAYENGNVDVAIKSLEDYIKNPSNKVIGS
FT                   DYMYLGLAKIKKGTNAEGAVDQASFDAGIANIKKAVELEPLVVEELGDYGKELFGKKQW
FT                   AQAAAIYELSSSNSESKNYLTDNVYYGISLYYANLDKKATTPEVAADLAKADAAFDRVL
FT                   VASPSYDEAYLYKGRIGNLLEKEDQIVKNYETYVANITAKGAEELAKPATVKKIVEAYN
FT                   SIGASYANTDKAKAIEYFNKTLVLDPTNAYASQSVKALK"
FT   sig_peptide     complement(512217..512279)
FT                   /locus_tag="Fjoh_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 21"
FT   gene            complement(512296..513219)
FT                   /locus_tag="Fjoh_0489"
FT   CDS_pept        complement(512296..513219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0489"
FT                   /product="ABC-type phosphate transport system periplasmic
FT                   component-like protein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03524"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMP0"
FT                   /protein_id="ABQ03524.1"
FT                   /translation="MLKYSKFLGLVIFVFLFAMCNQKSKSESNKETILKGALDVTVDET
FT                   VKPIVDDQVAVFEGTYYSAKITVIPKSEAELINDLLNQKAKVVVTARDLTTEEIARFEK
FT                   SKIKPRVTPFAKDAIAFISNKSNNDTLIALKTVIDFIQGKKDTGIKGLVFDNPNSSTVR
FT                   YMKELAKVKDLPTENVFSFKTNDEVIKFVSENNGMIGVVGVNWLSQPSPNMVDVVKKIN
FT                   VLSVKGLNDDKYYSPTQNDLAEVKYPLARDLFIINCQGYNGLGMGFGSFIAGDIGQRIV
FT                   LKSGLLPVRTPGRKLQIRNKLLKDNE"
FT   sig_peptide     complement(513139..513219)
FT                   /locus_tag="Fjoh_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.805) with cleavage site probability 0.310 at
FT                   residue 27"
FT   gene            complement(513449..514252)
FT                   /locus_tag="Fjoh_0490"
FT   CDS_pept        complement(513449..514252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0490"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03525"
FT                   /db_xref="GOA:A5FMP1"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMP1"
FT                   /protein_id="ABQ03525.1"
FT                   /translation="MKLDIIKNQWLDIVFEGRNKIYGAYELRKSNGKTTVKALILGSIF
FT                   FSFAIAAPLIASYLPDSTEEDTNTDIKIATVKLPPKPKEEIKPNQPPPPPPPPKVDQVK
FT                   FVKPVVAKANEVTEDPPKIEELKDKKVGSETIKGDPDAVLTVDEPVGKGPVSQVVEEDN
FT                   SVYNTAGIEVKPDFPGGMDKFYKFVGNNYKTPEEEGLKGKVYVTFVVEKDGSLTDIKVL
FT                   RDIGYGTGAEAIRVLKKCPKWTPGEQNGKKVRVLYSLPITIQSAE"
FT   gene            complement(514289..514843)
FT                   /locus_tag="Fjoh_0491"
FT   CDS_pept        complement(514289..514843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03526"
FT                   /db_xref="GOA:A5FMP2"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMP2"
FT                   /protein_id="ABQ03526.1"
FT                   /translation="MAELNTGDGGGGKGGKVRSKKQSSKVDLTAMVDLAFLLITFFMLT
FT                   TSLSKPQSMDLSLPDKDPKNDEKPVKVDENRTMTVMLGENNKLTYYMGLLESPIAGPKD
FT                   ISYGKDGIRRELLKRKKSVLEYSAGLGKPKNGIIVIIKPTKKSTYRNLVDMLDEMAITG
FT                   VDTYAIVPEFTPEETKLIDKK"
FT   gene            complement(514863..515489)
FT                   /locus_tag="Fjoh_0492"
FT   CDS_pept        complement(514863..515489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03527"
FT                   /db_xref="GOA:A5FMP3"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMP3"
FT                   /protein_id="ABQ03527.1"
FT                   /translation="MAKIKMKKKSTSTDMTAMCDVAFLLLTFFILTATAKVPEALPVDM
FT                   PSSTVQSKLPDSDLAIITIGQGKDGKSKVFFDIKGREIRKKTLEGMGAKFGVTFSEQDK
FT                   EKFALMDDFGVPITSLKQIIDMKAADRTKAEQPGIPIDSLDNQLKEWLLVSRRATIDLD
FT                   DKELQIAIKGDAKEQYPQIKKIMDILQDQKINSFNLVTGMRGKDF"
FT   sig_peptide     complement(515382..515489)
FT                   /locus_tag="Fjoh_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.990 at
FT                   residue 36"
FT   gene            complement(515545..516369)
FT                   /locus_tag="Fjoh_0493"
FT   CDS_pept        complement(515545..516369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0493"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03528"
FT                   /db_xref="GOA:A5FMP4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMP4"
FT                   /protein_id="ABQ03528.1"
FT                   /translation="MANVKVKKESTSNGGGMITGIIIVACILVGIVIWKFVMGSPANFE
FT                   GGNPETGHPINTLGMVYKGGFIVPALLGMFLMVVVFSIERFTVISKAAGKANLDKFMTS
FT                   VQGSIKEGNIEAAIAACDKQQGSVANAIKSALIKYQDVKKEGFNSEEASEVIHKEIEEA
FT                   TSLEMPMLEKNMTIISTLVSLGTLGGLLGTVSGMIKAFGALASAGTPDQAALATGISEA
FT                   LINTATGISTSVLAIISYNFFTAKIDDLTYSIDEAGTTIVNTYRRFRGSLRQ"
FT   gene            516749..518266
FT                   /locus_tag="Fjoh_0494"
FT   CDS_pept        516749..518266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0494"
FT                   /product="protein of unknown function DUF853, NPT hydrolase
FT                   putative"
FT                   /note="PFAM: protein of unknown function DUF853, NPT
FT                   hydrolase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03529"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMP5"
FT                   /protein_id="ABQ03529.1"
FT                   /translation="MNKKDNFIQDINNGYSAKGDSITLGGAILDGEAVAEAHVKIPLKT
FT                   LNRHGLIAGATGTGKTKTIQVFSEQLSNAGIPVLMMDIKGDFSGIAKEGKEEGFITERH
FT                   AKINLPYSVSAFPVELMSLSKQNGVRLRATVSEFGPVLFSRILDLNDTQAGVVAVIFKY
FT                   CDDKQMPLLDLKDIKKVINYITEEGKEEIAASYGKISTATTGTILRKIIELEQQGGDLF
FT                   FGELSFETDDLMRIDENGKGYVNIIRLTDIQDKPKLFSTFMLSLLAEIYQKMPEKGDAE
FT                   QPELVIFIDEAHLIFNEASKVLLEQIETIVKLIRSKGVGIYFVTQNPMDVPSGVLAQLG
FT                   LKIQHALRAFTANDRQAIKKTADNYPTSQYYKTDELLTSLGIGEALVTALNEKGIPTPL
FT                   VATMMRAPQSRMDILTPSEIDEINNKSKLVKKYVEEIDRESAFEILNKKIADANEAAAQ
FT                   REEQAPAKSSKAGPSTTEVVTKSVLKVVTSATFIRGVFGVLTKIFKK"
FT   gene            complement(518338..519678)
FT                   /locus_tag="Fjoh_0495"
FT   CDS_pept        complement(518338..519678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0495"
FT                   /product="Kynurenine 3-monooxygenase"
FT                   /EC_number="1.14.13.9"
FT                   /note="PFAM: monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03530"
FT                   /db_xref="GOA:A5FMP6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR027545"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMP6"
FT                   /protein_id="ABQ03530.1"
FT                   /translation="MQTSLKIAVVGSGLVGSLLAIYLKKAGHTVHVYDRSPDIRKINFS
FT                   GRSINLAMSNRGWKALDGVGVGDAVREIAIPMDKRAIHLVDKLNFQNYGQEGESIYSIS
FT                   RGTLNRKMIDLAENAGAEFYFEQKIWDVTLSDATLHIGESERGEWEERKYDMVFGADGA
FT                   FSRIRHRMQRQSMFNYSQEFLNMGYKELNIPANADRTHKLDKNSFHIWPRGEYMLIALP
FT                   NLDGSFTCTLFMPFEGENSFESLTDRKMVEDFFEKNFPDSIEVIPELANDFFKNPTSTL
FT                   VTMKCFPWTYEDKIALIGDACHAIVPFYGQGMNAGFEDITVLNEMIEKFGDDWKKIFTE
FT                   YQISRKPNADAIAELSYRNFMEMSTKTADEKFLLQKKIEKVFSDKHPDKWIPLYSRVTF
FT                   SDRPYAEALAIGDFQNGIMEEVLKLDNIENIWNTPEVENKILELLQK"
FT   gene            519902..520495
FT                   /locus_tag="Fjoh_0496"
FT   CDS_pept        519902..520495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0496"
FT                   /product="Acetyltransferase including N-acetylase of
FT                   ribosomal protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03531"
FT                   /db_xref="GOA:A5FMN1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMN1"
FT                   /protein_id="ABQ03531.1"
FT                   /translation="MNSEILQSEIIIENERALLIPFENERNIELKDIIFDDEIWKYMGM
FT                   YVRNDQDFENYIQNTLQQKANGICYPFLIIDKAVNRVAGSTRYGYLNHASQKCEIGWTW
FT                   YGKDFQGTGLNKACKYELLNFGFENIQFKRIQFSADLENLRSQRAIENLGALKEGLFRN
FT                   NYVDSEGNSKDDVYCSIILEEWQNTKRDYFGEFI"
FT   gene            520570..521361
FT                   /locus_tag="Fjoh_0497"
FT   CDS_pept        520570..521361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0497"
FT                   /product="helix-turn-helix-domain containing protein, AraC
FT                   type"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03532"
FT                   /db_xref="GOA:A5FMN2"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMN2"
FT                   /protein_id="ABQ03532.1"
FT                   /translation="MNLYLEHYVTQKTERFINKIWCLDNSIGESLIENKLVLPNGCFNL
FT                   AIVTGKAIEVHTSKNKYEMNEGVYFCSQMTNKVLVNIEPKTKVTIIQFHTWTLSMFPKY
FT                   DLSNFTDSIIKINPEELPFNLQIDSDIERLLQTINVYFEELSDLHSEKNTIEKICEIIK
FT                   NQEEISVADISKNLKLSQRLLQIKFKTATGLTIKKYIQILKFRKAVDQMVNADLEKLKL
FT                   TDVALYNKYFDQSHFIKKFKDVMKTTPKTFDPDSYFLSLKR"
FT   gene            521438..522946
FT                   /locus_tag="Fjoh_0498"
FT   CDS_pept        521438..522946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0498"
FT                   /product="beta-lactamase; peptidase family S12"
FT                   /note="PFAM: beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03533"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMN3"
FT                   /protein_id="ABQ03533.1"
FT                   /translation="MKINPSFFQLKVFLVGILFFQIQSGFSQEAKNSSLYKTIMSKDSL
FT                   LFDIGFNTCDIKQFENLYTKDFEFYHDKDSVSDKARFLKTLKNGICSPTRKYNYRRELI
FT                   DGSTEIYPLYKNGILYGAIQMGTHRFYESTADNTEQPGSFAKFTHLWLLKNKDWKLARS
FT                   LSYNHEITSSTAGKSNLFDNDQETEKWLKENNVPALGIGIIADGKLKQVKVFGELKKGV
FT                   SAPYNTIWNVASLTKPVTAITVLKLVSAGKWDLDEPLYKYWIDPDIAKDPYLKLLTTRI
FT                   VLSHQTGFPNWRSFNDSKKLDFKFKPGTQYQYSGEGYEYLRKALEKKFHKTLDQLASEL
FT                   IFEPLKMNDSQLIWNDKIDLSRYADGFDNKGNPYEPTKNKTVNAADDLLTTVEDYSKFL
FT                   CSVLNGDNLSKKVFDDMKSHQVSTKKNKYFGLGFEIYDLGNENYALSHGGADKGVQTIF
FT                   VLLPKTKQGLVIFTNVDDGYKVYENIVVHYLGENGQKIVDIETK"
FT   sig_peptide     521438..521521
FT                   /locus_tag="Fjoh_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.650) with cleavage site probability 0.561 at
FT                   residue 28"
FT   gene            522975..523451
FT                   /locus_tag="Fjoh_0499"
FT   CDS_pept        522975..523451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03534"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMN4"
FT                   /protein_id="ABQ03534.1"
FT                   /translation="MSNMINILVLFMLFLKRETIAQTNSEVLKLNLLKSEIIKMDSLLF
FT                   DVAFNQCDAGAFKKIIADDVEFYDDRSGLNISKANEIKSLEAKCARPEKLTRKLNSCVI
FT                   DKLGDFGAVQVGEHTFYSNGIPEGTGKFIHIWERKENEWKLKRIVSYEHRPYKK"
FT   gene            523678..525141
FT                   /locus_tag="Fjoh_0500"
FT   CDS_pept        523678..525141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0500"
FT                   /product="beta-lactamase peptidase family S12"
FT                   /note="PFAM: beta-lactamase; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03535"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMN5"
FT                   /protein_id="ABQ03535.1"
FT                   /translation="MKQSIKPIALCLMLFLFTAGIFAQNKAQQIEQLLAKYNEYGQFNG
FT                   SALVAENGKVILKKGFGLANMEWNIPNQPDTKFRLGSISKQFTALLIVKLAEEGKLKLD
FT                   VPITTYLPDYPKENGDKITIHNLLTHTSGIPNYTSAPNFLRDKAKNPYTPADFVKTFDK
FT                   LPLEFKPGEKFNYSNSGYFLLGYIIEKITGKTYEQYLQETILTPLKMVNSGYDHSDVIL
FT                   KNRAAGYEKEGKNFSNASYIDMSIPYAAGSLYSTVEDLYIWDQALYTNKLLSEKSMESL
FT                   FKPYIKSWGEESYGYGWSVKEINIGEKSKIKVIEHGGGINGFNTIISRIPADKILVVLL
FT                   NNTGGTVLGEMNNAIRNILYSQPFNQPKKSLALDLLDVFDTKGTAAGLDTYKKLKNDPT
FT                   YAIKEGDMNRVGYQLLQTGKKKEAIEVFKINVEAFPKSGNVYDSLGEAYLADGDKKLAI
FT                   ANYSKSVELDPTNEGGKKVLEELSKSKTK"
FT   sig_peptide     523678..523749
FT                   /locus_tag="Fjoh_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 24"
FT   gene            525290..525739
FT                   /locus_tag="Fjoh_0501"
FT   CDS_pept        525290..525739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03536"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMN6"
FT                   /protein_id="ABQ03536.1"
FT                   /translation="MKNSKKYSFLAVLFCLLISSKSVSQTNYTDVAMPSQQNKIIIDKI
FT                   VEAVHYKTYVIDFCLSKINEASAKEGWNEQKSMEIIQSVNYKNFKDAIYNSFVVFDEVE
FT                   LETLLNAYEKDPAYQTINVMTNNKVLINNLKIFASDIVKGKYVSK"
FT   sig_peptide     525290..525364
FT                   /locus_tag="Fjoh_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 25"
FT   gene            complement(525898..528285)
FT                   /locus_tag="Fjoh_0502"
FT   CDS_pept        complement(525898..528285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0502"
FT                   /product="peptidase S45, penicillin amidase"
FT                   /note="PFAM: peptidase S45, penicillin amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03537"
FT                   /db_xref="GOA:A5FMN7"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMN7"
FT                   /protein_id="ABQ03537.1"
FT                   /translation="MRRFKKFLLVLLVLIVVLAIALFAYIFHLKPKYEGELQLKNLEKE
FT                   TTVYFDEYGVPHIYADSEKDAMTALGYVHAQERLWQMELLRRIAPGKLSEIFGSVALKN
FT                   DKFFAGIGIEEASAKAIAKLDKNSESYKLTQAYLDGINQYLEEGTTPIEFTLVGVKKEK
FT                   FTIKDVYNIFGYMSFSFAMAQKTDPLLTDIKNKYGVEYLKDLGIEGEFNTTQIKSSKEN
FT                   IEDYAAVSKSITALLDKSPIPPFIGSNSWVAGPHKTKSGKVIFANDPHIGFSQPATWYE
FT                   AHIVTPKHELYGCYLAGTPFPLLAHNRDYAYGLTMFENDDIDFYQEKNKTGDSNQYQTP
FT                   EGFAKYEIRKKTIKIKDTSDVVLTVKSSRHGPIMNDLLDRLDRKNPIAMLWTYTNQPIQ
FT                   ILDAAYGLSHAKNRDEFKKSISLIAAPGLNVMYGDAKGNVGWWASGKLYKHDKGVNTHL
FT                   ILDGSSGKDDIKEYLDFSKNPSAENPEWGYVYSANNQPEAIDGFLYPGYYLPEDRAKRI
FT                   SGLMDAKSDWDKEAFSKMIYDNTSDVSVETVQNLILNIDLNALSASEKEAVNVLKSWKG
FT                   TNNLEDVAPTIYNKWVYLYLKNTFEDEMGEDNFNMFLGVSVGKQVVANQIKNENSVWWD
FT                   NIKTKNVKETRKDIVSKSFHEAVSDLQKQLGNTIADWKWGEVHTVEHEHPLGKVAALRG
FT                   LFNVGPFASPGSNEVINNLFFGFTNEGKYYVKGGPSTRRIVDFSDVENSWSILPTGQSG
FT                   NPFSKHYSDQAEMYNTGKFRKMKLNKDEIIKTSTKLVLKPKM"
FT   sig_peptide     complement(528211..528285)
FT                   /locus_tag="Fjoh_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 25"
FT   gene            528401..529957
FT                   /locus_tag="Fjoh_0503"
FT   CDS_pept        528401..529957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03538"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMN8"
FT                   /protein_id="ABQ03538.1"
FT                   /translation="MSIYKKIAIGIISLFLLVIFANFGLNYWIKKQLPIIVHEKNKTAY
FT                   NINYEKIEVSLFSRNIYAQTLLVSPKNQPKDSKNGLFSKIESITIKHFNIWDLAFRDII
FT                   QAESIIINKPRVILYKKGEKLINNSKSIKNEIFEPFRKIVAVSNIYLNDGTVDVVSLDT
FT                   QKPIFSIKKIILKLEGILLTDATLKEKIPLQYKSYALVIDSLFYRPSAFYHINIGKIST
FT                   EKNFLKINNFSNLPQFTRRDFVKRLEKEKDIYTLKFDSAQIAKMDWGFKNDRFFFKANS
FT                   LVINHFDANIYRSKVPKDDLSKKYLYNHLLRNIKFPLQIDTLQVLKSKLVYEEEIDFSK
FT                   GPGVLTFDKFNLQATNLRSGFGLKKTNDVKIKVKTIFMKTSPLDVDWSFNVLDKSDGFH
FT                   IQGVISNFDVRAMGQFSKPYMNASFTGVFHKYRFNFYGNDNVSKGNASLDYDDLKVKLY
FT                   KKKNPEKEAKLKSAIANLLVKNDSKDKPKTADVEIERIQEKSFYNFLWRSIAESLKKIL
FT                   I"
FT   sig_peptide     528401..528475
FT                   /locus_tag="Fjoh_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.415 at
FT                   residue 25"
FT   gene            530145..531953
FT                   /locus_tag="Fjoh_0504"
FT   CDS_pept        530145..531953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03539"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMM2"
FT                   /protein_id="ABQ03539.1"
FT                   /translation="MAKTPLHTFHIPVMGLAYTIDSPIRVAQYGISSVIALADDDLIEK
FT                   MRNFYSTKFNIPYEEITQKLHDYRAERITSYLNLVDKIVKEKFENFKTELAESKTALEN
FT                   FMSMLPNTSDIKKGFQNLLDDGIAFKENIQNYIETHLFPGEIDVNIMTKLDKDNFVKNE
FT                   QLPIEFNDAHAALRGFANSNLASSVVLSAGMNPRLFGYFENFKDFFPNENNELKKKIIL
FT                   KVSDFRSAMIQGNFLAKKGLWVSEYRIESGLNCGGHAFATDGLLLGTILEEFKQKKDQL
FT                   KQSAHDLMIKALQAKNQYFPENPLELKITVQGGVGTAEEHEFLLDEYQVDSVGWGSPFL
FT                   LVPEATSVDQETRNLLMKAKEDDFYLSNISPLGVPFNTLRGTTNEFLKQKRIHENKAGS
FT                   SCPKKFLALSKEYDPHGICTASKKYQDIKLEELEAKKDTLSVEEFEKSKIKITEKSCLC
FT                   VGLANASYLENDIKIKGQAQGVVICPGPNLAYFDQEVSLKEMIQHIYQGKSVVRTDRPN
FT                   LFVKELKMYVDYFRNEIETISGEVTAMQIKKWNSFKTNILEGIEFYQNLFSSTFYFKAD
FT                   ETKIKNQFDFYKTELNAIQIPTLELV"
FT   gene            complement(532013..532456)
FT                   /locus_tag="Fjoh_0505"
FT   CDS_pept        complement(532013..532456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0505"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03540"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMM3"
FT                   /protein_id="ABQ03540.1"
FT                   /translation="MKGLYILFAVILITSCQNQSKEDLNKAKQASIDSMKVEINKQRVI
FT                   DSMKTEMAKIKEEQRVESQKEKVVVVHQQAANGNTATTTTTTKKKGWSATAKGAVIGAG
FT                   VGAATGAIVSKKKGEGAIIGGLAGAALGTGTGAVIDSKNKKKE"
FT   gene            complement(532774..534051)
FT                   /locus_tag="Fjoh_0506"
FT   CDS_pept        complement(532774..534051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0506"
FT                   /product="kynureninase"
FT                   /note="TIGRFAM: kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03541"
FT                   /db_xref="GOA:A5FMM4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMM4"
FT                   /protein_id="ABQ03541.1"
FT                   /translation="MTFQNTREFAKQLDAQDALNHYQEQFIFPKVNDKRVIYFTGNSLG
FT                   LQPKRTKAYIDEVMNDWAELAVEGHFYAEKPWWDYQERFSEPLSKIVGALPSEVTVMNT
FT                   LTVNLHLLMVSFYQPKGKRYKIICEEKAFPSDQYMFQSQVHFHGYKPEDAIVEIKRREG
FT                   EHNIRLEDVLAKIEEVGDELALVLIGGVNYYTGQVFDIKTITAAGQKAGAKVGWDLAHA
FT                   AGNIKLELHDWNVDFAAWCSYKYMNSGPGNASGVFVHERHHNDPDLPRFAGWWGHNKER
FT                   RFKMEPNFDPVHGAGGWQISNLPVLSLAPYLASVEMFAEVGMDALIAKRDHITSYLEFI
FT                   LHEIDKEVESTFEIITPSNPEERASQLSVFLHGEGRSLFDYLMKNGVITDWREPNVIRL
FT                   APVPLYCSYEDMYDFGQILKKGILGK"
FT   gene            complement(534364..535413)
FT                   /locus_tag="Fjoh_0507"
FT   CDS_pept        complement(534364..535413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0507"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03542"
FT                   /db_xref="GOA:A5FMM5"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMM5"
FT                   /protein_id="ABQ03542.1"
FT                   /translation="MKLSHFNFNLPKELLAEFPAENRDESRLMVIDRQKNTIEHKMFKD
FT                   VINYFDDGDVLILNNTKVFPARLYGNKEKTGARIEVFLLRELNSEQRLWDVLVDPARKI
FT                   RIGNKLYFGDDDSLVAEVIDNTTSRGRTLRFLYDGSYEEFRNKLTELGETPIPKYINRD
FT                   VTPEDAERYQTIYAKEEGAVAAPTAGLHFSKHLLKKLEIKGVNFAEVTLHVGLGTFNPV
FT                   EVEDLSKHKMDSEELIITQEACDIVNEGKAKKKRICAVGTTSMRAIESSVSSANTLNPY
FT                   EGWTNKFIFPPHDFSIANCMITNFHTPKSTLLMMISAFCGHDLMKKAYEEAIKEGYKFY
FT                   SYGDAMLIL"
FT   gene            complement(535823..537052)
FT                   /locus_tag="Fjoh_0508"
FT   CDS_pept        complement(535823..537052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0508"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="PFAM: EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03543"
FT                   /db_xref="GOA:A5FMM6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMM6"
FT                   /protein_id="ABQ03543.1"
FT                   /translation="MNLKLTTNSPFTIDDSQLNITGSKSETNRLLLLKALFPNITLANT
FT                   SNSDDSEVMQKALTGNDEIVDIHHAGTAMRFLTAYFAVNEGREVVMTGSSRMQERPIKI
FT                   LVDTLRQLGVEISYEKEEGYPPIRIKGKKVTASKVTLAANVSSQYISALLLVASKLENG
FT                   LELTLEGEITSIPYIKMTLALLKDLDIKTSFEGNVIKVFPKESVESKEMVVESDWSSAS
FT                   YFFSLTALADAAKITLSSYKENSLQGDSELISLYEKMGVKTTFQGNKMTLEKVAGFNYQ
FT                   DVNFELNNTPDIAQTIVVTCLGLGIGCHLTGLHTLKIKETDRLEALKTELTKLGANISV
FT                   TNDSLTLVKSDTINHDVKIGTYNDHRMAMAFAPLAIKVPIIIEDAGVVSKSYPDFWNDL
FT                   KALNFQISEL"
FT   gene            complement(537187..537513)
FT                   /locus_tag="Fjoh_0509"
FT   CDS_pept        complement(537187..537513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0509"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03544"
FT                   /db_xref="GOA:A5FMM7"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR012359"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMM7"
FT                   /protein_id="ABQ03544.1"
FT                   /translation="MDLKNAQLDVDTWIKEHGVRYFNELTNMAQLTEEVGEVARIIARR
FT                   YGEQSEKESDKNKDLGEELADVVFVVLCLANQTGIDLQAAFDKKMDLKSVRDKDRHKNN
FT                   DKLK"
FT   gene            complement(537554..539575)
FT                   /locus_tag="Fjoh_0510"
FT   CDS_pept        complement(537554..539575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03545"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMM8"
FT                   /protein_id="ABQ03545.1"
FT                   /translation="MKITRLFIFLFLLFSASKIEAQEFKLGKVSIAELEQKVHPKDSSA
FT                   AAAILYKRGKSRIEYNDSDGFFLLTEVETRIKIYKKEGYDWANQSVTYYSVKNESRETV
FT                   SISDVVTYNLVNGKIEKTKLKSDGEFNEEVNKYRSRKKISMPNVKEGSVLEFKYTVRTL
FT                   NISMMRDWKFQSSIPVDYSEYTTYIPEYYTFNSMQKGYVFPKVATVKNSKSITSLNRER
FT                   TLGPGHVSKTTFSADKVDYMETQTSYLAENIPALKDELYVNNIDNYTASVEHELSIVKP
FT                   FNQPLKMYSADWNSVVKTIYDYDDFGPELNKTGYFENDLKTVLAGLNTAEEKIPAILSY
FT                   VKSKVKWDEYYGYSCDKGVRKAYQEGTGNVAEINLMLTAMLRYAGLTANPVLLSTRSNG
FT                   IPLFPNRTAFNYVVAAVETSTGNVLLDGTDRFSTPNILPLRTLNWNGRLIRKDGSSEEV
FT                   NLMPQKVSADNIFMNYTIAADGKVTGKTRRQYTDYNALVTRGNISGFKEEEYLEKLENQ
FT                   YNKIEINEYSKANEKDFLQPIIETYSFSGNNLCELIGEKIYISPMLFFTENKNPFTQEV
FT                   REYPVDFSYPFADKYNITIQIPDGFTVETLPAPAAVTMEDNLGTFKFNIASNGNTLQLA
FT                   ILHQINQAIVSAEKYDMLKEYYKAMIAKETEKIVLKKI"
FT   sig_peptide     complement(539510..539575)
FT                   /locus_tag="Fjoh_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.995 at
FT                   residue 22"
FT   gene            complement(539597..541504)
FT                   /locus_tag="Fjoh_0511"
FT   CDS_pept        complement(539597..541504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03546"
FT                   /db_xref="InterPro:IPR024544"
FT                   /db_xref="InterPro:IPR024618"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMM9"
FT                   /protein_id="ABQ03546.1"
FT                   /translation="MKSPFFALFFSLITYVSNAQKGEYSALSISDSLKDNANAVVRLDQ
FT                   MDISISSQRSMNIKTHRVVTVFNQNGLEHIEAYQHYDKSTTLKNIEAVVYDLLGNEIKK
FT                   IKRKDFKDESAVSGSTLFSDNRILYLDYTPISYPFTIVYNSEIESSNTAFIPRWYFLGD
FT                   YNVSIQKSILNISFPNDLGFKKKEFQFSDFNIKKTIDTDTKLSYTASNIQARKLEDYSP
FT                   SAGDLFPKVMMGLEKFHLEGVDGTATTWEAFGKWYGDKILSGTTVLPEETKERIKTLVG
FT                   DEKDPIKKARIIYDYVQKKSRYVNIAIGIGGWKPMLASDVDRLGYGDCKALTNYTKALL
FT                   QVVDVPSYNTILYGGRYKSNIQSDFVSMQGNHMILAVPNENNYIWLECTSQDDPFGYQG
FT                   TFTDDRDVLVVKPEGGEIVRTKIYEDKENTQNGKGNYTIDENGNFSGTISIASQGSQYS
FT                   SKANLENILPTEKEAHYKSYWSNINNIKLGKISFVNDKENVKFLEDVQLTALNYGLISG
FT                   NKMIFTVDAFNQNSENVKRIRNRKTPFQIQRGYFDTDEIEINLPAGFSIEFLPQNVELK
FT                   GKFGEYKTEIIKKDNNKLTYKRSMFLSKGKYSNKEYDEYRLFIEQISKNDNSKIILTKN
FT                   "
FT   sig_peptide     complement(541439..541504)
FT                   /locus_tag="Fjoh_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.706 at
FT                   residue 22"
FT   gene            complement(541558..542010)
FT                   /locus_tag="Fjoh_0512"
FT   CDS_pept        complement(541558..542010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0512"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03547"
FT                   /db_xref="GOA:A5FMN0"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMN0"
FT                   /protein_id="ABQ03547.1"
FT                   /translation="MRVIIQRVSQASVTVEGQKTADIQKGLLVLVGIEDADTQEDIDWL
FT                   TGKIIKMRIFGDENDVMNCSVQDVDGDIIVVSQFTLHASTKKGNRPSYIKAAKPDFAIP
FT                   MYENFVKSLEKEFGKKIQTGIFGADMKVNLLNDGPVTIVMDSKNRE"
FT   gene            complement(542104..543081)
FT                   /locus_tag="Fjoh_0513"
FT   CDS_pept        complement(542104..543081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0513"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03548"
FT                   /db_xref="GOA:A5FML2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="InterPro:IPR031944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FML2"
FT                   /protein_id="ABQ03548.1"
FT                   /translation="MTGTVYKSTGSWYTVKSEKGDFVECRMKGKFRIKGIKSTNPIAVG
FT                   DIVDYELDETSDAVTGTIHTIHERKNYIVRKSVNLSKQIHIIASNIDQVFLLVTIDNPP
FT                   TTTSFIDRFLVTAEAYGIEAILIFNKIDTLNEQTLDDQLYLQHIYTEIGYKCLRISSTE
FT                   NKGVDKLKEMMVGKVSMFSGHSGVGKSTLVNAMEPSLHLKTSVISEQSKQGQHTTTFAE
FT                   MYDLSFDARIIDTPGIKGFGIVDMEPTEISGYFPEFFKLKDQCKFNNCLHKEEPHCAIK
FT                   AALEKDEIAWSRYNSYLKILEGDEEHYRTDIYGEDRAASDETRK"
FT   gene            complement(543342..544424)
FT                   /locus_tag="Fjoh_0514"
FT   CDS_pept        complement(543342..544424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0514"
FT                   /product="DAHP synthetase I/KDSA"
FT                   /note="PFAM: Chorismate mutase; DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03549"
FT                   /db_xref="GOA:A5FML3"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A5FML3"
FT                   /protein_id="ABQ03549.1"
FT                   /translation="MENKKEMRKWLEDFNLNHPLVIAGPCSAETEDQVLKIAHELKDSK
FT                   VSVFRAGIWKPRTRPGGFEGVGEIGLKWLQKAKAETGLLMGTEVATAAHCKLALEHDID
FT                   VLWVGARTTANPFAVQEIADTLKGTDKIVLVKNPVNPDLALWLGGVERLHMAGIEKLGV
FT                   IHRGFSTYEKTKYRNIPEWQIAIELQNKFPDLPLIIDPSHITGDRKMIFEVTQEALDLN
FT                   YDGMIIETHIDPDNAWSDAAQQVTPDALKQIIKDLTIRKTDDTTDEYSQKMTKLRANID
FT                   VLDTNLLELLGKRMKVADEIGQVKKDANVAILQNNRWNEILGKMILEGEKKGLTEEFVL
FT                   RMFKAIHQESIGHQEKIFNA"
FT   gene            complement(544438..545292)
FT                   /locus_tag="Fjoh_0515"
FT   CDS_pept        complement(544438..545292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0515"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03550"
FT                   /db_xref="GOA:A5FML4"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FML4"
FT                   /protein_id="ABQ03550.1"
FT                   /translation="MKVYVIGIGLIGGSMVLDIKDQHPDSTILGIDNNEKHLQEAIDLG
FT                   VVDQAGSFEDLAEADFVIVSVPVDVALTVLPKVLDLVGDKTIVFEVGSTKKPICEAVAS
FT                   HPKRRNFIATHPIAGTEFSGPSAAIRGLFKGKTNIICEVEKTTFKLQEKALKLFSEIGM
FT                   RIRYMDPVSHDKHIAYVSHLSHISSFMLGKTVMNKEKDEQDIFDMAGSGFESTVRLAKS
FT                   SPAMWTPIFKQNKEHVLETLEAYISNLSRFRDLLKEEDYNAIFEEMESTNKIKEILNGL
FT                   IKK"
FT   gene            complement(545428..546573)
FT                   /locus_tag="Fjoh_0516"
FT   CDS_pept        complement(545428..546573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0516"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03551"
FT                   /db_xref="GOA:A5FML5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5FML5"
FT                   /protein_id="ABQ03551.1"
FT                   /translation="MITTAKRLDTVEEYYFSSKLREVRQLMSEGKSIINMGIGSPDLSP
FT                   SKAVIEAVAAAIQDENGHGYQSYQGLPEMRQAMADFYRDQFGVEVNPNNEILPLMGSKE
FT                   GIMHISLAFLNEGDHVLIPNPGYPTYTSVTNLVQAVPVYYDLKEENGWEPDFEALEKLD
FT                   LSKVKIMWLGYPHMPTGARGSLALFEKLVAFAKKHNILLINDNPYSFVLNDNPMSLLQV
FT                   EGAKDVALELNSLSKTFNMAGWRVGMVLGNPEIIDAVLKVKSNMDSGMYYGIQKGAIAA
FT                   LKCDKSWFEDQNKIYRRRRELTEKLAEKLNCKVSKEGVGLFVWAKLPEGIESAEKFIDE
FT                   ILYEKHIFITPGTIFGSNGEGYIRFSLCVKEEKVQEAIDRF"
FT   gene            complement(546662..547489)
FT                   /locus_tag="Fjoh_0517"
FT   CDS_pept        complement(546662..547489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0517"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03552"
FT                   /db_xref="GOA:A5FML6"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A5FML6"
FT                   /protein_id="ABQ03552.1"
FT                   /translation="MTTKIAIQGIKGSFHHQVVKEYFSENVDIDECLSFEELIDSLIAG
FT                   KSDQAVMAIENSIAGPIIPNYALIDKNNLHIIGEHYLNIQQNLMALKGQKIEDIKEVHS
FT                   HPMALLQCMDFLKQYPNIKLIEDKDTAETARRIQEKQLTGIAAIASVTASEMYDLDIIA
FT                   SSIQTIKNNMTRFVIIKKQNSFLPESEINRASIKFELDHKRGSLAAVLNVMSDCKLNLT
FT                   KIQSLPKIETPWKYSFFVDVTFEKYEDFAKAKALLNIMAEYFKVLGEYKNTRP"
FT   gene            complement(547962..549128)
FT                   /locus_tag="Fjoh_0518"
FT   CDS_pept        complement(547962..549128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0518"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="PFAM: protein of unknown function DUF1501"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03553"
FT                   /db_xref="GOA:A5FML7"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A5FML7"
FT                   /protein_id="ABQ03553.1"
FT                   /translation="MNRRNFLTLTGTFTGGLLVLPDFLHAFGSQNNLVVGEQCVVFIQL
FT                   NGGNDGLNTFIPYDDPLYYDLRTKIALNKDLVVGKNKGMAFHPSLKDFAQMQQNGDLTV
FT                   IQNVGYPEPIRSHFRSQEIWQTATDSNKYMNEGWLGRFLDLQCNGHQATAGINLDSIDN
FT                   LALKGVEPNFITIKDPDRFKVKSKEENVTLSQNPHLDFVRKIANSVTEGSDEIQKALAK
FT                   SKTEISYPKTELSKNLEWIARLIKGNLNSKVYYTSLNGFDTHDNQLAIHERKLTDLNDS
FT                   LYSFYSDLKQSQLLQNVTVVVFSEFGRRVKDNGNGTDHGTAAPMFIIGGNNKGTILGKN
FT                   PNLADLDNGDLKYEIDFRSVYASLLKEKMNFDYSKIGIANKPVSGLFG"
FT   sig_peptide     complement(549048..549128)
FT                   /locus_tag="Fjoh_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.729) with cleavage site probability 0.399 at
FT                   residue 27"
FT   gene            complement(549141..550538)
FT                   /locus_tag="Fjoh_0519"
FT   CDS_pept        complement(549141..550538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0519"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03554"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:A5FML8"
FT                   /protein_id="ABQ03554.1"
FT                   /translation="MKKSSLWSLRLGFSGKQTSKIEKLGLEKFLKQSYNSKFDTTLPDF
FT                   LQDQPKTTLELKQVREIIKTSEPEVKKEIQKKENQATAEFKKWWIAKMRTDELPLRENM
FT                   VCFWHNHFVSTSQKVKINYWIYQHNMILRENAFGNFKELTKQILKSNAMVRYLDNGDNK
FT                   KGKVNENLSRELLELFTIGIGNYTEDDIKNGAKALAGLNVGDEGAVYRKNIEDNSDKIY
FT                   FGKTGNWKADDLVDIIFEQKNIPYLITRKILKWFIYDNPPEDLVVYYGDYFRKQKFEIE
FT                   PLLTKIFTEEFKKENSGNKIKNPLVYILQLCDELQLENVNDAAIMAFIKQQGMDLYNQV
FT                   NVKGWDGGNSWLTSQIYLQRNNTADLLCSGKSLNRKVLKTMMNGVEKEKSEYEKTAVKV
FT                   NFDSEGNNKTIISELSDRLLFVVSDSAQKDMENLLKYDFDPKDPHADFAVVRLFNYITK
FT                   LPEYQLI"
FT   gene            550799..551365
FT                   /locus_tag="Fjoh_0520"
FT   CDS_pept        550799..551365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03555"
FT                   /db_xref="UniProtKB/TrEMBL:A5FML9"
FT                   /protein_id="ABQ03555.1"
FT                   /translation="MNITKLWKMNIYKIGSDYENYRFLLPHNDDGLVSTDGTSLIKEWK
FT                   PCDYTLFKDPRKKTDKRKTDFKASCYYPGVLIIEKSCKDIFTKLSENSIEYLEINTPEL
FT                   INFFYVANIIKSVNTIEYEGLSQENLINSFKNGTIRFKLENIGNKDFFRDKKFSSFYFC
FT                   TQKFINTINEANITGLRFTIAGIAL"
FT   gene            complement(551635..554028)
FT                   /locus_tag="Fjoh_0521"
FT   CDS_pept        complement(551635..554028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0521"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase, alpha
FT                   subunit; PFAM: ribonucleotide reductase large subunit;
FT                   ATP-cone domain protein; Ribonucleotide reductase large
FT                   subunit, N terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03556"
FT                   /db_xref="GOA:A5FMM0"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMM0"
FT                   /protein_id="ABQ03556.1"
FT                   /translation="MYVVKRDGHREPVMFDKITERIKKLCYGLNELVDPVKVAMRVIEG
FT                   LYDGVSTSELDNLAAETAASMTIAHPDYAQLAARVAISNLHSNTKKSFSETMKDMYNYV
FT                   NPRNGQDAPLIADDVYKVIQENAAFLDSHIIYTRDFNYDYFGFKTLERSYLLKINGKIV
FT                   ERPQHMLMRVSVGIHLDDLKSVIETYDLMSKKFFTHATPTLFNAGTPKPQMSSCFLLAM
FT                   QDDSIDGIYDTLKQTAKISQSAGGIGLSIHNVRATGSYIRGTNGTSNGIVPMLRVFNDT
FT                   ARYVDQGGGKRKGSFAIYIETWHADIFDFLDLKKNTGKEEMRARDLFFAMWTSDLFMKR
FT                   VQEDSTWTLMCPNECPGLYDVYGDEFEALYTDYEFRGKGRKTIRARELWEKILESQIET
FT                   GTPYMLYKDAANRKSNHKNLGTIRSSNLCTEIMEFTSKDEIAVCNLASISLPMFIDNGE
FT                   FDHQALYNVTKRVTRNLNKVIDRNYYPVKEAENSNMRHRPVGLGVQGLADAFIMLRMPF
FT                   TSDEAKKLNQEIFETLYFAAVTASMEMAKEEGPYSTFEGSPMSQGEFQYNMWGMKDEEL
FT                   SGRWDWASLRKEVVEHGVRNSLLVAPMPTASTSQILGNNEAFEPYTSNIYTRRVLSGEF
FT                   IVVNKHLLEDLVKLGLWNEDLKQEIMRHNGSVQNIDKIPQDLKDLYKTVWEMSMKDIID
FT                   MSRQRGYFIDQSQSLNLFMQDANYSKLTSMHFYAWQSGLKTGMYYLRTKAAVDAIKFTL
FT                   NNDKKEETAPSLVQETEAISVEDYKAMLLKAQAADPEDCEMCGS"
FT   gene            complement(554293..555270)
FT                   /locus_tag="Fjoh_0522"
FT   CDS_pept        complement(554293..555270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0522"
FT                   /product="Ribonucleoside-diphosphate reductase"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03557"
FT                   /db_xref="GOA:A5FMM1"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMM1"
FT                   /protein_id="ABQ03557.1"
FT                   /translation="MSQVEPILQENKNRFVIFPIKHHDIWEWYKKMEASFWTAEEIDLH
FT                   QDLTDWNNKLNDDERYFIKHILAFFAASDGIVNENLAENFVNEVQYAEAKFFYGFQIMM
FT                   ENIHSETYSLLIDTYVKDEAEKTELFNALEVFPAIAKKGEWALKWIESDSFAERLIAFA
FT                   AVEGIFFSGAFCSIYWLKKRGLMPGLTFSNELISRDEGVHCDFAVHLHNHHLVNKVPKE
FT                   RIKEIIVDALDIERQFVTESLPVSLIGMNAGLMTQYLEFVADRLLVELGCERVYGSANP
FT                   FDFMDMISLQGKTNFFEKRVAEYQKSGVMNTDSDAQKISFDADF"
FT   gene            complement(555609..556178)
FT                   /locus_tag="Fjoh_0523"
FT   CDS_pept        complement(555609..556178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03558"
FT                   /db_xref="InterPro:IPR021458"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMK3"
FT                   /protein_id="ABQ03558.1"
FT                   /translation="MFQLGKTIISEDILEKEFVCNLSACKGACCVDGDAGAPLNEAETK
FT                   ILEEIYPKVKPFLRKEGIEAIEAQGTWVTGTDGDLETPLIDNKDCAYVIFDGKTALCGI
FT                   EQAYNEGIVDWKKPVSCHLYPIRVKDFTEFAAVNYDRWDICDDACSLGKELEVPVYKFV
FT                   KEALIRRFGEDWYLELEKVAEELKNS"
FT   gene            556499..557077
FT                   /locus_tag="Fjoh_0524"
FT   CDS_pept        556499..557077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0524"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03559"
FT                   /db_xref="GOA:A5FMK4"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMK4"
FT                   /protein_id="ABQ03559.1"
FT                   /translation="MLEIDFKEIITVSMVLFAVIDIVGSIPIIVNLRAKVGHIESEKAS
FT                   IVAGAIMIVFLFVGEGLLNLIGIDVHSFAVAGSFVLFFLALEMILGIRIYRDEEPGSAS
FT                   IVPLAFPLIAGAGTMTTLLSLRSQFHTINIITAIVLNIILVYIVLKSSKKIENLLGENG
FT                   LGVVRKTFGVILLAIAVKLFAANVKGLFV"
FT   gene            557184..557384
FT                   /locus_tag="Fjoh_0525"
FT   CDS_pept        557184..557384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03560"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMK5"
FT                   /protein_id="ABQ03560.1"
FT                   /translation="MKIFTSILVLLALALIVFNITLLDFSNPFQGDSMVAFIGIAASFC
FT                   AVLILLIFRISKRIEEKTNGR"
FT   sig_peptide     557184..557243
FT                   /locus_tag="Fjoh_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.343 at
FT                   residue 20"
FT   gene            557389..557994
FT                   /locus_tag="Fjoh_0526"
FT   CDS_pept        557389..557994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0526"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03561"
FT                   /db_xref="GOA:A5FMK6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMK6"
FT                   /protein_id="ABQ03561.1"
FT                   /translation="MFDVLIIGGGVSGMSCALVLGSANKKAFVTDKKIGIFTHQKNSSL
FT                   QEAIFYNAYGITPGKLGSELLTESVQDLAASYPHIEQIANEKAIKIEGSFPSFTVVTNK
FT                   NSYQTKNIVVGIGSANTFDIEGLMQYVEPHKKALPEKQRIQLKNEDHKVADGIYVIGTL
FT                   AGWRSQLAIAAGSGAAVATDILTLWNNGVQTHSHDSIR"
FT   gene            complement(558090..558407)
FT                   /locus_tag="Fjoh_0527"
FT   CDS_pept        complement(558090..558407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0527"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03562"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMK7"
FT                   /protein_id="ABQ03562.1"
FT                   /translation="MKNLKKISFLVLLMAFVISCTTMKNNANSAVSGKVESIESGKDGY
FT                   TAKINTDTKEVYFATISIVNVGGPQNYKQLKIGDVVSLKGEIWKTDDENHIKVTQIVSV
FT                   K"
FT   sig_peptide     complement(558324..558407)
FT                   /locus_tag="Fjoh_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.540 at
FT                   residue 28"
FT   gene            complement(558497..558862)
FT                   /locus_tag="Fjoh_0528"
FT   CDS_pept        complement(558497..558862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03563"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMK8"
FT                   /protein_id="ABQ03563.1"
FT                   /translation="MEKNSIVTAEIELLTAIRNSDIAVLEKLLHDDLLFNMPDGQTITK
FT                   EFDLNSYRSGKMKIDSLEASDQIINVIGDSAVVAVTVSLKGAYDNNPINGVLKYIRVWK
FT                   QFDDNLKVIAGSCVQLA"
FT   gene            complement(558881..560458)
FT                   /locus_tag="Fjoh_0529"
FT   CDS_pept        complement(558881..560458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0529"
FT                   /product="carboxyl-terminal processing peptidase-3"
FT                   /EC_number="3.4.21.102"
FT                   /note="TIGRFAM: carboxyl-terminal protease; PFAM: peptidase
FT                   S41"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03564"
FT                   /db_xref="GOA:A5FMK9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMK9"
FT                   /protein_id="ABQ03564.1"
FT                   /translation="MKFNPKYLPIVIGATFALGTVIGSLTNGPADDQLLAKNYSKTKLN
FT                   KLIDFINTEYVDSVNTDSIVNLTVDNILSKLDPHSVYIPPSEQAEVAESMKGDFVGIGI
FT                   NFYMYKDSVAIIKPVENGPSAKAGLKSGDRILYAGKTKLYGRRLPSDSLFSKLKGIKGS
FT                   EIELTVFRKSEQKKLKFKIKRDVIPIKSVDASILIGNNTGYIKINRFAETTFNEFKTGL
FT                   ARLKQKGIQSLVIDLRDNGGGYMEEAIAIADEFLKDKQLIVFTKNKNGTTEKTYATKAG
FT                   SFETGKVYVLINENSASASEILAGAIQDNDRGTIVGRRSFGKGLVQREMDFNDGSAVRL
FT                   TVARYYTPTGRSIQKPYKKGNDEYFKESESRIATGELYAKDSIKVADSLKFKTPKGKIV
FT                   YGGGGIVPDVFVPMEAEHGNENVAYLLQTGIVGHFVFEELDKDRDAFAGLKFNEFLEKI
FT                   KSSDVYFKKFKNYIYMTGLDLKLDKTKALVNRYITAEFARQLYGEIYYYDVVLKDDAMI
FT                   KAILNPKK"
FT   gene            complement(560458..560889)
FT                   /locus_tag="Fjoh_0530"
FT   CDS_pept        complement(560458..560889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0530"
FT                   /product="CMP/dCMP deaminase, zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03565"
FT                   /db_xref="GOA:A5FML0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:A5FML0"
FT                   /protein_id="ABQ03565.1"
FT                   /translation="MEVKKLNKYDKAYLRIAKEWSLLSYCKRKQVGAIIVKDRMIISDG
FT                   YNGTPSGFENCCEDEDGLTRWDVLHAEANAILKVARSTQSCEGATLYITLSPCKECSKL
FT                   IHQSGIKRVVYKDGYRDDSGIQFLIKAGVEVEHIPVLEE"
FT   gene            complement(560895..561488)
FT                   /locus_tag="Fjoh_0531"
FT   CDS_pept        complement(560895..561488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03566"
FT                   /db_xref="InterPro:IPR032809"
FT                   /db_xref="UniProtKB/TrEMBL:A5FML1"
FT                   /protein_id="ABQ03566.1"
FT                   /translation="MSQFWIYFQIGLKHVLDINAYDHVLFLIALTVPYLFKDWKRIFLL
FT                   VSLFTIGHTLALILSVYGIIAIKVNIVEFLIPITILVTALYHLFTAGKTSKNDGINLVF
FT                   FITLFFGIIHGLGFSNYFKTILGGSATSKLLPLGEFALGIEAAQLVVVFVVLVISYIVQ
FT                   TVFRFSKRDWALVMSAFIIGVVIPMIIESPIWNR"
FT   gene            561658..562089
FT                   /locus_tag="Fjoh_0532"
FT   CDS_pept        561658..562089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03567"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMJ4"
FT                   /protein_id="ABQ03567.1"
FT                   /translation="MPFSELFDNEFKQRNRGHFSAIVRVAFADGKISPEEQEFLDKIAS
FT                   TLQISEDEYKEILKDPWKHPINPPYLYTQRLERLYDLARMVHVDHHLGDQQEVMLNRMG
FT                   LALGFTPGNVNYIVSKALSLIDKKVDLDTFLFEMENMNK"
FT   gene            complement(562256..563260)
FT                   /locus_tag="Fjoh_0533"
FT   CDS_pept        complement(562256..563260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0533"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03568"
FT                   /db_xref="GOA:A5FMJ5"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMJ5"
FT                   /protein_id="ABQ03568.1"
FT                   /translation="MEERNKTLGEFIIENQKAFQYSSGELSRIINSIRLAAKVVNYKVN
FT                   KAGLVDIIGAAGEQNIQGEDQQKLDVYANEVFIQTLINREIVCGIASEENDDFITVQGS
FT                   DNCHNNKYVILMDPLDGSSNIDVNVSVGTIFSVFRRITPIGTPVTSEDFLQPGINQVAA
FT                   GYVIYGTSTMLVYTTGFGVNGFTLNPAIGTFYLSHPNMKFPENGNIYSVNEGNYVHFPQ
FT                   GVKNYIKYCQREEEDRPYTSRYIGSLVADFHRNMIKGGIYIYPTSSKASKGKLRLLYEC
FT                   NPMAFIAEQAGGKATDGFGRIMEIQPTELHQRVPFFCGSKSMVEKAEEFMAAE"
FT   gene            563432..563926
FT                   /locus_tag="Fjoh_0534"
FT   CDS_pept        563432..563926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0534"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03569"
FT                   /db_xref="GOA:A5FMJ6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMJ6"
FT                   /protein_id="ABQ03569.1"
FT                   /translation="MNIRKGNPEDMKSVLGLIQELAIFEKEPDAVVITEEDLVRDGFGE
FT                   KPLFQVFVAEIDSDENEGGKEIVGIALYYYRYSTWKGKTIHLEDLIVKEKMRGTGLGSA
FT                   LYAEIMKQGKRDNVRRVEWNVLDWNTPAVKFYENSGAKILDEWRVVQMDETGINSFLEK
FT                   L"
FT   gene            564103..565362
FT                   /locus_tag="Fjoh_0535"
FT   CDS_pept        564103..565362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0535"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="TIGRFAM: aspartate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03570"
FT                   /db_xref="GOA:A5FMJ7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMJ7"
FT                   /protein_id="ABQ03570.1"
FT                   /translation="MRVFKFGGASVKDAEGIKNVYDVLQKVGYEDVILVVSAMGKTTNA
FT                   LEVVIKNYFEKSEELNSSVQEIKNYHFQIVLDLFKDEKHEVFAAVNAQFAELEYFLAHN
FT                   KSPNYNFVYDQVVSFGELISTNILSHFMNFMGIQTQWLDVRNFIKTNANYRDAEVDWET
FT                   TEQNISKNVPRKQLNITQGFLGADENNFTTTLGREGSDYTAGIFAYCLNAESVTIWKDV
FT                   PGVMNADPRYFENASLLNQISYREAIELAFYGATVIHPKTLQPLQKKEIPLYVKSFINP
FT                   LLKGTCVSKGVDLEPQYPCFIVKREQLLISLSSIDFSFIMEENISEIFGLFHEFKIKVN
FT                   LIQNSAISFSVCVEDKFGNFNDLNAILSKKFKVEYSENVTLYTIRHFTEQAAEMVEKNK
FT                   EVLLKQVSRETMQIVTKELN"
FT   gene            complement(565444..567690)
FT                   /locus_tag="Fjoh_0536"
FT   CDS_pept        complement(565444..567690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0536"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03571"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR041700"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMJ8"
FT                   /protein_id="ABQ03571.1"
FT                   /translation="MKLIIVVVISIYCLIFSSIEVKAQVVKNNRDKSYVDEDKLIEKTT
FT                   FSTPAPDSIIKDQDHNQLNEVVVKSNPSLVKYGANGTINVNVTGTVLAASSSVNELLGR
FT                   VPNVVVAEGQISVLGKGEAIIYLNGILINYERFAAIPVSQIARIEVISNPSSKYDAEGK
FT                   AVVNIITRQNIESGMMGSASQHVTVSKFAGTSTNTLIDFNYTKGKFSFITNYGLQLGKG
FT                   RELLYTTRTRPNPDVYMQSVLTTDWLREFNNYSNFGFGLQYTFSEKSYISLAYSGNIED
FT                   LGGAVESRNSITNNSGNSFYATDIAKNDVLLNQFINLNYNLITDSKGSSLFIGTQYSNY
FT                   NGTVRDFIEENSVVEEADGRRYLKNDVGNTINITAVQADYSKKISENTKLELGAKFSSA
FT                   SIKSGTDFFIANADAVDFELDDNLSSDFTYNEKIMAAYFNYAGSLGEKVDFSAGARAER
FT                   TNYDLYTNANGVQEFGKNYANFFPNLLLNFNFSEDWKAHFSYVSRITRPRYQALNPFVV
FT                   YQDPFTTIEGNPNLLPEKVHAFEIGTMYKKFDFKIGYTYKIDPISGAALQGDTPNSYIL
FT                   RSLNLQKGHTFFSSLSRSFNIKWWNSTNTISMNLTKSVDDFYSFEMSSVKPQIYLYSNN
FT                   TFTIPKLFKIQLLAWYLGDRSYGLGSDNSRSTVTLGIEKNFFKDALKLNFTANDIFHDF
FT                   MVSGNYEVGQTQIYYHRTYTTNYFKLIAAYSFGNSKKTTYKKSEIEQTENNRAR"
FT   gene            complement(567806..568855)
FT                   /locus_tag="Fjoh_0537"
FT   CDS_pept        complement(567806..568855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0537"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03572"
FT                   /db_xref="GOA:A5FMJ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMJ9"
FT                   /protein_id="ABQ03572.1"
FT                   /translation="MSIGKEILFFFGALGAFNGFILSLYFLFFTRKKYLSNLFLGALLF
FT                   VLSTRIAVTVFVYFNIDLPKIYLQIGLSACLLIGPFLYYVLKSGISNRISSQWKWHLTI
FT                   WIFSILTIGFVFPYQNYPVLWNDYFAALIFLQWFCYLFISGFEIRELLQKTISNYSSSN
FT                   PAERWFGIIFLGNASIFISYFLGFARVPFVSCITGALAFTFILYLIILVLLYRTRTDDL
FT                   FLLNVEKDKKLNNEEALILSQKLEKIMIEKALYKNPNLSLKDVSAEINISNHQLSQFLN
FT                   NNLGKNFTSFVNEFRIHNACEIITSNDKLTLESVGYDVGFNSKSTFFAAFKKHTGTTPL
FT                   NYQIQALQP"
FT   gene            complement(568858..569919)
FT                   /locus_tag="Fjoh_0538"
FT   CDS_pept        complement(568858..569919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0538"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03573"
FT                   /db_xref="GOA:A5FMK0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMK0"
FT                   /protein_id="ABQ03573.1"
FT                   /translation="MDTGKELLFFFSALGSFNGIILGVYFFFFTKKKFLTNYFLGALLF
FT                   ALSIRIGKSVFIYFHPELPKMYLQLGLTACFFIGPCLYYFLRSAVEEINVMPKSWKMML
FT                   LFWGILIVSVGILYPYEMYPTLWSFYFIRIIYFQWFVYILFSGFTIRGVLKKIFNTKEK
FT                   ASPSEIWFGTLFLGTFLLFLFYFLAIMGASAATYISGAVVFSFILYLIISILLYRKKTD
FT                   DLFLLNSQKVSGKKIDAAEAVIISEKLENIMNEKSLYKNPNLNLQDLSREINISSHQLS
FT                   QFLNNNLGKNFTSFVNEFRINEACRIITSNDKLTLESVGYDVGFNSKSTFFAAFKKHTG
FT                   TTPLNYQLQALQT"
FT   gene            570093..573524
FT                   /locus_tag="Fjoh_0539"
FT   CDS_pept        570093..573524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03574"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMK1"
FT                   /protein_id="ABQ03574.1"
FT                   /translation="MLKKLLFCMILFWYSGLMAQETETLYKTKKVIVTKDTIHLEKVSI
FT                   NSGFFEILNTKNQPIDSTFYKIDFKKGTLLFNEKFTSVSDTLIVNYLNYPDFLTKEYGL
FT                   YKDSQVVSSDVTSEKLYKIDNGNAKKAAPFDGLSTSGSITRGVTIGNNQSTVLNSNLDL
FT                   QITGKISDKVSLRASLQDNNIPLQDGGYSQKLDQFDNIFMELFTDDWNIRAGDVFLENR
FT                   KTQFLSFNKKVQGLAASFDFDTEKSKTNVFASVSFVKGQYAKSTFTGQEGNQGPYKLKG
FT                   QNGELYVLVISGSERVYVNGVLLKRGENNDYVIDYNAGEIVFTSLFTITSEMRINVEYQ
FT                   YSERNYNRLVTYAGVTTENKSWSFGGYIYSENDMKNQPLQQNLSTEQVQILAQAGDDIN
FT                   LMKAPSAFEDTYSENKILYKKILVNSVEAYEYSNNSADVLYNVKFSLVGNNLGNYIIQN
FT                   TNSVERIYQYVSPIGGIPQGNYEPIVQLVAPMKIQVATFLGKYNPDEKTLVDFEIAMSN
FT                   NDKNLFSSIDDSDNEGIAFKTNIKKRLFTRNWTLDGFANYQFVQKDFRSVERLYNIEFN
FT                   RDWNLNSTLLGNQSLLVTGINFDLFAKKETSNIGLFTYQFEKLDFSESYSGARHTTTAL
FT                   FKLKKWTIENQGSFLNSDATASTSKFIRNQTRTKYHFGKNWVGGSLQIEDNQEKDKATN
FT                   QFSALSQRFSEYGVFVGRGDSTKVFVELGYLQRRNDSLQNGLLQHVNNSQTYFLKSKLI
FT                   QNKTTDLAVYASYRNLDFTDSSRKNEPSLNSRVLYNDRFFNQFMQIGTAYETSSGTIAQ
FT                   QEFTYVEVPTGQGVYTWNDYNGNGIQELEEFEIAAFPDQAKYIRIFLPNQVYIKTNQNK
FT                   FSQSVILNPLQWQNEKGLKKLLSYLYNQTSFIMDRKVRSNGDRLELNPFYSSDENVLGL
FT                   NSSFRNSLFYNRGKQKHSVTYTYLINNGKNLLSVGSQSVKNSSHQLQYTHLYQKSWLFN
FT                   FFTKTIKTDLISKDFVEKNYDLKGYQLAPKISYLFSKNTSLDFFYEFQNKENQIGNFET
FT                   LVQNRLGTAFSFAGEKKVTINGEFSFYENKFNGNEFSSVGFQMLEGLQQGQNLVWKLLL
FT                   QKNITQFLDVNLNYQGRKSETGNTIHTGNVQLRAYF"
FT   sig_peptide     570093..570152
FT                   /locus_tag="Fjoh_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            573588..574121
FT                   /locus_tag="Fjoh_0540"
FT   CDS_pept        573588..574121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03575"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMK2"
FT                   /protein_id="ABQ03575.1"
FT                   /translation="MKKLVLLCFLVVLSTNFYAQETTAKAAKSKTEASAKKAKSDADKA
FT                   KADAKKESAKAKKEAAKATEASADAKKESAAAAKKSADKEAAKAKKEATGAKSDAAKAK
FT                   KAADKAEGAKADAKKEAATAKKSATKTLKETNEKAPKTADKVTGEYNGKKVYTGPKGGK
FT                   YYINKNGNKTYIQD"
FT   sig_peptide     573588..573653
FT                   /locus_tag="Fjoh_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.711 at
FT                   residue 22"
FT   gene            574470..575540
FT                   /locus_tag="Fjoh_0541"
FT   CDS_pept        574470..575540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03576"
FT                   /db_xref="GOA:A5FMI8"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMI8"
FT                   /protein_id="ABQ03576.1"
FT                   /translation="MSIDYSANKTILVAPLNWGLGHATRCIPIIKALQENNYIPIIASD
FT                   GVALALLRKEFPYVQTLELPSYHIEYAKNGKNFKWKLIKNLPKMITAILDEKKMVNSWI
FT                   KKHGIDGIISDNRLGVFSKKVPSVFMTHQLNVMTGNTTWFTSKCHQHIIKKYTECWVPD
FT                   SNEKVNLTGDLGHLKNDHLNLRYIGPLSRMKKKETPIVYDLMIILSGPEPQRTYLDEKL
FT                   QKEAAKFKGKVVFVQGIVEKTQEKWQAGNVTYYNFMNSKQLEQTFNESEFVLCRSGYTT
FT                   VMDLAKLGKKAFFIPTPGQYEQEYLAIKLQEENLVPYAMQDDFTIEDLSKVKSYKGLSQ
FT                   FKNDIDWDSLFNVFED"
FT   gene            complement(575543..576838)
FT                   /locus_tag="Fjoh_0542"
FT   CDS_pept        complement(575543..576838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0542"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03577"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMI9"
FT                   /protein_id="ABQ03577.1"
FT                   /translation="MIKRKILAVLLLITCAANAQEINKQEVKNEVLRILDSINKAKLPD
FT                   TKSGGGVEEHWYDRISLRGYAQIRYNGLFSTNDKVSCEQCDKSWGTTSTAPDAKANNGL
FT                   FIRRARLVFSGQVHPNVFFYFQPDFASSPSTGIQNFVQIRDLYFDLSFDKKREYRVRIG
FT                   QSKIPYGFENMQSSSQRLTMDRADAINSSILNERDLGMFFYWAPAEIRERFNMLVKDGY
FT                   KGSGDFGVFAFGVYNGQIANKLDGNRDLNVVARVTYPFVIGSQIIEPGIQAYTGKWAFT
FT                   GEISNGVTVNDPQYVKDQRVGATFVLYPRPFGIQTEYNIGTGPRYNTLTNTVDETDLNG
FT                   GYVLLNYKWDIKKQHIYPFAKFQYYDGGKKYEKDARSYVVRDYEFGIEWQPIKAFELTA
FT                   EYVIADRTFEDSALPINRQQGNVLRLQAQFNF"
FT   sig_peptide     complement(576779..576838)
FT                   /locus_tag="Fjoh_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 20"
FT   gene            complement(577002..578087)
FT                   /locus_tag="Fjoh_0543"
FT   CDS_pept        complement(577002..578087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0543"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03578"
FT                   /db_xref="GOA:A5FMJ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMJ0"
FT                   /protein_id="ABQ03578.1"
FT                   /translation="MKINFKKTYKFAIKSALYISLFSTGFVLILMSLFYKNQLKHQIAF
FT                   GIIFIIVIYIFSFLVLQYRVERFIYRRVKKIYDEVSLLESTNLINQPITTDMETLSREV
FT                   KKFATDKKLEIEMLEIREQYRREFLGNVSHELKTPLFTVQGYVSTLLDGAMDDKHIRKK
FT                   YLKRAEKGVERLIYIVEDLDMITKLESGDLDLNMTDFDIVELIQNVFDLLEMKADKKKI
FT                   KLAFESKNVQSVIIRGDQDRIQQVLENLIVNSIKYGKEGGLTEVGVVNLTKKKVLIRIS
FT                   DNGEGVEKQNIPRLFERFYRVDKSGTRSEGGSGLGLAIVKHIIEAHKEKVYVESEFGIG
FT                   SEFSFTLEKAFKSQKPDVKKL"
FT   sig_peptide     complement(577974..578087)
FT                   /locus_tag="Fjoh_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.677) with cleavage site probability 0.451 at
FT                   residue 38"
FT   gene            complement(578293..578976)
FT                   /locus_tag="Fjoh_0544"
FT   CDS_pept        complement(578293..578976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0544"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03579"
FT                   /db_xref="GOA:A5FMJ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMJ1"
FT                   /protein_id="ABQ03579.1"
FT                   /translation="MKKTQTKILLVDDEPDILEIVGYNLAQEGYQIVTASNGKDAIAKA
FT                   QKELPELIIMDVMMAEMDGMEACEHIRKIPELNNVIITFLTARSEDYSQVAGFDAGADD
FT                   YITKPIKPKLLVSKVKALLRRLKEQEVVTDTINVGGIEINREEYKIIKGNVEIALPRKE
FT                   FELFYLLASKPGKVFKRDEILDKVWGNEVVVGGRTIDVHIRKLREKIGEDLFKTIKGVG
FT                   YKFEV"
FT   gene            579210..581978
FT                   /locus_tag="Fjoh_0545"
FT   CDS_pept        579210..581978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0545"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03580"
FT                   /db_xref="GOA:A5FMJ2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMJ2"
FT                   /protein_id="ABQ03580.1"
FT                   /translation="MKFNLRFLFIALFICTISIAQNKGTISGVLTDKEMNNDPLPFANV
FT                   LVKGTNISVNTDVDGKYSLSVNPGNYTLIFSFLGYESKEAPVNVKANETVVINQALSSG
FT                   SFTLKDVVVKSAAVNRQKESALLLEQKNAVDIKQSIGAQELSKKGVSDAAAAVVKTTGI
FT                   TKQEGSNNIFVRGLGDRYNSTTMNGLPIPSNDPEKKNINLDIFSTDIIEFVSIDKVYNG
FT                   KFFGDFAGGNVDIVSKDYKGNGFFKIDAESKVNTNALGEDNFALQTGPSAFGFSKPSIP
FT                   NNPLTEYNFGSLQFDKKTPLGGAFGVSGGDSFNVGEGKINIFGTASFTNEYSSRTNGTA
FT                   KGSVNAAGVAGKDLDYHYLSYNTNTTGMFNAGYKINNNNKINFNSLYINTSAQRKEESS
FT                   GYIVDLANDGNGYIRRNEYEKTDLWVNQLLGEHKLSDRSTLNWGGSYNIVNQTIPDRTY
FT                   NTFNLVEGGYVINSQSAPNNNRYFQNLKEKELAANLSVNYKFSKNDEGDYRGKFTAGYN
FT                   GRFKNRDFEATQFNLKTTTFPVSHTGDIVDPNNLDLFYNQQNFANNYFTISTFRGGPEV
FT                   PNALDPQTYSGDLTINGGFLNTEYKFNKLTAVLGLRAEVITQNVEWSTQLDPEGGSDKL
FT                   EKTAFLPSLVLKYELNEKQNLRLGVSKTYTLPQFKERSPFIYEEFLQAKIGNPFLYASD
FT                   DYNFDLKWELFPSSEEVLSVTAFGKYILNPINEVIINSSTNDISYVNSGDKGYVAGAEL
FT                   EYKKVLFNFDSENAKKLTGGINISYLYSKQDLDNEKVNEETNGTRPTTFTNTTGKFTGA
FT                   SPLLLNADLSFYNEWNDKNSNLTTTIAYNYFSDRVNAIGTLEKGDLVDKAVGSLDFIAK
FT                   SKLNKNYGLGLVVKNILDPTINRVQENKSGDVNVLSYKKGLNLSLQFSYEF"
FT   sig_peptide     579210..579272
FT                   /locus_tag="Fjoh_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.504 at
FT                   residue 21"
FT   gene            582190..583368
FT                   /locus_tag="Fjoh_0546"
FT   CDS_pept        582190..583368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0546"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03581"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMJ3"
FT                   /protein_id="ABQ03581.1"
FT                   /translation="MKKSILNFVTVVALSGGLLTSCSSDDDKKTPSSSFVADAANFKGT
FT                   ITDGEVVLDASKTYKLTGAIKVENGATLTIPAGTTIEGTGGTASYIAVAQGGKINVNGT
FT                   AAKPVIMTASVKEAGKWGGLVICGRAPINRVSGGASTATSEVAELTYGGTNSADNSGSI
FT                   KYLRIEYAGAAFNSEKEFNGLSFFGVGSGTIVENVEAYHGADDGFEFFGGSVNTKNLIS
FT                   IGNEDDQFDWTEGWNGTNENWYGRLDFGKGNRGIEADNFEFGYAFTPIANPTITNMTLI
FT                   GPGSTAAAANFAENQAIKLRRGTKGIISNVVLSAWATGIDVENDETIAFVGTALKVNNV
FT                   NFVTDVPTQTKGKKTDGTSANVSAVATLSAAATGAGNGVGTPTWATGWSVGF"
FT   sig_peptide     582190..582264
FT                   /locus_tag="Fjoh_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.684 at
FT                   residue 25"
FT   gene            583476..583814
FT                   /locus_tag="Fjoh_0547"
FT   CDS_pept        583476..583814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03582"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMH8"
FT                   /protein_id="ABQ03582.1"
FT                   /translation="MAKNYFYITFLLAFFFTVSVSAQDSKQLPKTQDPTGIEGLSLYPN
FT                   PVVNGKVYISSKNDLEKEIIVFDILGKKVLQAHLTTKELNVSDLVPGVYIIRISEQNAT
FT                   ATRKLIIR"
FT   sig_peptide     583476..583544
FT                   /locus_tag="Fjoh_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            583966..584946
FT                   /locus_tag="Fjoh_0548"
FT   CDS_pept        583966..584946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03583"
FT                   /db_xref="GOA:A5FMH9"
FT                   /db_xref="InterPro:IPR007534"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMH9"
FT                   /protein_id="ABQ03583.1"
FT                   /translation="MITASDIFTISSHKQFEKTALKVFRFQYANNAVYRDFCDYLKTDV
FT                   QQVKSLKQIPFLPIQFFKSHNVVSNENPAEVTFTSSGTTGMITSRHLVTDISLYEESYR
FT                   KGFSQFYGNIEDYVVLALLPSYLEREGSSLIYMVEDLIKLSNQPDSGFYLHNHDDLIKK
FT                   LTELDESGQNVILIGVTYALLDLIEKHQFNLQNTIIMETGGMKGKRKEMIREELHEILC
FT                   KGFGVSSIHSEYGMTELLAQAYSLGEGIFECPSWMHILVRDPEDALTYIQDGKTGGINV
FT                   IDLANINSCSFIATQDLGKKNPNNSFEVLGRFDNSDIRGCNLMVL"
FT   gene            585068..586708
FT                   /locus_tag="Fjoh_0549"
FT   CDS_pept        585068..586708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03584"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMI0"
FT                   /protein_id="ABQ03584.1"
FT                   /translation="MKKITLLLVISLLNLKAWSQNPNYRYHELQDLGTTIEWAISIECT
FT                   HHFQPLRVLDVNLKQNFKLEVGKIYKVDLGLPANYGTRYYKVTYAGDSGVDKGDELDTP
FT                   PNFGSPITNLCSSLSWKYIRPILLGSTVEEAQNNYCANLTANTTREKVNIKITQSLTVG
FT                   SAYFMDFGKGPNYYLIDGSSPENGDADYEFDPTIANAVFSPAALNCPKPDLQAIATDFG
FT                   GTTTTTGANASVIYSIKNIGGRAFAPSHCLIYFSKGNSVLSSDDILIKDVTIDPLNPNE
FT                   SKYGVPSIIIPANISSGTYYVIIQLINSEDINNSNNIISSLSSFTVNQTTTPTGKPDLI
FT                   IDPANTIIFSNCFDCSAALSDLGNKRHTINNQSGIINLQAITIKNIGSTASTPATLQFY
FT                   LSTDGILDAADIKSTASSVSIAAINPGSSITVSKSIFSSDFGGLTVTGNRNILMSVDDS
FT                   KTNTESNENNNITVIPVTFVNPFAKTVQSNVNVEDSIQPYSINVYNFEGQKVLTKEVKS
FT                   IEEENKSLDSLKSGIYIIKSKNETRKVLK"
FT   sig_peptide     585068..585127
FT                   /locus_tag="Fjoh_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 20"
FT   gene            complement(586772..588067)
FT                   /locus_tag="Fjoh_0550"
FT   CDS_pept        complement(586772..588067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0550"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03585"
FT                   /db_xref="GOA:A5FMI1"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMI1"
FT                   /protein_id="ABQ03585.1"
FT                   /translation="MKNLVEELKWRGLYHDSMPGTEEQLLKEVTSAYIGFDPTADSLHI
FT                   GSMVQIILLVHLKNFGHQPIALVGGATGMIGDPSGKSDERNLLNEETLAKNVAGIKSVL
FT                   SRFLDFNSKEQNAPIMVNNYDWMKEFSFIDFAREVGKRITVNYMMAKDSVKKRINGEGE
FT                   GMSFTEFTYQLIQGYDFYHLYKNNNCLLQMGGSDQWGNITTGTELVRRMGGENAKAFAL
FT                   TTPLITKADGSKFGKSEGGNVWLDADKTSVYKFYQFWVNATDADAEKYIKIFTFLDKET
FT                   IDALIAEHQTAPHLRILQKKLAEEITIFVHSKEELEKAIQASNILFGNSTADDLKKLDE
FT                   KTFLEVFDGVPQAEIAKADLENGLDIVTVLNEKTGFFKSNGEARRALTANSISVNREKI
FT                   KEDFVLTANDLINNQFVLLQSGKKNYFVIRVV"
FT   gene            588266..589267
FT                   /locus_tag="Fjoh_0551"
FT   CDS_pept        588266..589267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0551"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03586"
FT                   /db_xref="GOA:A5FMI2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMI2"
FT                   /protein_id="ABQ03586.1"
FT                   /translation="MVLVTGGTGLVGSHLLLHLIENGENVRAIYRSQNNIEKTKSVFEL
FT                   YKKTELFEKIEWLEADILDIPSLEIAFNGIEYVYHCAALISFDPKDEEALRKTNIEGTA
FT                   NIVNFSIAREIKKFCFVSSIAALGDLAAHETYITEETDWNPEKPHSDYAISKYGAEMEV
FT                   WRGHQEGLDVIIINPGVILGPIPKEKSKQQGSSELYAKVANGLSFYTLGNTGFISVDDV
FT                   VKTALQLMKSDIKNERFTLIADNIVFKDILNTIADALNVKRPHRHAKPALMNFLWIADG
FT                   IFSTLFFQKRRLTKATAKASYSKNLYSNEKIKTALGTVFLDVHEYVKNISKL"
FT   gene            complement(589268..589747)
FT                   /locus_tag="Fjoh_0552"
FT   CDS_pept        complement(589268..589747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0552"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03587"
FT                   /db_xref="InterPro:IPR025381"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMI3"
FT                   /protein_id="ABQ03587.1"
FT                   /translation="MKNCLIILLVLFLSVSCKKEVVKQPAKLIEKEKMIDIMYDLSLLE
FT                   AMRYQHQELIDSTETNPTKFILKKYKVDSLQFAQNNMYYAADYENYKDMFDEVGKRLAK
FT                   VQRATDSIVKIEDKKAAKEAKKKKKEVLKDSIKKAEPVIKSIDSLKKAKRKQLRK"
FT   sig_peptide     complement(589688..589747)
FT                   /locus_tag="Fjoh_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.710) with cleavage site probability 0.425 at
FT                   residue 20"
FT   gene            complement(589757..591097)
FT                   /locus_tag="Fjoh_0553"
FT   CDS_pept        complement(589757..591097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0553"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /EC_number="3.5.2.3"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03588"
FT                   /db_xref="GOA:A5FMI4"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMI4"
FT                   /protein_id="ABQ03588.1"
FT                   /translation="MNRILIKNAKIVNEGSIFDGDVLIENDLIVEVADSISLKTSDCIV
FT                   IDAEGSYLMPGAIDDQVHFREPGLTHKGDIESESRAAVAGGITSFIEQPNTVPNAVTQE
FT                   ILEDKYQIAAQKSFANYSFMMGATNDNLEEVLKTNPKNVAGIKIFLGSSTGNMLVDREE
FT                   TLEKIFSSTPMLIAVHCEDETTIQNNLAEFKEKYGDDIPVTAHNLIRSAEACYLSSSKA
FT                   VALAKKTGARLHIFHLSTAKEMELFTNKIPLEDKKITAEVCVHHLWFTDEDYKTKGNFI
FT                   KWNPAVKTESDRKVLWEALNDGRIDVIATDHAPHTKEEKAQSYLKAPSGGPLVQHAVVA
FT                   MFEAHHQGKISVEKIVEKMCHNPAKIFKIEKRGFIKEGYFADLVIVNPSKPWSVNTDNI
FT                   LYKCGWSPFEGTTFKSRITHTFVNGEMVYNNFKVKDIRAGKRLLFDR"
FT   gene            complement(591107..591832)
FT                   /locus_tag="Fjoh_0554"
FT   CDS_pept        complement(591107..591832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0554"
FT                   /product="Candidate GDP-Man: lipid-phosphate
FT                   beta-mannosyltransferase; Glycosyltransferase family 2"
FT                   /EC_number="2.4.1.83"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03589"
FT                   /db_xref="GOA:A5FMI5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMI5"
FT                   /protein_id="ABQ03589.1"
FT                   /translation="MNDSIVIIPTYNEIENVESIIRAVLSQHKSFHLLIIDDNSPDHTA
FT                   DKVIALQEEYPERLFLEKRAKKAGLGTAYVHGFKWALAHNYDFIFEMDADFSHNPNDLE
FT                   KLYDACHFGGADLAIGSRYVKGVNVVNWPLSRVLMSYFASVYVKFITGMKIHDATAGFV
FT                   CYKREVLEKINLNKIKFVGYAFQIEMKYRTYCAKFEIKEVPIIFTDRTKGVSKMSNAII
FT                   KEAILGVISLRLKKLVNTL"
FT   gene            591940..592608
FT                   /locus_tag="Fjoh_0555"
FT   CDS_pept        591940..592608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03590"
FT                   /db_xref="InterPro:IPR025367"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMI6"
FT                   /protein_id="ABQ03590.1"
FT                   /translation="MIEHLHPRIIENKDWATALFVLTFAVVAMTKSAYETRFTEFSKLI
FT                   FSDKYAKIYRDNSHMKSSFTVGLFFVQVISFAFFIQLTMNIFGQASKTDWILFIQIATF
FT                   LLYFILAKYLIEKIVAASFNIDDFVELFNLQKVTYRTYIGVLILPINAILFYYDNIPTI
FT                   VPFAIIGISLCISLYSYFISIKTYQNVIIGKLFYFILYLCALEIAPYYFLYYWITKGSA
FT                   "
FT   gene            592623..593372
FT                   /locus_tag="Fjoh_0556"
FT   CDS_pept        592623..593372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0556"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03591"
FT                   /db_xref="GOA:A5FMI7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMI7"
FT                   /protein_id="ABQ03591.1"
FT                   /translation="MKVKTILVSQPEPKVENSPYFELQQKHKIKIDFRPFIHVEGVSAK
FT                   EIRLQKIDLNHYTAIILTSRNAVDHFFRVADEMRYKVPEGLKYFCQSEAVAFYLQKYVV
FT                   YRKRKIYVGAKDFADLSPLIKKYKDEKFLLPASDQLNADAPITLNSLKVDWAQAIFYRT
FT                   VMSDLSDLADVYYDVLAFFSPTGIKSLFKNFPDFKQNDTRIAVFGSTTQKEALDHGLRI
FT                   DILAPTPETPSMTMALEKYVAEANKGK"
FT   gene            593517..593987
FT                   /locus_tag="Fjoh_0557"
FT   CDS_pept        593517..593987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0557"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03592"
FT                   /db_xref="GOA:A5FMH0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMH0"
FT                   /protein_id="ABQ03592.1"
FT                   /translation="MKINSLLIEIDGIDKEILRYLMDDARKPILQIANKIGISGAAIHQ
FT                   RLKKLEQSGVISGSKFTVNPKVLGYNTMAFIGVYLDKASRNSEAVKELRKIPEVLECHY
FT                   TTGNWSVLIKIICRDNEHLMQLLNTKIQAIEGVSRTETFISLDQQIDRQIQL"
FT   gene            complement(594165..594848)
FT                   /locus_tag="Fjoh_0558"
FT   CDS_pept        complement(594165..594848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0558"
FT                   /product="peptidase, membrane zinc metallopeptidase,
FT                   putative"
FT                   /note="PFAM: peptidase, membrane zinc metallopeptidase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03593"
FT                   /db_xref="InterPro:IPR007395"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMH1"
FT                   /protein_id="ABQ03593.1"
FT                   /translation="MGSGYLILAGAIMLFSWMVSAKLKSKFELYSKLQLRNGMSGAEIA
FT                   EKMLADNGITDVRVISTPGQLTDHYNPSDKTVNLSEAVYSHRNAAAAAVAAHECGHAVQ
FT                   HAIGYEWLTMRSKLVPVVSVASNFMQWILLAGILMIRTFPQLLLVGIIIFAVTTLFSII
FT                   TLPVEYDASNRALAWLENKHMLTQEEQAGAKDALKWAARTYVVAALGSIATLLYYISIY
FT                   SNRRN"
FT   sig_peptide     complement(594783..594848)
FT                   /locus_tag="Fjoh_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.908 at
FT                   residue 22"
FT   gene            complement(594948..595583)
FT                   /locus_tag="Fjoh_0559"
FT   CDS_pept        complement(594948..595583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0559"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03594"
FT                   /db_xref="GOA:A5FMH2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMH2"
FT                   /protein_id="ABQ03594.1"
FT                   /translation="MSKKYKMVVVDDHPIVISGISGLLSDLDNIEIVEKMQSGALLLDY
FT                   IENNEVDLVLIDIFLPVVTGIDLCKAIKQKYSQVIVIGMSSQSERSLVMQFIQNGGNGY
FT                   ILKSASFEEFKNCINKAIEGEIVFSDEVKTIVSQPLSEDLDNIPSLSRREKDIALLLSK
FT                   GKQTQEIADELFLSFLTVQTHRRNILQKYKTKNVAELITLLLKNNLLD"
FT   gene            complement(595576..597588)
FT                   /locus_tag="Fjoh_0560"
FT   CDS_pept        complement(595576..597588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0560"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, dimerisation and phosphoacceptor region"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03595"
FT                   /db_xref="GOA:A5FMH3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMH3"
FT                   /protein_id="ABQ03595.1"
FT                   /translation="MKKIYLLALFLFLSAVSNSQVILSLDDDSVYIDSIANITKNTKSD
FT                   SIKCLYSFKLSKLYLMIQDAKKSKEYLAQANSLKDKYPFLRDAGIFYNSSTFLEKGDVE
FT                   GFEKTLLDGNEKLKKYFNTEAFRIRAIILQNYGIMQQRKNNEKVYMKLLINEAIPAAKK
FT                   SRDYELISGLYKAVAIIFMNNNERGKASEYLSEAQKYIERAIKKSPTAAESKMETYIIN
FT                   AENLIELQHFYDAKKILDKAFSTLKDFPESNLNDSYYYSEGLYYAKQNKNSNALESYGK
FT                   GIKSAEKHQNAIALNRLKFAEYEVLFKLKNYDKAKSNLDYLLENTPFVVDKKNYYNELA
FT                   KVYNATKDYDKAYFYSHKYNALNDSLNNTKFQSEIVELEAKYKKAESEKKITLLQSQND
FT                   NAALQVNNNRLNSVLFAGLSFLLFLIVLFLWIFNKNQKKLSIQKEINLKQELSSFEDRH
FT                   KLSVSKALIQGEEMERKRIARDLHDGLGSMLSGVKIHLNLAKKDNGEAVNNVDTLLDNS
FT                   IKELRNISQNLMPESLLELSLEHALRDLCAANSNAVTKIEFQYLIKKSKLPKNYEIMIY
FT                   RIIQELLNNALKYAKASQVLVSCSQNKDVFFITVEDDGVGFNLSEAKSKNGMGLKNIHN
FT                   RVEFLSGKLEIDSKINQGTSVYIELNVINENQKNE"
FT   sig_peptide     complement(597529..597588)
FT                   /locus_tag="Fjoh_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.871 at
FT                   residue 20"
FT   gene            597755..598162
FT                   /locus_tag="Fjoh_0561"
FT   CDS_pept        597755..598162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0561"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03596"
FT                   /db_xref="InterPro:IPR038468"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMH4"
FT                   /protein_id="ABQ03596.1"
FT                   /translation="MKSILKTAALVLTLAFTAVSCSSDNDNDNGNSGTGSRDVKYEITG
FT                   NYTGKMDVTYMEKSGAPLIEDVTTLPWTKEFTADADSDGALVHTGGYGGVAGQTLTAKV
FT                   YVGGKVVSELTGKADSDGIIVVHPKTYIFPR"
FT   sig_peptide     597755..597823
FT                   /locus_tag="Fjoh_0561"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.469 at
FT                   residue 23"
FT   gene            complement(598238..598834)
FT                   /locus_tag="Fjoh_0562"
FT   CDS_pept        complement(598238..598834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03597"
FT                   /db_xref="GOA:A5FMH5"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMH5"
FT                   /protein_id="ABQ03597.1"
FT                   /translation="MDNDNNIDFKDLWKKQAISQPDMTDLLARVNKFKKTGLRCLWITN
FT                   ILLLATSIFIAFVWFYYQPQFISTKIGIVMVILAMLIYLMTYNKLLGNYKNIEANQTNH
FT                   DYLQKLIEIKKKQQFLQTKMMSFYFTALTIGICLYMYEYASRMTALGAGLTYGITLFWM
FT                   LFNWFYLRPKQIKKQQEKINSLIDKFEEINNQLGI"
FT   gene            complement(598821..599294)
FT                   /locus_tag="Fjoh_0563"
FT   CDS_pept        complement(598821..599294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0563"
FT                   /product="ECF subfamily RNA polymerase sigma-24 subunit"
FT                   /note="PFAM: sigma-70 region 2 domain protein; Sigma-70,
FT                   region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03598"
FT                   /db_xref="GOA:A5FMH6"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMH6"
FT                   /protein_id="ABQ03598.1"
FT                   /translation="MEFEQIYKIYWDRIFRLCMGFVNDYDAAQDLAQETFIIVWQKLET
FT                   FRNESSIGTWIFRIASNNCLRQIEKQKRFPKSELPIHLSEEKQTSLEPQIQFLYKCIAE
FT                   LPETDRIIISLELEDIKQNEIAKIVGLSEANVRVKIHRIKEKLTQKFKENGQR"
FT   gene            complement(599300..600145)
FT                   /locus_tag="Fjoh_0564"
FT   CDS_pept        complement(599300..600145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0564"
FT                   /product="Peptidase family S33-like protein"
FT                   /note="classified as 'non-peptidase homologue' by MEROPS;
FT                   may not have peptidase activity; alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03599"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMH7"
FT                   /protein_id="ABQ03599.1"
FT                   /translation="MKKYIILIIAFLFSALCLNVFGQTRQFPFEILKTGNGDQSIIFIP
FT                   GFASSGDVWNETKAAFENDFTCYTLTMAGFAGIKPQSNASFENWKNGIVNYIKDNNIEK
FT                   PILIGHSMGGGLALAIASDYPDLISKIVVVDALPCLAALNDPAFKSKINNDCSSTVNQM
FT                   TGLTNDQFYDMQKKTMPRLLANTSKMDMVVDWSVKSDRTTFGQMYCDFFNVDLRDKISQ
FT                   IKCPALILLESYFINLKPAIEDQYKNLKTANFQYATNGLHFIMYDDTAWYLEQLSTFLK
FT                   "
FT   sig_peptide     complement(600077..600145)
FT                   /locus_tag="Fjoh_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(600478..603342)
FT                   /gene="leuS"
FT                   /locus_tag="Fjoh_0565"
FT   CDS_pept        complement(600478..603342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="Fjoh_0565"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03600"
FT                   /db_xref="GOA:A5FMG2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMG2"
FT                   /protein_id="ABQ03600.1"
FT                   /translation="MKYNPNEIEAKWQKYWAENQTFAAKNNSEKPKHYVLDMFPYPSGA
FT                   GLHVGHPLGYIASDVYSRFKRHQGFNVLHPMGYDSFGLPAEQYAIQTGQRPEDTTRVNI
FT                   DGGVDKEGKQIAGYRKQLDKIGFSFDWAREVRTSNPDYYKHTQWIFIQLFNSWYCRKQG
FT                   KAFDISELVTVFEESGNALVEAVCDDNVTIFTADEWKSYSDDQKEKILLQYRMTYLAET
FT                   EVNWCPGLGTVLANDEIVNGVSERGGFPVIRKKMTQWSMRISAYAERLLQGLNDIDWSE
FT                   SIKESQRNWIGKSVGALVTFNVKNHDEVIEVFTTRPDTIFGVTFMTLAPEHDLVAKITT
FT                   PEQKEAVEAYIEKTAKRSERERMADVKTISGVFTGAYAEHPFTKEAIPVWIGDYVLAGY
FT                   GTGAVMAVPCGDERDYAFANFFKGQNGMQEIKNIFANVDISEAAYGSKDNVEIAASDFL
FT                   NGLNYKDATAKAIYKLEEIGQGKGKTNYRLRDAVFSRQRYWGEPFPVYYVNGLPKMIDT
FT                   QHLPIILPEVEKYLPTEDGLPPLGNAAVWAWDIKENKVVNTDLVDNVSIFPLELNTMPG
FT                   WAGSSWYWMRYMDAHNENEFASKEALAYWENVDLYIGGSEHATGHLLYSRFWNKFLKDK
FT                   GFAPTEEPFKKLINQGMILGTTAYVYRLEGTNTFVSKNKIKGQNVQPIRVDVHFVNSSD
FT                   ELNIEKFKAWREDFNTAEFIFDENGKYIVGREVEKMSKSYYNVVTPDDICAEYGADTLR
FT                   LYEMFLGPLEQAKPWNTAGISGVFGFLKKLWRLYFDDNGLIVNNDEPTKDNLKSLHKTI
FT                   KKVAEDIENFSFNTSVSQFMICVNELSSQNCHSRAILEPLAILVSPYAPHIAEELWAQL
FT                   GHKTSISEVAFPVFDAKHLVETNKEYPVSFNGKMRFTIELPLDLTAAQIEEIVMKDERT
FT                   QKQLDGRIPNKVIIVPGKIINLVG"
FT   gene            603530..604126
FT                   /locus_tag="Fjoh_0566"
FT   CDS_pept        603530..604126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0566"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03601"
FT                   /db_xref="GOA:A5FMG3"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMG3"
FT                   /protein_id="ABQ03601.1"
FT                   /translation="MKTKNYILILFIAFCCSMCNSSKKDKEETISKEKISKNPKHGHPT
FT                   LTAEDSLKLVNHSIEVKGDVEFSLQLTVDSLKKMKVVTIDNLKVTGKNGETKRIIKACK
FT                   GVLLKDILEKAKIRQNGHKDRNFYIVARASDDYKATFSWAEIFNNPTGENTYVLFEENG
FT                   KPVKNGEMILICKNDIKTGPRHVYWLKSIEVYKVK"
FT   sig_peptide     603530..603601
FT                   /locus_tag="Fjoh_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.582 at
FT                   residue 24"
FT   gene            604369..605244
FT                   /gene="ftsX"
FT                   /locus_tag="Fjoh_0567"
FT   CDS_pept        604369..605244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsX"
FT                   /locus_tag="Fjoh_0567"
FT                   /product="FtsX"
FT                   /note="PMID 10692373; PMID 10692373"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03602"
FT                   /db_xref="GOA:A5FMG4"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMG4"
FT                   /protein_id="ABQ03602.1"
FT                   /translation="MSSNFDKFQKRRLISSYFSVVLSVFLVLFLLGVLGLFIINSKKLA
FT                   DDFKEKIAMTVFFKNEANDSIIKAFNSELKRAPFALSYVYVTKEKAAKEHTDIIGEDFL
FT                   TFLGENPLLNSYDIHLKADYVERDSILKIESALRKNTMIEDIVYDKQLVNLVNDNIKKV
FT                   SMWILIISGFLTVIAVLLINSSLRLSIHSNRFIIKTMQMVGATKSFIRKPFVMRSVKLG
FT                   MLGALLAIIALIGLLFYVETNFPGLGILEDKALIGLVLLAVFGLGVLITWVSTHFATQR
FT                   FLNLRTDDLY"
FT   gene            605329..605586
FT                   /locus_tag="Fjoh_0568"
FT   CDS_pept        605329..605586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03603"
FT                   /db_xref="InterPro:IPR021448"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMG5"
FT                   /protein_id="ABQ03603.1"
FT                   /translation="MKNNNNKEEQQVQKQEFLFDGINYKILLIGIAVIALGFILMSGGG
FT                   SDNSNVFNEDVFSFRRIRLAPTTVLIGFGITIYSIFKKSK"
FT   gene            605676..606473
FT                   /locus_tag="Fjoh_0569"
FT   CDS_pept        605676..606473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0569"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="TIGRFAM: putative undecaprenol kinase; PFAM:
FT                   Bacitracin resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03604"
FT                   /db_xref="GOA:Q9RB37"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RB37"
FT                   /protein_id="ABQ03604.1"
FT                   /translation="MNTLQAIVLAVIEGITEFLPVSSTGHMIIASSFFGIAHEDFTKLF
FT                   TIVIQLGAILSVVVLYFKRFFQTLDFYFKLLVAFIPAVVLGLLLSDFIDGLLENPVTVA
FT                   VSLLIGGLILLKVDEWFNNPNAAETSQKITYLQALKIGLFQCIAMIPGVSRSGASIVGG
FT                   MSQKLSRTTAAEFSFFLAVPTMLGATVKKCYDYYKAGFELSHDQVNILIIGNVVAFIVA
FT                   LLAIKTFISFLTKNGFKVFGYYRIIAGIILLLIHFFIHPLTII"
FT   gene            606473..607162
FT                   /locus_tag="Fjoh_0570"
FT   CDS_pept        606473..607162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0570"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03605"
FT                   /db_xref="GOA:Q9RB36"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9RB36"
FT                   /protein_id="ABQ03605.1"
FT                   /translation="MTPEEYLEGQVLLIDKPLKWSSFQAVNKLKYLLINKVGLPKKFKI
FT                   GHAGTLDPLATGLLLICTGKFTKKISELQGQAKEYTGTFYIGATTPSYDLETEIDQTFP
FT                   TEHINEVLIHETVKQFLGEIDQKPPIFSAIKKDGVRLYEHARAGESIEIESRKTTIHEF
FT                   EITRIALPEIDFRVVCSKGTYIRSLAYDFGKAMNSGSHLTVLRRTKIGDYDVKNAIDIT
FT                   LFEESLQ"
FT   gene            complement(607581..608198)
FT                   /locus_tag="Fjoh_0571"
FT   CDS_pept        complement(607581..608198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03606"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMG8"
FT                   /protein_id="ABQ03606.1"
FT                   /translation="MKSTVAKALFNSYSYAEYRKLVTDLLSEGKSTGSQQSESLTNYSK
FT                   LNEARMNRLEKTITISEVAISKLRHLDNHYIWLVISEGWCGDAAQILPILNKMAHESDK
FT                   KIDLRIVLRDENDELMNQYLTNNGRAIPKVIVICKEAGIVRADWGPRPKGATELMETHK
FT                   REVGPIDEKIKTDLQLWYLADKGISVQSELVEIMENIKYNRL"
FT   gene            complement(608291..608824)
FT                   /locus_tag="Fjoh_0572"
FT   CDS_pept        complement(608291..608824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03607"
FT                   /db_xref="InterPro:IPR025409"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMG9"
FT                   /protein_id="ABQ03607.1"
FT                   /translation="MKDELILLVKEIATAAEKSFLSLFENKESYYYCVLITTGEALPPF
FT                   ISAWSREALEVFRKETSDEDADLLKWFYGDSPYFNFGEENFEIVRELFYVRKLDLDDEI
FT                   EYFKEIDFRIEAMVLAMELLDKKGIFSLNQPRDKVYINVEVVPPDSSNTIRALRLNKKE
FT                   DISDWLNEVTEDDL"
FT   gene            complement(608842..609351)
FT                   /locus_tag="Fjoh_0573"
FT   CDS_pept        complement(608842..609351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03608"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMF4"
FT                   /protein_id="ABQ03608.1"
FT                   /translation="MKLGIAKLNDEEFVNSLTEEDLANLIIEWCEDWLKYKEISMDGLY
FT                   VKSLWYRFETIIWRFGADLKTILKREKFKKSQLIEKSIICVLNDKRYGKGRETFALLVG
FT                   DFKFHLSQKNVNILLNDEDVYGHVIISLRKLKMKGFEEKMTEIINSEKGWIKSEAKKYL
FT                   DKSTSW"
FT   gene            609508..610215
FT                   /locus_tag="Fjoh_0574"
FT   CDS_pept        609508..610215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0574"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03609"
FT                   /db_xref="GOA:A5FMF5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMF5"
FT                   /protein_id="ABQ03609.1"
FT                   /translation="MKYKRILLKLSGEALMGDLQYGIDPKRLGEYADEIKQIHDKGVEI
FT                   AIVIGGGNIFRGVAGASAGMDRVQGDYMGMLATVINGMALQGALEDKGMKTRLQTALKM
FT                   ESIAEPYIKRRADRHLEKGRIVIFGAGTGNPYFTTDTAAVLRGIEINADVILKGTRVDG
FT                   VYDSDPEKNASAVKFDFISFDDVLKKGLNVMDTTAFTLSQENKLPIVVFDMNKIGNLLK
FT                   ICEGENIGTVVNI"
FT   gene            610358..610921
FT                   /locus_tag="Fjoh_0575"
FT   CDS_pept        610358..610921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0575"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03610"
FT                   /db_xref="GOA:A5FMF6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FMF6"
FT                   /protein_id="ABQ03610.1"
FT                   /translation="MTEEIDFILESTEESMNGSIAHLEKEFLNIRAGKASPAMLGGVFV
FT                   DYYGSATPLSQVSKISVPDARTITLQPFEKNMLQAIEKAILIANIGFNPMNNGDVIIIS
FT                   VPPLTEERRRDLAKQAKSEAEDAKIGIRNVRKDANTDIKKLEKEGTSEDICKSAEEEVQ
FT                   NLTNTYIKKIDELLAAKEAEIMKV"
FT   gene            611040..613535
FT                   /locus_tag="Fjoh_0576"
FT   CDS_pept        611040..613535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03611"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMF7"
FT                   /protein_id="ABQ03611.1"
FT                   /translation="MRLFCLLTLFFTLSIQAQFQINGIVTDSNNKPLPFATITTSDNSN
FT                   TITDVDGKFIFKTLSKSGNFTVSYIGFQTKIVALAENKKFYSISLIQKTDDLKEVIVSN
FT                   ENPALTIIKKVIANKNNNNPQKRLKSFDYKTYNKLIVTANPDSIDGRIDSSAVYKDLNK
FT                   KKINIDSSDYKFKEIITKQHLFQTEKVSQYQFGNNKLKETVLGTKIAGFKNPIYEVIAF
FT                   NLQSISIYDNKYELFETKYENPISNTAPASYNYKLLDTVNIKGRETFMIYFKNKHKRKT
FT                   SGLEGVLYIDSQNFAIAKAVMRIKGVLDISGIHEFNYVPNEKIWFQSNTTFKIVKGKND
FT                   DDIKILGGTIQFDGDVAEDFEPRKKAASDFTYLLSESNNFDIHYNLETPIKNPSLYIEI
FT                   KDDAGKKPEEFWNQYRKEALDQKSQKTYQLLDSLSVSRRIEKRLGFGRKIINGYIPIGP
FT                   VDLDLKKIISYNNYEGFRLGLGGITNDKFSKNFRIEGYTAYGTKDGVVKYNLGAGVLLD
FT                   KNTNTWLNGSYTDDIREIASTVFAVDKRVFKIYDPRPINISTFYHYTSWKANVQTKIIP
FT                   KTEAVLELARTEIEPKFDYLFNYNGQLYSSYIMTTAMLSIVWAPFSDFMQTPTGRTESD
FT                   KRFPRFTLQYTQSLPNVLDNDFNFGKIDFKTEYEKKYLNGQKTSLLLQGGYALGDVPLT
FT                   HLYNTMPNNLTKETVIQRITFAGRNSFETMFFNEFFSSQYIFFQVKHGFNRIKILKKVR
FT                   PTIVLVSRMAWGNMEKPEQHVGPEYKTLDKGFFESGIELNKIYKGFGLGGFYRYGPNQL
FT                   MKFEDNIAVKISYVLDLGL"
FT   sig_peptide     611040..611093
FT                   /locus_tag="Fjoh_0576"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.858 at
FT                   residue 18"
FT   gene            complement(613617..614096)
FT                   /locus_tag="Fjoh_0577"
FT   CDS_pept        complement(613617..614096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0577"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03612"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMF8"
FT                   /protein_id="ABQ03612.1"
FT                   /translation="MIIFVGFYLNKLFMEKFDDSQLYKLLYGKDFSKIKDFLEKYGLDS
FT                   VDRGGRTFLMTVVVDGDEKLVKDLLALGCGINNKDTQGLTALHLAVINNKVDAVKVLLS
FT                   FDCDVNIVDNIGNSALWRAAMSLKNDSEIIKLLLDKGSDVNLANKHGVSPKDLLN"
FT   gene            complement(614177..616447)
FT                   /locus_tag="Fjoh_0578"
FT   CDS_pept        complement(614177..616447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0578"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03613"
FT                   /db_xref="GOA:A5FMF9"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMF9"
FT                   /protein_id="ABQ03613.1"
FT                   /translation="MNNIKNSLFYVTIIGGFTALIYWIISKGAAIEAGRHIVKKQIESN
FT                   HWNDFLDSMVHNLQHPLAILLAQIVTIILVARLFGWFFRKIGQPSVIGEMIAGIVLGPS
FT                   LVGMYFPEFSAALFPKESLGNLQFLSQIGLILFMFVIGMELDLKVLKNKAHDAVVISHA
FT                   SIVIPFALGLTLAYFIYHTFAPIGVEFSSFGLFMGIAMSITAFPVLARIVQERGMQKTK
FT                   LGTIAITCAAADDITAWCILAVVIAIVKAGSFTSSLYVIGLAILYVIIMLKIVRPFLKR
FT                   VGDLNSTRESLNKPVVAIFFITLLISAYAAELIGIHALFGAFLAGAIMPENNKFRNIFI
FT                   EKVEDVAIIVLLPLFFVFTGLRTQIGLLNDPELWKVTGLIIAVAVAGKFFGSALAAKFV
FT                   GQNWKDSLAIGALMNTRGLMELVVLNIGYDLGVLSTEIFTMMVIMALVTTFMTGPALDL
FT                   IGFIFKDKITAIPQEIGNKSKYKILLSFATPERGKKLLKIANSLVKKQGDNSIVTAMHL
FT                   SLSTEVHSFDIKDHERKMLVPVVEESHRLNQNMVSMFKVSNDIDTDIIDAANQGEYDLL
FT                   LVGLGQSIFDGTLLGKILGFTTRIVNPDRLIDKFTGKEGLFENNPFDERTRHIITKTKM
FT                   PVGILIDKDLEEVNQVFMPIFNKEDAFLIDYAKKLINNNGSQITVLDASGDVKNTREIQ
FT                   ETIRSIEQIAPNHIMIMHDRTIKKEFLDGQNLMIISLDSWKKLIESQSTWLNNTPSVLI
FT                   LKP"
FT   gene            complement(616561..617280)
FT                   /locus_tag="Fjoh_0579"
FT   CDS_pept        complement(616561..617280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0579"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03614"
FT                   /db_xref="GOA:A5FMG0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMG0"
FT                   /protein_id="ABQ03614.1"
FT                   /translation="MNTKLKCLLLDDELPGLTYLKMLCEQIPELEIVKTFNNPEKLLSD
FT                   IPDLDFDLLISDIEMPGMDGLHLAEILENKLVIFCTAYKDYAADAFNIDAVDYITKPVK
FT                   LERLQKAVSKAFERFDKTDNSKKFIQLNTDKGKTLLYFNKIQYITTASSDSRDKTVLLA
FT                   DGSLLNLKNVKFDTLLQELPDADFCRINKKEIVAVKAIKFFNHNEIVLHHLEENNKNTS
FT                   LILSETYRSDFLKKVKL"
FT   gene            complement(617243..618004)
FT                   /locus_tag="Fjoh_0580"
FT   CDS_pept        complement(617243..618004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0580"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03615"
FT                   /db_xref="GOA:A5FMG1"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMG1"
FT                   /protein_id="ABQ03615.1"
FT                   /translation="MQENNTTTFIFLAILLLLIVIICFMMYQLMQSKKAKEDAEKSFYA
FT                   LEVKVNDLQLENLESKLNPHLFKNILNSIQSHAYQTYFALDKLANVLDYILYESKKKFV
FT                   TAKEEINFALNLIEINKIKISPLFELKIKTNINEDDKLYDQPLLAPLISIDLIENAFKH
FT                   ADLQSADAFISVVFEFKDNAFFMTVSNKISDKKVLKKERSGFGHATLEHRLRIIYKNNF
FT                   KLDKFIENDVYIAHLKIDLLEYKTEMLASGR"
FT   gene            618225..620591
FT                   /locus_tag="Fjoh_0581"
FT   CDS_pept        618225..620591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0581"
FT                   /product="exporter of the RND superfamily-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03616"
FT                   /db_xref="GOA:A5FME4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A5FME4"
FT                   /protein_id="ABQ03616.1"
FT                   /translation="MKNAVQVGFWEKLARIILKNRITILVILSALTIFFGYQWKNLSMT
FT                   YTEANLLPKDHIANKDYQKFLDKFGEEGNLIVIGFKDPKFFTPKNYAAWTELMNGLKKA
FT                   KEVDLVISLNDLKKLEKDTVNQKFVLAPFIDENKVLDAAYLKSVQYDLFHNLPFYEGLL
FT                   FNKESGSVRSAIYMNKALVNTAERKTFILNDLVPKIDKFEKTTGIDLKVSGMPYIRTIN
FT                   ADNMKGEIGLFIGASLLTVSLIFFFFFRSFRATFISICILIVGVTWSFGTLGLFGYKIT
FT                   ILTAIIPPLIIVIGITNCIFLINKYQQEIKLHNNQAKALQRVISKIGHSTFMTNLTAAI
FT                   GFATLMITGNELLFEFGLVTSINVLSVYTLTLFIVPIIYSFMPLPKAKHLYHLDKTYIS
FT                   TLLNTVTTIVKGKKTIVYCIYAVLFLVSLNGIRQMKVSGSLIGEMPKSASFFKDILFYE
FT                   KEFNGVMPLEIMIDTKKKKGVMKPATIRKMDELQNTISEIPELAKPVSVVNLVKYAKQA
FT                   FYNGNPEYYQLPTSQEQTFILGYAKNATKNSKENLMKAYVDSTGQYARITTFMKDIGTD
FT                   EMAKVEGKLRKKIDEIFPKDRYEVTITGKALVFQKGTTYLAHNLIESLLFAILTIAILM
FT                   LYLFRSFKMVAASLITNILPLCITSGLMGYFGIPLKPSTILVFSIAFGISVDNAIQFMA
FT                   KYKDELTQNKGKVKKSVFSALRETGVSTFYTSIVLILGFATFTLSSFSGTIALGGLISC
FT                   TLVFAMFANLVVLPSLVLTFEKKKTKKEELENLEK"
FT   gene            620625..621161
FT                   /locus_tag="Fjoh_0582"
FT   CDS_pept        620625..621161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03617"
FT                   /db_xref="InterPro:IPR035324"
FT                   /db_xref="UniProtKB/TrEMBL:A5FME5"
FT                   /protein_id="ABQ03617.1"
FT                   /translation="MGKIEIYSSKKKSFFLLIVSLLFVIGGIWMFMNAENLNSFRLKSP
FT                   ILIKAIGIISVLFFSLSLYISIRQLVKNKLLLIVDGNGIIINPKKNSFELINWKNIEGF
FT                   SELKIQSQKMLLIDVNNPDFWIQKETNLIRKKMIQYNFKQYGSPFCLSAVSMQINHAEL
FT                   MKVLNENLEKYKKQA"
FT   gene            621391..622836
FT                   /gene="asnC"
FT                   /locus_tag="Fjoh_0583"
FT   CDS_pept        621391..622836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="Fjoh_0583"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /note="TIGRFAM: asparaginyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (D, K and N); nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03618"
FT                   /db_xref="GOA:A5FME6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A5FME6"
FT                   /protein_id="ABQ03618.1"
FT                   /translation="MKHTKVRDLLNSTTTLQEVNAKGWVRTFRNNQFIALNDGSTINNI
FT                   QCVVDFENTPEETLKRITTGAAVSVIGTLVESKGAGQKYEIQVNKLEILGDSDAEKFPM
FT                   QPKKHSLEFLRENAHLRVRTNAFGAIMRVRSVLSYAVHSYFQQKGFVYVNTPIITGADA
FT                   EGAGEMFQVTSLPLDNLPKNEEGNIDFKKDFFGKHTNLTVSGQLEGETFAMALGQIYTF
FT                   GPTFRAENSNTSRHLAEFWMIEPEVAFNDLDDNMDLAEDFIQYVIKYALDNCKDDLKFL
FT                   EGRLLEEEKSKPQAERSEMALLEKLNFVLENNFKRVSYTEAIDILRDSTPNKKKKFQYL
FT                   INEWGADLQSEHERFLVEKHFKCPVILYDYPANIKAFYMRLNDNTEPGRETVRAMDILF
FT                   PGIGEIVGGSEREERYDVLVEKMEKLGIDKEELYWYLDTRRFGSATHAGFGLGFERLVL
FT                   FVTGMTNIRDVIPFPRTPGSAEF"
FT   gene            622967..624427
FT                   /locus_tag="Fjoh_0584"
FT   CDS_pept        622967..624427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0584"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor, core-binding region; sigma-54, DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03619"
FT                   /db_xref="GOA:A5FME7"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A5FME7"
FT                   /protein_id="ABQ03619.1"
FT                   /translation="MLKQFLNLKLSQKLSPQQIQLMKLIQLPTQAFEQRLLEEMNENPA
FT                   LEAGKEDDYEADEYANEDYDDYDDAESDRIEADDINIDEYLSDDDTPDYKTQVNNYSDD
FT                   EERETPFAAPISFHQDLINQLNTFILNDEEREIAEFLVGSIDDMGYIRRSIPDIVDDMA
FT                   FTQGIYTDEAMVEKMMTVIHELEPSGVGARDLQECLLLQLKHKTPTEYVDLAIDIIENQ
FT                   FDAFTKKHYDKLLQKYSVSNEQLKKAIHEIERLNPKPGGSFAGNNKVTENVVPDFAIRI
FT                   VDGELELTLNGRNAPSLHVSKDYQEMMQTYKESKDKSTAQKDAVQFIKQKLDSAKWFID
FT                   AIRQRQETLFVTMNAIMHYQEEYFLDGDETKLKPMILKDIADMVGLDISTISRVANSKY
FT                   VETPYGTKLIKEFFSEAMKNDQGEDVSTLEIKKILQNTIEEEDKRKPLPDDQLAEILKE
FT                   KGYPIARRTIAKYREQLDIPVARMRKKI"
FT   gene            complement(624801..625238)
FT                   /locus_tag="Fjoh_0585"
FT   CDS_pept        complement(624801..625238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03620"
FT                   /db_xref="UniProtKB/TrEMBL:A5FME8"
FT                   /protein_id="ABQ03620.1"
FT                   /translation="MEEKQNKRKQNVLLLVVIGIALALAVFFQFFLSEKSDEVKTEVTE
FT                   LVEKYNKSCPLKIQEGIRLENVTLTKERVVQYNLTLTNVEKATAETDVIQEEIEKSLLS
FT                   TAKANPGLQVFRDNDYTLVYSYSDKKKAFLFDITILPDQYK"
FT   sig_peptide     complement(625161..625238)
FT                   /locus_tag="Fjoh_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.301 at
FT                   residue 26"
FT   gene            complement(625275..625859)
FT                   /locus_tag="Fjoh_0586"
FT   CDS_pept        complement(625275..625859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0586"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="PFAM: thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03621"
FT                   /db_xref="GOA:A5FME9"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FME9"
FT                   /protein_id="ABQ03621.1"
FT                   /translation="MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQRV
FT                   EIFKPAIDTRYHDEMVVSHDANEIRSTPVPAAANISILAQGCDVVGIDEAQFFDDEIVT
FT                   VCNDLANRGVRVIVAGLDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRK
FT                   TDNDKLVMLGETEEYEPLSRAAYFNAMKKNQ"
FT   gene            626105..627124
FT                   /locus_tag="Fjoh_0587"
FT   CDS_pept        626105..627124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03622"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMF0"
FT                   /protein_id="ABQ03622.1"
FT                   /translation="MKKKLEADLISIAHRILKLKNKSDINQLYLETQKLYEKLAILKFV
FT                   DENFDEVKPTISHSEISAEIETIFENKTISEEILPTETAIENPIQAEEAEIEKTPEPVV
FT                   IEEIPVAETPVAEAPIAAVPEEITPEPAEEITEEPKAPEIEEPEVNEEVEKTEEPKSNI
FT                   GELSFTTVSDLKPIPDFKPAFELDLEEIKEEVKEEPKIESKSTPIPIAFEDFGINYADA
FT                   QFVKVDSFEPVSSNNDLKEQKNAPVLETSREPKSVSLNDKLAKGFHIDLNDRIAFTKNL
FT                   FGNSTEDYSRVLNQLLTFDSYAEAKDFIENMVKPDYNNWEGKDDYAERFLGIIEKKFA"
FT   gene            627161..627877
FT                   /locus_tag="Fjoh_0588"
FT   CDS_pept        627161..627877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0588"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03623"
FT                   /db_xref="GOA:A5FMF1"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMF1"
FT                   /protein_id="ABQ03623.1"
FT                   /translation="MSKLYIVPTPIGNLEDMTFRAIRVLKEVDLILAEDTRTSGKLLKH
FT                   FEIGTHMHSHHMHNEHKTTENLIARLKAGETIALISDAGTPAISDPGFLLTRACVENKI
FT                   EVECLPGATAFVPALVNSGLPNDKFVFEGFLPDKKGRQTRFLALAEETRTMILYVSPHK
FT                   LVKTLAEFVQYFGEDRQVCVSRELSKLHEENVRGTAKEVLAHFEKTAPRGEIVVVVAGK
FT                   TITKEAKKSKFSKDEE"
FT   gene            627963..628307
FT                   /locus_tag="Fjoh_0589"
FT   CDS_pept        627963..628307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03624"
FT                   /db_xref="InterPro:IPR014984"
FT                   /db_xref="InterPro:IPR038604"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMF2"
FT                   /protein_id="ABQ03624.1"
FT                   /translation="MSIQAFLEKVKQTPTQITFPETIAVIEENYNFTPTAFQNGTQHNA
FT                   AGENSGSCKLFSFAKLQNLSKEETLACFGAFYFEEVLGDPNGTNHQNIRNFINLGWDGI
FT                   QFEGNALEAK"
FT   gene            628494..630200
FT                   /locus_tag="Fjoh_0590"
FT   CDS_pept        628494..630200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0590"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase, RecJ domain protein;
FT                   phosphoesterase, DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03625"
FT                   /db_xref="GOA:A5FMF3"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMF3"
FT                   /protein_id="ABQ03625.1"
FT                   /translation="MRWTLKPKPSEDKIKHLAQALNVEDFVATLLIQRGIETFEDAKNF
FT                   FRPSLEHLHDPYLMKDMDKAVARIERAIENQENIMVFGDYDVDGTTAVSLVSSYLKSHY
FT                   PHIATYIPDRYDEGYGISYKGIDYADDNGISLIIALDCGIKSIDHIAYAKAKNIDFIVC
FT                   DHHRPGEILPDAVAVLDPKREDCSYPYDELCGCGVGFKLIQALGQNRNETIEDLVPYLD
FT                   LVATAIAADIVPITGENRVLAYFGLKVINSEPRPGIKALVHQAKKKVLDITDVVFIISP
FT                   RINAAGRIKHGNHAVELLTEFDLEQAQQFASEIEQYNADRKDLDKKITKEAFQQILQNN
FT                   EEERFSTVVFQEDWHKGVIGIVASRLIETYYRPTLVFTKSGDKYAASARSVKGFDVYNA
FT                   LDACSEHLEQFGGHMYAAGMTLKAENYQLFKDAFEKCVQETIQPEMRTPEIEIDAEIDF
FT                   SDITPKLIRILKQFEPFGPQNMTPVFMTKDIKDTGYAKTLGAEEEHLRLFVKQSLGTDG
FT                   IAAIGFGLGKKLNIAQNQNPFQLAYTIAENEWNGNISTQLMLKDIRTDGRD"
FT   gene            630187..631470
FT                   /locus_tag="Fjoh_0591"
FT   CDS_pept        630187..631470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0591"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03626"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMD6"
FT                   /protein_id="ABQ03626.1"
FT                   /translation="MEEIKSNKPDPYQALRYREFNVFLLLRFAMVFAWSMQFIVIEWEV
FT                   YSLTKNPLSLGIIGLMEVIPAVGMALFAGHIVDQKEKKGLLVKCILGFSIISFGLFLLT
FT                   WPKVVGGWSSNIILYSIYALVFFGGLVRAFMGPTIFSLLSLIIPKKVYPNAATWSSSVW
FT                   QIGAVMGPALAGFSINWIGVHWSMCLVFGFSILSLIALSQISAKPIINPKIGESIKDSL
FT                   TEGLTFVFKNKIVLGALSLDMIAVLFGGAVALLPVFAQDILKVGSEGFGILRAAPAVGA
FT                   FITMIVSAYVPLYKNAGKKLLIAIFVFGLSIILFGLSTYFWLSVFALFLSGLADGISVV
FT                   IRQTILQLKTPDHMRGRVGAVNSIFVGSSNELGAFESGATAKLMGAVTSVVFGGSVTLL
FT                   TVVFTALKSPTFRNLDLKRDMDEHHKLE"
FT   gene            631501..632385
FT                   /locus_tag="Fjoh_0592"
FT   CDS_pept        631501..632385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0592"
FT                   /product="Peptidase family S33"
FT                   /note="PFAM: alpha/beta hydrolase fold; alpha/beta
FT                   hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03627"
FT                   /db_xref="GOA:A5FMD7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMD7"
FT                   /protein_id="ABQ03627.1"
FT                   /translation="MFCFFANAQNLYIKTYGNEKNKPVIFIHGGPSGNATLFEGTTAQK
FT                   LADQGFYVIAYDRRGEGRSADPDAKFTYEEAFQDLNFIYKIYNLKKAVLLSHSFGGLVA
FT                   TLYANKYPQNVSALVLAGALFSQQETYDHILNTLKKKYNNDSEQLKRIHVVENLDKNSA
FT                   EYRKKCFELAGENGFFKMPNPTAESKKLYTDYETGEFYKTNIRNKNAPLLFYQNEKQNN
FT                   IDSRPFLKKIKAAGVPIYGIYGKQDGIFSLAQIKSIKDLAGEKHFAFLDNCSHYLFVDL
FT                   QKEFLDNIKKWLK"
FT   gene            632465..632821
FT                   /locus_tag="Fjoh_0593"
FT   CDS_pept        632465..632821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03628"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMD8"
FT                   /protein_id="ABQ03628.1"
FT                   /translation="MREIEQIYHNNFGIAFYWKQNSQTILDKVQLVFKETGFYFTISEL
FT                   NQFCDLIEDSLLENTCCEACEMKYSCHKFLLKTPCNSIDLAVSMTELKSIKDLVEGSLF
FT                   KIELDEYVYGVGLN"
FT   gene            632905..634116
FT                   /locus_tag="Fjoh_0594"
FT   CDS_pept        632905..634116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0594"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03629"
FT                   /db_xref="InterPro:IPR010177"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMD9"
FT                   /protein_id="ABQ03629.1"
FT                   /translation="MKNTCIIIAFMVLSVFLTNCTNKSDEYIDPRGTNYAGSESCIQCH
FT                   KAESESAFHSSHFKATSPALKENVLGHFSKGKNTFVYDKNTKLVMEERNDTLYQVLYKN
FT                   NKEVEAYPFEVLFGVKHAQTSAYWKNHYTYELPVSYYKSLNSWATSPGYSATVPNFERK
FT                   IEKECYGCHSSNIASRYITTSSDSITFTNMEVEDFMNPKTLIYGIDCERCHGPAKKHVQ
FT                   THLKFPDLKLAQDIVSFKKLTRQQKIDACAICHSGNDKLKIKSRFEFRPGDNLLDYFRG
FT                   VPGSNDNKVYDVHGNQLGLLSQSKCFKKNETMTCMNCHNPHENTSKSMVSYSKICMSCH
FT                   QDPKHTPETLKTVSKTAMAENCIECHMPKQDSNAIRFQQSNTAAMSSYSLRTHKIGIYP
FT                   ANKK"
FT   sig_peptide     632905..632964
FT                   /locus_tag="Fjoh_0594"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.278 at
FT                   residue 20"
FT   gene            complement(634117..634860)
FT                   /locus_tag="Fjoh_0595"
FT   CDS_pept        complement(634117..634860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0595"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03630"
FT                   /db_xref="GOA:A5FME0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A5FME0"
FT                   /protein_id="ABQ03630.1"
FT                   /translation="MKKVYFASDQHFGAPTPELSLPREKKFVAWLDEVKEDAEAIFLLG
FT                   DLFDFWFEYKTVVPKGFVRILGKLAEIRDSGIPIYFFVGNHDLWMNDYFETELNIPVYH
FT                   DNKEFTFNGKTFLIGHGDGKGPGDKGYKRMKKVFTNPFSKWLFRWLHPDVGVSLAQYLS
FT                   VKNKLISGDEDIKFLGEEKEWLILYAKRKLETKHYNYFIFGHRHLPMIRPVGENSEYVN
FT                   LGDWIGYFTYGVFDGETFELKEYKK"
FT   gene            complement(634933..635385)
FT                   /locus_tag="Fjoh_0596"
FT   CDS_pept        complement(634933..635385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0596"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03631"
FT                   /db_xref="GOA:A5FME1"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A5FME1"
FT                   /protein_id="ABQ03631.1"
FT                   /translation="MSNIRITKQFSFETGHALYGYDGKCKNVHGHSYKLSVTVIGSPIT
FT                   DRSNVKFGMVIDFSDLKKIVKEEIVDQFDHATVFNQTTPHIELANELKNRGHHVILVDY
FT                   QPTSENMVVDFAERIKNRLPVGISLFSLKLQETESSFAEWYASDNL"
FT   gene            complement(635418..635594)
FT                   /locus_tag="Fjoh_0597"
FT   CDS_pept        complement(635418..635594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03632"
FT                   /db_xref="GOA:A5FME2"
FT                   /db_xref="UniProtKB/TrEMBL:A5FME2"
FT                   /protein_id="ABQ03632.1"
FT                   /translation="MTIISLFQNVDVAEKIKHAPDSSYQIGVVIGSFIPFLVLGGIALW
FT                   MYNRAKKRDKNGY"
FT   gene            complement(635685..636449)
FT                   /locus_tag="Fjoh_0598"
FT   CDS_pept        complement(635685..636449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0598"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03633"
FT                   /db_xref="GOA:A5FME3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FME3"
FT                   /protein_id="ABQ03633.1"
FT                   /translation="MSSEIIKGSLQTSFQNTIATVQFGHPASNSFPRELLDRLTSEINE
FT                   LSRNEKVSVIILKSEGAKAFCSGASFDELLQVENEEQGTEFFSGFAHLINAMRNCNKLI
FT                   IGRVQGKAVGGGVGIISACDYVFATQESDIKLSELAIGIGPFVIEPAVSRKIGKTAMVE
FT                   MTLTAHAWKSAEWAFQKGLYSVLSNAENLDAEVENFAQKLSSYNPESLKEMKKIIWEGT
FT                   EQWESLLFERAAITGKLVLSDFSRNALLQFKK"
FT   gene            636553..636629
FT                   /locus_tag="Fjoh_R0020"
FT                   /note="tRNA-Ala1"
FT   tRNA            636553..636629
FT                   /locus_tag="Fjoh_R0020"
FT                   /product="tRNA-Ala"
FT   gene            637078..637584
FT                   /locus_tag="Fjoh_0599"
FT   CDS_pept        637078..637584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0599"
FT                   /product="outer membrane chaperone Skp (OmpH)"
FT                   /note="PFAM: outer membrane chaperone Skp (OmpH)"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03634"
FT                   /db_xref="GOA:A5FMC9"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMC9"
FT                   /protein_id="ABQ03634.1"
FT                   /translation="MIKHKSSLLLIINSLLVFSLIFYVILTSFTSKTKIVYVDTTELFN
FT                   GFSMTKELKSKGEKEFISKKIALDNLYSQIQSKSINASQKEVLMKQFIQEKEELEQFNQ
FT                   IYAATESSKIWSRINSYSEDFSKENNYDLIIGTENKTTVLYADEKITVTKELLTYINKR
FT                   YEGLK"
FT   sig_peptide     637078..637179
FT                   /locus_tag="Fjoh_0599"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.842) with cleavage site probability 0.386 at
FT                   residue 34"
FT   gene            637568..638170
FT                   /locus_tag="Fjoh_0600"
FT   CDS_pept        637568..638170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0600"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03635"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMD0"
FT                   /protein_id="ABQ03635.1"
FT                   /translation="MKDLNKLFCIFCVLFFISCKKETKNDSKNSEIRDRYFNLEKIGWK
FT                   SRAYTQKADDIAFTAIEVPIQYYLLKDLGTENLIPVDSLYEKNKRERIIEFTFQQDEEK
FT                   DLLEKKFTGIDYTDAVKYMSFGLEKDFYVVTSKKDTIACSGVNYERTYKIAPYQKVLLF
FT                   FSGIDPNEKIQLVYSDYLFRKGTLKFQFKDTYTQIAL"
FT   gene            638167..643740
FT                   /locus_tag="Fjoh_0601"
FT   CDS_pept        638167..643740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03636"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMD1"
FT                   /protein_id="ABQ03636.1"
FT                   /translation="MIQPKISKLKKTVAIYLAMMILLETLQPMQMYALTGGPSQPEFES
FT                   FTPIGTSDMVDLASGDFNYNIPIMDVGGYPINLAYNSGVTMDQEASWVGLGWDLNVGQI
FT                   TRQMRGLPDDFNGDEMTYENNMKPNVTVGSDFNVFFGAFGVNEVKANVGMSIKYNNYEG
FT                   FGATASGGLSAQIANNIRVGMNLESSASEGVSASPSVAYQDIDDTKKTRDNTPTGNFGI
FT                   SYNSRKGVENVTYSASMNLKKIKDKAGNEKTRTINGFAGSGSTSFIDASFTPTKRVGMV
FT                   SSNFIFNLNIEGEFWGIEPGMKFTGYRTSQGIKNSEKYKTERAYGFENTYNASTADVLD
FT                   FNREKDRTFNKNTTSLPLTNNTYDLYNIQGQGISGMFRPYKSQVGYVFDKETNDDSVGA
FT                   NLGLELGAGGLTHWGIDATVTLGKSNTSLWSASNPALGRFKENKTNNRPDYEKVFFKNI
FT                   GGNHVDKELDLFNTKLGGYDAVKLGLSGGKFSRSTDVKYAKNTGAIAYTGAVKRESSRL
FT                   SRNQSIQKLTKVEAKRFGSKLQPSEYSRDHHTTEIRITKEGGERYIYGRAAYNTLKKEV
FT                   TFDVSDKDRPAEKLDYRNGLIHYDSGDNSANNKKGGDQYFNRVTTPPYAHSYLLTSVLS
FT                   ADYQDLKNDGPTDDDLGNYTKFEYDNKTAEHLYKWRIPFKENEANYDEGLRSSKKDDKG
FT                   NYQYGEKELLYIKKIVTKTHVAVFHLSERNDAYGVKGENGGIGYDSKMYKLDKISLYSK
FT                   PEYLAQGDNATPIKEANFEYNYSLCKGIDNSINNEGKLTLSKVYFTYKNSNMGKYTPYV
FT                   FNYGFNPDYDMKAYDVWGNYKKVKEGVNEGTLAQLSNAEFPFVDQSNRTQADEYASAWL
FT                   LKSIRLPSGGQMELNYEADDYSSVQNKDAMQMFKVVGSGSKEGLTANNISNGIERKTLG
FT                   KYIYVQLDHKVDNSKEFYDQYLKNVGDASNPLYFRFLLNMVNPNPLPGVDSTDKYDYVT
FT                   GYLNIEGIKNKTVDCGFLEVNDKQYVAIPIDYVGKGDGFNKDSHEVNPISKAGWNFGRQ
FT                   NLNRLVYSMYNEEDTTDLKSIVMEMIGWLPTILDIFKSPNAKLEQTEIASRFITNKSWI
FT                   RLIQPTGKKVGGGTRVKNIAINDQWDVMTANTNKELYQQSYGQKYVYETENGKSSGVAT
FT                   YEPLGCKENPFVKPFYDQNKRDLPLGPDNTNYVEEPFGESFFPAPKVTYSRVTVANLSR
FT                   EKHNESNVVTNSVKKHATGSVVTEFYTTKDFPTLTDRTTLSLNYDKSSALASLLNLKVK
FT                   DHITLSQGFSVHTNDMDGKMKNQRVYGEGQKDFISGVDYKYNTITDAQNRNEGRLNNTV
FT                   QTIDSKGNIASKLVGVDYDVINDFRENKSTTQIAGIHYNTAGIPIFLAIIVVPVPLPSY
FT                   SQYESQLRSAVTTKVIHTTAILSETIAYDLGSKVSTKNLAYDAETGEVLLTETVNEYND
FT                   KYFSFNFPAYWSYAGMSQAAKNIGLEWDITKTGNNQYQLKDEGIKTFLESDYLVDGDEL
FT                   WLNGLAPDGKTKTLMKAWAVHVTKDNFKLIDEKGILIKSDVINTAKMKVIRSGYRNLQT
FT                   ASMASVTSMTNPLYNYDGNNKITTIKTNIGNNPFMSSDSSNRIVNASAVQYNDVWPSQC
FT                   ECNLPKMVFENGNLVFEYEKENNTAEEDDIAKRSFNPYLYNILGNWRANKSYAYLTGRN
FT                   YTVDPTPRKTGFFNDFYPFYVYDTTKNVWGKTASNYDRWTFASEVTQYNPAGQEIENKD
FT                   ALKRYSSALFGYNNRFPVAVASNTKYTELASDGFEDYDLSNCGTESHFDFQAQLKTNDV
FT                   SVSDRQAHTGRKSLKISPSKKAIIKKQVVSCNEIPSTVTAKK"
FT   gene            643740..651215
FT                   /locus_tag="Fjoh_0602"
FT   CDS_pept        643740..651215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0602"
FT                   /product="Two component regulator three Y domain protein"
FT                   /note="PFAM: PKD domain containing protein; leucine-rich
FT                   repeat protein; Two component regulator three Y domain
FT                   protein; SMART: leucine-rich repeat-containing protein,
FT                   typical subtype"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03637"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMD2"
FT                   /protein_id="ABQ03637.1"
FT                   /translation="MKIQMKLKYTLVFTIISFFISTAGFAQQYTDEEIGLNVSKITASL
FT                   KEKGVAEADIEFEISLLRKMHTNQYAKIKQNENEILKETKAKALTNKSALTADISSTEK
FT                   AALQALYNSTNGANWINKQGWDFSTPVTSWDGTNGWYGITVTNGTITSINLGQNNLTGT
FT                   LASEIGSLTNLQQLYLQDNELSGAIPNEIGNLLSLKILYLNDNKLAGSIPTQMGNLVNL
FT                   SQFALSFNKLSGSIPSSLGNLNNVEFFFIGNNELTGSIPPEIGNLSKVTHLYLYHNQLS
FT                   GSIPTQIGNLSKVQALFLEYNNLSGSIPNEISNLSSLKFFNLSNNQLTGPIPTGIGNLY
FT                   YNLLEVYFRNNQLSGPLTNDILLYNLVSLYLDNNQLSGPIPSSINRLRNIGLLYLDHNQ
FT                   FTGTIPANIGNLPEAIHLNLSNNQLTGTIPPELGGLSKVQMLDLSFNQLTGSIPLEIGN
FT                   LTSIRNLFLNNNEFSGTIPSRLTQLTLIGNFYINNNKFRFIDFANEYQTYKNFYGFKYV
FT                   DQAKTDTKETKNFDIGSSTTLTMCTDNRYTINDTFQWYKGKFPDGGLINGATNREYTIS
FT                   NLGASDAGDYYCLSSHPQITIATNPDRNLVLEREPITLKIACATEVTGASIMPSNNSFT
FT                   TDTNIEFYLDSTYPNLTYNWTFYNLDNTPNETYEGNYILKSFDTPGTYRMNLIVMQENG
FT                   CTTSFDKYITVKYANPCLSSETGSIIVKGFDYDYNNLPNNVFSNTSTYFSFDTMSRNLS
FT                   YNWKFYNPDGTFLTSKPYQSFDIIFENNGEHKVVLEITDLYGCTATFEKIIPVIKDCRK
FT                   TGVILTYEGSSLDEILENTSLSVKLFGNDFDLDGKQFDWEFLNPNGSIVSTGSNPVFTV
FT                   TPPTVGNYRINLKITDPESDCVYDFSVVLEAVDACRMTHLTRNGYISLNGQSEYLNDVL
FT                   FLDLNQTVELGLFREWYNETGKTFNLEWNFYSPNSELISTGNQPRFPITLTTEGFYKVT
FT                   LKVTDPETGCFTEVSRKFSSVKQNSCTLTNERSNQVKDLTRALIKKLILRTVTGETDAQ
FT                   INASPFLEEFTSLKPFIINSPNDKIYNYKTTRNKFGILINVDFSFSPERESDVHISVRD
FT                   GLFTNFQRDYVYKNIDDAVYIDINQYVTADETLLSCWTYAKDRSLAKSALEQKDCRYSS
FT                   EIKNINFCPNPCTPIVGTMKTSSNDFFTNRKTVFSLETLSTDLTYKWTFYNSDNTSFTN
FT                   FTTSNVDYLYRTAGNYNVVLEVTDSKGCSATFEKTIVVSVNTNCVSLPGTILTSTPEVY
FT                   VSKNTTFSFETPATDLTYKWIFTQNKTNESTVFFSKTVDFTYLLPGSSEIRLEVTDSNG
FT                   CKSIFQKSVTIKQSTSLCDNVIQFGRSYIQVGTDSDLFKSATISVNQTTNITFSSQNYS
FT                   PQYDLEYKWSLLNEDDQVVDSGNNLNFPITPVKGGYYKAVLDLKDHTSGCVYQLVRSIV
FT                   CTIPSSCTGTNPQSTVVKGLVINLLKNLISRSMMGESDADINSSAVPTEFNTLKPYITT
FT                   NTAKNRIYNFATTRSTANEFTSVSFSFSPERASDIYISIPHSLQYSQGMPLDYLLSMIE
FT                   SKIYIDLSQYASSNQYLISCLSDSQASAKSVLHTGDCLRASEIRYIDFCPNECDPLLGV
FT                   IKTNSEIVSLNTPAVFSLETNNASVLSYNWTFYNPDNSVRENQTTSNAFQTYTIPGTYK
FT                   VELEAKDVNNCTTTLTKMITVAAPACVAAIGTIKTVSPNIFTGTNTEFLFETTATNLTY
FT                   EWTLYRNVNSSITIFTTNTANIYYLDPGNYNVKLIVTDANGCKNTFRTTVTATVKPPCV
FT                   NVVGEIKTANPIISTNENTTFSFETTATILRYYWTFHSLNNTPLLTTTESSPTLMYTFP
FT                   NNYKVTLTVWDENDCYTIIEKNINVVRGCPVIPGSANIPETVTSGQIIPFEYSTTSNGV
FT                   GYKWTFYNLDGSIKSTSTSNKINKAYYATGNYRVTLELNDLFNSGCKTTIDKIVTVTGE
FT                   CGIQGTIASNPAAESISLDQYVYFWFESEAIDLNYKWTVTKPDNVSSQYSTDKYAPYYF
FT                   QSGSGTYKIAVEVSDGNGCILNLEKTYNLEYDCSRNTGLVTGSIYNNNHKFYYSSDVLI
FT                   NAPNKFTFWYDYSSQENLPVNWELTDLNGSLISSGTEKEFIFTPTTSAGLILKLTITDQ
FT                   YGCPHHFSKELNVVEKCQFYVSDISGDINFDEEYSYKVAFIDANQTKDLILRSYDENDG
FT                   KVYTYQWNLYDLDNTLVSTGDQQKFPITLTKAGYYKVTLDIIDPDTDCPVQFTKKIGCV
FT                   INNSCTETNPKSQIVKELYLDFMRSLVMRCLLGETDEQINTSPMTPEFTALVPYITNGP
FT                   KDKIYNFKTKLGGESGNSFAGFEFSFSPDRQSDVYYYTRWSLYYNSWDLEKTIDDINYT
FT                   LYLALNQYVAADQSLVSCFIDYASKMAGKNVNHLETDECLFQTAVQYIEFCPPEDCSPI
FT                   AGTLKSTPVVGIQKTAKKAQLKQTPKK"
FT   sig_peptide     643740..643820
FT                   /locus_tag="Fjoh_0602"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            651287..654070
FT                   /locus_tag="Fjoh_0603"
FT   CDS_pept        651287..654070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0603"
FT                   /product="PKD domain containing protein"
FT                   /note="SMART: PKD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03638"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMD3"
FT                   /protein_id="ABQ03638.1"
FT                   /translation="MVNDFKIKKYWITALCTVLFSLAGFSQGLSDATIGFNLSKETEVL
FT                   KKQGLKDEDLTKEIARLRKIKMASFIIIKNKEAAAIQENKMKPLAKSILTKNIKTASKI
FT                   SSLAKTEMECSYDYYRAGRIQYAGGPTYDQNSVKINTPANITFYKYYNGTNGNLSYEWK
FT                   LYNPDGIVIDTKNTSNFSITLPAVGAYKIVLTLTDAIGCSEFEATLYVRDSNNCVISPE
FT                   ERNGTIYTPRNSDQLVENRESIVTLSPSGFSTNNLIYKWDLFDVNGSNIFTSSEPEFKF
FT                   TPPAKGQFLINLKITDPNGCSTTYTRNVETVDICTYTQYDDYFDIMAPEESAGGRVSFA
FT                   KVGQRVTLEPVFFSGGNKEFTYSWKLFDPKGQQIGTGSHRVFPFTPTEPGYYTLTADLT
FT                   NLETGCILTAKKTVASQIENGCVLTNPKSSEVYELYLKFVKKLIERLVLGETDEQINSS
FT                   IAMPEFMALKPYIKNGVGDKIYNFVSIQEGYGDQRVNGINFSFSPEREYDIHIYSIDGV
FT                   YYNSEYSTPEDLEYNISSAIFTNISQYIAADDFFVSCQVINGGKKAKTGKVVLEPYECT
FT                   RESEVRNIIFCPGEGSNCTPEIVGTIKSNFPFIYPKTEYSFYFETIIPNLTYSWSITSE
FT                   TGEVLSTSDTDITTPYRYTFLNEGIYFVKLTAKNELGCTTNFTKKIIVDNKRCANDSNN
FT                   FTFETEENGVTYIWTTTDINGNIVDTVTNTSGNYSFTTNTAGTYEVKLTANAEKKCETI
FT                   FAKTIFVENCTPVVVVSCTQNNPLTPKIHQLFINLINKAATTPNGVDVNTYAKTEIAAL
FT                   APYTFGPNAKIFNFSNDSSSVSFSFTENYTGIDVYIPKSSQGTITGIDLSKYESSSSKT
FT                   IVETNYTNGSSNLTNGYVTNIDFCPSIDCTPITGVINIVKRGTASTNKKTNSSSKI"
FT   sig_peptide     651287..651373
FT                   /locus_tag="Fjoh_0603"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.385 at
FT                   residue 29"
FT   gene            654138..658010
FT                   /locus_tag="Fjoh_0604"
FT   CDS_pept        654138..658010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0604"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; leucine-rich
FT                   repeat protein; von Willebrand factor, type A; SMART:
FT                   leucine-rich repeat-containing protein, typical subtype;
FT                   Immunoglobulin subtype; Immunoglobulin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03639"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMD4"
FT                   /protein_id="ABQ03639.1"
FT                   /translation="MTNNLKIKKYWITTFCLVFFSLFSFAQELSDETIGFNVVDYTAFL
FT                   KNRGVTDKDMKSELSKLRKTRLSDYLEMKKSENDFLQMNINENKVKQSRSSINSKTAVL
FT                   DIPQIEKDALLAFYNSTNGSNWLLKKGWDFSTPVTTWDGFSQTGWYGITITDGHVTKIT
FT                   DILNATGTLPDLSALQYLKELYIFNSSFTGNLTGLQNLNNLEKLRIGWSTSSQSSFQDL
FT                   NPLSKLTNLTELCLHSCNFTNNSIPSDFTKLVNLKKLEIRFGNVNQNWEVLGNLTNLIH
FT                   LNLGNNNFASQNTTLVVPPNFANLTKLEILDLSNNKIKDISVINNMKELKYLNAQWNEI
FT                   STIPSGFSELTKLNYIRLGQNKIKGNFPSYLQNLQLNTFEISSNEFEGKIPALNFDLAN
FT                   STVNYYIAGQGVAFLNKTLGIYDNKFRFIDFANEFEIYKTKIASNYFTYQYQKRINVVE
FT                   TITKGIGQSVTLKMFPEGDSRYLNDDTFKWFKNGVEIIGATERTYTLTNLTAANAATYI
FT                   CRSYHTSNPDMSALTLEREPITLKVVNCTPLTGNITSTTDKFHTGGESNFAFQTTATGL
FT                   SYEWSVTTAEGLPVNEIPSNTLEIYTYTFTNPGDYIVKVKATDSTGCTTEFTKEITVTE
FT                   RYCDNEPVDFSFETTATNLTYTWTTTDSTGKVVNRVTDTTGLYTFTPQVSGEYVIELVA
FT                   SSATSCKTLFTKNITIDQCTPYISCTRDNPLSPEIHRLFINMITKLTSAPAGTNVNVYA
FT                   HKEIAAVAPYTTEKTAKIYNFVNNGTAISFSFTENGTDDVYIPKASTGSVTAIDLSKYV
FT                   DSVTSTIVATSYSNGTTNNSDGRVKNIDFCPKELSCVSHVALVVDESGSLDQSEINKIK
FT                   KQLKLFVAQQAFTNDDIGSNIHISITGMSDSDDVNKRRKDFIIPTKVTASNVYLFNNWI
FT                   EKLGKRYGDTIGISQASDFWKSGLDGALSYSMKPNFVIMITDGAQTDDVTGLKETLAKF
FT                   DNNNKTVTDPKLPHLYVVGIENGVYIDRNSLTGKALPRNEDPNYNSAIGSQNNLTAKTT
FT                   PFLTKSLQFLLDLSPTEFPVADINQFTVGTYFGHSNFDLLASDETYFSDKLIVGEVVCG
FT                   TPAVKDSCDDCFSFKPEPGKEYVLSAWVKEESNEQVKTYVNPLIKIKFYNNKEALDIPA
FT                   HKIDSLSIKGSGDIIDGWQRVVKKFKIPNNTITLGIELENLSPSIPVYFDDIRIHPLQG
FT                   SVKSFVYDPETFKLMSELDENNYSTFYEYDNEGGLVRVKKETAKGIKTIQETRSGNVIE
FT                   TTNTTP"
FT   sig_peptide     654138..654218
FT                   /locus_tag="Fjoh_0604"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            658015..658725
FT                   /locus_tag="Fjoh_0605"
FT   CDS_pept        658015..658725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03640"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMD5"
FT                   /protein_id="ABQ03640.1"
FT                   /translation="MYKKIIYVWVLFNCCLAHTQTVNEVIQKISKQYSLAKPLQYKSTY
FT                   SLYKDFDSKKIEETYKGIYYKNDLNEIYTKIGDTEILNSKEVYLKISNSEKAVEISNPV
FT                   PNYNGDFDIKPLLQLCKIEKFVDYKTYWEITLTAKPYSSLSYSKIVVQVTKNYFLQKQV
FT                   FYYSTAVNFSNDYRKPDPHYPRLEIVNTNFNRNAVNASVFNTKTYFTTSAKKQIVPAEK
FT                   LKKYEIIDQRVISK"
FT   gene            658747..669735
FT                   /locus_tag="Fjoh_0606"
FT   CDS_pept        658747..669735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0606"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: Thrombospondin
FT                   type 3 repeat; YD repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03641"
FT                   /db_xref="GOA:A5FMC0"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMC0"
FT                   /protein_id="ABQ03641.1"
FT                   /translation="MYINKHLIAFVFTLFSLFAFSQQEETISPRKKGNQLNGQPILQVS
FT                   DPKLASLDQKNVFTSLKPSVSIHFGFEEDLSASSDETFLNAYGTVYFAEVVLIVKPMDK
FT                   NGNPITTYTDIPGAPKTNPFEVTLKIKHDHVTKEKQFNDYAVYQLPGVHNADITVKSIK
FT                   YTDVNSNVLTITNSPAYVELKFSTERYYNMQLNATQYTSVFPLTHQLIKYNGLTETTVS
FT                   QVSAGAEELIINWTKDAVAPAVEYELEWTWIDNYSKTANGKLSPDEIALTEKDFKLNST
FT                   RIQTKDLSYRIPLVYSKGYLVYRVRPVGRFLDNTNKNFYGQWTSGLTDAYTKVSHWPHF
FT                   VEIDQAHESGKKNWQYQASFAEDGKKKEVVSYFDGSLRNRQTVTKTNTPGEELVGSQLK
FT                   ATQGKAIVGEVIYDNQGRPAVEVLPAPVNSSGIHFYNDLNKNASNTIYSHNDFDWDNPT
FT                   VTDCTPIPAPTMSNANGAGKYYSENNTVNSNYKDLVPNAQGYPFSQVEYTPDNTGRIKR
FT                   KGGVGKDHQIGTGHEMQYFYGQPKQEELNRLFGYKVGDFSRYKKNIVIDPNKQASVSYL
FT                   DPQGRTVATALVGDNKGSLISLDDETNDNLHLKTVTNLLSNNDKYASGINGIEEDGIRL
FT                   NTPVSVVKEGEVKIEYTFKKDIASYTDSCLTTKQYPFVYNWSIGMKNDCADELLTGNPL
FT                   TTKFGTFSLDTFSPAAIELQKREYFALENGQHLKVGTYPLSKDLRIDYDALNKYADDYI
FT                   AQIISDKKCLPDYAGLEPDITAEDCNVTCKSCEESLICTNLTKEQCDAFKLKLSADPAD
FT                   LGKVSERESFITDAEVQYVIKNLNAFFTVSTFAYNGTQFTAAGIDQKNILPKVTAYKAE
FT                   FRGLLSGCRELCKQPINVCNLNLEVLLGDVSPNGQYGSVAGLDAEDEEINDPASSKITD
FT                   PLSIFNENNQLLYGGYTNGVELDPDTNQNVPVKISNYNWKKPFGGSYKEADGSISKIRV
FT                   TLVGDGVYRPSLVDTVTLTENDRDPESDDPNVFLVEPKYLRYVADFIPLWKPSWANALL
FT                   PYHPEYQYYVYNSAFCEKFNAIGDNSDGFDEKLRNIDYADPETGVIKDNTIFTPGGIIT
FT                   QLSNIGAQNNDSDPYYLSRASQNNVESEADFTLRKDIMKEAINTNFDGIAQSNGKKLNM
FT                   LQASYYFAVYSNGITPESVYEDYINLSTADLLVKINAIQDPIVKQQIWTNFRTYYTGLK
FT                   QKTRTVFSHVYAATRNNYNDCIGNVESSDTFVTLFKKYTTVGNPHNYERITRLVNTIPE
FT                   NPSLPSGSEGIEWACSEETSSLFATKEKRFIPADYGYDSALTDAQAISDLSTTTEKAMY
FT                   METGKCPMAFEMEYFLKGLVDKKIQSQGLLVNGLKTTSMIYLTKNLFNAQVNPTFNLQT
FT                   ASETPKIKSYEDASGALNITFTHLGNEIATPIELRFVNNSSYYQDACGNNVNTPRWEDI
FT                   VDFKSFYYIPDSYDNVTKTYKFQIIGIVKRDGVASTCISPEEIIIEGTTKANVGECSYL
FT                   IDAPCDKKDKFDDSFRKLVFNLQTLGTIRSASLDITNNPVFTDGYLYTYFGIKPNDIVK
FT                   WKNTADGVSISVNDENRVVLNLGGYNLGSERITSFSIGNVLGNYNQVRIGTKRSVFLFS
FT                   TRQVTAKITSGNTNRPLYLVCCSPCGEWDYNGDGLGDACGGGGNCGTVDTDGDGIYDGC
FT                   DNCPNTPNPNQEPCNSYTPITSCTVAGADELTYENNIKNILNDFLITRNHEVNASGDFY
FT                   KAGSVSSYSPINAFVRDSKLVSHFQKQRTRYTENNFRPVVIDKYSIVAENDLVSINFDE
FT                   NSGSVYNRNFINFYGINIKSARRINYIDVTSDLTFRINFVDSQGRTLTQEGGKISHYTF
FT                   TKITSSEAKAPAVPFCPFMSETYPPKTTSKKSFDSLDDLYVSVADEKIIENNRSSLTAK
FT                   TAKNNAVKSILEVTPTFSCSNLCIPVAVAPIACRPQWLTYKNMINLQVPDYKLPEDLDK
FT                   YAKFFCEANFGYISTDYLQYLAKLEITTVKNPLFVSISEFGSTKLRYGNTVTASVIIQY
FT                   YNYVQSQIANPTEELLVWQQFADKYAVDNKICPPAIIPPSFSLEIPNEETRTPCEIYAA
FT                   TVKAANKQEIENTFYAGKKEEFKEKYLKAAFEGITETLTQSSFDKEYQYTLYYYDQAGN
FT                   LIQTVPPQGVKRLDPNSDAVIKDVRENSPEKVDTTPVSGVPVAPDHKMQTQYRYNSLNQ
FT                   LVWQKTPDGGVTKFAYDALGRIIASQNANQALATPALFSYTRYDGLGRIMEAGQLEVKT
FT                   GTAMHINENGRLVFANDDLVPVDAVNDHFPYNQGSKFDQVTKTLYDIPVKDTEDWFTSY
FT                   AGDNNHKRVTAVLYYNQLTAELGEIKAYDKYSNAILYDYDVHGNVKELVHHTNNNQKLI
FT                   DFKQDLKKVVYDYDLISGNVNKVTYQPNSTKDQFIHRYEYDADNRIKQVYTSKDNVIWE
FT                   KEANYLYYEHGPLARVEVGDKKVQGLDYIYTLQGWLKGVNYERIGFYDAGKDGLVVAKD
FT                   AFGYALNYYTGDYKSRFNVNGNNNPIDNTIFSFSKDLSGNSNLYNGNIKEMVTSLLNTS
FT                   QQPIPTQFNYYKYDQLNRISSMNSKAISYNIGGTTNSPVDGFKSNYSYDRNGNLDKTNV
FT                   WAPLADGSLNTTQMDQLSYNYLAGTNKLDHVKDAVPNGAFSNDPNNANDTSLDIDSQDA
FT                   GNYAYDEIGQLIKDAKENLDEIKWRVDGKVESVTKFKNTPQQKVVISFEYDGLGNRTAK
FT                   KTTTATSSKTTYYQRDAQGNVLSTYEMQEEGGTTKYFLVEQEIYGSSRLGVERGRLEIT
FT                   KDVASALKNSKTITASEKNAIVAKVAETVSKAGIKFSTEGGFAVWEVNNKNAINLFDNK
FT                   SRKTESLTVSTHLKIDPNTDAENSTLAVFHGSSVEGDFPGDNSVGYRSSIVLGIKKVGT
FT                   GYSPTFSLIKYRRNHNKYKTVIKLKKRTRHSFRSYATAVDYDVRPTDRPGMSVISIPEK
FT                   EWDYKADIVLNQATSNYDITITLNGNVYKGIAAQPRSILNGEENRGFEGNDGNLKIKVP
FT                   NNTLGAATIEYQPGNSIGTYRTLKSDICDFTYSINNGEDPEDIKINKFELDEPSTKTST
FT                   KSDTGIPMVISQAKFDATFCGNPDEDSDGDGVINSEDNCPYTFNPKQEDKDGDGVGDVC
FT                   DNCIDKRNGLLEKDIEGVGNQLDTDGDGRGDACDNCKKTPNFDQKDTDDDGVGDVCDNC
FT                   RTIANGDQKDTNGNGIGDVCEGLDQGEGNETVAESPLTSYRFVGDKNYELSNHLGNVLS
FT                   VVTDRPLFVQNGSSYRFDPDVLSFSDYYPFGMLVPNRHESSKDYRYGFNGKEKDDEFNG
FT                   DVNSYDYGARMYNPRVGRFLSLDPLSHDFPFYSPFQFAGNSPIFAIDLDGLEMQISNTV
FT                   FTLKEGKGTPELNYSTDIKIHYKVLNLTGRKIEGIQQITDFARDRSRLVYSDRAGMGNF
FT                   SITFDGKGNRLKQPISYKLNGKIKSFETTFSVIKSTKEINDSDYVVILVNQRLSNKKYP
FT                   EHAHANLAGNIMTVDIGNPDYKSILTNGTFNFNLMTTVARKIGATINHETGHNLGLDDE
FT                   YKMKEDGQAIVNPGYENNQMSGGSGKELNSRQIASILNDIFTNFRIDLYNKKKSGKEQT
FT                   DSTKSQVNEEQKKLNLGN"
FT   sig_peptide     658747..658812
FT                   /locus_tag="Fjoh_0606"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.940 at
FT                   residue 22"
FT   gene            669701..670273
FT                   /locus_tag="Fjoh_0607"
FT   CDS_pept        669701..670273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0607"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03642"
FT                   /db_xref="GOA:A5FMC1"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMC1"
FT                   /protein_id="ABQ03642.1"
FT                   /translation="MKNKKNLIWGISALLIINCILLLKNCNQKQLIEVKDKKIDKTIDK
FT                   KVLFTGEFNDVGSPINFWDFYGDNGESILSLIFYKNDKNEFDYEIKQKNSLGKIVYSAE
FT                   MRNGKVLKEFDYEILQNINIDNGRFMYENYCVNCHNYKKEGVSKPLLKLKNIEVSKFIK
FT                   KYKNVSHENVPKLNDNELKSVILFINK"
FT   gene            complement(670447..671493)
FT                   /locus_tag="Fjoh_0608"
FT   CDS_pept        complement(670447..671493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0608"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03643"
FT                   /db_xref="GOA:A5FMC2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMC2"
FT                   /protein_id="ABQ03643.1"
FT                   /translation="MKKTTPIVPLFKQFIKETESGKRLKKNGEKIKSGSIQNYYYVLNN
FT                   LIQFSSETKFELRICDASKLDKRELASEKSYWKKFYLKFTEFLYKKGCHDNYVGANIKI
FT                   IRVFFNYLKNDKDIITGDFQRLFYVRKEEIEIFVLSPEQLKFLIHDKDFEQTLIPSHKR
FT                   IKDIFVFGCSTGLRYSDIFLLTNKNFEQMEGDWYLKLKSQKTKTFSFIKLSAYAITIFQ
FT                   RYKATSDRIPIFGTISLFNFNKSLKQIGEQAGFTMPIEVSREQQGKTQKLTKKTDTSRN
FT                   RFCDKMSSHMMRRTAITTLLILGMPEHLVRKISGHSNASSSFNRYVHYAQAYMDKEIEK
FT                   VHSKLESY"
FT   gene            complement(672198..673199)
FT                   /locus_tag="Fjoh_0609"
FT   CDS_pept        complement(672198..673199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03644"
FT                   /db_xref="InterPro:IPR018960"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMC3"
FT                   /protein_id="ABQ03644.1"
FT                   /translation="MLVPNRHESSKDYRYGFQGQEKDDEIRGGEGNSINYTFRMHDPRI
FT                   GRFFAVDPLFREYAYNSPYSFSENRVMDGVEREGLEVENINAYLKAKKYGVDALEIKKM
FT                   DDGMGNVSSQLYSLRTLGITPSEFANLRDTFLNAPQTFTNNFMATYKPVQKANSNILSP
FT                   GDEIGINLQPATPFPIFVRVMNVVKKDNSFEMTFATLEGHTDAGYITFSGVFNKRTGQM
FT                   DINIFNETRENLAMAYPLDLGRGAQILQWKIVMKNIAKAIQQDPKNNNTVIEITKHIEE
FT                   YEYDESGTGGKGKLVESITEQIDIPKKPSIPAKTTKIKNTKSDYDIQDGDGF"
FT   gene            673473..674261
FT                   /locus_tag="Fjoh_0610"
FT   CDS_pept        673473..674261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03645"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMC4"
FT                   /protein_id="ABQ03645.1"
FT                   /translation="MKTKVLSGFLLFFLSLFLVSFSDPYAIKRISDANFRYEFFTTDKK
FT                   VKVKDNKIYFWFKGGTIHNAQSGIAGALLDDKFVKMYHNNQLAEQGQFDEGLKVGLWKT
FT                   WHSNGIIESTQKWKKGIKCGEYFRYNSNGDLVETGKYSQDLKTGKWVDLEKKDTLVYKK
FT                   GILLSKPQKISKSQEYKLKEEQEKLDKSRKEAKELEIIQDSNTLNSYKEATKQREKAEK
FT                   EKLEREKKAEKDKKAAEKASQPKKDSKVKSFFKNLFSKKK"
FT   sig_peptide     673473..673541
FT                   /locus_tag="Fjoh_0610"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 23"
FT   gene            674266..675480
FT                   /locus_tag="Fjoh_0611"
FT   CDS_pept        674266..675480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03646"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMC5"
FT                   /protein_id="ABQ03646.1"
FT                   /translation="MIKAHSLLYAIYICLIVSIICGALLYFSNLYNQLNLYYNLQEELY
FT                   IQNQSVVNFALGNKIKPQEIQKDENSGIEGNYKTKPYGLLTLLLAESSVGNDTVKSAHF
FT                   VGSYTTDKTAVFLTNISKPLSYSGTVTLNGDSELPSTFIQTAYINNSPNKLNNNGKIAV
FT                   SEIRLPEINPNFEKIFEETEGVKTALKDIEKAKDSIYYNSFFNETKDIYVTSSLSNIIF
FT                   KGNFILRSKDSIRVRKNAVLEDVILIAPKITFETGFKGNLQAFATKGIDVEEKVTLNYP
FT                   SVICVYNKNEEESQIRIKKETTISGAVVYFGNSSDDDFSKKTVEIAEEGLVFGDIYCTG
FT                   KLSLRSNVYGSVYTNRFFLKTDATSHDNVISNVEINPHKRPEYFISIPLFSNQKTAYGI
FT                   LKKVL"
FT   gene            675455..675799
FT                   /locus_tag="Fjoh_0612"
FT   CDS_pept        675455..675799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03647"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMC6"
FT                   /protein_id="ABQ03647.1"
FT                   /translation="MVFLKKYCSVKANSILESVIALTIISICLYFAILIFAAVFTPRTS
FT                   AKFYNTQNKVNELFFLSQLKNDSLQYESNDENLLIEEEVVTDHLKKISVEYKDSTKFKF
FT                   QKSFYVEGNP"
FT   sig_peptide     675455..675568
FT                   /locus_tag="Fjoh_0612"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.640) with cleavage site probability 0.617 at
FT                   residue 38"
FT   gene            675780..676280
FT                   /locus_tag="Fjoh_0613"
FT   CDS_pept        675780..676280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0613"
FT                   /product="GspJ-like type II secretion system protein"
FT                   /note="predicted prepilin type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03648"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMC7"
FT                   /protein_id="ABQ03648.1"
FT                   /translation="MSKEIRNNKNSVAAFSIIETLVGMAITAIIMGILFLIFSIVTERM
FT                   LDFKNQNQLVNDLNRLTYSLNKDIFEKEKMIKTDNELAFRGYAGEKTIYHFEEDFTTRS
FT                   QETFVDTFKIKLKQIVIDTVKNKSERLLFQKLKLNVEINENESSLSFYKRVYANELLQK
FT                   IPK"
FT   gene            676280..677407
FT                   /locus_tag="Fjoh_0614"
FT   CDS_pept        676280..677407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0614"
FT                   /product="GspF-like type II secretion system protein"
FT                   /note="predicted cytoplasmic membrane component of type II
FT                   secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03649"
FT                   /db_xref="GOA:A5FMC8"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMC8"
FT                   /protein_id="ABQ03649.1"
FT                   /translation="MSLDLSTYKAPKAEKTDFKLPSGSASFQLSKKLSDKKKEVFYREL
FT                   GMLLKSGVDFKKALEILSNQSAHKLEKEIILEIKEKVISGRSIYESMKETNQFSAYEYY
FT                   SIQIGEETRKLEEVLGELQKYFNRKIQMKRQIVSVLTYPAIVMIVTVLVLYFMLNKVVP
FT                   MFSSVFKQFGSELPKSTQVIIKISNHSGTIFSIVFAVIIGLVIMHTMLKEKEFYRALTS
FT                   KIVLRIPYFGNLIRKIYISRFCQAMNLLTTSKTTLINSLSLTAKMIGFYPIEKAIEEIK
FT                   EDITRGASLHESLKKHSVFENKMVSMVEVAEQVNQLETMFERLTEQYNEEISHQTKMIG
FT                   VILEPMIIIVIGVIVGVIMVSMYAPMFDLSKIINK"
FT   gene            677480..677914
FT                   /locus_tag="Fjoh_0615"
FT   CDS_pept        677480..677914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0615"
FT                   /product="GspG-like type II secretion system protein"
FT                   /note="predicted prepilin type N-terminal
FT                   cleavage/methylation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03650"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMB1"
FT                   /protein_id="ABQ03650.1"
FT                   /translation="MSKTIKTLLKNSKKATIKAYSLTEILIVLCIIGILLLMVLPNQTS
FT                   VIGQAKAIEAQAMLNQVYGLQKSHFYRHSKYSNSLEELGFEQEQTVDEGGQAVYKIEII
FT                   EASNDSFVARATATSDLDGDGNFNTWEIDNKKMLTEVTKE"
FT   sig_peptide     677480..677614
FT                   /locus_tag="Fjoh_0615"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.523 at
FT                   residue 45"
FT   gene            677917..678396
FT                   /locus_tag="Fjoh_0616"
FT   CDS_pept        677917..678396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03651"
FT                   /db_xref="GOA:A5FMB2"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMB2"
FT                   /protein_id="ABQ03651.1"
FT                   /translation="MELTLLCLSFSLLFVFFQDWKYRRIHVLLPVIIFLFSFYLTHLKL
FT                   IPIKNILFNTAFFIITLGVLVIYMSIKNKQFLNPFEHYFGLGDLLFYLAVTPLFILPNF
FT                   ILFFILSMLFALLLQFAFKKYIHENTVPLAGFSSLFLFIILVKDYLHFYQKLTVI"
FT   gene            678400..679803
FT                   /locus_tag="Fjoh_0617"
FT   CDS_pept        678400..679803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0617"
FT                   /product="GspE-like type II secretion system ATPase"
FT                   /note="predicted ATPase of type II secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03652"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMB3"
FT                   /protein_id="ABQ03652.1"
FT                   /translation="MQDIIVLSENQHIVSSDLANQYRILPKSVSENILELYVDSANSSA
FT                   DAKEELELFLGKNIVFSPIDSYEIEKALSIYYRKERITTSSKSLNFDRGDFLENLLEEA
FT                   KSLKCSDIHFEVYEKNARIRFRIDGQLIERYKVERENYLELVNKIKIKSKLNITEKRLP
FT                   QDGRITNDSFDIRVSILPTLFGEKIVMRLLGQDASNIDLSTLGLQKEELEHYLEAVKKP
FT                   NGIILISGPTGSGKTTTLYATLRLLNDSRRNIVTVEDPIEYTLKGINQVQLKEDIGLTF
FT                   SSALKSFLRQDPDVIMLGEIRDSETALMAIRASLTGHLVLSTIHTNSAIGTISRLIDMG
FT                   VPSYLIAETLNLSVAQRLIRKLCNHCKTEVPCTKKDFPMNFQFPYEISSYYKPVGCNQC
FT                   FHTGYKGRTAIYEVLTIDTKIAEAVKNNTITELFSNDENYKSLSEKAFDILAEGETALE
FT                   EIYSILINL"
FT   gene            679808..681712
FT                   /locus_tag="Fjoh_0618"
FT   CDS_pept        679808..681712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0618"
FT                   /product="GspD-like type II secretion system secretin
FT                   protein"
FT                   /note="outer membrane secretin of type II secretion system"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03653"
FT                   /db_xref="GOA:A5FMB4"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMB4"
FT                   /protein_id="ABQ03653.1"
FT                   /translation="MFKKLGYVFIILFFTNSIIAQQDINQLSKQFDALSVQKKGLNETI
FT                   KIDVSGLTLRDFISSIAEEHQLNIDVDSELTQQVSNNFFDVTVKDVLIHLVQKYDLEVT
FT                   FMNNIIVFKKRKAVTVVEKKAPKVIDVSYNPQNDFLSVKLENDTLSAVAKAIIDKSGKN
FT                   LIVAADAKNLRVSSYILNRPFDQVIEMMSKSNDLTATKDDNGFFYIEKNKDATVTVNGS
FT                   TQKVKPPKASSGLPGYYEVNLNKNGFLSVKAYIADASDVLTEAAEKLHVNYFLYNKPEN
FT                   EKTTLSADNITFDELLFHIFKGKKYTYKKQDNLYLIGEEGSEGLRATEVIQLENRSIEL
FT                   VLPSLPKVFSEKLEIKEFVELNGLVASGSKSILEELKLYIKQIDKIVPMVQIEVIIAQY
FT                   NKSHDVQTGMKAGLDKINKQVTGGTVFPTTDMTVNSTSVNSLIDAFNGFGIFKLGKVTE
FT                   AFYLNLKLLENNSIVKVESTPKIATISGHEAKLSIGETSYYFEQSNRLINSNIGNDILN
FT                   SGTWKSTDANLSLSIKPYVSIDENVTLTIVVEKSSFLGRAGETAPPGKATQKFESLVRV
FT                   KNGEMILLGGLDELKKEDSGSGTPLLSRIPIIKWFFSSRKKGKNNSKLHIFIKPTVVY"
FT   sig_peptide     679808..679870
FT                   /locus_tag="Fjoh_0618"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.865 at
FT                   residue 21"
FT   gene            681712..682899
FT                   /locus_tag="Fjoh_0619"
FT   CDS_pept        681712..682899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03654"
FT                   /db_xref="GOA:A5FMB5"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMB5"
FT                   /protein_id="ABQ03654.1"
FT                   /translation="MITFLSKIIKLNNLHVIGIIRNEDEEIYNVLTVKKKGNKIDIVST
FT                   QSFENFEKTAKSIDLKIPVILVVDGKGILNKEIDFNNESDVSWYKNIDFESIYHTSLLG
FT                   SKSSFISFCRKNIVNEISENFLKKGFQVADIYVGSFLSGLLYNAIQKDTIISNDIILEF
FT                   DNGKLDAFSKQPATVKTETYILGKEKINSSFLPLYGTIIHFFIQQKEVSKTKNETLSTE
FT                   EIIYKKAFNVFGVAMLAGFLISLLGSYLLIQYYGSKNAELNLQSVYSNQSYQKILDLEK
FT                   QKENKQRLLKEAGFLSAKFLSFYGYEIIKGIPSDISLTDLNIIPVNQEIKENKKISFDA
FT                   KSIIIKGETFNESSFNNWMEKLKKMNWLKNFEIKSFKKDKKNKSQFEIKITIKDV"
FT   gene            682892..683416
FT                   /locus_tag="Fjoh_0620"
FT   CDS_pept        682892..683416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03655"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMB6"
FT                   /protein_id="ABQ03655.1"
FT                   /translation="MFEKYSYKKKFTALLLIFIMLLITAYKRSFHTLIDVIRENKTLSE
FT                   KTNTINKKANNIDKLSQEINYLDRVIGKEGITKEMVQQGIISFASTEDPRISINDLQSS
FT                   HVFSDENYKIISNQLDVTGNCNQLLTLGYGFEKKFDYSRIVSMNFYTTKKNNTSEVLHL
FT                   KMIFQNYENNK"
FT   sig_peptide     682892..682975
FT                   /locus_tag="Fjoh_0620"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.794) with cleavage site probability 0.432 at
FT                   residue 28"
FT   gene            683400..684356
FT                   /locus_tag="Fjoh_0621"
FT   CDS_pept        683400..684356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0621"
FT                   /product="Fibronectin, type III domain protein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03656"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMB7"
FT                   /protein_id="ABQ03656.1"
FT                   /translation="MKTINKLILILLSLTVISCEDIFEEDISDDTIETVSPKDNTVIES
FT                   NVVNFQWDELDGAKKYRVQVLDLDETVVLDSLVTKTSFLCPLSPGNYQWKVRGENFAYE
FT                   SNYSFSSTFSVVTTSDLANQQVILSTPDSNIYKNTASITLKWQKLAAATGYNVEVLNTT
FT                   TGESVYAEENLTATSVALTSTQLSKDATYQWKVRGVNSTSQTLVFSTRNFHIDTVTPPV
FT                   PQNSLPANNAVVTNNQSASFNWISPTDTGTIQSPIVYTIEFSSTNTFTTLLSSTNNATT
FT                   SYQQIFTTTGDYYWRIKTTDAAGNVSAYSTPFKFTVI"
FT   sig_peptide     683400..683456
FT                   /locus_tag="Fjoh_0621"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.761 at
FT                   residue 19"
FT   gene            684364..684873
FT                   /locus_tag="Fjoh_0622"
FT   CDS_pept        684364..684873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0622"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03657"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMB8"
FT                   /protein_id="ABQ03657.1"
FT                   /translation="MAKKKINIVLIIVVIALWGAVFYKTVYKYFSSQETFANETYTAQN
FT                   VKFNQIHKDTFALETITRDPFLNKQTQQVVIPAQKQYSAVTSTAVKKTAAPIAKTRQLT
FT                   IWPAISYHGYIKDSKGELVIMKIDNKMYRLRKDALIDGIALKKITRDSLELDFNRERKI
FT                   IARFKI"
FT   gene            685231..685674
FT                   /locus_tag="Fjoh_0623"
FT   CDS_pept        685231..685674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03658"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMB9"
FT                   /protein_id="ABQ03658.1"
FT                   /translation="MNQTVKPKIVSFFKKLIIIAFLLFIFTFIEIYWAMGSLSERISSG
FT                   NPDSHFFDDAYLVSVFTTVFLTIVFLLFTFIKNKYLKITIELISLISVWFFWNYSIFVD
FT                   RESSWSTYLFKEELLYTLSLSFLPIWVLSIVTVFTLHYILKKL"
FT   sig_peptide     685231..685335
FT                   /locus_tag="Fjoh_0623"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.676 at
FT                   residue 35"
FT   gene            685671..686600
FT                   /locus_tag="Fjoh_0624"
FT   CDS_pept        685671..686600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03659"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMA2"
FT                   /protein_id="ABQ03659.1"
FT                   /translation="MSQSKKIILRIYFMICVLFVLNCLLYYFKEISLRGYYSDVVLSWL
FT                   WLISSFVIIIVFWKKLLAKLFLTALLITFAMSIIAMMLPFYTLLLSSTSLGLYQNKDLN
FT                   KNYRAQIVGYGVMVNPWLEVIEKKGLFEKRIIKCTDSELMDDNLDIKIRTAKDIIFKSE
FT                   TDSTITLALFYGGPNKTITFDKKTGNIVSQMLNIKGLTQKYGGTWYDETQKLYLTFYFE
FT                   EGYDYATLNTWTGSIDKKENIEAYKAFIKDNKLILPAENSDHHAPYCEIDIQYNLLVYK
FT                   CNEGFNFSDNFLNTKKTISVTKYKRITD"
FT   gene            686663..687694
FT                   /locus_tag="Fjoh_0625"
FT   CDS_pept        686663..687694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0625"
FT                   /product="hypothetical lipoprotein"
FT                   /note="predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03660"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMA3"
FT                   /protein_id="ABQ03660.1"
FT                   /translation="MKIKLYALSTVLTLFLFSCNKKENTTGTLPEVTEHTETETDTLQE
FT                   TEETPRKESIYLFTLTPKDSSDVAFVSLSDIYPAGDEKDTLALPNIEKMGKENAAYFTF
FT                   DKNYRKRFFSKTNISETDSLFVYDYAKNKLVSFAVKNLKTAAMLNGYSSEEDWPYHNYD
FT                   FMIGFEINKKHLNGFSEYYRDALVYVGKENPFSKERLKPITWKKIAKKDYPSKALKNND
FT                   RNLLKNTVTGNTYFYKTDSHEYFLQDYLDSNKIIYGRRLLVVDSKTKDVIIEKLFSQSE
FT                   GTSPTPLNYENGEDSIDQWTGKLFKNKPAVVFGFEYLSFGCPSISVIDKSNEEINIQCD
FT                   NRH"
FT   sig_peptide     686663..686728
FT                   /locus_tag="Fjoh_0625"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.774 at
FT                   residue 22"
FT   gene            687746..688330
FT                   /locus_tag="Fjoh_0626"
FT   CDS_pept        687746..688330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03661"
FT                   /db_xref="InterPro:IPR018958"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMA4"
FT                   /protein_id="ABQ03661.1"
FT                   /translation="MEEIKNRIAACELEYDEIQESSLASDEEIQELTSYFSLPLPQELI
FT                   TFYKTVGGIESDETFRISSAENLIRYMKQRTAFSHNSAGIIDMIIAFWANDRPELQEYK
FT                   LLTEEQTQKINEAFPCIGWMMSEEDINESGEYVIFDKNGNFANIYCHQDNIKAATNELL
FT                   KHLETGLPERSLENVLEELFERAEGNLSRWD"
FT   gene            688380..688949
FT                   /locus_tag="Fjoh_0627"
FT   CDS_pept        688380..688949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03662"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMA5"
FT                   /protein_id="ABQ03662.1"
FT                   /translation="MSELSSLYCKVKITKSQLEKFLNSPLEEPELNKNWLDYWESRKMY
FT                   SKSVLTQELLRTYNDDINKEVIDGWIDYPEAMAFSDYDETTEEWNWGMMFFSENFVEMI
FT                   PMFAFIISMEKYVTESTENKAIVFPFFWGDNAVHAFIEFKDGKAVLCPKAQTLKDIDPE
FT                   FLEKTKDFLNKKWDQLSKEMDLDNLD"
FT   gene            688968..689702
FT                   /locus_tag="Fjoh_0628"
FT   CDS_pept        688968..689702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03663"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMA6"
FT                   /protein_id="ABQ03663.1"
FT                   /translation="MINQDNLKLYTYKELKVVLPAGTPFEKLYEKAKDKEKFDQQFICV
FT                   YEGNVETEAFSPHDEVQWGVYYKFIEEKENIPLFSVPVILGNVTCKTASLREVLITGNL
FT                   HTKNLDVNYTSRPNTFSQIMGNVTVDEVLFTTGKGLGGKTFNFQVNGDVNIHTWINLEQ
FT                   AAIKAKSLTVKKEFSFPQVYVTEDRSKHAQKKTDWSRHSLEELTNHFNKEHLNLEEYEN
FT                   YVDFFFRVPTKLSKADYDYLIK"
FT   gene            689879..690427
FT                   /locus_tag="Fjoh_0629"
FT   CDS_pept        689879..690427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03664"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMA7"
FT                   /protein_id="ABQ03664.1"
FT                   /translation="MLQQDFYISQKKVQKNIILCSFLFLSFLGGLWYVSGSFFTQDDYE
FT                   PALVLILLPCLVIIFSKLLKEIRFLSNTSPFITVLNEGVVFYEDHFDQIGLVKWKDIEH
FT                   CDDFSINNFFHEHYLMVYVKNPEYYSSRIKDKKQLSQYFRASKNNQNALLWVETKRLDL
FT                   DVIEIKKIFFQMIEANKKN"
FT   gene            690430..691176
FT                   /locus_tag="Fjoh_0630"
FT   CDS_pept        690430..691176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03665"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMA8"
FT                   /protein_id="ABQ03665.1"
FT                   /translation="MIYYYQIKNKPLTQKMLLGKTCPVCNKKDTLQLTLNTKYVSIIVP
FT                   VFGMGRTTSVHCTECQHIVKSETGPVYAKKSYTKKINNEINNIDTTYKSSIWQLLYPWT
FT                   GILLFAGLIITGLAMTRIKEYRNSKIQEILDKPQSGDIYKSDWYENGMRFSKGTLVKVL
FT                   RIKGDTLTIVRSLHIIEGAAVFSKENWEKIPTDRASFSSKEHKIKLSRFLKDLEFEEFS
FT                   TYTTHFLGRVMGSGDSNYEFDVVERK"
FT   gene            691350..692510
FT                   /locus_tag="Fjoh_0631"
FT   CDS_pept        691350..692510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03666"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMA9"
FT                   /protein_id="ABQ03666.1"
FT                   /translation="MNITNSFTDSGFRDYVLKNFSKDKTSIQISDVKNITSLNLKSQKL
FT                   ENLNGIEYFTSLNSLDCSYNQIRSIDISQNLLLKELICNENEILSLDLSANTHLEHLNC
FT                   AFNRLKKLNISHNLLLVKLICHWNLLTNLDLENNSLLEELDFAYNHIFGIELGVKPKLK
FT                   NLKCSQNGLISLDVSDCPELKVLHCANNSLLSIELAKNVIMEDLRCFYNHITTLDISQN
FT                   KLLETLYCSNNKISVLDTSHNTKLQTLDYSNNLIWEKDFLIDEIGVFKYNVSTSTYNAN
FT                   LIFEDKELYVSTEARTYKEIEKLKTIIKTFGKNFSKLNHDAINFIKQQHPNEDVESLKL
FT                   SDIIFEDENTFRIGFDAGESPAGQLFLYISFDKNLKMNDEIIYETY"
FT   gene            692638..693033
FT                   /locus_tag="Fjoh_0632"
FT   CDS_pept        692638..693033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0632"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Fjoh_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ03667"
FT                   /db_xref="GOA:A5FMB0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FMB0"
FT                   /protein_id="ABQ03667.1"
FT                   /translation="MSTATKPNHIGRKISRIRELRDMKQEALAQALGTNQQAISTIENS
FT                   ETIDEAKLIEIAKALGVTPEAIKSFSEENVFNYFNTFTDSHGNFGNFASGAICNFNPLD
FT                   KVVELYERLVQVEKDKVEYLEKLMKGK"
FT   gene            complement(693724..694683)
FT                   /locus_tag="Fjoh_0633"
FT   CDS_pept        complement(693724..694683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Fjoh_0633"
FT                   /pr