(data stored in ACNUC7421 zone)

EMBL: CP000688

ID   CP000688; SV 1; circular; genomic DNA; STD; PRO; 1341892 BP.
XX
AC   CP000688; AAOM01000000-AAOM01000033;
XX
PR   Project:PRJNA15770;
XX
DT   08-MAY-2007 (Rel. 91, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 7)
XX
DE   Dehalococcoides mccartyi BAV1 chromosome, complete genome.
XX
KW   .
XX
OS   Dehalococcoides mccartyi BAV1
OC   Bacteria; Chloroflexi; Dehalococcoidia; Dehalococcoidales;
OC   Dehalococcoidaceae; Dehalococcoides.
XX
RN   [1]
RP   1-1341892
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Lowry S., Clum A.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Ritalahti K.M., Loeffler F., Richardson P.;
RT   "Complete sequence of Dehalococcoides sp. BAV1";
RL   Unpublished.
XX
RN   [2]
RP   1-1341892
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Pitluck S., Lowry S., Clum A.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Kim E.,
RA   Ritalahti K.M., Loeffler F., Richardson P.;
RT   ;
RL   Submitted (03-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 38fe71db50020cb6ea492bc8aeaa41f8.
DR   BioSample; SAMN02598353.
DR   EnsemblGenomes-Gn; DehaBAV1_R0001.
DR   EnsemblGenomes-Gn; DehaBAV1_R0002.
DR   EnsemblGenomes-Gn; DehaBAV1_R0003.
DR   EnsemblGenomes-Gn; DehaBAV1_R0004.
DR   EnsemblGenomes-Gn; DehaBAV1_R0005.
DR   EnsemblGenomes-Gn; DehaBAV1_R0007.
DR   EnsemblGenomes-Gn; DehaBAV1_R0008.
DR   EnsemblGenomes-Gn; DehaBAV1_R0009.
DR   EnsemblGenomes-Gn; DehaBAV1_R0010.
DR   EnsemblGenomes-Gn; DehaBAV1_R0011.
DR   EnsemblGenomes-Gn; DehaBAV1_R0012.
DR   EnsemblGenomes-Gn; DehaBAV1_R0013.
DR   EnsemblGenomes-Gn; DehaBAV1_R0014.
DR   EnsemblGenomes-Gn; DehaBAV1_R0015.
DR   EnsemblGenomes-Gn; DehaBAV1_R0016.
DR   EnsemblGenomes-Gn; DehaBAV1_R0017.
DR   EnsemblGenomes-Gn; DehaBAV1_R0018.
DR   EnsemblGenomes-Gn; DehaBAV1_R0019.
DR   EnsemblGenomes-Gn; DehaBAV1_R0020.
DR   EnsemblGenomes-Gn; DehaBAV1_R0021.
DR   EnsemblGenomes-Gn; DehaBAV1_R0022.
DR   EnsemblGenomes-Gn; DehaBAV1_R0023.
DR   EnsemblGenomes-Gn; DehaBAV1_R0024.
DR   EnsemblGenomes-Gn; DehaBAV1_R0025.
DR   EnsemblGenomes-Gn; DehaBAV1_R0026.
DR   EnsemblGenomes-Gn; DehaBAV1_R0027.
DR   EnsemblGenomes-Gn; DehaBAV1_R0028.
DR   EnsemblGenomes-Gn; DehaBAV1_R0029.
DR   EnsemblGenomes-Gn; DehaBAV1_R0030.
DR   EnsemblGenomes-Gn; DehaBAV1_R0031.
DR   EnsemblGenomes-Gn; DehaBAV1_R0032.
DR   EnsemblGenomes-Gn; DehaBAV1_R0033.
DR   EnsemblGenomes-Gn; DehaBAV1_R0034.
DR   EnsemblGenomes-Gn; DehaBAV1_R0035.
DR   EnsemblGenomes-Gn; DehaBAV1_R0036.
DR   EnsemblGenomes-Gn; DehaBAV1_R0037.
DR   EnsemblGenomes-Gn; DehaBAV1_R0038.
DR   EnsemblGenomes-Gn; DehaBAV1_R0039.
DR   EnsemblGenomes-Gn; DehaBAV1_R0040.
DR   EnsemblGenomes-Gn; DehaBAV1_R0041.
DR   EnsemblGenomes-Gn; DehaBAV1_R0042.
DR   EnsemblGenomes-Gn; DehaBAV1_R0043.
DR   EnsemblGenomes-Gn; DehaBAV1_R0044.
DR   EnsemblGenomes-Gn; DehaBAV1_R0045.
DR   EnsemblGenomes-Gn; DehaBAV1_R0046.
DR   EnsemblGenomes-Gn; DehaBAV1_R0047.
DR   EnsemblGenomes-Gn; DehaBAV1_R0048.
DR   EnsemblGenomes-Gn; DehaBAV1_R0049.
DR   EnsemblGenomes-Gn; DehaBAV1_R0050.
DR   EnsemblGenomes-Gn; DehaBAV1_R0051.
DR   EnsemblGenomes-Gn; EBG00001226411.
DR   EnsemblGenomes-Gn; EBG00001226412.
DR   EnsemblGenomes-Gn; EBG00001226413.
DR   EnsemblGenomes-Gn; EBG00001226414.
DR   EnsemblGenomes-Gn; EBG00001226415.
DR   EnsemblGenomes-Gn; EBG00001226416.
DR   EnsemblGenomes-Gn; EBG00001226417.
DR   EnsemblGenomes-Gn; EBG00001226418.
DR   EnsemblGenomes-Gn; EBG00001226419.
DR   EnsemblGenomes-Gn; EBG00001226420.
DR   EnsemblGenomes-Gn; EBG00001226421.
DR   EnsemblGenomes-Gn; EBG00001226422.
DR   EnsemblGenomes-Gn; EBG00001226423.
DR   EnsemblGenomes-Gn; EBG00001226424.
DR   EnsemblGenomes-Gn; EBG00001226425.
DR   EnsemblGenomes-Gn; EBG00001226426.
DR   EnsemblGenomes-Gn; EBG00001226427.
DR   EnsemblGenomes-Gn; EBG00001226428.
DR   EnsemblGenomes-Gn; EBG00001226429.
DR   EnsemblGenomes-Gn; EBG00001226430.
DR   EnsemblGenomes-Gn; EBG00001226431.
DR   EnsemblGenomes-Gn; EBG00001226432.
DR   EnsemblGenomes-Gn; EBG00001226433.
DR   EnsemblGenomes-Gn; EBG00001226434.
DR   EnsemblGenomes-Gn; EBG00001226435.
DR   EnsemblGenomes-Gn; EBG00001226436.
DR   EnsemblGenomes-Gn; EBG00001226437.
DR   EnsemblGenomes-Gn; EBG00001226438.
DR   EnsemblGenomes-Gn; EBG00001226439.
DR   EnsemblGenomes-Gn; EBG00001226440.
DR   EnsemblGenomes-Gn; EBG00001226441.
DR   EnsemblGenomes-Gn; EBG00001226442.
DR   EnsemblGenomes-Gn; EBG00001226443.
DR   EnsemblGenomes-Gn; EBG00001226444.
DR   EnsemblGenomes-Gn; EBG00001226445.
DR   EnsemblGenomes-Gn; EBG00001226446.
DR   EnsemblGenomes-Gn; EBG00001226447.
DR   EnsemblGenomes-Gn; EBG00001226448.
DR   EnsemblGenomes-Gn; EBG00001226449.
DR   EnsemblGenomes-Gn; EBG00001226450.
DR   EnsemblGenomes-Gn; EBG00001226451.
DR   EnsemblGenomes-Gn; EBG00001226452.
DR   EnsemblGenomes-Gn; EBG00001226453.
DR   EnsemblGenomes-Gn; EBG00001226454.
DR   EnsemblGenomes-Gn; EBG00001226455.
DR   EnsemblGenomes-Gn; EBG00001226456.
DR   EnsemblGenomes-Gn; EBG00001226457.
DR   EnsemblGenomes-Gn; EBG00001226458.
DR   EnsemblGenomes-Gn; EBG00001226459.
DR   EnsemblGenomes-Gn; EBG00001226460.
DR   EnsemblGenomes-Gn; EBG00001226461.
DR   EnsemblGenomes-Gn; EBG00001226462.
DR   EnsemblGenomes-Gn; EBG00001226463.
DR   EnsemblGenomes-Tr; DehaBAV1_R0001-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0002-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0003-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0004-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0005-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0007-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0008-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0009-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0010-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0011-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0012-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0013-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0014-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0015-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0016-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0017-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0018-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0019-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0020-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0021-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0022-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0023-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0024-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0025-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0026-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0027-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0028-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0029-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0030-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0031-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0032-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0033-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0034-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0035-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0036-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0037-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0038-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0039-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0040-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0041-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0042-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0043-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0044-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0045-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0046-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0047-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0048-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0049-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0050-1.
DR   EnsemblGenomes-Tr; DehaBAV1_R0051-1.
DR   EnsemblGenomes-Tr; EBT00001795214.
DR   EnsemblGenomes-Tr; EBT00001795216.
DR   EnsemblGenomes-Tr; EBT00001795218.
DR   EnsemblGenomes-Tr; EBT00001795219.
DR   EnsemblGenomes-Tr; EBT00001795221.
DR   EnsemblGenomes-Tr; EBT00001795223.
DR   EnsemblGenomes-Tr; EBT00001795225.
DR   EnsemblGenomes-Tr; EBT00001795226.
DR   EnsemblGenomes-Tr; EBT00001795228.
DR   EnsemblGenomes-Tr; EBT00001795230.
DR   EnsemblGenomes-Tr; EBT00001795232.
DR   EnsemblGenomes-Tr; EBT00001795234.
DR   EnsemblGenomes-Tr; EBT00001795237.
DR   EnsemblGenomes-Tr; EBT00001795240.
DR   EnsemblGenomes-Tr; EBT00001795241.
DR   EnsemblGenomes-Tr; EBT00001795243.
DR   EnsemblGenomes-Tr; EBT00001795245.
DR   EnsemblGenomes-Tr; EBT00001795247.
DR   EnsemblGenomes-Tr; EBT00001795249.
DR   EnsemblGenomes-Tr; EBT00001795252.
DR   EnsemblGenomes-Tr; EBT00001795254.
DR   EnsemblGenomes-Tr; EBT00001795256.
DR   EnsemblGenomes-Tr; EBT00001795257.
DR   EnsemblGenomes-Tr; EBT00001795260.
DR   EnsemblGenomes-Tr; EBT00001795261.
DR   EnsemblGenomes-Tr; EBT00001795263.
DR   EnsemblGenomes-Tr; EBT00001795265.
DR   EnsemblGenomes-Tr; EBT00001795266.
DR   EnsemblGenomes-Tr; EBT00001795268.
DR   EnsemblGenomes-Tr; EBT00001795270.
DR   EnsemblGenomes-Tr; EBT00001795272.
DR   EnsemblGenomes-Tr; EBT00001795274.
DR   EnsemblGenomes-Tr; EBT00001795276.
DR   EnsemblGenomes-Tr; EBT00001795278.
DR   EnsemblGenomes-Tr; EBT00001795282.
DR   EnsemblGenomes-Tr; EBT00001795286.
DR   EnsemblGenomes-Tr; EBT00001795290.
DR   EnsemblGenomes-Tr; EBT00001795293.
DR   EnsemblGenomes-Tr; EBT00001795294.
DR   EnsemblGenomes-Tr; EBT00001795296.
DR   EnsemblGenomes-Tr; EBT00001795297.
DR   EnsemblGenomes-Tr; EBT00001795299.
DR   EnsemblGenomes-Tr; EBT00001795300.
DR   EnsemblGenomes-Tr; EBT00001795302.
DR   EnsemblGenomes-Tr; EBT00001795304.
DR   EnsemblGenomes-Tr; EBT00001795306.
DR   EnsemblGenomes-Tr; EBT00001795308.
DR   EnsemblGenomes-Tr; EBT00001795310.
DR   EnsemblGenomes-Tr; EBT00001795311.
DR   EnsemblGenomes-Tr; EBT00001795312.
DR   EnsemblGenomes-Tr; EBT00001795314.
DR   EnsemblGenomes-Tr; EBT00001795316.
DR   EnsemblGenomes-Tr; EBT00001795318.
DR   EuropePMC; PMC2168065; 17933933.
DR   EuropePMC; PMC2764846; 19893622.
DR   EuropePMC; PMC4703385; 26734727.
DR   EuropePMC; PMC5440377; 28533514.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000688.
DR   SILVA-SSU; CP000688.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000264
CC   Source DNA and bacteria available from Frank Loeffler
CC   (frank.loeffler@ce.gatech.edu)
CC   Contacts: Frank Loeffler (frank.loeffler@ce.gatech.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1341892
FT                   /organism="Dehalococcoides mccartyi BAV1"
FT                   /strain="BAV1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:216389"
FT   gene            245..1579
FT                   /locus_tag="DehaBAV1_0001"
FT   CDS_pept        245..1579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16593"
FT                   /protein_id="ABQ16593.1"
FT                   /translation="MSVRPAQELWEAALGEIELQVNKPNFRTWFAKTVGLKYDGSEFVI
FT                   GVPNTFVAEYLELNQRSLIEKTLINTTHSPVELCFQLIQSGQVPAAVPQTNKQKQESPF
FT                   NPRYTFESFIVGSCNRMAHAASLAAAQNPGKSYNPLYIYAEAGLGKTHLLQAIGHLANL
FT                   NRRKALYVSGEQFTTDFISSIRNGQTEEFRSRYRDVDLLLLDDVQFIGGKEQTEECLFH
FT                   TFNDLHNSNRQIVISADSPPKSLPQLAERLRSRFEWGLTIEIEPPDEKTRLELLQLKAE
FT                   QSGTELNMDTLEYLAQAVKHNIRELEGSLNRVLAYARLLRAAITPDLAARALSDIGSRP
FT                   VRENSPLRPGNIISAVSQVFQIPTTELLGAARDKDTALARQFAMFILKQQNSASLVEIG
FT                   QSLGGRSASTVSHACDKIQLELENSTFLRLKMTEVQNHLSQQRLP"
FT   gene            1910..3184
FT                   /locus_tag="DehaBAV1_0002"
FT   CDS_pept        1910..3184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0002"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; GTP1/OBG sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16594"
FT                   /db_xref="GOA:A5FP49"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR015349"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036346"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FP49"
FT                   /protein_id="ABQ16594.1"
FT                   /translation="MFDRVEINIKAGDGGSGKVSFRREKFVPYGGPDGGDGGDGGNVYL
FT                   EADSGLYSLLNFKHKRVHKASNGEGGMGSRCTGHNGADLVIKVPVGTVATILEENGQKR
FT                   VLADLAADGDRTLVAHGGQGGLGNTHFVSSTNQAPMLAQKGQPGGEYDLILELKLIADV
FT                   AIIGYPNVGKSSLLSLLTAAKPKVANYPFTTLSPVMGVIERPEGVFVMAEVPGLIENAH
FT                   LGKGLGHDFLRHISRTRMVIHLLDGTSENPIDDMIKVNSELYLYDASLSERPQVVAINK
FT                   IDDELVQLRREELKETFKEAGLEVFFISALTGEGVDVLLAKVAEKLDILKAADISETAP
FT                   DHEVKIFRPAPKGKMGFRITRLEDGWQVEAPEIERIIEHSDIEDPEVRRQVMVLLKHRS
FT                   VQQSLIKSGAVIGQKIITGRMEWYL"
FT   gene            3172..3786
FT                   /locus_tag="DehaBAV1_0003"
FT   CDS_pept        3172..3786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0003"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="TIGRFAM: cytidyltransferase-related domain;
FT                   nicotinate (nicotinamide) nucleotide adenylyltransferase;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16595"
FT                   /db_xref="GOA:A5FP50"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FP50"
FT                   /protein_id="ABQ16595.1"
FT                   /translation="MVSLKTGILGGTFDPIHTGHLILADEVKNRLGLDEVIFIPTGQPY
FT                   YKADKTISPAEDRLNMVKLAISDKPYFRVMDIEIKRSGPTYTADTLNDLKTILPEKTEL
FT                   YFMLGWDNLEALPRWHKASEIIRLCRLVAAPRIGQVKPDVDELDDKLPGLQQSLILLSK
FT                   PEVDISSSLVRERVENGQGVEHLVPAAVASYIKKHNLYCRK"
FT   gene            complement(3868..5796)
FT                   /locus_tag="DehaBAV1_0004"
FT   CDS_pept        complement(3868..5796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase,
FT                   subunit B domain protein; ATP-binding region, ATPase domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16596"
FT                   /protein_id="ABQ16596.1"
FT                   /translation="MLDANKAKPGANSETYTASDIQVLEGLAAVRKRPGMYIGSTDQRG
FT                   LHHLVYEIVYNSVDEAMAGVCDRIKVIMFKDGSVSVEDNGRGIPVDIHSTTKISALETV
FT                   MTVLHAGAKFGGKTYQVSGGLHGVGASVVNALSEWTTVKVRRNGKIYQQSYLRGKPSTP
FT                   LEEVGVSEGSGTTTIFMADSQIFSTTEYDFETLTDRLREIAYLNKGLEVYIYDEKSDQE
FT                   RTYYFEGGITGFVRHLNRNREVRHRQPIYITKKSDSTILEVAIQYNDGYSDSTLTFANC
FT                   VNTVDGGTHLTGFRSALTRAFNDYAHKSKFLKDTDPNLMGDDVREGIVAIVSVKLPEPQ
FT                   FEGQTKGKLGNIEIKSFVESAVAEQLSLYLEEHPDDTKRILEKCITAAKAREAARKARD
FT                   LIIRKSALDTGTLPGKLADCSERDASLCELFLVEGDSAGGSAKQGRNRRFQAILPLRGK
FT                   ILNVEKASPDKMLAHEEIRAIITALAAGIDNDFDPSKLRYNRLVLMTDADVDGSHIRTL
FT                   LLTFFFRHMPRLITESHLFIAQPPLYKIKIGSTEHWVYNDAEKEAILAQTKSTKVDIQR
FT                   YKGLGEMSAEQLWRTTMDPASRTLLEVKVEDAAKADQIFNLLMGGEVAPRKAFIQSHSR
FT                   TVKNLDI"
FT   gene            complement(6001..8187)
FT                   /locus_tag="DehaBAV1_0005"
FT   CDS_pept        complement(6001..8187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0005"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="TIGRFAM: RelA/SpoT family protein; PFAM: amino
FT                   acid-binding ACT domain protein; TGS domain protein;
FT                   metal-dependent phosphohydrolase, HD sub domain; RelA/SpoT
FT                   domain protein; SMART: metal-dependent phosphohydrolase, HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16597"
FT                   /protein_id="ABQ16597.1"
FT                   /translation="MEFADLKEKASKYLPPEKLTLLEEAYNYAAAAHAGQMRKSGEPFI
FT                   EHPLNVAMTLADLQLDAATLSAALLHDVPEDANISLEQIDKKFGADVAKLVDGVTKLSK
FT                   LALGPAIEDARRPGGNASLRQAENLRKMLVAMAEDLRVVFIKLADRFHNMRTLQALSPE
FT                   KRRSIAKETMEIYAPLAHRLGIWELKWQLEDLAFRYLDPRHYRQVANLVDSKLAQRQNY
FT                   LEHVSAILQGEFEKNGLNVEVSGRPKHLYSIYQKMEKYASQGKQFEDIYDVLALRVLVN
FT                   DIPDCYHAVGIVHSLWHPIPGAFDDYIANPKPNGYQSLHTAVMSLGTTPLEVQVRTYQM
FT                   HHIAEYGVAAHWRYKTAGKEDVNFEDRIGWLRQLIEWHRDMRGAEEFLESVKTDIFNDQ
FT                   VFVFTPKGEIKDLAKGATPIDFAYRIHTELGNRCIGAKANGRLVPLDYQLKNGEVVEIV
FT                   TTKKDRGPSRDWLNGNMGYIKTHHAREKILAWFKKQERTENLDRGRELLEKELKHIGIK
FT                   TVDRDALAKTFKYENADEFLMAIGYGAVSVHQVSMKLLSQQEQPRVVTPPTQTTKPTSQ
FT                   SSVSVMGTGSLLTNIAKCCNPVPGDDIIGYVTRNRGVTVHRQDCHNILHEEERERLVSV
FT                   DWGMPKEELYPASIRIQAWDRVGLVRDVSTVVAEEKISILSMTVTENDDKTTTLAMTTQ
FT                   IKSLSQLTRLMAKLEGIRGIISINRVGADGSRSG"
FT   gene            8315..9571
FT                   /locus_tag="DehaBAV1_0006"
FT   CDS_pept        8315..9571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0006"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16598"
FT                   /db_xref="GOA:A5FSR7"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSR7"
FT                   /protein_id="ABQ16598.1"
FT                   /translation="MYQSPRGTEDILPEDQPYWHFVRQQAARIAALYGYQRTDTPVFED
FT                   AGLFVRSVGEGTDIVSKEMYTFEDRGGDKLTLRPEGTAPVCRAYLEHGMQTRTKPVKLY
FT                   YLSSIFRYDRPQAGRYRQHHQFGFEAIGEADASLDAEIIEMAWSFYNLLGITDLSLELN
FT                   SIGCRQCRPNYISALKDYYQQHAGKLCPDCNTRLDKNTLRLLDCKRAECQAVAGNAPRS
FT                   ADYLCPDCLAHYSRLKECLTILDLPFHENFRLVRGLDYYSRTVFEIQPMAEGAQSTIGG
FT                   GGRYDGLIEQLGGEATPAMGFATGIERIILNLKRQGIVPSPLPSPAVFLAYMGETASLA
FT                   SFALASDLRKAGIGIYQTYAQKSIKAQLRQANSLGVDWVVILGEEELKQGCAVLRNMKE
FT                   AGQANIPLDQLICEIKKQI"
FT   gene            9568..10731
FT                   /locus_tag="DehaBAV1_0007"
FT   CDS_pept        9568..10731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0007"
FT                   /product="Saccharopine dehydrogenase"
FT                   /note="PFAM: Saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16599"
FT                   /protein_id="ABQ16599.1"
FT                   /translation="MTKNILIIGGYGNAGSCIAMLLMQETDARIFLGGRSLEKAKYVAE
FT                   GLNRLENIQRVEGVRLNVEDPQSLKEAFSGMDIVVVASNTPEYARQIAVAALEAKVDYI
FT                   DIQYSDRKLHQLKLLSQKINNANLCFITEAGSLPGLPSALVHLVHQDFTTLERVSVGAI
FT                   ICQNWESAISEERTNEVMRQLSDYQPYVYKNYHWKRLGWFHPGTSRTFNFGSFGRLSCG
FT                   PMTLEEMRPLPGMYTTLKELGFYMGGFNWFTNWISIPLLNLGLRFFGKEAKRSLGKLLV
FT                   WGLRNFDNQPYGMAIKVSARGERGGIRERQDILLSHKDAYMFTAIPLVACLKQYLDGSA
FT                   RRSGLYYMGHLVDSKRLVGDMEKMGMTIRFQTQLVDKPPVARPRIED"
FT   gene            complement(10728..11330)
FT                   /locus_tag="DehaBAV1_0008"
FT   CDS_pept        complement(10728..11330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0008"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="PFAM: protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16600"
FT                   /protein_id="ABQ16600.1"
FT                   /translation="MLGSIPSAYLVTRRLIGRDIRQMGGGNVGGLNTFREVGTGAGISV
FT                   AFIDLVKGALAVSVSYYLLTQNAQWVILTGFMAVIGHNWSVWLDFKGGKGLGPAFGAML
FT                   FLLPVYGLPQQLGILALLVFIPLALTRNIALATGIALFSLPFLVWYGSHSEFATLISVL
FT                   LFLMIGGKFVLDNRKSLRDPANRRNLIVDHWKRPDKG"
FT   gene            complement(11384..12304)
FT                   /locus_tag="DehaBAV1_0009"
FT   CDS_pept        complement(11384..12304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0009"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16601"
FT                   /protein_id="ABQ16601.1"
FT                   /translation="MGTSYAYFKKQIIPLEDAKIGVMTHALHYGTGVFEGIRGNWNDEK
FT                   KQMYVFRLKEHYTRLLSGAKVLKMDLPYTVDELCKITIELVRKCGFKEDIYIRPLAYKS
FT                   SESFGVRLHNLECDLLIVAIPWGRYIDKDTCHCCVSTWRRPDDNVMPPQLKSTGIYLNN
FT                   AFTKTEAVENGFDEGIMLTPDGHVSEGSGENLFLVRKGKLITPPICDSILDGITRNSVM
FT                   ELAEKELGLQVVERSIDRVELYMAEECFLTGTAAHLTPVSEIDHRKVGNGEIGPLTAKL
FT                   KDLYFEAIKGNITKYENWCTPVYNL"
FT   gene            complement(12458..13630)
FT                   /locus_tag="DehaBAV1_0010"
FT   CDS_pept        complement(12458..13630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0010"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16602"
FT                   /db_xref="GOA:A5FSS1"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSS1"
FT                   /protein_id="ABQ16602.1"
FT                   /translation="MSIRRVMHVDLDAFFVSVEQAVRPEFKDKPVIVGGKPERRGVVAA
FT                   ASYEARKFGIHSGMPLITAKHLCPQAIFIEGNHQLYREYSEKFMLILSDFSPFLEPMGL
FT                   DEAYLEVTGFESLHGSIAQMASKIRRRITAELGINASIGIANSKVAAKIATEQAKPNGQ
FT                   CEVPAGEEASFLAPLDIAVMPGIGKKTEQHLKSLGIDTLGKLAALPASFLKSCLGTYAP
FT                   YLSNAAMGIDNRPVEMPSEAKSISRETTFETDTRNQTFLEAKLSYLSEKITATLRKRGK
FT                   QTRVVQIKIRFADFTTLTRQKHLGQPASGNREIFQTALSLMNGILDSDRQAVRLLGVGI
FT                   SDFCGPEKQLEIDPAKARLEKLDASLDKIRQKYGFSSVQTGRTYRLKDMF"
FT   gene            complement(13630..13818)
FT                   /locus_tag="DehaBAV1_0011"
FT   CDS_pept        complement(13630..13818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0011"
FT                   /product="protein of unknown function DUF951"
FT                   /note="PFAM: protein of unknown function DUF951"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16603"
FT                   /protein_id="ABQ16603.1"
FT                   /translation="MPEINPGDVYKLRKPHPCGGTDWKVDFAGSDIGITCLRCGHHLLL
FT                   SRPLFEKKVKCLIKPGE"
FT   gene            complement(13889..14701)
FT                   /locus_tag="DehaBAV1_0012"
FT   CDS_pept        complement(13889..14701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0012"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16604"
FT                   /db_xref="GOA:A5FP84"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FP84"
FT                   /protein_id="ABQ16604.1"
FT                   /translation="MKFLEKLKQAGNRNKSLLCVGLDPDPKLMPVGMSALEFNREIIEA
FT                   TAPFVCGYKINLAFYEALGKQGWEILSETCEFIPRELITIADAKRGDIGNTSKAYARAI
FT                   LDELDCDGVTVSPYLGYDSLEPFIEYQDKGIFILCLTSNQGSTDFQMLKTEYLGQKRFL
FT                   YEVVADKASLWNRYENIGLVVGATQQEELKKLRLIYPKLPFLIPGIGAQGGDLKATIEN
FT                   GTNPNGELAIICASRGILYARSGSEFAQGAAEAAEQMRDAINHYRKRF"
FT   gene            14849..15544
FT                   /locus_tag="DehaBAV1_0013"
FT   CDS_pept        14849..15544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16605"
FT                   /protein_id="ABQ16605.1"
FT                   /translation="MKKEFPNKNFQRIEAGHGFEISLIRSDSFEVTVDASEDGFRNIEI
FT                   KQEGDKLWLMYSPSIFSLKNLLPGWYLPRATVKMPRLGGLYINGATRAKLEGFDSNGKL
FT                   EIKLSGASQLEGEVKAGEAEIKAEAASEVRLKGVFKKLKLELESGSKVQMEGWTEELEA
FT                   EAKGVSQIALDKMVCKQAKVKLENASQAELRVEEVLNVKLNGASELKYAGSPCFNEVEI
FT                   KGSSSLSKS"
FT   gene            15583..16377
FT                   /locus_tag="DehaBAV1_0014"
FT   CDS_pept        15583..16377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16606"
FT                   /protein_id="ABQ16606.1"
FT                   /translation="MKKAALLCLSICFTGILALLGGGCIPGVGGFITGSGEVESQPFDY
FT                   ADFNRVEISNVITADISRADSFEVSVSTNENIFEYLELEKSGQTLKIGLKDNYSFTNVK
FT                   IEASIRLPELVGLDISGASKATVSGFNSVNDFTALVSGASRITLFNMRVGQTRLYISGA
FT                   SFASGDLICGNASLEVSGASRLELSGQGVDIDVLTEGASTVNLEKFLAASAEVTATGVS
FT                   NIRVYTNGDLYITASGVSSVKYFGNPIIKDINISDISSAGKG"
FT   sig_peptide     15583..15648
FT                   /locus_tag="DehaBAV1_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.403 at
FT                   residue 22"
FT   gene            16423..17739
FT                   /locus_tag="DehaBAV1_0015"
FT   CDS_pept        16423..17739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0015"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16607"
FT                   /protein_id="ABQ16607.1"
FT                   /translation="MGLTDYESATSRAAANYDLRRVVELLMRLRNPHMGIPAVHLAGTK
FT                   GKGSTASLIASVMSVAGYRTGLYTSPHLLDFRERICLDGKMISKDHLVRLMASIRPLVD
FT                   EMNAHAYLGKITSFEVMTALAFEFFHRQQATFQVIETGLGGRLDATNVITPNLSVLTPI
FT                   SLDHTEVLGDSLDKIAAEKAGIIKQSVPVVSAAQRLEAMAVIRERCLKTQSRLIEVSDG
FT                   YKAEFLGYLGNGQLVKLTGRLGEYCLCLSLLGHYQRQNALTALASLEVLIEAGFKISPE
FT                   DICEGFRQARWPGRFEVIKGNPLLVIDGAHNEEAVAELVLSLEEYPATAKIEKGERVLV
FT                   FGTSFDKDAQAMAALLGGYFGTVVLTRSAHPRAMKMDLLKQAFEGRGLQVLEADGVPKA
FT                   LELAGEISPADGLICATGSLFVAAEALKGKSQPRSGTGS"
FT   gene            complement(17722..17937)
FT                   /locus_tag="DehaBAV1_0016"
FT   CDS_pept        complement(17722..17937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16608"
FT                   /protein_id="ABQ16608.1"
FT                   /translation="MSCYFRHMGDIFLAAGVDPQGEKRRELDKIIHRFLGIEYKSCPET
FT                   WKKLKEEVIPYPDKKNKLIELLRASS"
FT   gene            complement(17951..18214)
FT                   /locus_tag="DehaBAV1_0017"
FT   CDS_pept        complement(17951..18214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16609"
FT                   /protein_id="ABQ16609.1"
FT                   /translation="MQSSLIGKIEKAKRYAQEKDRIRFNQLSVQFRGENDIHTTEYINS
FT                   KWHCTCNFFAAWGMCSHTMAMEKVLENMLPDEALSNVFAELP"
FT   gene            18517..18978
FT                   /locus_tag="DehaBAV1_0018"
FT   CDS_pept        18517..18978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0018"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16610"
FT                   /db_xref="GOA:A5FSN9"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSN9"
FT                   /protein_id="ABQ16610.1"
FT                   /translation="MKAVVQRVSRASVRVSGETVGEIGPGLAVLLGVAEGDTEEDAEYL
FT                   ASKIINLRIFSDAEGKFNLSLKDLCREMLVVSQFTLIADTRKGRRPSFIEAAQPQEADG
FT                   LYNVFIRLCREEGTQVATGQFGAMMMLEIYNDGPVTIILDSRDRLNPRL"
FT   gene            19030..19458
FT                   /locus_tag="DehaBAV1_0019"
FT   CDS_pept        19030..19458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0019"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16611"
FT                   /protein_id="ABQ16611.1"
FT                   /translation="MHKQNSIAGELASDGFRLTPQRVLILEALDMAEGHISAEDIYAEV
FT                   GQEYPNINISTVYRTLELLKGQGLVLETDMGDGRLRYHSVNKGSHHYLVCRKCGQVTDL
FT                   SEDMVKQLEQSIFKTYGFAADFKNLVIYGQCQKCSASA"
FT   gene            complement(19849..20601)
FT                   /locus_tag="DehaBAV1_0020"
FT   CDS_pept        complement(19849..20601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16612"
FT                   /protein_id="ABQ16612.1"
FT                   /translation="MESRKLSRFIIIVAIISLAASALLYLLHYYIFQDSHHIFIYMLGD
FT                   LAFIPLEVFLVVVVIERILTSREKHAISQKMNMVVGSFYSELGNALLGKILGSFDDPEQ
FT                   IDSHMGVNKNWSSPEFKQALVYSSHFNHTPNPGKLDLQHLKNLLAAKRSFMLTLLENPN
FT                   LLEKDDFTDLLWASFHLGEELDARPSLENLPETDKAHLANDVKRMYALLLNQWIKYLIH
FT                   LKSQYPHLYSLVLRTHPFQPSPNPVIHE"
FT   sig_peptide     complement(20533..20601)
FT                   /locus_tag="DehaBAV1_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.614 at
FT                   residue 23"
FT   gene            20704..21090
FT                   /locus_tag="DehaBAV1_0021"
FT   CDS_pept        20704..21090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16613"
FT                   /protein_id="ABQ16613.1"
FT                   /translation="MVKYAPDMVADKKDQLEQIEGICLPDELIHAVFDLKGQGTGFIGL
FT                   TNKRIIFYDKEFAKKAKAIVSIPYNRVATVGSEDKGGLIFRKGFMVSDKLYVGVSGQAV
FT                   KEFEFRGGDKAHQAHDIIMTYVLN"
FT   gene            complement(21172..21312)
FT                   /locus_tag="DehaBAV1_0022"
FT   CDS_pept        complement(21172..21312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16614"
FT                   /protein_id="ABQ16614.1"
FT                   /translation="MANRIAEQIDRTFFQFKWLFMPPKAKYVYLWNRSRASLQADYYGL
FT                   R"
FT   gene            complement(21369..23759)
FT                   /locus_tag="DehaBAV1_0023"
FT   CDS_pept        complement(21369..23759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0023"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /note="TIGRFAM: DNA internalization-related competence
FT                   protein ComEC/Rec2; PFAM: beta-lactamase domain protein;
FT                   ComEC/Rec2-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16615"
FT                   /protein_id="ABQ16615.1"
FT                   /translation="MIISLCSLGLIAGVALSRLGLPVLPFIILALALGVFWFIFRKKTR
FT                   LLLGLSLGFLALSGGLWLANSQITINSDPSRLDYYNDSGKLELQGIITENPDKRDRTSL
FT                   ILLEASGIATSSGWQEVSGNVLLTLPSYPEYSYGDQIRISGYLKTPENFDGFDYKSYLE
FT                   NQQIYSVMVYPETTLLSEDNGNPVMTAIFSFRQSLSESLSRAMPEPEASLAKGILLGER
FT                   SGIPEDIQTEFSISGTTHLLAISGANLSILSGILLAALGWILGKRGYIYIYLTLILIWG
FT                   YSLLSGFDPPVVRAVIMASIFLSAELLGRQKNAMPALCLAAAVMVAFSPSILWSVSFQL
FT                   SFMSMLGLILVYPMLKELNIRLLDRLGLAEGIFRATLGLVLDGLAVSLAAIAGIWPVLL
FT                   YYFENISLIGPVATLLAMPAMPFIIVLSFLTALLGLVFPAGAIFMGYLTWLPCRYMLVV
FT                   VSLTASVPGVLMSGLRPGAMLMGIYYFLLGMLYWLYKHMLKMPPSRPNTNPASTLNLRW
FT                   LLAGIAVPVLFFSFNLSPSTDQKLHVYFLNVGQGDAILIQYQNQDILIDGGPSPQTLCS
FT                   ELDKHLPFFDRSIEMVILTHPDSDHLNGLLEVLERYRVKEVILPQTRSQDSLYQSYQNL
FT                   IAEKAIPARIAETGMQITMANGAVLEVISPFGGLSSKAADTDNNHSTVLNLSCGQINYL
FT                   FCADIETTVEYQLITQRLLADTTVLKVSHHGSKYSSSAWFLDVTSPEFGLISVGADNRY
FT                   GHPHPETLSRLISVMAENCIYRTDIWGSLDFATDGQSLYILQS"
FT   sig_peptide     complement(23697..23759)
FT                   /locus_tag="DehaBAV1_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.812) with cleavage site probability 0.564 at
FT                   residue 21"
FT   gene            complement(23756..24256)
FT                   /locus_tag="DehaBAV1_0024"
FT   CDS_pept        complement(23756..24256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0024"
FT                   /product="DNA uptake protein and related DNA-binding
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16616"
FT                   /protein_id="ABQ16616.1"
FT                   /translation="MKVSKRFGLLLGLALSVITAQGCSETTPLAVYTPPQITEKPLEIY
FT                   ISGNINLPGIYPAGTQDTLQSLLESSGGLKDNSELTTIYLSFNPPPLASSAQKIDLNRA
FT                   EIWLLVALPGIGEARASDIVSYRNQNGGFKNTLELMLIPGFSQSLYDQIKDMICVSETA
FT                   DIS"
FT   sig_peptide     complement(24188..24256)
FT                   /locus_tag="DehaBAV1_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.794 at
FT                   residue 23"
FT   gene            complement(24434..25099)
FT                   /locus_tag="DehaBAV1_0025"
FT   CDS_pept        complement(24434..25099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0025"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16617"
FT                   /protein_id="ABQ16617.1"
FT                   /translation="MYVVVIGGGRLGYYLLKALLNDGHEVLLIEKNSSLCDGINKEMGS
FT                   VCLHGDGCETAVLTEAGTSRADLLIAVTGDDEDNLVACQVAKYKFNVPRTIARVRNPKN
FT                   ESVFRQLGVDSTVNSTNIILEHIEHEVPSHAMTHLLTLHGKDLEIIDIRIPENALTVGK
FT                   QIHELVLPPQTIISLIVRKDGKPILPRPETTVQVGDQFMIVTSAAKEAEIRDILTATA"
FT   gene            complement(25104..25508)
FT                   /locus_tag="DehaBAV1_0026"
FT   CDS_pept        complement(25104..25508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0026"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16618"
FT                   /protein_id="ABQ16618.1"
FT                   /translation="MKVVIMGCGRVGAQLATMLDKEGNEVISLDIDAYSFRRLPADFKG
FT                   TALLCNGMDEESLKKAGIETADAFVAVTQGDNRNIMAAQIAKKIFNVPKVVCRIYDPLR
FT                   RDLYTLLGLDAISPTTIFAQMLKDKIESKE"
FT   gene            complement(25512..25940)
FT                   /locus_tag="DehaBAV1_0027"
FT   CDS_pept        complement(25512..25940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0027"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16619"
FT                   /protein_id="ABQ16619.1"
FT                   /translation="MEFERILVPVDGTETDEEAISLACTISKVSGKTRVFAVHIIPVER
FT                   ALPLDAELSSAINKSEGILAKAEEIAEKQGVKLETDLLQAREVANAIIDEAVEKEIDLI
FT                   LIGLSYKTRFGEFCMGGVLPYILQNAPCRVIVYHQRKV"
FT   gene            complement(26017..27462)
FT                   /locus_tag="DehaBAV1_0028"
FT   CDS_pept        complement(26017..27462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0028"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16620"
FT                   /protein_id="ABQ16620.1"
FT                   /translation="MKINNVLHYLGLVIAIVGGFMLIPFIFSLINAEPDQMAFGISIVI
FT                   TLSAGFLLWRFTPITERRISLRESLAIVAGSWIMAALFGSLPFIISGVLPSVIDCIFEA
FT                   MSGLTTTGASVFSSVENLPHGILVWRSLTQWIGGLGIIMLFVTILPMLGIGASQLMEAE
FT                   TPGQQERLTSRIRDTARTLWLLYLGFTVAGFIALVIAGLPGFDAFNVILATTPTGGFAP
FT                   VSSIGVYNNLAVELILIFFMVASGVNFGLYYYLLWKGRPAKFFGNPEFKLYIGILAGCI
FT                   LLINWDLVANAGIGIFEGLRQASFQTASVMTTTGFATADFATWPHFSQAILLVLMVVGA
FT                   SAGSTGGGLKVIRLLVLFKYTYRRILLTFNPNAVIPIKIGGNVISDKLISRSVGLTILY
FT                   FAALWAGFLIMSAIGLDFVTALSSITSCLGNIGPALGTVGPMSSYADIPGIGKLVLLIA
FT                   MLVGRIELFTLLVLFVPAFWRWR"
FT   sig_peptide     complement(27364..27462)
FT                   /locus_tag="DehaBAV1_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.661 at
FT                   residue 33"
FT   gene            complement(27466..28830)
FT                   /locus_tag="DehaBAV1_0029"
FT   CDS_pept        complement(27466..28830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0029"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16621"
FT                   /protein_id="ABQ16621.1"
FT                   /translation="MYIVIAGGGTVGYNIASMLVVEDHEVVVVEQSEKAVEYLNQQLDI
FT                   KTIFGNAAIPRILRDAEVQRADLVLAVTDRDETNMVICFIAKEMGAATTAARIRNSEYT
FT                   GYFIPPAKSTLSARRIIRPKSLGIDVFINPEVEMAREILGILSSFYSTPVEQLANGLVQ
FT                   IRSFTIEGSPMAGKTLSELNFAKPCVVAAIARKEELLVPRPDLVLENEDALYLVAERDN
FT                   MDYLGRMFSAIQRPARSVFILGGTQIGMLVAEGLADHDVVVKLIEPDEEKSQKAAVRLE
FT                   KAVVLKGDPTDRDFLTEQGVPSADAFVATTENDEFNILSCLVAKNLGVDRSLTVINKPS
FT                   YIPLAEAVDIDVAGSPAIITARKIAHFVLSGGAIAATLLESGQLEAVEFVVSPQAGIIN
FT                   QKVSQIEIPKEATIGAVVQNNQVIIPPDEAVIHAGDHVIVVSQLNVLHDVEKLFK"
FT   gene            29308..29937
FT                   /locus_tag="DehaBAV1_0030"
FT   CDS_pept        29308..29937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0030"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16622"
FT                   /protein_id="ABQ16622.1"
FT                   /translation="MPRISIIPREEKFFDLLEMSAKNMVITAQELDKLVNNWVNVDDQV
FT                   ARIADLEHEGDSIAHQIINLLHRTFVTPFDREDIALLAHTMDDVTDFIHSAADFMFIYK
FT                   TGRPGERAKELAAIIVLAAKEVSLAVPHLRHKSEMKQVISHCVEINRLENLADVAFRAA
FT                   LGELFTDSKDMANIIKWREIFEHMETATDRCEDVANVLEGVALKNA"
FT   gene            29930..30931
FT                   /locus_tag="DehaBAV1_0031"
FT   CDS_pept        29930..30931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0031"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16623"
FT                   /protein_id="ABQ16623.1"
FT                   /translation="MPDASFLPYLLIILLAIGFAFVNGTNDTANAIATVVGTRVLSPRK
FT                   AIIMAAVANLAGVFTGTAVARTIGKGILGPESLTYETVIAGLIAAVIWSVVATRKGLPV
FT                   SLTHCLVAGLAMAGVAMAGFGSVDWGILLKIIAAVGIAPIMGMAGGYLLMVALLWIFRR
FT                   SVPSKTNGLFSHLQIFSAAFMAFSHGRSDGQMPMGIIALGTVLYTGNAGLWDAIPFWII
FT                   VLSALSISAGTAIGGWKVIQTVGVRMTNLRPINGFAAETAAATVIQIAASIGIPVSSTH
FT                   AISSAIMGVGATRRLSAVRWGVAGNIVGAWLLTFPICGVLGFLVAGLFKLIF"
FT   gene            complement(30928..31545)
FT                   /locus_tag="DehaBAV1_0032"
FT   CDS_pept        complement(30928..31545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0032"
FT                   /product="Guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16624"
FT                   /protein_id="ABQ16624.1"
FT                   /translation="MTNWNFNKAEKPLLLIVSGPSGVGKDAVLARMKERKLPLTYIVTT
FT                   TTRPKRETETEGVDYNFIRPAEFQELISQNELLEWANVYGNFYGVPKAPIRQALSRGSD
FT                   VIVKVDVQGAASIKKIVPNAVFIFLMPPDMDELTRRLEHRLTESPESLRRRLATAPLEI
FT                   EKLPDFDYVVVNPEGEIDNAVREIMSIIAAEHCRIQPRLIEL"
FT   gene            complement(31526..31816)
FT                   /locus_tag="DehaBAV1_0033"
FT   CDS_pept        complement(31526..31816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0033"
FT                   /product="protein of unknown function DUF370"
FT                   /note="PFAM: protein of unknown function DUF370"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16625"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FP31"
FT                   /protein_id="ABQ16625.1"
FT                   /translation="MFIELVHIGFGNILAMNRVIAISPPSSAPIKRIIQESRTKGFLID
FT                   MTNGRKTKAVIFTDSGHIVLAALAPETITGRLSISRGGAVKPELVDDKLEL"
FT   gene            32025..32873
FT                   /locus_tag="DehaBAV1_0034"
FT   CDS_pept        32025..32873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0034"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudB"
FT                   /EC_number="1.8.1.-"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16626"
FT                   /protein_id="ABQ16626.1"
FT                   /translation="MYTIIERQDLLPKVHLLKIQAPKVAAAAAAGQFVILRVDTEGERF
FT                   PLTIADWDAQAGTVTVIYMEIGVSTRKLAKLGKGDAILDFAGPLGKPTEIENFGTVVCV
FT                   SGGFAMATIVPIARAMKEAGNRVISIVGARSKDLFFWHDRLTKYSDEMIVCTDDGSAGI
FT                   KGLVTEPLRDLLSSDTKLDRVIVIGPSVMMKFCSKTTQPFGVKTIVSLNPIMIDGTGMC
FT                   GCCRVSLDGQTRFACVDGPEFDGHKVDWDGLLVRQKSYVAEEAVASERCRCKEEGCGNH
FT                   G"
FT   gene            32866..34263
FT                   /locus_tag="DehaBAV1_0035"
FT   CDS_pept        32866..34263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0035"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudA"
FT                   /EC_number="1.8.1.-"
FT                   /note="TIGRFAM: glutamate synthase (NADPH), homotetrameric;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16627"
FT                   /protein_id="ABQ16627.1"
FT                   /translation="MAKAGLNRIDMPKQAVAKRIQNFSEVATGYTPSDAHIEAARCLQC
FT                   KKRYCVEGCPVNIDIPEFILALREGDMPEAARILKKTNSLPGVCGRVCPQETQCEQACI
FT                   LNKKEVPIAIGRLERFVADWEREHSAEVNLPKSLKPKSGKKAAVVGAGPAGLTASAELA
FT                   RLGHDVTLFESLHTAGGVLMYGIPEFRLPKDIVQGEVEYVKSLGVKIELNSVAGRLFSL
FT                   DDLFKQGFQAVFLATGAGLPLFLNVQGENLNGVYSANEFLTRINLMKAHSFPEYDTPVK
FT                   KGKKVAVIGGGNVAMDAARCALRLGAEEVSIIYRRSEVELPARKEEVENAREEGIKFHF
FT                   LTSPVRFLANEQGKVRAMDCQKMELGEPDASGRRRPIPVDGSEFEMDIDLAIIALGTRP
FT                   NPLVMQSAPDLQVNPNGTVAAGISGQTSHRAVWAGGDIVTGSDTVISAMGAAKRSALVM
FT                   DEYLRSL"
FT   gene            complement(34260..34466)
FT                   /locus_tag="DehaBAV1_0036"
FT   CDS_pept        complement(34260..34466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16628"
FT                   /protein_id="ABQ16628.1"
FT                   /translation="MFRSALLFYVFAMLALCFIPAWHSFISQVTGSLDQNLSLVIKLIA
FT                   DPLEYVWKWVLAIFIILLLNRRN"
FT   sig_peptide     complement(34371..34466)
FT                   /locus_tag="DehaBAV1_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.402 at
FT                   residue 32"
FT   gene            complement(34582..35115)
FT                   /locus_tag="DehaBAV1_0037"
FT   CDS_pept        complement(34582..35115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16629"
FT                   /protein_id="ABQ16629.1"
FT                   /translation="MKIEPEVRKEINQVLDAMKEAVEAKNIEALVALVDSEPNILTVGP
FT                   CPDNVGLGQNGFRRWMQALLDKATPVKFKLGFTTIKGNGPVVWLDTHVTYTCKNGENQK
FT                   DFDFYLSGVMEKVTNEWRWSQMHLSAPSELEFPEGPPPSPEAEKPAEKPKDTTENKAPN
FT                   PEQGEDAPPEWNYM"
FT   gene            complement(35186..35794)
FT                   /locus_tag="DehaBAV1_0038"
FT   CDS_pept        complement(35186..35794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0038"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16630"
FT                   /protein_id="ABQ16630.1"
FT                   /translation="MLEINYSTAIDPFLRNIRSFIPDFGGIKPGERVLDVCSGSGAQVG
FT                   EYRKRGILGFGLDLSPDMLSLSRRLYDPALPSDSYFTEADARHLPFADASFDYTSTTLA
FT                   LHDKPSQTCLEILAEMKRVVKPEGYILIADYTCPLPASFPGWIIRTIERLAGGEHYRNF
FT                   RQYLKHGGVPALFEELGIKPEGTQTTSYGLITVTKAKVS"
FT   gene            complement(35805..35999)
FT                   /locus_tag="DehaBAV1_0039"
FT   CDS_pept        complement(35805..35999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16631"
FT                   /protein_id="ABQ16631.1"
FT                   /translation="MFDFFFGGILGLISFAISLAFYFLPTIIALAKHRRNTLAIFLLNF
FT                   FLGWTFIGWVVALVWSVKK"
FT   gene            36141..36512
FT                   /locus_tag="DehaBAV1_0040"
FT   CDS_pept        36141..36512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0040"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16632"
FT                   /protein_id="ABQ16632.1"
FT                   /translation="MDIEQFKQLVGEAVDSLPEEFLALLDNVEILVADRPSRVQRRNLD
FT                   MQAGEELLGLYEGVPLTERHASYGMVTPDRITIFRLAILDTVKSEDDIKDEVRRVVKHE
FT                   VAHHFGISDERLEEMGGPV"
FT   gene            36648..37094
FT                   /locus_tag="DehaBAV1_0041"
FT   CDS_pept        36648..37094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0041"
FT                   /product="C_GCAxxG_C_C family protein"
FT                   /note="TIGRFAM: C_GCAxxG_C_C family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16633"
FT                   /protein_id="ABQ16633.1"
FT                   /translation="MSDIAVSAQILHEKGFNCAQSLLAAFAPSLGIETGTALKLASAFG
FT                   GGMAARGDTCGVISGGLMVIGLKFGQASVEDKAAREKCNRLGREFLKQFEAEFGATACR
FT                   DLIKCNIGTPEGAKMVKEKGLREGLCSKLVYRGAEILSALIEQI"
FT   gene            complement(37091..38194)
FT                   /locus_tag="DehaBAV1_0042"
FT   CDS_pept        complement(37091..38194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0042"
FT                   /product="Protein of unknown function DUF933"
FT                   /note="PFAM: Protein of unknown function DUF933"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16634"
FT                   /protein_id="ABQ16634.1"
FT                   /translation="MAVTIGIIGLAKSGRTTIFNAATRSNAATGSYSQSSSANVGIVKV
FT                   PDARLSPLEEMFHPKKLTPAEIKYFDVGASLKGGTKDSSFSGELLTQLQNVDALLNVIR
FT                   AFEDTAIPLPAGGINAERDLTTMNAELIFSDLTIIEKRLNRIGSQMKSAKPPERAALER
FT                   EKELMARIKEAMEKDIPVRDMEVDEEEAKILSGYQFLSNKPVLMVINIGEDDLPKAAEM
FT                   EAELNTRYGGKNYRVIVMCGKLEAELINMDEAEATEFRSSYGLKETGLDRTIRASYDLL
FT                   DLISFFTVGPDEVRAWTITRGTISQKAAGKIHSDIERGYIRAEIVHVGDLLTAGSLAEV
FT                   RKRGQLRLEGKTYIVQDGDTANFLFNV"
FT   gene            complement(38216..38458)
FT                   /locus_tag="DehaBAV1_0043"
FT   CDS_pept        complement(38216..38458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16635"
FT                   /protein_id="ABQ16635.1"
FT                   /translation="MPEEVVMPYELRKHIAIANDMEIAPEIREKTIKHIARFGSYEALC
FT                   ALLDIACNTKANYGERDLALKVSRDVLKNSRKNDI"
FT   gene            38586..39614
FT                   /locus_tag="DehaBAV1_0044"
FT   CDS_pept        38586..39614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0044"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /note="TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III, delta"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16636"
FT                   /protein_id="ABQ16636.1"
FT                   /translation="MLYIFTGSDDFSLKERLKQIKQALGDESLASANTTLLEAKNLTAA
FT                   ELLNYVQTIPFLAPARLVIVNGLLERFEGAKGKTAAKDTANKNSPDEFARALDNLPPTT
FT                   LAVLLDYTTAKDGDYREKEKVSALATNPLFKIIGSRAEVKHFAPLSAQNLPGWVMQRAK
FT                   QSSIQMSVPAARLLGRLAGPDLWALSTEIEKLGLYAQGRVIEEADVQAMVGYAQEVNIF
FT                   SLVDAILDCKVKEAQQSLAAFTSAGGSPGFLLFMLVRQLRLMVRYTALKKRGLKEAEVF
FT                   KVMGGSEYALRKTASQAVCQNMDSLKNIYTKLLETDLYIKTGRFEPELALSLLVAELCG
FT                   RK"
FT   gene            39616..40227
FT                   /locus_tag="DehaBAV1_0045"
FT   CDS_pept        39616..40227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16637"
FT                   /protein_id="ABQ16637.1"
FT                   /translation="MEEKQKQSLREQLKTVKWGSLLLTFGALIALSFLLAWGLNSLVDS
FT                   LDIPLDEYAWLTYLLVFVMSILANATVIAPVPFAISIMVAAATNFNPVLVALFGALGGS
FT                   LGEMSGYFAGRLGKKLAIPEGLVGYNRVEIWIQKYGAWAIAFLAAQPIVPFDVGGLIAG
FT                   LARMPVHKFLPALFLGKFPKYIILIYAGIGLMDWLPFLKA"
FT   sig_peptide     39616..39726
FT                   /locus_tag="DehaBAV1_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.491 at
FT                   residue 37"
FT   gene            40262..41269
FT                   /locus_tag="DehaBAV1_0046"
FT   CDS_pept        40262..41269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0046"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="PFAM: ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16638"
FT                   /protein_id="ABQ16638.1"
FT                   /translation="MNRSNSEVMSKPCLCLDIGGSKIRSAVVTHDGRVVAWEQEPTCAL
FT                   NGVTGVFESICLVLDRLLERNNLNTSQFEALAAAVAGGIDMPNGLVTQSPHLPDWRDVP
FT                   LRDMLTERYLKTFIINDASAAALGEHRLGVGLGVKNLVYLTVSTGIGGGIIINNELYLG
FT                   QSGCAGEIGHMCLDINGKEDVCGNKGCLETLASGTAIVSRVQTELAGGEFSVLVERFKA
FT                   DYSALTAEDIGRAASEGDRLCLGIIRQAGEYLGIGLVNIANIFNPELIILGGGVSKLGE
FT                   IFIEPARQVLYKRAFRLAGDDVRLIVSVLGDNAGVIGAALYAYACLDSANNQPQ"
FT   gene            41385..44000
FT                   /locus_tag="DehaBAV1_0047"
FT   CDS_pept        41385..44000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0047"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="TIGRFAM: alanyl-tRNA synthetase; PFAM: alanyl-tRNA
FT                   synthetase, class IIc; phosphoesterase, DHHA1;
FT                   Threonyl/alanyl tRNA synthetase, SAD"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16639"
FT                   /db_xref="GOA:A5FSU1"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSU1"
FT                   /protein_id="ABQ16639.1"
FT                   /translation="MFSSDELRENYLKFFEEKGHKRIASSSLIPHNDPTLLLTTAGMVQ
FT                   FKPYYLGVAKPENPRMASCQKCFRTTDIESVGDASHLTMFEMLGNFSIGNYFKKEAIAW
FT                   AWEYVTQRLNIPAERLWITVYLDDDEAIALWKEQGVPENRIVRLGAADNFWGPAGDSGP
FT                   CGPCSEIHYDFGQETGCGKADCNPSCKCGRFCEIWNLVFVQFNQDKSGKRQNLPAPSID
FT                   TGMGLERLTILMQSKKNVYETDIFAPIVEKACLLSGRKYGCDAATDRALRIVSEHSRGI
FT                   TFLIADGVIPDKAGRGYVLRRLLRRAVLFGRRLGLERPFLVDMAGAVINRMSGIYPELK
FT                   KRQTYVLEMIASEEARFSETLATGLELLEEIVRQTKGGRISGQDAFKLYDTYGFPVEMT
FT                   TEIAAEKGLSVDLDGFESEMEIQRTKARSSRKFSFDAAATAEAVKNMRHAEKTCFVGYE
FT                   LAIQKSTIKDILTEGGTVDSIEEGDEASIVLDESPFYAEMGGQVGDTGEIITDAGRFEV
FT                   KNTLHLPNGVFLHQGRVINGCLKISEAATAHINEERRRDIARNHTATHILQTALREVLG
FT                   EQVQQRGSVVTPDRLRFDFSHLKPMSKDEMRRVEEFVNDKIRRNLPVYAEEMPYRHALE
FT                   EGVTALFGEKYGDRVRVLRVGRPAVSAELCGGTHVTASGEIALFKIMSESSVGAGLRRI
FT                   EAVTGREAEAFINLQQDSLSELSGMLESTAEESPRKLAELKEEIDTLKKAVQNLERQMS
FT                   RGEAEELLSKAEDYKGVKLLVSRMTSVNADTLRETADFLRDKLGSGVIVLGTVTEDKPF
FT                   FLCMVTPDLIAKGYHAGNIVKKLSQIAGGGGGGKPNMAQGGGRDKSKLDEALQAVKGMI
FT                   "
FT   gene            44047..44448
FT                   /locus_tag="DehaBAV1_0048"
FT   CDS_pept        44047..44448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0048"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase, RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16640"
FT                   /protein_id="ABQ16640.1"
FT                   /translation="MGDKWIGAALSDPLRILASPLVILRRDDDTKTLENIESLVKTHQP
FT                   DLLIIGLPISLNGTIGPQAEKVKSFSELLSRHLNIEIIYRDERFSTDEARRKMNDSGKN
FT                   NKTVRDDAAAAAVILQDYLDETNPPCCQP"
FT   gene            44470..45648
FT                   /locus_tag="DehaBAV1_0049"
FT   CDS_pept        44470..45648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0049"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16641"
FT                   /db_xref="GOA:A5FSU3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSU3"
FT                   /protein_id="ABQ16641.1"
FT                   /translation="MDKSFILNKTSSRSLARRGQLFTAHGKVETPVFCPVGSQATVKTL
FT                   TPEDLKSVNINMILSNTYHLYLRPGIPIIKEMGGLHKFMNWDGVILTDSGGYQIFSLAN
FT                   LRKLDEGGVSFRSHIDGSTRYITPEDAVSFQQDLGSDIAMVLDECPHSEASENEVLAAM
FT                   ERTHQWAKRCLAAHTLKSQHLFAIVQGGLSPELRRQSAEYLASLDFPGYALGGLSLGEP
FT                   KDITFETVRHTLRFLPENKPRYLMGVGAPEDLLEGVSCGVDIFDCVLPTRVARNGAFFS
FT                   RLGRLNIRNAAFATQKGPIDPDCNCYTCRNYSAAYLHHLFRCEEILAYRLATIHNIAFL
FT                   SNLMQEIRTSIEKDCFEEFKADFLSRYQPTNEAIRIEQKQKWLFGRNGEPPS"
FT   gene            45743..46885
FT                   /locus_tag="DehaBAV1_0050"
FT   CDS_pept        45743..46885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0050"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16642"
FT                   /protein_id="ABQ16642.1"
FT                   /translation="MITTFDLSTRIIFGVGSISSLNHEASLLGRHALLVTGKGAVRRLG
FT                   ILERALFLLKEACIQTTLFDHVEPNPRSSTVDEGIKLARAKGVDLIIALGGGSAMDAAK
FT                   AIAFGLACNGPVWDYIQQEEYPEGDLLPLIMIPTVAASGSEANGNAVISNWEKHEKRVI
FT                   SDNRLQPKVSLVDPLLTLSLPPRQTAQGGVDIFCHIAEPYLTAADTSPLRDGMAELAMR
FT                   LVVEYLPKAVQTPHDLQSRTQLSWLSTIACSQFMSLGGKSGNMTMHGLEHALSGYYDIA
FT                   HADGLAALLPAYMRNLYPVRRHRIEMLGEKVFGQTDGILAVENWLKKNNINFSLKDLGV
FT                   AEAKIEEIAAAAIVMSPWVKNHPGVLDKRVATSLYSTAFN"
FT   gene            47152..50096
FT                   /locus_tag="DehaBAV1_R0001"
FT   rRNA            47152..50096
FT                   /locus_tag="DehaBAV1_R0001"
FT                   /product="23S ribosomal RNA"
FT   gene            50203..50320
FT                   /locus_tag="DehaBAV1_R0002"
FT   rRNA            50203..50320
FT                   /locus_tag="DehaBAV1_R0002"
FT                   /product="5S ribosomal RNA"
FT   gene            50498..52972
FT                   /locus_tag="DehaBAV1_0051"
FT   CDS_pept        50498..52972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0051"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16643"
FT                   /protein_id="ABQ16643.1"
FT                   /translation="MSSRFDKFSERARRVLTYAQEEAQSLNHNYIGTEHILLGLVREEE
FT                   GVAARVLVNMDVNLAKVRSAVEFILGRGEHPATSETGLTSRAKKVIELGIDEARNLGHN
FT                   YIGTEHLLLGLLREGEGAAAGVLESFGVTVEKVRTEVGRILNQGLNKPKASRTTPSRTP
FT                   QLDQLGFDLTAAAKAGKLDPVIGRSKEIERVVQILSRRTKNNPALIGEPGVGKTSIVEG
FT                   LAQRIVSGDVPETLEQKHIISLDVASLVAGTKYRGEFEERLKKVIEEIKNAGNIILFID
FT                   EFHTMVGAGAAEGAVDAANILKPSLARGEVQVIGATTLDDFRKYVERDAALERRFQPVL
FT                   VEEPAIEDTLSILRGIKERYEEHHKLIISDEAIIAAANMAARYIPDRFLPDKAIDLVDE
FT                   AASRVRIKKRTKPVSLKEMKAIEDSYRRDKEAALATQQYDYASELRERELQIAEKIRRM
FT                   EDEWQTEQAMDKPVVGEEDIAQVVSMWTGVPLVQLTGDETERLLHMEDALHERIIGQEE
FT                   AIVTISKAVRRARAGLKDPRHPIGNFVFLGPTGVGKTELARALAQFMFGSEDSLVRLDM
FT                   SEFMEKFAVSRLVGAPPGYVGYDEGGQLTEAVRRKSYCLILLDEIEKAHPDVFNILLQI
FT                   FDDGHLTDAKGRRVDFRNTIIIMTSNIGAELIRKGSGTIGFATQTDESKAQQTNFEHMK
FT                   DKLLGELKKSFRPEFLNRIDSVVVFHSLNKEQIRSIVDLMLKSVVKQMAEKGIGLEVTE
FT                   SAKDLLGKKGYDEVYGARPLRRTIQTMIEDRLSEDLLRAKFKAGDKVIVDTAEDEIIVR
FT                   LAEPAELSQATP"
FT   gene            53418..54812
FT                   /locus_tag="DehaBAV1_0052"
FT   CDS_pept        53418..54812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0052"
FT                   /product="DNA replication and repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16644"
FT                   /protein_id="ABQ16644.1"
FT                   /translation="MDKSRNVYICSNCGHESLKWLGRCPGCQEWNTLEETTIAAPLGRK
FT                   NAPARVISPAAELSSLNASDTTRRSLSISEFNRVLGGGIVPGSLMLLGGEPGIGKSTLL
FT                   LQVAASVAQSGGKVVYVSGEENPAQIKMRAQRLGISGEGLFLMAETDLNAILAQLSVLC
FT                   PSLVVIDSIQTVFLPELEAAPGAINQVRESALRLMQWAKSSGASVFITAHVTKEGNIAG
FT                   PRILEHIVDVVMYFEGESQSAYRLIRSVKNRFGSTNEVGIFEMKSEGLVEVANPSQIFL
FT                   SNRQANTVGSAVTAVLEGSRPLLVEVQALTNTTSFGQPRRTANGVDFNRTIMIAAVLSK
FT                   RLSMRLGTQDIIVNATGGIRLDEPAADLAIALAIASSYRDIGVCPETIALGEIGLSGEL
FT                   RTIPHLERRLSEASRLGFTRALVPAGANCQNININGIQIIAVSTVKEAIKLALTGVKTE
FT                   TEDVFE"
FT   gene            54799..55482
FT                   /locus_tag="DehaBAV1_0053"
FT   CDS_pept        54799..55482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0053"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16645"
FT                   /db_xref="GOA:A5FP88"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FP88"
FT                   /protein_id="ABQ16645.1"
FT                   /translation="MFLNEKVGAVIVAAGQSRRMEGQDKIFALLAGKPVLAHTLSVFQE
FT                   SPQVDDIALVMAEHNIEKAKELVKEYNFSKVIAICSGGTLRQDSVRSGLSALCDCGWIL
FT                   IHDGARPLLEPDSIPEGLEAAKLCGSAIAAVPLKDTIKEISPEGLVEKTLPRERLISVQ
FT                   TPQVFRADIIQKAYQRVGIIATDDAQLVEKLKLPVRIFSGACANIKITTPEDLLMAEIL
FT                   LKKGR"
FT   gene            55488..55961
FT                   /locus_tag="DehaBAV1_0054"
FT   CDS_pept        55488..55961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0054"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="TIGRFAM: 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase; PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16646"
FT                   /protein_id="ABQ16646.1"
FT                   /translation="MRIGNGYDVHRLAPGQKLVLGGVEIPFECGLIGWSDADVLTHAIM
FT                   DSLLGAAALGDIGLYFPPGDPKYKGISSLKLLEQVTDLLAKKGFGIINVDSVIVAEEPK
FT                   LRGHIDTMRKYLAKAMGIDPGRVGIKASTSEQLGFVGRQEGMVAWAVALVDEK"
FT   gene            55965..57338
FT                   /locus_tag="DehaBAV1_0055"
FT   CDS_pept        55965..57338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0055"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; PFAM:
FT                   cysteinyl-tRNA synthetase, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16647"
FT                   /db_xref="GOA:A5FP90"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FP90"
FT                   /protein_id="ABQ16647.1"
FT                   /translation="MKIYNTLSGKLEEFVPLENDKVKMYVCGITPQSEPHIGHAMSYIN
FT                   FDVIRRYLTYKGYRVKYIQNFTDIDDKIIAKANAQGIEPSTLAERNIGVFLDAMAALNI
FT                   TPADYYPRATQEVPKIIEIVSGLIDKGYAYAVDGSVYLRVQKVDGYGKLSHRTLEQMMA
FT                   GARVEIDEEKEYPMDFALWKATKPGEPSWESPWGLGRPGWHIECSAMSLRYLGEQIDIH
FT                   GGGQDLIFPHHENEIAQSECFSGVKPFVKYWLHNGLLKLGEEKMSKSLGNLVTIKEALS
FT                   RYSADALRIFVLSSSYRNPLTYSEEALEAAEKGAERLRQTAARKDNPQFKETTVDTKAY
FT                   RERFTQYMDNDFNTSAALATIFDLSRELNRIEGEAGKSTDGQKLFKELADILGLSLIVA
FT                   ESKTGTDVAPFIELLIELRKDLRVAKQYQLADKIRTSLDTAGILLEDSAGGTVWKVKK"
FT   gene            57444..57519
FT                   /locus_tag="DehaBAV1_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            57444..57519
FT                   /locus_tag="DehaBAV1_R0003"
FT                   /product="tRNA-Ala"
FT   gene            57557..58555
FT                   /locus_tag="DehaBAV1_0056"
FT   CDS_pept        57557..58555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0056"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16648"
FT                   /protein_id="ABQ16648.1"
FT                   /translation="MNDRLTHKNSYDYPIVASDLLTTPDDLRLCLSTYLLMAKVGQLSP
FT                   ATISNYRYMCGKFVDFCQEHGVTKPAQITSIHLGLFLQQLQLTNGPQSVTDYFKQIRPF
FT                   INWLKDNGQITVDPLKQVRLPKVPRKVIQPFTQEHCQRLLALVSGETFEDKRNKALILL
FT                   LLDTGLRLRECTELKWSDINYDSELVKVMGKGAKERIVRIGPKVQRALLEYQYLKIQSF
FT                   PGDKTPDVWVSRHKTRYSDKECHPLTKNGIMQTIVVLGKRAGITNIRCSPHTFRHTFAT
FT                   MCLRNGAGEFEVQSLMGHSTLTQTRKYAASLNSEVAVQGHKKFSPVDNLKL"
FT   gene            complement(58582..59448)
FT                   /locus_tag="DehaBAV1_0057"
FT   CDS_pept        complement(58582..59448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16649"
FT                   /protein_id="ABQ16649.1"
FT                   /translation="MNESNQLEPIPEGEIQISLFKNKEIRRVLHDGEWFFSVVDIIEAI
FT                   TDSIRPRQYWTDLKSKIIKEGANELYENIVQLKMPASDGKERDTDAADAETVFRIIQSI
FT                   PSPKAEPFKRWLAKTAYDRIEEFQNPEIAIKRAILDYQIQGRTDEWIKARIRTLTSRTE
FT                   LTDEWQKRGIAGAEYGILTNVISKETFDIDTTEHKEIKGLAKRHNLRDHMTDMELILTM
FT                   LGETSTAELARSRDAKGFQENEQAAHAGGRIAGDTRRNFEKQLGESVVSKNNFLPKHPD
FT                   QPKLEEG"
FT   gene            complement(59840..60553)
FT                   /locus_tag="DehaBAV1_0058"
FT   CDS_pept        complement(59840..60553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16650"
FT                   /protein_id="ABQ16650.1"
FT                   /translation="MCVMWDSFVGNQIRRCNRNLLVTIILIALIFIAIASFSYTDPAVT
FT                   WIILGAGIVILLYPIICYLRQINSFSNHPVMKTLRKYDDLPELLHAIDEEVKSESSIKS
FT                   SSKLILTPNWAICLTMYGIKIVNLTELVWVYPKKTTHTVNFILPLYSSNSLCICATPIE
FT                   SRNSNGNMKNSIYPTQIEIDVTKEQCNEYMQSLQSYAPWVLYGYADDIESCWKKQPLAL
FT                   LQAVLNRKEELSKVE"
FT   sig_peptide     complement(60431..60553)
FT                   /locus_tag="DehaBAV1_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.637) with cleavage site probability 0.404 at
FT                   residue 41"
FT   gene            complement(60568..60753)
FT                   /locus_tag="DehaBAV1_0059"
FT   CDS_pept        complement(60568..60753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0059"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16651"
FT                   /protein_id="ABQ16651.1"
FT                   /translation="MIKTLRDHRLDKFWSQAELAKQAGIGADTVNRLENGKQNPSFITI
FT                   RKLAKALNVKPEDIEF"
FT   gene            60861..61205
FT                   /locus_tag="DehaBAV1_0060"
FT   CDS_pept        60861..61205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16652"
FT                   /protein_id="ABQ16652.1"
FT                   /translation="MVIRTGKEVVLPYAPEDPVKAEYLPYLLEDIGISQTLMQGFAKSP
FT                   QEWLAANATKDFIYQFYNYIETGNLSPSTTMSELQNIANMFYTGYEVAQHDVSQIFKIP
FT                   DTSALKDRNR"
FT   gene            complement(61286..66757)
FT                   /locus_tag="DehaBAV1_0061"
FT   CDS_pept        complement(61286..66757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0061"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16653"
FT                   /protein_id="ABQ16653.1"
FT                   /translation="MGILGFPSQGSSGKILSYGPPRQPNNQVAINAALQSVDSSDSKKI
FT                   TTVEMKDGKWTITTDGAVYNIDTNGQTADTVQYITNYLTSRGASADIIKSVTEQIPIIT
FT                   TRESGNVVKKKTSATITDPNDTTKKYTAEPVNEPANDSTGEGDTQTNTDVSVTVDNSTA
FT                   WTFTTPNGTVYTVPMAGLAWSDPAKMHEYITNSLNSIGAPANVIMEAVSRMPDVMGDTG
FT                   LREPRTDEFGNLIDNTQEIKDIIAGSDQSLASITALKAFLDAKGFSNLSPEEQFNKAIE
FT                   YGLIPTDSVYVPPDAGYNVGQNAPPGMPDDVAVSLGLLPSGEQIEYNIPNFNWAYMPKN
FT                   EADKYFAELKEIVGYDVTSANLKQAIKEAREIITDQILKQSNFEWRLNKGYLIKLPNNE
FT                   YMETSEFNKLSQSMQAYIKTNGIEAAKARQAWAENVLDKYSSGSGDDKNINIQSALNSY
FT                   DKDVYEALQFLFPDVWDGLKRKPEISGATVAELDKIINASWFSESDNQQEIKTLLRRMG
FT                   YWTGVGGKLSDKWNELSEDDKQKVADNYLKNINDRWLREMGDIQVTFANAITDIVTAVD
FT                   GMSQSDKEIANWLVFSPPLNFMKQYLKPEAWEKITDWLKNAGDKVIQSQESFKEWIDKQ
FT                   PDATKIPLSAVRGIYDTLTAIGASIPLALMETATGYDPKNPTPSIKRILDMGAGLVTWP
FT                   TTLPYEIAQDPKTGIPYTMGLALSLVIGPKTIIKLGQSLGRKIFIPKGYEIGAIRLDID
FT                   LPGGIGPEKMSEVTAHSLQNVLQDMLSKLSDPKNKGAMTDQIITDPVSGATIRVTPLQR
FT                   AEKALAKDAGNWSYSVDLNYQWLAEQIKKNGKAIADVPNRGDWGAGVYSSDSAWLTRLE
FT                   TAQDKSAGVYKPAIVAIKYNELKKVPKEVQELFEQGKFDEARALFAEMERAGKIEPGAY
FT                   EMWKHWVDKNGRLIMEREIYFAKGTEFLPIQPTFWNRTKAVGDLTASNFTWADRDLKRP
FT                   DVNGKETVVVKKGERVPIIWIAAKGAKRSAPRLAVRQLSSFVYQPYTTLRRMGRVPKGK
FT                   VSLQLGYGDVQLPELPGIEYKHRNTGYDYLANNEHPSVTSLEIKQIGGKGDWGTTVIGD
FT                   LHGDYTDLLKDINSGYERPLIRGRDGNITNWKWNGEKQSVVQVGDIVDRGAHYDQIRTT
FT                   FNRLADEAAQTGGRVERLIGNHELAYLTGEKIHGIDYSNAAAIKKGILEDINAGKLKAA
FT                   EAINGELYTHAGVSLEKFPEWKGKDAAYIAAEINRRFNKALAQNKWTDRIFDKGSGERG
FT                   YKGIGGPFWLRTKETSAEALNLGYKQYFGHTPRPSGINEEAPNAINVDIGRQWTESWAG
FT                   KIGAYQRTPKLETVERGTNLIESLGESPVHGTGFMPVQFSLDIPTIEEGAISQTIKSLS
FT                   RHDRGQIDWLRPEDIKATMEPPTNLTPNQIGAANRLIKSVWDQNGMVDMQFKGVIGISK
FT                   DGMPAYNRQNILWQGEASLLNSNPKNPAYIAMPLVSKSQKLFENQREIDAGLKRLGINA
FT                   NYAEFRPAIILGKFKPKISMKDRMGYMEKVMKNQPRSAVMIRAEKVELLKAKPGKNSKK
FT                   SNKTNNKIDENYDENRYEGSENSKEYTKLELGPKPGYKPQDYEDYSKEYPANKLYYPIH
FT                   ESKYASATEESHEPDYTASEQLPTYSSPKYSTTGYNPKNYEGKDSPIETIPPPVIPTDD
FT                   NQITKRQDSKATSKQDRPKLGNGDVAWKQGELGTGENKRPVWYIQRADGDVDIVFQPPE
FT                   DAPRLEGTPAETFFTRGKKPPTNLTQKMGVTTAKINLQDNPEIKFIQTKSPKFKQSIPR
FT                   HIRRSIGM"
FT   gene            complement(67261..68091)
FT                   /locus_tag="DehaBAV1_0062"
FT   CDS_pept        complement(67261..68091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16654"
FT                   /protein_id="ABQ16654.1"
FT                   /translation="MIWGYIGHEGAGKSAAMCYFDLLHIAKGGGLFTFPGFEVFNPNIT
FT                   LDDGNHPRLGKSIDMKEFIFSFSDEQKLRNVFVSMDEIQNFFGSDKYMTMYNSLITKYS
FT                   MQRRKLNFGINYTVQSWNWIDPRLRQLTHFLTVCKDLSRTPWGKEAGLKRGQLIDLVTY
FT                   DCKGFITGEEWAPLKHFNLNILPVRDWYDSYSTVDPLESFRKLVIKKPEDILDMREGMP
FT                   RFNPLDDSPLENVPDDVREISQENNARILSKLEEQVDPATLIQVSKALRKVNAK"
FT   gene            complement(68088..68522)
FT                   /locus_tag="DehaBAV1_0063"
FT   CDS_pept        complement(68088..68522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16655"
FT                   /protein_id="ABQ16655.1"
FT                   /translation="MAGFKRKNGGPATGGTTDTLGIQDTIGAAGGNGFKSGLLDFDALE
FT                   KLLGNPQTVSLAKEFTSPGDNVRGLLMRADFKDAKQVLAMIEYLHRCKEIHYKRGEDRL
FT                   LDFIAALPAIQARRINLLAKVLTHGVMEASSRQQKERRPE"
FT   gene            complement(68535..68987)
FT                   /locus_tag="DehaBAV1_0064"
FT   CDS_pept        complement(68535..68987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16656"
FT                   /protein_id="ABQ16656.1"
FT                   /translation="MTKASTIEKNQELIAGFKTPEEIISSRMQSDQRAKREPDALVYDM
FT                   RLGWAPEYIDNPIGHRKSFRNKRLCPIIRRWKQLPTGEWESKIEPVPEPEDMEASPQSL
FT                   YRMLHWEPLVKSAFGGLGDIWQKLKVGLLVVLVGIGIFALYLFTQS"
FT   gene            complement(68993..69451)
FT                   /locus_tag="DehaBAV1_0065"
FT   CDS_pept        complement(68993..69451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16657"
FT                   /protein_id="ABQ16657.1"
FT                   /translation="MKILWMQFGRDKTRTQDVHVLTEDGRIVEVSADVLYGCVSVDEWG
FT                   QAWVLRGADLCPSRDGKGDILLVNERSLAPIAFDGRPARTHEEALKLKDDIGAEACESV
FT                   HFNRDREIKKETMANVLQVLIIGLFGTVCVIALIGVYASGNAKLPWVG"
FT   gene            complement(69766..70215)
FT                   /locus_tag="DehaBAV1_0066"
FT   CDS_pept        complement(69766..70215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16658"
FT                   /protein_id="ABQ16658.1"
FT                   /translation="MGKAMSTVMLIVGIAVSVLFFPMVLSSMDSIQFASNTGTYAAVTT
FT                   GVGETTADVVLSTALYNDDNGHVTSITSTVGTDVPVAGTYVAATKTLTVTGLTASESRT
FT                   LTVIYDSDNLSDYTGLGTIVSLSPLIIWLVILGALGIGLYSNVKS"
FT   sig_peptide     complement(70132..70215)
FT                   /locus_tag="DehaBAV1_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.515 at
FT                   residue 28"
FT   gene            70367..70630
FT                   /locus_tag="DehaBAV1_0067"
FT   CDS_pept        70367..70630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16659"
FT                   /protein_id="ABQ16659.1"
FT                   /translation="MEEQKIIVPAKIPGLLEALKNEDAFPDNLRYIMQTHGIGATAISR
FT                   IYGISRMQVYRYLKGEDLPREPAIYMSVNEWADYLRKSIKAS"
FT   gene            70591..71598
FT                   /locus_tag="DehaBAV1_0068"
FT   CDS_pept        70591..71598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16660"
FT                   /protein_id="ABQ16660.1"
FT                   /translation="MGRLFTKIYKGVIVACLCLASLPPAAVLAVDPAAPTTFTIDDVQV
FT                   AHNIVETGDSLVSFKYTIAYSSGQPTTPANKLFHFRLMDTDGIIQLGAIEPYAYYNAGY
FT                   DMGYSAFYFAADDAPEWETALILKMVGNPQYWEIPPEVNYTLTTSDYSQLETKKENQTL
FT                   MGSWIIEVCRALEINWVQKLLTETDQGTVFNEYGSAYGKGTIPGLQTMCPKIFSTQTQG
FT                   LDMTRRVWVMTKLDEWAHQWDGTIIGDILEGLASIFNNVTSWQMITSLICIVMVIGLFI
FT                   WGRVKYANNHGAMIASSYILAGGTDMGLFNGVLLAMIVTIYAAYASYVLMGRHA"
FT   sig_peptide     70591..70680
FT                   /locus_tag="DehaBAV1_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 30"
FT   gene            71595..73340
FT                   /locus_tag="DehaBAV1_0069"
FT   CDS_pept        71595..73340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16661"
FT                   /protein_id="ABQ16661.1"
FT                   /translation="MKKLIISVGMLILATIIGPGTILASTITDAIYQANIRATNASYTA
FT                   THVAAPFTWATDSLLDGYYIDSEFNNLAMRDSIGNDIPFMPGQGSDPWIMWIDQIAQNS
FT                   AINYNLYTGGETAMGGKLAYCPDTAGMTVADAASLELGNSFEIELSGRFNDGYNLSKFG
FT                   AFWIYTSGTDVSAGNSSSYTETPYNGTASSATSMYGANWIAQTFQFSNDVAVNQFTFRT
FT                   QRVGNPTGNFNYAIYATSGDVPTGSALVSGSVVASTISTSAVNHTFDFSNIINLTAGTR
FT                   YAIVLSLPNGDSSNKLTHWYNPTNPYANGRYCTTNNSGSSWSGTATTDINISITGNANN
FT                   TIVTAADISSSEHVYKISLSAGTMNIYIDGLLEGSAAFAVSITDNANNLVIGANGSMPY
FT                   LYYAKITVGGVLRGSWEWQYAATFTDLSGNGNDATPSFRTTTTDADVSVSVISYTACNQ
FT                   SAFITGEDDEAVEIVTDDDIGEMPDGWYGDLHPENLPGGQAISDFLENMDFPPAFFWYS
FT                   LVYLGAAIVTMVSLGLTSELLPCAAAGLIWQIFFCAIIGTSWWVLLPEGIIIIGEMVNR
FT                   KLASY"
FT   sig_peptide     71595..71669
FT                   /locus_tag="DehaBAV1_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            73340..73684
FT                   /locus_tag="DehaBAV1_0070"
FT   CDS_pept        73340..73684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16662"
FT                   /protein_id="ABQ16662.1"
FT                   /translation="MRQQWLVWLAFTYIVGQFMCLILEGTWLGDPEQSFFNALLGFSVM
FT                   QYSDSVLGNLFVTVVNIVGGVYGLLTYAIPRLLFWDYSFLAGTASLAKWLFFYPVSAGT
FT                   VWGLYTSLRR"
FT   gene            complement(74225..74767)
FT                   /locus_tag="DehaBAV1_0071"
FT   CDS_pept        complement(74225..74767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16663"
FT                   /protein_id="ABQ16663.1"
FT                   /translation="MKTVLTKIKGITPLLMHRFPMAGADDTSKRRTGVPDWKAEAELAL
FT                   YKDDHGQIYQPASHIEAALKEASKTLKIPGKRGATYSKLIGSAVSVSPDAITHLVQDYE
FT                   IDSRPVVIQKARIVRYRPVFKDWELEFDINIGDDQIPIEVIKQALDHAGLYVGIGDFRP
FT                   GRGGKFGKFMVVRFEEK"
FT   gene            complement(75294..75611)
FT                   /locus_tag="DehaBAV1_0072"
FT   CDS_pept        complement(75294..75611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16664"
FT                   /protein_id="ABQ16664.1"
FT                   /translation="MKQLKPKCRHKFYQAGSIYYCSRYAIEGTDFCKVHNPESVAAKEK
FT                   ERELANLEHFRQARNELIRQIIITEIFSGITTEEIRKNKAKLKAVFKTVFKTEALLEHF
FT                   Q"
FT   gene            complement(75785..76420)
FT                   /locus_tag="DehaBAV1_0073"
FT   CDS_pept        complement(75785..76420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0073"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16665"
FT                   /protein_id="ABQ16665.1"
FT                   /translation="MKVALYARVSTRDKNQDPEVQLMELRKYCQENGMEITREYIDHAS
FT                   ANDFVRRTAWKQLLVDASARKFRGLLVWKLDRAFRDITVATSSVKMLRNAGIDFIVTTV
FT                   PVLSVQGPAGDLMFNIYAAFAQFEKDTIIERVNAGLSRAKAKGKAFGRPRKAIDFNKVL
FT                   EAHEIACSRVNRITKENQGYSETARILSEQTGLRITAGWVYNRIKAGN"
FT   gene            complement(76799..79402)
FT                   /locus_tag="DehaBAV1_0074"
FT   CDS_pept        complement(76799..79402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16666"
FT                   /protein_id="ABQ16666.1"
FT                   /translation="MTIATRKYTIDDILAKLQGVKKNGSGFMACCPAHEDKNPSLSISE
FT                   KDGKVLLKCFAGCSYEQIMTALNMPINAAAQDTTATSSKKPKESTKREIKQTYDYTDRS
FT                   GQLIFQVVRFEPKSFSQRHPGGKTGWVWNMKDIEPVIYHLPDVLEAVKTGQTIWITEGE
FT                   KDADNARAMGLVATTSPMGAGKWRDNYTNDLLGASQVVVIADKDAPGRKHASDIAMSCR
FT                   RQRIPVKIIEVPGDAKDFTEWLEAGGQTSELDDLVATAKSYTPSKNQSLYFLSDGKFSI
FT                   EAGRIIYHSYRDNVPYDAPLCNFVAAVKEEIIKDNGINRKTFFRIGGTDCTGRPFPDIE
FT                   VPSENFSSMSWALSQWGIKAMIEPSPSAERLLRGAMQYMSMEAPCRIIYENTGWTNING
FT                   KDVYLTPHGAIGADNVEVEMPSNISHYDIPSPEQNDDVKSFIEASFNFLKVAKLYITLP
FT                   LFAAMYMTPLSDAIDTNFNLWLIAGSGSLKTTIASLALCHYGNFDYTCVPAAWRDTQNT
FT                   LERILFTCKDMPVLVDDWSPGQTTASQKEFDAKADYVCRGQANRQGRKRMSADTSMRQE
FT                   YVPRGFLISTSEGQPPGESNNARFLIIEMSKTDIEFPCLTLSQKEDHLYRRAMAHYLAW
FT                   LQADWPAKKVYLRQRYQEVFEQFTESLRGENVHLRLPRSIALLYIGLEMAIRWAEENGA
FT                   ADIFDRFIDESGNGENDSVGSAYLLKQAREVFIEMAKRQGARIDEATPSKKFVNALNAA
FT                   LIAGTAYLDVKDGANPRSASPGQTLIGWDDRTNGHVSLHNDLAYQVANQHYQKINEAFV
FT                   KKDAVFMDLVKRGYVDPGKDGKTTVFEYIPVIAKACRVLHIKREFLGRDEQKRGE"
FT   gene            complement(79846..80181)
FT                   /locus_tag="DehaBAV1_0075"
FT   CDS_pept        complement(79846..80181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16667"
FT                   /protein_id="ABQ16667.1"
FT                   /translation="MTSGMVILAEIRTETEQGRPAPTPGWEWSPGCTPIKDPSPGKWIV
FT                   RRSIDSFDVIFHSYLTPEAREGGPEYLIDSFNPTDAGELGAREMALKLRKESYRQEAER
FT                   NGHSDIE"
FT   gene            complement(80178..80450)
FT                   /locus_tag="DehaBAV1_0076"
FT   CDS_pept        complement(80178..80450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16668"
FT                   /protein_id="ABQ16668.1"
FT                   /translation="MVLRRLRIMGHSDYGGQENGDGASMKLLAVFKQSHFLLAFGIIFL
FT                   TAGVGGFGRITEWPELIMCILATLVALYILYAAYKQACKEAEVKK"
FT   gene            81298..81921
FT                   /locus_tag="DehaBAV1_0077"
FT   CDS_pept        81298..81921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0077"
FT                   /product="phage repressor like transcriptional regulator,
FT                   XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; peptidase
FT                   S24, S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16669"
FT                   /protein_id="ABQ16669.1"
FT                   /translation="MDIQIGLKVKQLRIARGMTQAKLADASGLTRGYISMLELRKSTMP
FT                   SYEALSKIARALGVDIKEFKTDPEIVRLESPEEVLRKYQLMAPVSIPVYDHFYVHAGDA
FT                   ALAPIEYIYRARESFAPQNIEAYKVRGNCMEPVISEGDILLIDRDRTPQKGNILLCVVD
FT                   GEVIVGKLIEQNGVLYLKNGHGTHSLSDCQASAVVVEVNKKLIF"
FT   gene            82056..83015
FT                   /locus_tag="DehaBAV1_0078"
FT   CDS_pept        82056..83015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0078"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16670"
FT                   /protein_id="ABQ16670.1"
FT                   /translation="MLSYHLTTSGSHEQPQAKTYHLTNFKNLSGRLNAFVLTCKVARLS
FT                   PHTIRYYTYALNSFLGYCQTLGINTVEEIEANHVRLYLVKLQERNNPTSVLDYYKAVKR
FT                   FFNWLIEEGVLSKSPLATIKPPRTEQKIIRPFTRQQIEDLLATCGDSPIGLRNKAMILT
FT                   MLDTGLRVSEMSAIQLKDVDFDKETIIVMGKGAKQRVVRIGHKAQETILRYLLTRQDEC
FT                   PALWMSTTGSGLSTEGIKVVVRELGKRAGLTGVRCSPHTFRHTFATQALINGAGEFEVQ
FT                   SLLGHSTLVMTKRYTASLKSEHAVQEHKKFSPVDNMRL"
FT   gene            complement(83602..84609)
FT                   /locus_tag="DehaBAV1_0079"
FT   CDS_pept        complement(83602..84609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0079"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16671"
FT                   /protein_id="ABQ16671.1"
FT                   /translation="MQIISLFSGAGGLDLGFEKAGFNVVWANEYDKTIWDTYQHNFPNT
FT                   NLDTRSITEIPSTEIPTSDGIIGGPPCQSWSEAGALRGINDHRGQLFFEYIRILKDKQP
FT                   SFFLAENVSGILFERHREAFSEIIKQFNEIGYNVSYYLLNAHDYSVPQDRKRVIIVGYH
FT                   VKTELYFTPPKPIAHKPLLRDAIWDLRETAKPGGKTNKSIGNLEFPNHEYMVGGFSTIF
FT                   MSRNRVRSWEEPSFTIQAGGRHAPIHPQAPKMQLVSKDKMEFKPGDQHLYRRLSIRECA
FT                   RIQTFPDNFVFKYAGLADGYKMVGNAVPVEFAYNIAMKISEDLRSYEKRTDTKR"
FT   gene            complement(84613..85461)
FT                   /locus_tag="DehaBAV1_0080"
FT   CDS_pept        complement(84613..85461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0080"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.4"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16672"
FT                   /protein_id="ABQ16672.1"
FT                   /translation="MATNILTAIAHLVENPNTQLHQHNKSKTRANAMGDSLEEYIKDLF
FT                   ANSLNENDVVKKNEIYNQKFCYFGNQNNPPDFIIKNGDAVEVKKIETMESSLALNSSYP
FT                   KDKLYSTSNMITDACRTCEPWSIKDLLYAIGTVKDGNLKALWMVYGDCYAADRSVYERI
FT                   QTVISDGVNGIEDIQFSPSKELGRVNKVDPLGITYMRIRGMWGIENPNKVFNYIVNIDK
FT                   NARISVNSIMLKSKYDSFSTLDKAKIASLANKGLGIKDIRIKSPNNPANLLDAKLISFR
FT                   M"
FT   gene            complement(85567..85848)
FT                   /pseudo
FT                   /locus_tag="DehaBAV1_0081"
FT   gene            85925..86209
FT                   /locus_tag="DehaBAV1_0082"
FT   CDS_pept        85925..86209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0082"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16673"
FT                   /protein_id="ABQ16673.1"
FT                   /translation="MEENRRKHSPSFKAKVALEAIKGEETIAQLASRFDVHPSQVHKWK
FT                   KELAEGAVGIFGDERKHQKPDNQQLVSQLYQQIGQLKVERDFLENALGR"
FT   gene            86347..87135
FT                   /locus_tag="DehaBAV1_0083"
FT   CDS_pept        86347..87135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0083"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16674"
FT                   /protein_id="ABQ16674.1"
FT                   /translation="MKLIDRQYLATPFYGARKIALELKKQAGLTVNRKRVRRLMQLMGI
FT                   RAIYRRPRTSTPATGHKVYPYLLRELEITRPNQVWAADITYIPMSRGFLYLVAIIDWYS
FT                   RYVISWRLSNTLDADFCVAALEEALSKGTPEIFNTDQGSQFTSEAFTALLKEHNVGISM
FT                   DGKGSYNDNLFIERLWRTVKYEEVYLKAYQDGREARISLCKYFRFYNTNRIHQSLGYLT
FT                   PVEVYAGAMDKTCNDVVKSSITKPAGMAELSLNKVPILSY"
FT   gene            complement(87298..88449)
FT                   /locus_tag="DehaBAV1_0084"
FT   CDS_pept        complement(87298..88449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16675"
FT                   /protein_id="ABQ16675.1"
FT                   /translation="MYTVINSGIDSLVIGFNVSAYRDPESLKLLEQAKEEAGEKLFGGN
FT                   GTGIDWHGKPFVVHARGAKGYEWVLENADVSICIARKPENGRIYPELYVTFRAEYLWSS
FT                   NARNVVYDLKHWLSTWAIITGDKVSRCDLCIDLQMDMPQINLANDVVTRARGKTEYYGS
FT                   LPAEHYVNGKRDTGYRFGQGTIISRIYDKSLEVVISQKEWFQTLWSANGWDGESAITRV
FT                   EFQCRRDFLKEMGVDDFWSLTERIGDIWRYCAQDWLTIRTPGNDSHRHRWQMTNWWNVI
FT                   AESFYFFGELYGVLRYKQKKCKYDHLMRQARGVLLTAAALCCVSTGTIHAFTQVNQETA
FT                   QWFKSDEFRIEVQNRMVQVGGMNEEKLPRLVEEAINLGGQLLR"
FT   gene            complement(89033..89578)
FT                   /locus_tag="DehaBAV1_0085"
FT   CDS_pept        complement(89033..89578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16676"
FT                   /protein_id="ABQ16676.1"
FT                   /translation="METDRLIEGVVKIRGYMRCGKTASMVALAVNEIQQGHYSPDKVIS
FT                   NVSIPSYGIVQKRNTEIIDFLARMKEDQLRGWLILIDEADQLFSHRGYSSKQQSQVLVN
FT                   VWQAMKLDNMIIYTMHEGLGVDLIFRDATLMSLLPEIVGNKIVIYTIDGRYGGEPYLLE
FT                   IAPASEVFKLYNTKEAVY"
FT   gene            complement(89582..89908)
FT                   /locus_tag="DehaBAV1_0086"
FT   CDS_pept        complement(89582..89908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16677"
FT                   /protein_id="ABQ16677.1"
FT                   /translation="MSYLEDQEKIEIHPSQLGNKNVSSQMLEYSSTNRNCPVALARTLL
FT                   LCHMTSEVLGISCFHQIADQCERYAHTADTLVRDQAATVAKYEAVALEEKRKQGFMQFG
FT                   IGKV"
FT   gene            complement(89909..90487)
FT                   /locus_tag="DehaBAV1_0087"
FT   CDS_pept        complement(89909..90487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16678"
FT                   /protein_id="ABQ16678.1"
FT                   /translation="MRDLEIFRPSNRCYVMVNYMDRRILEKGLVTDVTDKGVHFEYKKN
FT                   GVNHVYHEHADGYHIPQIWNRPLFAHVYGSAVDYDLVTGQAMFDGNMFNQAVNGKITSD
FT                   ALKEVKGLNKKSSVNLVTILLVVAIAIGGMFVFQNKDKIFTTGNSEPVPEQTIPNNPVY
FT                   PENPVDNPSDGTEIPEGDYIPTNPPSGGS"
FT   gene            complement(91006..92598)
FT                   /locus_tag="DehaBAV1_0088"
FT   CDS_pept        complement(91006..92598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16679"
FT                   /protein_id="ABQ16679.1"
FT                   /translation="MYKTKHLKRIIGVISSLAVMLVTLLPGTVSATETLQTKMFTAGSA
FT                   YEYYADNLNLTWSDLAVSGDPFQTSIANSIMLADHGGTFNNGYTCATATSIADAQNLSQ
FT                   NGDYQQIYANYKRGQSFTALGTGGCQYVTLKIARVGNPGDLQVILYAYGSPTSLGAVLG
FT                   SITTPQAQIGTTTADYQLPLGNPSITQGQKYVIMAYCPTGNTSNYYKVFDSNSNPYSGG
FT                   TLISDDGSQVWESNPYDYYFKITRTSGLMALDDYYRNVMYFNLDGLLDTSKIRSIEIVL
FT                   HQSGTIYHKTKAVLVWNPANLESQTDGRWFMANAYSSTDYNPLGQTDADKGANGIHTWD
FT                   IVPTEWDLANQTQWLNSYLDDDNNLRVGMILENAMIGYPSYDSYGNVLWSSGDAYIDEW
FT                   LSPGCSDIPVGSETVKVEPYIIVNYVNGAFFVPPPETTDISDIIQIIPNFINNIGEQDS
FT                   GVRWLIMLAAVAAAIALCWRVQIMAIVTPLLVVGAFIAMGWIDIWLVLLLAALGAFIIW
FT                   QTAGGKRLVGGDG"
FT   sig_peptide     complement(92503..92598)
FT                   /locus_tag="DehaBAV1_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 32"
FT   gene            complement(92675..93010)
FT                   /locus_tag="DehaBAV1_0089"
FT   CDS_pept        complement(92675..93010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16680"
FT                   /protein_id="ABQ16680.1"
FT                   /translation="MVKLLKRIKHAMSIEQMVNGIPLKKQAAQWLDNLVTCQTGSMNIG
FT                   GLVMLFMAALMLMALTPSLVDANAVIQTDTGSGDMVKMIMNLLVWAIPLGGGVGIIMAA
FT                   INLFKND"
FT   gene            complement(93066..93458)
FT                   /locus_tag="DehaBAV1_0090"
FT   CDS_pept        complement(93066..93458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0090"
FT                   /product="single-strand binding protein/Primosomal
FT                   replication protein n"
FT                   /note="PFAM: single-strand binding protein/Primosomal
FT                   replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16681"
FT                   /protein_id="ABQ16681.1"
FT                   /translation="MDQKYERKSYCEMKIHRARVTKEPVMTYTPTGKAVTRFSVSYGGY
FT                   WDKEKKEETVASTWKNIKCWGTLAENTYRELKKGQFVYLEGIEDTSEYKGKKYDSLTAE
FT                   DVQIELETGERQLLAESNNKEKAGKH"
FT   gene            complement(93499..93825)
FT                   /locus_tag="DehaBAV1_0091"
FT   CDS_pept        complement(93499..93825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16682"
FT                   /protein_id="ABQ16682.1"
FT                   /translation="MAVYIVVFETVFGYIIGNSVVFITFGCEMKQKLTNKEIGRLGGLK
FT                   TVALYGREHMKELGKLGGRPRLPTLQEIRDRKAKASNINNNKGVATGGYSLKELKLMWA
FT                   SRTA"
FT   gene            93922..94554
FT                   /locus_tag="DehaBAV1_0092"
FT   CDS_pept        93922..94554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0092"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16683"
FT                   /protein_id="ABQ16683.1"
FT                   /translation="MSNLGLIIKELRERRGWPQTELADRAGISRSSLATIEIGRSVPKV
FT                   ETSIKIAKVFGMTVEELYSKAGYETGKTVVETTEDILERLRLASPIAVPVYTDFVIHAG
FT                   DNVEAPIEYIYLARPKAVGKNIEAYLIKGQCMEPDIQDGDIAIVDRDIAPEKGNIILCL
FT                   INSEIVIGRYLLDKEGKPYIQNGHGKHTLKECQATAVVTGISRNMRH"
FT   gene            94704..95195
FT                   /locus_tag="DehaBAV1_0093"
FT   CDS_pept        94704..95195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16684"
FT                   /protein_id="ABQ16684.1"
FT                   /translation="MSMRRLPGNIQRILTKDEEVLDQFNLKGSLGSPRQKVYCTNKRII
FT                   VSEHGAVLFGSHLFDADYNHISSIDLKTQPRIALLFIATLLILFSIPFWRNILGYTDGS
FT                   YMILATMFTASGFIFVLIAFIFRTYRLEIFTTGRNKPIAIKSSRIDLEQILMFTRERRL
FT                   "
FT   gene            95226..96302
FT                   /locus_tag="DehaBAV1_0094"
FT   CDS_pept        95226..96302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16685"
FT                   /protein_id="ABQ16685.1"
FT                   /translation="MKGLPLNVKDSLTKANESALAAVSLYNHPGIPFRSGGYIVLMIIA
FT                   WTSLFHAIFFKDNKKPFYMDTKKSHGKYIRYQKIDGENKAWELTTCLKEYYGNENPSER
FT                   DNLRFFLGLRNKIEHRSMPEIDEQIFGECQAMLFNYESTVAKNFGYKYAINESLSMSLQ
FT                   FSAAYNSQKKEALRKLHSKTYKNIIDYMNDFRSSLSSNSLESMDYSYKVFLIPKTANHS
FT                   NTADFVSEFINPNKLTNEARAKLKEVLILFKDRNSGDINQNNYRASFIKENVQRKLGQK
FT                   FSMKDFVTCYKHFKIRPNYGAEIKEPIISKYCAYDLAHGDYVYKPALVEFLVSELSDEK
FT                   KYENILGRKPIPISSNIL"
FT   gene            96364..97416
FT                   /locus_tag="DehaBAV1_0095"
FT   CDS_pept        96364..97416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16686"
FT                   /protein_id="ABQ16686.1"
FT                   /translation="MKLNKELETENIQSAKEWLEQANQDFSVFQKLVHLHFEFDTNIKC
FT                   NYPANAVSLLQQTIEKSIKAVAAATGEYNEEETIKTYGHNSAALILDILSKMIIQADFL
FT                   DLNAIARLNNIDISVKLPELITLKNQVKKGILVSKDNKKVDIRSEVINLSDSQINSVLM
FT                   MLITIRNYILKIVDVTFESLKKLGINNYKIRIKDQELFLKALSDLIYKEFNQNPLSDKQ
FT                   IKILLDSLSVIEITNSSDNTAKHKNFEIIRKREFTHLFLGVWAIISLVLLGYITFGHES
FT                   SSRYPSQKSKGIKTSEVGCNDYNENMGIVRRLSQIGYLTDLLLKELSGYIDTVALLFAM
FT                   EKDNFSNKRS"
FT   gene            complement(97959..98744)
FT                   /locus_tag="DehaBAV1_0096"
FT   CDS_pept        complement(97959..98744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16687"
FT                   /protein_id="ABQ16687.1"
FT                   /translation="MTARQPGNIHPRTIPSQYLLSGLAFCGCGASLTGHSAKSGRHFYY
FT                   QCNRKFKQGNEVCNGQAIPKSKLESAVITQIKSRILTEENLENLVSLVNKDLELASVQY
FT                   NERLAVIDTELEDIRQRLNRLYEAIESGKLDYSDLSPRIKDLRSRQSDLEKSRIVAEAE
FT                   LLASGSESIKIEQVKAYAGDLKQLLAEAEISECKAFLKTFVKKIEINGNKATLKYRLPL
FT                   PGLKNGKEVLPIETLGGAEGIRTLYLLTASYGSSKQPMH"
FT   sig_peptide     complement(98634..98744)
FT                   /locus_tag="DehaBAV1_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.502 at
FT                   residue 37"
FT   gene            complement(98940..99575)
FT                   /locus_tag="DehaBAV1_0097"
FT   CDS_pept        complement(98940..99575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0097"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16688"
FT                   /protein_id="ABQ16688.1"
FT                   /translation="MKVALYARVSSEAQDVELSIAAQLRALRDYAAKNEQQIVYEFIDE
FT                   AESGRTASRPEFKKMIALAKSNTSPFEAILVWKYSRFARNRVDSITYKTLLQKKGIKVI
FT                   SINEPLDDTPTGKLMEGIIESLDEFYSANLGQDIKRGMKENALRGFFNGSQPPLGYRII
FT                   KVKDGPKQRNRLEPESDTSSGIKTVRHIFSLADKGQGCKEIAVTLNRE"
FT   gene            complement(99572..100531)
FT                   /locus_tag="DehaBAV1_0098"
FT   CDS_pept        complement(99572..100531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16689"
FT                   /protein_id="ABQ16689.1"
FT                   /translation="MPRKKAPSIKETREWLDLYESGWSEALLAQRKGRDIRTIRRYLAK
FT                   AQDERRLDLVESELIKSALAKHQEQLLLTLDNLYSAIALPEPYLSLNSTGNNGRIELNS
FT                   GRVVVTQVAESTGVAVHLESEDSVLFSLVEEHLDHDLLFLMLNEWKSKLENYVRACSYI
FT                   KESRTERLSRRGADERSYNIKEKSADEQICKSICMSDLSEFIYKNSLNYIIKNDKSVLT
FT                   KARERLAINKERGELILKPGNTLLSCPGKEAEYLQKTLELLTEESLQEHKGPIQQAYRK
FT                   LEDETSKLKKVIEEIKLCNFIPGECRVCRRLKGQGGLR"
FT   gene            100651..100776
FT                   /locus_tag="DehaBAV1_0099"
FT   CDS_pept        100651..100776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16690"
FT                   /protein_id="ABQ16690.1"
FT                   /translation="MGRKKIAKTTTIDPQVKQRLEILSRIITRQYLIDKAKKRAR"
FT   gene            complement(100821..101420)
FT                   /locus_tag="DehaBAV1_0100"
FT   CDS_pept        complement(100821..101420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16691"
FT                   /protein_id="ABQ16691.1"
FT                   /translation="MEDILVIKFIRSVATGLLIIMAGLALLNWVNSSESDNPISSTVAY
FT                   IPTKSSILQSPLALDSLKTSAHYADGYVFLDFYDPYRLSNYLNKYDYSETHQPYAEGER
FT                   YGMYFSDVFYLVPGDNLKIVIYSDVPLGTDLACEISEYKNNGVSGSTPAYTVERYENGY
FT                   RAIISCHATESGEYQFKLWHRDKSQSERCAIVFYFE"
FT   gene            101503..101718
FT                   /locus_tag="DehaBAV1_0101"
FT   CDS_pept        101503..101718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0101"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16692"
FT                   /protein_id="ABQ16692.1"
FT                   /translation="MTKKTIEQRFGERIRVLRKKAEISQEELAFRAGVHRTYLGGIERG
FT                   ERNPSLKNIEAIAKALEVPISDLFIN"
FT   gene            complement(102397..103161)
FT                   /locus_tag="DehaBAV1_0102"
FT   CDS_pept        complement(102397..103161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0102"
FT                   /product="protein of unknown function DUF105"
FT                   /note="PFAM: protein of unknown function DUF105"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16693"
FT                   /protein_id="ABQ16693.1"
FT                   /translation="MLQELKTDTYKELGCFHGVRAGIAYHKALGVSTNTLVIELPEERN
FT                   ILSTRTGLGKAKYILNTHIPPELWDFMHDNSADWQTAYSVVLEEVLKRYDTDLDNVSFL
FT                   STGVDQDNIAWAEETYEEFWVLAFATAGVKTNAMRIGCDEASGIERNGKFEKIGTINVI
FT                   LLTGSSLETPTLASSYITLTEAKNVALQELDIRSAAHPDWQATGTGTDQIITVSGTGGK
FT                   YTYVGGHTKLGEMMARATTRAVKQAIRNCRGY"
FT   gene            complement(103248..103544)
FT                   /locus_tag="DehaBAV1_0103"
FT   CDS_pept        complement(103248..103544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16694"
FT                   /protein_id="ABQ16694.1"
FT                   /translation="MWSLYTMIWMLIGIALGVGFTALVNMLNKRGISVRFYEWLIGITG
FT                   LVLFLFTIQNFYTAFQEFYTKAAWMFLLVTGIPAVILLAISWQLVSRRVSNKA"
FT   sig_peptide     complement(103470..103544)
FT                   /locus_tag="DehaBAV1_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.603) with cleavage site probability 0.540 at
FT                   residue 25"
FT   gene            complement(103582..105129)
FT                   /locus_tag="DehaBAV1_0104"
FT   CDS_pept        complement(103582..105129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0104"
FT                   /product="reductive dehalogenase"
FT                   /note="TIGRFAM: reductive dehalogenase; PFAM: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16695"
FT                   /protein_id="ABQ16695.1"
FT                   /translation="MSAFHSTLSRRDFMKAVGLAGAGIGAASAASPVFHDLDEASQIGG
FT                   VAEKRPWYVRELEYAKPTVEIDWNMIQRQTHYNNWEDHLDQTEKDNRAHMYYDNTKKMV
FT                   LENNPGNTMFDVAIRHPAWTAVRRNMDYFFGVEGIMKDTPPGFEMGFDPESGHCMMSPV
FT                   WATDLFGIITPGNMGVPRWEGTPEQNAALIRMAARWCGGAEVGYLKADEYTKKLVHKTC
FT                   GILPILADKNGREVVWENVDQPYETDKKLVIPEKCDNIIVVTIREERNPALMAPSYRAD
FT                   ATTAKSYARSIAFDIHFRGFLHAIGYTSAGSGWGPWNNVPFGVLSGIGELGRMRGQITP
FT                   SCGPLIRKVEVFFTDLPLPPTNPIDFGANRFCRDCGLCAKACPASAIPTFREPTYDITP
FT                   ADDANSNPTKLHPEYFNLSGKKVWPNNDFACHNFWVTSGKHGCAACVASCVFSKDIKSS
FT                   IHEVVKGVVSQTGMFNGFFANMDHAFGYGIVSDQDMWNNFWFEPDKYWPLEGIDTNL"
FT   sig_peptide     complement(105040..105129)
FT                   /locus_tag="DehaBAV1_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.927 at
FT                   residue 30"
FT   gene            complement(105240..106106)
FT                   /locus_tag="DehaBAV1_0105"
FT   CDS_pept        complement(105240..106106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0105"
FT                   /product="putative ATP binding protein"
FT                   /note="TIGRFAM: putative ATP binding protein; PFAM: protein
FT                   of unknown function DUF71, ATP-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16696"
FT                   /protein_id="ABQ16696.1"
FT                   /translation="MNNFDLSPSRTGILEDNTRFYGNSEASLSLKSPITEYSLSPNANN
FT                   LTNLPWQPGAVNQRVLVSWSGGKDCCLSCYLAMLAGLDIRCLLSVIDHTGRLGAHSLAP
FT                   QILHAQAEAIGIPLVTRQVRVSEYDADYCRVVKELKEQEGISGGVFGDVNIGNSEAELH
FT                   ETWVKRIGNSAGIQAHLPLWNINRENILRMLISYGFEVLMIVTDNSELGKEWLGRRIDM
FT                   ETLAELKSRYESSENGRVGYYHTLVVDGPIFQKKLQIEKTSRIFKEDEWGANWYLDIEK
FT                   CSLSSKH"
FT   gene            complement(106418..107101)
FT                   /locus_tag="DehaBAV1_0106"
FT   CDS_pept        complement(106418..107101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0106"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16697"
FT                   /protein_id="ABQ16697.1"
FT                   /translation="MKIVIIEDEEEIVKILKLTFQIRWPSAEILAANYGSKGIQIVEKE
FT                   SPDLVILDLGLPDMDGFDVLDQIRAFSSEVPVLILTVTNDEHCIVRALESGADEYIIKP
FT                   FHQLELLSRVKVLLRRRLMDSEEVAINVGPFRLSKYSNTLMVDNRRLILTNTEKIIMSH
FT                   LLSNAGNLVPATLLAEAIWGHNYTNAKDAVRVHIWRLRRKVEPNPQTPCFIITVSHLGF
FT                   KLALS"
FT   gene            complement(107082..108308)
FT                   /locus_tag="DehaBAV1_0107"
FT   CDS_pept        complement(107082..108308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0107"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16698"
FT                   /protein_id="ABQ16698.1"
FT                   /translation="MSDNSKGDSILNSQISQSQVESMLFRCFAEELNDIVWEGSNTIAV
FT                   TFVNSKVYDIWGYKPEELIGKNFLDFMVPSKREEQKKVIDSMVENKAAVNGIHLYYQHR
FT                   NGKTLIFETRAKPILDNNGKCVGHRGIFRDVTNYILQEKRLQKLYKQEKAAFTELENQM
FT                   QQRLEFTRALAHELKTPLTVIQAANELMGTQILSPELTNISDSIARGVQSLQKRVNELL
FT                   DLAKGEVGILTVNRKLIKTLPYITNLINDLKPMVKMRNRNLLTNIPNSLPNICADEQRL
FT                   TQIISNLVDNSIKYSTEKAAITISVRQDTNLDNILFQVTDTGFGIPPDKQIEIFNPYAR
FT                   IRKAEEHTTGLGIGLSLSRTLVELHGGQIWFETSEGIGSSFYFTMPKYARKRMITAVKK
FT                   RQPDENCHN"
FT   gene            complement(108405..109889)
FT                   /locus_tag="DehaBAV1_0108"
FT   CDS_pept        complement(108405..109889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0108"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16699"
FT                   /protein_id="ABQ16699.1"
FT                   /translation="MKILLVNPGTEYKPRFRTYAVFPNGLLYIASVLERAGHEVRIFDN
FT                   VVSELTPPDYAKDFAPEVVGFSVLTGPCIGNALVQSKEFKALLPGVKVVWGNVHATCTT
FT                   EQTLKEEAIDFVVRGDGEYTFLDLIDHLEKGEENYAEIQGLAWKDREGRVTINQPRPFI
FT                   HNLDELPNPAWHLIDVPKYWDITLNTSRGCPFKCSFCYNIPFHHGHRADLSVERIVAQI
FT                   EHLQKNYKVKFIRFFEDNFTFNRKRMREFCQTVIDRRIKIKWDTESRADMSEEDVALMA
FT                   KAGCTSVGIGVETGSKRMLEYLNKGVDLDEMGRTFWRFVKHGIMPRLYIMLAVPTETVE
FT                   DFTETQDMLHRMEDPPFMYMRFVPYPGTPLYNQLVQDNRIKPPESLGEWAKFSVYFATK
FT                   GNLSELSDEVINQAISHWAHSYASRRVMFTLRHNPRYLLSAVKNPAEFFKAVSSLIKNS
FT                   LPVVFNKNTNIKPLVLEAVPNKMHGKQEPRLISNYE"
FT   gene            complement(109912..110661)
FT                   /locus_tag="DehaBAV1_0109"
FT   CDS_pept        complement(109912..110661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0109"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16700"
FT                   /protein_id="ABQ16700.1"
FT                   /translation="MKVYHLIYEPSYKSAVFHHWTECNLDCKGCFCRVEKLDFGLFPDA
FT                   LERLKDKAPETAPTDFLESPEEALKLLEGCELERAVFIGTEPALDPDLPALAKALHQKY
FT                   GSYNVLLTNGVRLCDLSDIDEIIFSLKAVTNAIYQDYTGRSNEKTLDNFKKVHASGKKL
FT                   QAECLLIPGLIEADEVEKIAKFIATVDKDITLRIDGYFPIPGCPWRGATPKEVTEASQR
FT                   AGKHLAKVNYLSADLPRQGEKPLRLFG"
FT   gene            complement(110658..111404)
FT                   /locus_tag="DehaBAV1_0110"
FT   CDS_pept        complement(110658..111404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0110"
FT                   /product="putative ATP binding protein"
FT                   /note="TIGRFAM: putative ATP binding protein; PFAM: protein
FT                   of unknown function DUF71, ATP-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16701"
FT                   /protein_id="ABQ16701.1"
FT                   /translation="MTEVIVSWSGGKDCTLACYKAIKSGLKVRYLASIITRSTGKLWPH
FT                   LLTPEVLRMQAEAIGIPLLEWPSATEGYDDNYRRMLGQLKTEGVEGVVFGDVNIGNSFA
FT                   VKHLNWIKSVCEPTGMDYHLPLWQDNRATLLSELIDLGFEVRILAADSTELGESWLGRK
FT                   LDKDMLAELKIRHSLSPNGNVGYYHTFVTDGPLFKSRLVIEEWGRVFDEQAQFGGMGVW
FT                   YMDIKRCRLESKAKPETLVLLSAEAL"
FT   gene            complement(111488..111757)
FT                   /locus_tag="DehaBAV1_0111"
FT   CDS_pept        complement(111488..111757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16702"
FT                   /protein_id="ABQ16702.1"
FT                   /translation="MWFFIGLIIGVALLALVLWLKRKVIRLSWYDWVIGFIAFIFGVLA
FT                   VQHYMASVSHGELKAGLLGLGIFGVIAIVLALLDWQLIARRKKV"
FT   gene            complement(111779..113299)
FT                   /locus_tag="DehaBAV1_0112"
FT   CDS_pept        complement(111779..113299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0112"
FT                   /product="reductive dehalogenase"
FT                   /note="TIGRFAM: reductive dehalogenase; PFAM: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16703"
FT                   /protein_id="ABQ16703.1"
FT                   /translation="MSQFHSILSRRDFMKSLGLASAGIGAASLGGVNATAPFFHDVDEI
FT                   TSSPSAITKKPWWVKLQDKPTVPMDLSLLEPGRTKVWCMPPDDPSGPVTLRAPGYSEEE
FT                   TRQKFTDYFKKEWGTWDPGPTMEGFGDFPERTTEHIGPIRDNALLAGLMPFLFGKLPDE
FT                   IIAAEKGQYLSYLLDKPCGWRYAAPLEQRGGTKWQGTPEENLRTVRAAARFYGADDVGA
FT                   IEVDEDFLRVMWGVSRFPFIPVPVQFEWGDVDDFVPTPSATRPTKIIIPRRCKYFVHWT
FT                   MRQPPSRLKHDSGTQQGPSQGWTYSRNPMVNVNIQEFLWGLGYIALTNWSGYLIPTGYA
FT                   GVASGAGELSRWSGVLTPKFGNQVRGMYGFLTDLPLAPTKPINFGGYEFCKTCGICADA
FT                   CPMGAIQKGEPSWDASEIWQNPGYLGWRLDLTKCSHCPVCQGVCPFNTTDDSFVHNLVK
FT                   GTIPNVKLFNGFFANMERDFGYGRKPYEDWWENAADGKEPVFGIDSTQ"
FT   sig_peptide     complement(113195..113299)
FT                   /locus_tag="DehaBAV1_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.810 at
FT                   residue 35"
FT   gene            complement(113374..113997)
FT                   /locus_tag="DehaBAV1_0113"
FT   CDS_pept        complement(113374..113997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0113"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16704"
FT                   /protein_id="ABQ16704.1"
FT                   /translation="MKELLSSNSKPKPHINGMSYSEQTYWQLMAAEYEAHVAQIGKQQP
FT                   NAASTNVSKCIRCGLCCYQYPCIPRPEEIEPIAQYLELTTLDLINKYMVINTADCKVYF
FT                   LRWAKHGEEDLTGKMIPPARTFDRGYCVFYDQKSRSCCIHPIRPQEARVIKCWEKNNGM
FT                   DKSLWGITGWNSQDILRFLPDFSPRIYADNKYLPPKSSMPPRKY"
FT   gene            114086..114973
FT                   /locus_tag="DehaBAV1_0114"
FT   CDS_pept        114086..114973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0114"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16705"
FT                   /protein_id="ABQ16705.1"
FT                   /translation="MKRPPKVYFKNESINTNKYLVTLFKIHQPQNPNSCDIIQCVRDSR
FT                   FKSLQPNAKQFTIVNKLLLNDIRDYIFILDMDGKIMFVNEQACKARGYTQEELIGRSIL
FT                   ELDTPETAALAFQKIQEAKEKGFALHNIAHKCKNGAIKISELLTRIVEIEGKEYVFGLA
FT                   KDISEVQARVAAYVNAQEKEREWVSIEIHDRVIQNLTGISHKIDALSSAKESCVSKQIE
FT                   LKELSKQMQASIAEARNIMRELYPNTLARYGLIKLIQEELARLQDELNCNTSLNNSIVN
FT                   LIPPYLETTMTCPR"
FT   gene            complement(114986..115681)
FT                   /locus_tag="DehaBAV1_0115"
FT   CDS_pept        complement(114986..115681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0115"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16706"
FT                   /protein_id="ABQ16706.1"
FT                   /translation="MADIIELASKYGRYGYRRITALLNERGWRVNHKRVERIWRTEGLR
FT                   VPKKQPKRSRLWLNDGSCIRLRPERKNHVWSYDFVTARTADGRAFRMLNIIDEYTRECL
FT                   AITINRRLTSEDVIDQLFNLFIFRGIPEHIRSDNGPEFTAKAIRKWLTRLGIKTLFIEP
FT                   GSPWENGYIESFNGKLRDELLNLEIFTTLAEARVLITDWRRQYNQVRPHSSLGYRPPAP
FT                   EAIMAVVTT"
FT   gene            complement(115822..116100)
FT                   /locus_tag="DehaBAV1_0116"
FT   CDS_pept        complement(115822..116100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0116"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16707"
FT                   /protein_id="ABQ16707.1"
FT                   /translation="MPRKSFTPEQIINKLREAEILISQGTTLAVMLKKIEVSDCTYYRW
FT                   RQEYGGMRIEQAKRLKELEVENTRLKKLVADLSLDKAILKEAARGNS"
FT   gene            116258..116575
FT                   /locus_tag="DehaBAV1_0117"
FT   CDS_pept        116258..116575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16708"
FT                   /protein_id="ABQ16708.1"
FT                   /translation="MCKKCAVNCPAGAISMEDEPSEVVKSARFIGWDTDSHKCLTERIV
FT                   HGCSTCQAICPWSKPDTIIHEIGRTFGQNKALAPFLVKLDDFFYGSKPEGYDVATWAPW
FT                   R"
FT   gene            116611..116883
FT                   /locus_tag="DehaBAV1_0118"
FT   CDS_pept        116611..116883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16709"
FT                   /protein_id="ABQ16709.1"
FT                   /translation="MTLILLLVGVAMGIFGTWLWNAKNKKNIKLTFIEYLLLAFAVIIF
FT                   SAGVLFVKTFVEESETNVALMSGLVSSITALILLATTWQLVKRHN"
FT   gene            complement(117096..118538)
FT                   /locus_tag="DehaBAV1_0119"
FT   CDS_pept        complement(117096..118538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0119"
FT                   /product="reductive dehalogenase"
FT                   /note="TIGRFAM: reductive dehalogenase; PFAM: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16710"
FT                   /protein_id="ABQ16710.1"
FT                   /translation="MTKSGFDVIKADAMANIGTNFKDLDELKSDSLAVEKLPWWIKQKE
FT                   FWDFTTEMDWSAQKPFEYSIRNFNQHLSPKQAKQYNSRYTQVMEWRKTSKVPGFTHRDY
FT                   AMKCGANTITLLSDLAGIDKNGESALYWTGSPKLMDVTPTPEEMGCPKYEATPEENLLM
FT                   IRTFLKVCGASKVGAVPVDVKFKSTQPKFYADKIPLVYENVDKPYITRSKYVIPDRMKW
FT                   AIVFSTEGGNDLTGRGNNWVGALGASLYSGGPSDYIQIQVQRFLKALGYSSVVSGICYN
FT                   LQNWPAMGVASGMGELGRMQISVSPFLKWDRAIRCIITDLPVSFTLPIDAGITRFCIDC
FT                   GRCASVCPVSAINSSRESSWDIWPKDPKNPNLRPELFNNPGKKTWYFGHHLCGAFGRDA
FT                   NDSKCGICMLNCVFNRGTDTILYPFIKPVGANKSALANFLKDMKKNFSCTGFESSMPLG
FT                   EEDQYTLAGESLVENFWNQDSS"
FT   gene            complement(118864..119136)
FT                   /locus_tag="DehaBAV1_0120"
FT   CDS_pept        complement(118864..119136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16711"
FT                   /protein_id="ABQ16711.1"
FT                   /translation="MWLLLGILIGIIALGIIWWARKSNTSLQWYDWVISLAGLAMLLFT
FT                   VQNYFASVAEGESKAASMFLLVAGLPALILLAVVWQLVIRRVKKA"
FT   gene            complement(119160..120704)
FT                   /locus_tag="DehaBAV1_0121"
FT   CDS_pept        complement(119160..120704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0121"
FT                   /product="reductive dehalogenase"
FT                   /note="TIGRFAM: reductive dehalogenase; PFAM: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16712"
FT                   /protein_id="ABQ16712.1"
FT                   /translation="MNKFHSSVSRRDFMKGLGIAGAGLGAAAATVPVFHDLDEAVSAPV
FT                   AGGFRRPWWVKEREYEDPTCEVDWSQIERSDNSWIMHGVRNGVKGGYLFAGQKYLDWQK
FT                   EGSDRAFNGVKNNEPGLTLRDMALEGGASPLLMGLNKVVNFVLPEIDQDQVLAQFGFTA
FT                   AAWPNASSFWVASAPPDFWGVPKWQGTPEENSRMLRSAMRFFGASEVRFAELNEKTKKL
FT                   IFTHHVHNTPIVFEDVDKAYEVAGQKFVLPDKPLYIVSVAVQMSKEMYRQGNAGIRFAA
FT                   NNMRYRLNNVVQVATQSFLKGIGYQGIGYPSESLFHGMMPSQADAILTGFAEMARNNNY
FT                   CISPEFGTVAGYYSILTDLPLAPDKPIDAGYFRFCHTCRKCAEACPSQAISFDSEPTWD
FT                   IPPSSVDPAKATLYSTPGKKVFHTDSPACYSRWIGLHGCARCMGTCVFNTNSSAMVHDM
FT                   VRATIGTTGLFNGFLWNADKAFGYGLIPPEKWEEWWDKDYPVLGQDSTIGSYYGGY"
FT   sig_peptide     complement(120618..120704)
FT                   /locus_tag="DehaBAV1_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.850 at
FT                   residue 29"
FT   gene            complement(120715..120942)
FT                   /locus_tag="DehaBAV1_0122"
FT   CDS_pept        complement(120715..120942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16713"
FT                   /protein_id="ABQ16713.1"
FT                   /translation="MTVTNLYRNFIIYNRKYILLLLGCWYTPLKRLFPATLIIGFIISG
FT                   KGVQVNKNGGENGIKDVVPLGKPQIFMVLI"
FT   gene            120969..122270
FT                   /locus_tag="DehaBAV1_0123"
FT   CDS_pept        120969..122270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0123"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-3 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16714"
FT                   /protein_id="ABQ16714.1"
FT                   /translation="MRFKEHLMKMPSPERIGTADYCSQIVKIMQHNTLVGITIVDQKMH
FT                   QIIRVNQALCKMLGYRKKELLGKTMFDITHPDDMEISYKHAMKIWDDEHCYSKIIKRYS
FT                   KKDGGFIWAESEGFLLKDNADNGILSVTFIKDITKETTLSSSTPLSISSNPASSSQENP
FT                   DIDVNKLLSDEINKRKLIYNQLMVSYENEKKLRKRIQTEMKSRLEFTRIVVHDLKTPLT
FT                   SIISSSGVLSNIAADGKYKALASNIYESTMNLNIRLDELLDMAQCEVRDPKLNKSRFNI
FT                   KEMLEHIISIQQEICNTNHIVFNIVIAPEVTFIIADEDRLKQILDNLIDNAIKYSADSG
FT                   IISINISHDQNNVLFSISDSGIGIEPGEIKNIFKPYYRVENRQRKLQGLGLGLSIVRTY
FT                   VKLHGGRIWVESECGKGTTFLFTIPQPPSKATPA"
FT   gene            122267..122944
FT                   /locus_tag="DehaBAV1_0124"
FT   CDS_pept        122267..122944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0124"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16715"
FT                   /protein_id="ABQ16715.1"
FT                   /translation="MKLLFIEDDKKIVESIFLLFKSFWPDMETKAVHLGKTGIETAYKE
FT                   DFDIAIIDLGLPDIDGINVLKQIRAFSSLPILILTARNNEQEIFTAFELGADDYITKPF
FT                   QPLELIARVKSLLKRLSRASQDLGVKYGHWKFGTSLKEISYNNIRVNLTVTEGQLLHIL
FT                   LTKAGSTVSYADISKSIWGRNEYYAKETIKTHIMRIRQKLSRIDNSKEFIINIPGVGYQ
FT                   IVE"
FT   gene            123332..123655
FT                   /locus_tag="DehaBAV1_0125"
FT   CDS_pept        123332..123655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0125"
FT                   /product="TM2 domain containing protein+B7201"
FT                   /note="PFAM: TM2 domain containing protein+B7201"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16716"
FT                   /protein_id="ABQ16716.1"
FT                   /translation="MYCSKCGKQVDDSVSFCPACGNQLHTSGTTATEYPERKSRIAAGL
FT                   LGIFLGSIGVHRFYLGYVGIGIAQIIVSFVTLGIGSIWGFIEGILILTGSFQYDAKGIP
FT                   LRD"
FT   gene            123743..124000
FT                   /locus_tag="DehaBAV1_0126"
FT   CDS_pept        123743..124000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16717"
FT                   /protein_id="ABQ16717.1"
FT                   /translation="MPKIGPIEIIIIIILIMIPVGLIWGLIYLFNKLNKKKITGRNMPL
FT                   DIIEINKGVQYCTRCGQKLEANIQFCPVCGTEKLHAPKIP"
FT   gene            124013..124354
FT                   /locus_tag="DehaBAV1_0127"
FT   CDS_pept        124013..124354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16718"
FT                   /protein_id="ABQ16718.1"
FT                   /translation="MVRLIIGILLGLWGLPVLVFSIQNLIGSLSETEPQVAGMFFFVTG
FT                   LPALVMLLGAFLLIRSYLKNPSKPAHPVQSRLSTPDSQNTSGQYCTKCGIGLAADVVFC
FT                   PNCGQKITP"
FT   gene            124563..125747
FT                   /locus_tag="DehaBAV1_0128"
FT   CDS_pept        124563..125747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0128"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16719"
FT                   /protein_id="ABQ16719.1"
FT                   /translation="MPRKTTLIIGGGAAGMVASISKARRGEPVMILEKTAQLGKKILAS
FT                   GNGRCNLLNEALDSSSYNPEARPLVNSVFSRFGRDDILNFFSELGLHYYSQDGRIFPFT
FT                   NQAASVQKVLALEIKRLGVQVEYGFDCVSIQKTQTGFSLGAADGKQQTGHSLILTGGGS
FT                   TYPSFGSDGSGYKLASSLGHRIIKPVPSTVPLVVKDPLCHLLQGQRIIARAQSRIQGKI
FT                   GNPVDGELLFTKYGLSGSLILDISQEISLAINRLNIKDVSLETDLIPFMEQKQLETELT
FT                   NRHKMGLTPEDMLTGILPGKLCLAFKQLFEKENPSKAAVKLKNWRFEVSGTRGWNEAEF
FT                   TAGGIDTKEVDPQTLESKLVKGLYLAGEVLDVNGKRGGYNLGFAWASGYVAGLS"
FT   sig_peptide     124563..124634
FT                   /locus_tag="DehaBAV1_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.519 at
FT                   residue 24"
FT   gene            125873..126727
FT                   /locus_tag="DehaBAV1_0129"
FT   CDS_pept        125873..126727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16720"
FT                   /protein_id="ABQ16720.1"
FT                   /translation="MKSFKVIAPLISLLMLLSLALGGCSSGTADNDSPDTNNLPVSDTT
FT                   PTGSQLIASILAASPNITSFDTTSVIDMTMQVSGMSIKTVMTANGKEDLSSKKAYLTSS
FT                   IIMTGDLASTMEMETYLIDSFQYFRITSTDQNTGMQLNTWYKMLMDTQMQTQTWNSQSQ
FT                   QNNYLFSKSSITVDGSETINGTSCWKVTITPDLTELIKYLNEQQAIEDPSAITNPADSL
FT                   KNIKLTAWVAKDTSYVIKMNMSMDMLIEAQTLSMVMSTTITNINQPVSITLPPEAVNAI
FT                   QVG"
FT   sig_peptide     125873..125962
FT                   /locus_tag="DehaBAV1_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.677 at
FT                   residue 30"
FT   gene            126795..128852
FT                   /locus_tag="DehaBAV1_0130"
FT   CDS_pept        126795..128852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0130"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: SMC domain protein; ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16721"
FT                   /protein_id="ABQ16721.1"
FT                   /translation="MSYTSFGGGGFLLYNGYYTKTNMLNIQNLSKSFGVRSLYTGVNLN
FT                   IGARDRLALLGPNGSGKTTLFEMIAGRLEPDEGKIILRRGTTVGYLEQDIKPSSKQPLL
FT                   KAVSSASDRLRSLSHKISLLQGELAEEKDGSESNRLMNELGELQHSFEALGGYNAEQEA
FT                   KLILAGLGFKPADFDRPLHEFSGGWLMRAELAKLLFLSPDILILDEPTNHLDLESTRWF
FT                   ESYLKQYSGSVLFTSHDRAFLNSIATKILSLEEQKARLYTGNYDSYLRERELRLIQLES
FT                   QSRRQQELIDKETKFIERFRYKATKASQVQSRIKKLDKLSAIVIPRQTKKMHFNFPEPE
FT                   RSGHDVIKLRNLTKSYGDMVIYQGLELVLNRGDKVALVGPNGAGKTTLLKILAGVMLFD
FT                   SGYRNLGVNVNTAYFAQYYVESLCPSNNLIQELETILPDAPEQQLRGMLGAFLFSGDDV
FT                   KKRISVLSGGEKTRLAIAKMLLKPANLVLMDEPTNHLDIPAREILADALQAYKGTLCFI
FT                   THDRTLIREVATKIIEVRNGKIRIFEGDYDAYLEFAAANPFEDEILKNRTAVSSPRPAP
FT                   VSASLSQKQRKTLEGQIRNQHYKETGALKQEISDTEEEITGLEKSKQELETLLADPDLY
FT                   RSGQKVADASLEYKTCKERLIILGEKWLKLCQQNDTLKQKLEDTLKELDN"
FT   gene            complement(128849..129427)
FT                   /locus_tag="DehaBAV1_0131"
FT   CDS_pept        complement(128849..129427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0131"
FT                   /product="Hly-III family protein"
FT                   /note="PFAM: Hly-III family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16722"
FT                   /protein_id="ABQ16722.1"
FT                   /translation="MLALIVLVILSWGNWDIMAVSVIYALAVISLFSFSTIYHALKKKE
FT                   NEINVWRKLDHIAIFIMIAGTYTPMAYIYLDGGWRLGMLIATWVFVLAGVFQKIFFLNA
FT                   PRWLSPVTYLGMGWMAVVPLREFWLNMPSLVFWLIAAGGLAYSIGAVIYGLKKPNPVPG
FT                   AFGFHEIFHTLILLGWAFHLAAVILAILG"
FT   gene            129622..130902
FT                   /locus_tag="DehaBAV1_0132"
FT   CDS_pept        129622..130902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0132"
FT                   /product="proteinase inhibitor I4, serpin"
FT                   /note="PFAM: proteinase inhibitor I4, serpin"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16723"
FT                   /protein_id="ABQ16723.1"
FT                   /translation="MKIKHLFSLLAVASLFTLTACSGGVSAEELKSDKDRIANPNISQQ
FT                   DANIQAEANNDFAFKLYHFLKGTEEGNFFYSPFSISIALAMTYAGADTTTKTEMQNTLN
FT                   YLLPDANLHAFFNFIDQELNKRESQAEEADAGTFELKLVNAIWGQKNYTFLSDFLDTLA
FT                   QNYGAGLRVLDFAASSEDARRVINDWVSEATKDKIKDLIPSDGIDSTTRLVLTNAIYFN
FT                   AAWAAPFEEEDTQNGLFYLQNGSSVSVQMMHQSEGHGYYNGDDFQAVELAYAGNSLSMV
FT                   IILPDEGKFGQVEDALSGQMLTGILASIKYNQINLSLPKFSFESEFALKDALSALGMPT
FT                   AFSGQADFSKMDGGYNLMIGDVFHKSFISVSEAGTEAAAATAVTMNLTSAPAEPVTLSI
FT                   DRAFIFCIVDMATGTTLFTGRVLNPGA"
FT   sig_peptide     129622..129705
FT                   /locus_tag="DehaBAV1_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 28"
FT   gene            complement(130984..133176)
FT                   /locus_tag="DehaBAV1_0133"
FT   CDS_pept        complement(130984..133176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0133"
FT                   /product="beta-lysine acetyltransferase / L-lysine
FT                   2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /EC_number="2.3.1.-"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: GCN5-related N-acetyltransferase; Radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16724"
FT                   /protein_id="ABQ16724.1"
FT                   /translation="MVLADTKSEMPQYPQTEQDHQVMAHKISSDYHEDEWNNWKWHISH
FT                   TIRDLTTVEKLLGVKFSAEKRRSLEDTILKFPMSITPYYFSLIDRKNFENDPVFIQSVP
FT                   SAAELNFSCYDKEDPLAEDVDSPAPGITHRYPDRVLFHVSNRCAMYCRHCTRKRKVGDI
FT                   DKNLSRDELKKGLEYIKNTPRVRDVLLSGGDPLLLPDSILEWLLSELKAIPHVQVIRIG
FT                   TRVPVVLPQRITPHLVKIIRKYHPVWINTHFNHPREITATSSRALGMLADAGIPLGNQT
FT                   VLLAKVNDCPRVMKALVHKLVENRVRPYYLYQCDPAQGLSHFRTSIGKGIEIIENLIGH
FT                   TSGFAVPTYVIDAPNGGGKIPIMPNYLISQSSSKVILRNYEGIITAYYQPEDYHPPKCG
FT                   QDCSACNLDLDLNGAAEGALVGIARLLSNYEDTDYLVPTECDRMDRRKSGYDQITTMGT
FT                   SLIQHGKNSDRIYLMRLAAEEAATLITGMQALATENGYTKLFAKVPDDIKPLFEADGFE
FT                   TEAVIPCFYGGSKTGYFMGKFIDKDRKIEENGELLEDVLKVAHSKAGKVPVVKLPNGYT
FT                   LRKCTAEDTSAMADVFSTVFASYPFPIFEPDYISRTMAESITYYGIWHGDRLAALSSAE
FT                   QYPLEGHVELTDFATLPVYRRRKLAGILLRTMEDEMKQKGFGVSYTSAVAESYGMNISF
FT                   ARQGYKFAGRLKNNTQINGSIKSMNVWYKCLKKKTK"
FT   gene            complement(133630..134124)
FT                   /locus_tag="DehaBAV1_0134"
FT   CDS_pept        complement(133630..134124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16725"
FT                   /protein_id="ABQ16725.1"
FT                   /translation="MADTEFITQQIQLLKDPDGLKRQSARLALEDLGKSSVPYLVAKLD
FT                   EYQGDALWESVKALSRIGDASSAGALVKLLSHEVSDIRWLASLGLIKIGKEGVKPLLRD
FT                   LSLSDARSPLLREEAHHVLTGLRDKQLKNSLSGVIKALESNSPRSDAPVAAEEALVKLK
FT                   F"
FT   gene            134276..134629
FT                   /locus_tag="DehaBAV1_0135"
FT   CDS_pept        134276..134629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0135"
FT                   /product="protein of unknown function DUF134"
FT                   /note="PFAM: protein of unknown function DUF134; Sigma-70,
FT                   region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16726"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSQ2"
FT                   /protein_id="ABQ16726.1"
FT                   /translation="MPRPYKCRRISEIPKVAYYKPAGIPLSMLEENQLSTEEAEALRLK
FT                   DLLGLEQAQAALQMNISRPTFQRMLYSARYKVADALLNGKALRIEGGVFEIDARPCCQR
FT                   QTPSCQPDPPKQT"
FT   gene            complement(134626..135600)
FT                   /locus_tag="DehaBAV1_0136"
FT   CDS_pept        complement(134626..135600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0136"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16727"
FT                   /protein_id="ABQ16727.1"
FT                   /translation="MNNIIDKKWAYRELGKTGIGLSPIGLGGWQFSRGKGAAIGVWGML
FT                   NQTKVNEIVLNSLGGGINWFDTAEAYGMGQSEEALAEALKQAGIQPGECFIATKWQLTL
FT                   RFASSIKTLLPMREGFLNPYKVDLYQVHFPSLFASIDAQMDNMAALYKEGRIRAIGVSN
FT                   FNASQMRIAQKRLNEHGLSLASNQVRYNLLDRQIETNGVLETARELGISLLAYSPLGMG
FT                   ILSGKYQRNPEYLQQVPFIRRKSIRRALEKSMPIIATLSEIAGRYSADIAQVALAWVIY
FT                   GQGDTVFAIAGASTPVQARENLKALDIKLTTAEIAELNKVSRL"
FT   gene            complement(135870..136667)
FT                   /locus_tag="DehaBAV1_0137"
FT   CDS_pept        complement(135870..136667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0137"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16728"
FT                   /protein_id="ABQ16728.1"
FT                   /translation="MKLMKKNRARLFISLTVICLAGVSFFLWAMPAVLGQQYIKQLNYL
FT                   PSPQPGERILIFSPHPDDETIALGGYIDSACQAGAEVEIVLVTDGSKFTNKEIRYQEFE
FT                   SACRLLGVAADHLVFLDFKDGSLRSVPVTLLIDCFGALINSFMPDIVFYPHPQDAHDDH
FT                   AAVSRAVRQCLKVTPGIRGYEYLVHYRIFFPQPRVFNQNLYLLPPLTLVNEDHNWLKFD
FT                   LSEEQLERKLAALSAYASQLKNPFLKPLMQSFIRQNELVCLPN"
FT   sig_peptide     complement(136578..136667)
FT                   /locus_tag="DehaBAV1_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.785 at
FT                   residue 30"
FT   gene            136845..138170
FT                   /locus_tag="DehaBAV1_0138"
FT   CDS_pept        136845..138170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0138"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16729"
FT                   /protein_id="ABQ16729.1"
FT                   /translation="MAYIFNKTRPDAVADMRVTTAKPYQLFGKLRSPLYINAIFLIIGG
FT                   GAGAALSFVFWILTARFFTPSAVGLAGAVISAISLLGTVSHLGLGFGIIRFLPQNIYPA
FT                   KSIINSSISLTLIVSILAGGIFLLGLGIWSPELLFLRQSPLLAVSFLAFTAATALNSIA
FT                   DNSLIAHRHSGYSTLRVVAASGLRLILVIILASLFPQNGIFSAWGIALIATLFMAIFGF
FT                   IPKVSGGFRPGFEICYPYLKSSFGFSLSNNLSQFLGSAPALLLPLLVLGILGAESNAYF
FT                   YIGWSTATALTTIPVSISTSLFTEGSHDEKGLSLHIQKSLKLSLGLIIPLVIILFLLAD
FT                   KVLLFFGQEYAVSSSGLLRIMIVGLIPQSLNVIYMGSLRVIKQLKRLMLINCLIAGLSL
FT                   ILSFGLIPVMGINGAGLAWVIAQSVCAVYVGFRLITNRSTSV"
FT   gene            138170..139456
FT                   /locus_tag="DehaBAV1_0139"
FT   CDS_pept        138170..139456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0139"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16730"
FT                   /protein_id="ABQ16730.1"
FT                   /translation="MNTPKEPKSILLTLRQQLCCGCGICQAICPAGAIKMQIAPDKGIY
FT                   LPWLNTSLCRSCGKCLKVCPGTGIDLDSYSQAIFGGASPSLIQNSCYTAFSSDHLQRNL
FT                   STSGGVATALLNYALETGLIDGALVSGANPSSPLTPASFIARTPEELKQAAGSKYCPVA
FT                   AASAISEITAKPGRYAVVGLPCHIQAIRKAENQNPLLKERIVLHLGIVCSSTMSFRGTE
FT                   YILKQQGINKINLISLHYRTGGWPGDMHLEMACGDTQTLPLRNYHPYHGHGFFSPRRCL
FT                   MCTDQLNELADISLGDAWLRELEYDHEGTSAVIVRGDTGEDFYRNAVQYGCIKSQPLSN
FT                   KRVMEWRNKRQDYAAKKNILSLLGWKLPEYSHSCPPARKIAYLYTLEQVINYHLGKTNS
FT                   RLVIEPAKHFWVWLTRIAEKFISKQASRG"
FT   gene            complement(139431..140723)
FT                   /locus_tag="DehaBAV1_0140"
FT   CDS_pept        complement(139431..140723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16731"
FT                   /protein_id="ABQ16731.1"
FT                   /translation="MKENPDNKPPRILVLSNADFESRGFQAIVRGLEHCLGECLPGLTL
FT                   EYFSFAPKRYRYLESKGLKLISHPWANGNCETLNTFSYLVLIPKSLLRAVYYKLRPAKN
FT                   PYRHYNALLHINVDCLNETDYGFVCVCLNLLKSWAGLRAFGCPLLTAPVDIGPFNTPVS
FT                   RFMGRYILSRAKLVALRDELSYEYLLKLGLKPERLYLGADMAFLMPPASREVVKELFMA
FT                   EGVENDNRFIIGISPSLFQMELKNIFADSAADKPEVYLMLIAELADFAASTFDAGIYLI
FT                   PHVHPDDSRVCHEVYARMQHKNRVHVFSGDYPSETVKGLIGECDIFISCRMHASIAALS
FT                   QAIPTLTLGYQEKYWKLLGSYLGQSDYLVDIKKPNPRDIQDELKQKLSCMAANRPAISA
FT                   RIKERLGIINHRASVYGQRVAEVISRGKPVC"
FT   gene            complement(140704..141405)
FT                   /locus_tag="DehaBAV1_0141"
FT   CDS_pept        complement(140704..141405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0141"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16732"
FT                   /protein_id="ABQ16732.1"
FT                   /translation="MNRVFVKKLLNLSHRYGGYVPLSRLNTVSCWLEGGGESLLDIGCG
FT                   GGEAMLFLNRRKSFKTCGVDINPILIAEAKNKSSHHQYFCRDILNLNLADKSYDTVICL
FT                   ELIEHLPKDEGLNLILRLEKIARKRVILSTPVGFSRVEGNHNEDGSAHQCGYLPFELKE
FT                   MGYLVRGNRLRLERVWWPYLLKRSAALASVYWAFWLAAGVVFSPLAYFFPDRIASGMVC
FT                   LKEVGYERKSG"
FT   gene            complement(141402..142616)
FT                   /locus_tag="DehaBAV1_0142"
FT   CDS_pept        complement(141402..142616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0142"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16733"
FT                   /protein_id="ABQ16733.1"
FT                   /translation="MNILHLGSGSLQTPPVGYGGIERYVFESARGLAARGNRVVIFDIR
FT                   LDRADLVSEQTGGIEIIRLHCLVAHRSSSLWLSNIYSVLNLLGFSLRARRYINKNSFEV
FT                   IHIHRTLVGLVLVLVLPSQREKMIYTVHSPVWVMQRGSFKDRLSRKLDIFIMKRVHRVI
FT                   AQSARIKNILERERAAPGRIRLLPCGVDTSAFNPASRCSFICRKYGIDDRLLVLFVGRI
FT                   VPYKGVEYLVRAANLVVNKAGFRKCAFLLAGPMAEHGLDALEHAAYPKKVSSLIAEYNL
FT                   GDFVFLSGSLPQDDLQMVFASADIFVLPSLAESSPAVVLQALASGCAVVASDISGIHEQ
FT                   VVEGVNGYLVKAGDETELAKRILELLQSPARRSAMGANGRELVKKEFDWGVICGRLEGI
FT                   YREAT"
FT   gene            complement(142616..143470)
FT                   /locus_tag="DehaBAV1_0143"
FT   CDS_pept        complement(142616..143470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0143"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16734"
FT                   /protein_id="ABQ16734.1"
FT                   /translation="MEDYVPLSVIVCARNAEKTIGSCLESIMQNSPAEIILVDGDSTDK
FT                   TVSLAAAFTQHILNDRGRGTSFAHQIGSEIAGYDYIMFVDADVELPPYALGQMFAELKK
FT                   AKLDGIYARTEGAGQGNFWERAATDFLSCRPNPAGIWFGAALVSRDIVLKYGFDSFISP
FT                   GDDVDFNRRALSGGCVFGVSAVRVKHHHRTTFKNVVHQYIWYGKGNSRLAWKNGLLILR
FT                   FWPPFPAVYGLLHSLGHFKFRPVSLHLLAFVFQSWGMVCGLTELIFNPPPDRPRRPCWK
FT                   CGI"
FT   gene            complement(143472..145091)
FT                   /locus_tag="DehaBAV1_0144"
FT   CDS_pept        complement(143472..145091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16735"
FT                   /protein_id="ABQ16735.1"
FT                   /translation="MKNESALLASSKLFCILALVLWGLSLSGDGFNPDMGTMLKPPMLL
FT                   FVSGLGFLCLGSVFLWKMRASQTRLLCLYTFIMLAMLWLSPVIMQSSPVSAQWAYGIYY
FT                   PNTQFISQTGGIDPAGYTFHNWPGFFILDYSLSAVAGTSCLDFMAFYGPFLMQVLILVP
FT                   LYCLFKNIIPNPNHRFAAIWVFYLANWVAQLYFVPQGVGVFFLICLLAIITSPGFSASE
FT                   GNAVSHRVVIILVLAALTVSHLLTSIVALLCVGALTLSRLVKGFNLGILAGMLVGCWTI
FT                   YGAATQFDSQLPDFANRAFELENLFQFSSSSGGVDAGAAFLEISRARFIFSGLFAGLAV
FT                   LGVLLSLKYRNRFDFSLFALEGVAIVILCSMLYGSEFWTRAFLFSLVPIAYFAVKLLRN
FT                   RLSTLVMAAVLLVAIPGHLLAHYGAIPDMVSRFDLAAWQYLENYTLRGYISGGISYIKP
FT                   DYLSLPLKKLDWQDGLLVSQGYTGRYPQYLQIGRSTGVGWVYYNGDSQYVPALEAALED
FT                   SASYGLIYQNGEMNIYFNQGAN"
FT   sig_peptide     complement(145005..145091)
FT                   /locus_tag="DehaBAV1_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.581 at
FT                   residue 29"
FT   gene            complement(145088..146011)
FT                   /locus_tag="DehaBAV1_0145"
FT   CDS_pept        complement(145088..146011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0145"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16736"
FT                   /protein_id="ABQ16736.1"
FT                   /translation="MEKIMSLSVVICTRNSASTIKACLDSLMPAYRSSLIREIIIVDAC
FT                   STDATCRIAGNYPVRIYYEPGKGVYFGYQYGWGICSGEYVLFLDSDAYLEKISLVGVLN
FT                   MFSDPQVGLVGVYSFSPDGSRLGRCAGQWWDYHRNRLLPKARSSLFGRWYHRVVGFGAE
FT                   YTSGPCFMASRQCLEATGGFAPELYLYYLYPKLAYPGDIILSGRAIQAGYKAVWANDGR
FT                   VGHSPPGDLPALWRQRANWGRGDAAYLDICRTGFSKRVTCVLSRLASPVMALYLAVKYR
FT                   NLLHLWYLPLAQLAWLGGYFNFRLKR"
FT   gene            complement(146027..146677)
FT                   /locus_tag="DehaBAV1_0146"
FT   CDS_pept        complement(146027..146677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0146"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16737"
FT                   /protein_id="ABQ16737.1"
FT                   /translation="MIISKPSNPGSKENTPKTTDSKPEKDMDCLLRGYLGGLSHCLEEL
FT                   TAQDICGVAELIYQAYTRRRQIFIVGNGGSASTASHMARDLRIGTSLRGKPRLRTCSLA
FT                   DNVAFITSLANDVNYESIFTEQLIGQIEPGDVLIAISCSGNSANVVRAAEYANECGAST
FT                   VGLTGFGGGRLLEICDICVVLSSCDYGQVEDVHLSLGHIFSCMVKARIEKETV"
FT   gene            complement(146706..147683)
FT                   /locus_tag="DehaBAV1_0147"
FT   CDS_pept        complement(146706..147683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0147"
FT                   /product="GHMP kinase"
FT                   /note="PFAM: GHMP kinase; GHMP kinase, C terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16738"
FT                   /protein_id="ABQ16738.1"
FT                   /translation="MIISRTPFRISFAGGGTDLRAFYSLKAGEVVSTAINKYMYITVNK
FT                   RFDSTIRISYSSTEIVNTVEEICHPIVREALKLTGISGGIEIVSIADIPAGTGLGSSST
FT                   FTVGLLNALYAYQGKLLSAEELAKQACRIEIDCLKEPIGKQDQYIAAYGGMCHFRFEPD
FT                   EYVGVSPLPLKTELKANLSESLLLFYTGSSRQAGTILAEQQATTTRPDSFKNLTYLTEL
FT                   AVSCRECLLDHAVPKDIGAILHKGWLAKKNLSRGISNPYIDKCYQSALNAGAYGGKILG
FT                   AGGGGFLLVCAPPDRHTAIRKALSDLPQVDFEFEPEGSKIIYVL"
FT   gene            complement(147680..148390)
FT                   /locus_tag="DehaBAV1_0148"
FT   CDS_pept        complement(147680..148390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0148"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16739"
FT                   /protein_id="ABQ16739.1"
FT                   /translation="MQAVILCGGLATRLRPITENIPKCLLPMAGRPFLHHQFRLLKSQG
FT                   FDRAVLCIGHLGEMVKDSFMQGDEYGLKLVYSQETEKLLGTAGALKKAEEYLEDEFFVI
FT                   NGDTYLEMDYLHAWQTYTQSGRDALMAVYDNRNGRINARNDVALDENMLVRCYEKDSHL
FT                   PELKFVNAGALILKKSLFATLEEGKPYSLERAILPVLANTRRMLAYPVKQCFYDVGTVE
FT                   GIYTFCNYLENQTA"
FT   gene            complement(148393..149334)
FT                   /locus_tag="DehaBAV1_0149"
FT   CDS_pept        complement(148393..149334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0149"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16740"
FT                   /protein_id="ABQ16740.1"
FT                   /translation="MPEVLITGGCGFIGSHLADALLGQGFKVRVLDNLSNGSLENLKVC
FT                   DHGDELTVINGNLTNTNLLDSAVKGCEAVFHLAAHANVQNSARDTSIDLENNTLATHNL
FT                   LESMRKNGVGRLMFASSAAVYGESGLTVLDEDYGPLLPISLYGASKLAGEGLVSAYSHL
FT                   YGLKATMFRFANVVGSRRRNGVIYDFVNRLKKDPAALSVLGDGSQSKPYLHVSDCVAGI
FT                   LLGFEKSTKTLGLYNLGTPDSVSVRDIACMVASEMGLKNVCYSYEGGERGWRGDAPQVR
FT                   FDISRICSLGFKPRFSSLQAVKLAIKETLKEI"
FT   gene            complement(149327..150322)
FT                   /locus_tag="DehaBAV1_0150"
FT   CDS_pept        complement(149327..150322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0150"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16741"
FT                   /protein_id="ABQ16741.1"
FT                   /translation="MADPFISVVVSAYSMERYSDLLSLIDSLKSQSYTNFEVILVIEKS
FT                   GQLFSCLNRCLAQHPHNRNFKLFFNEGIPGLASARNLGVAKSQGEIMAFIDDDAAASPE
FT                   WLACIAQCFGGDKKIIGLTGPALPWWEHPGLSWFPSEFNWVISSMPCLPRSRGYIRNAW
FT                   GTNMAFRREAFEGGQGFNPELGAKGGGCHGKSELVGEDTEFCLRICRLSGLHILYAPEV
FT                   KVMHRVYKYRLKPGFIAKRAYWEGYTKAVFKYRLSKETNLNGVLSEERGLLKRIILHLL
FT                   PLSLLNLPLKPRQSALTILTTLNILGSAGWGYLRGAASARFIADKEAVNA"
FT   gene            complement(150315..151547)
FT                   /locus_tag="DehaBAV1_0151"
FT   CDS_pept        complement(150315..151547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0151"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   glycosyl transferase, family 2; Polynucleotide kinase 3
FT                   phosphatase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16742"
FT                   /protein_id="ABQ16742.1"
FT                   /translation="MEQKAIFIDRDGTIVEDVPYCNSPRRVRLLDGVGKAIKRLNDQRY
FT                   LVILITNQSGVARGYFSEETLGKIHNKLKEELDCFGARLDDIFYCPHHPGQGCTCRKPA
FT                   TGLIDMAVEKYGIDIGRSYFIGDRFIDIQAANRAGCQAVLVPYAPPETDYFKQEVAPDS
FT                   RPSFLAADFTTAVDWVLADAAGKASVSVVIPTLNEEKNIGCVLPRLRCVPGITEVILVD
FT                   GKSTDRTVEKALQLWPEIKVINQPGRGKGNAMRAGFEAATGDIVVTLDADGSLAPEELP
FT                   RYIGPLFEGYQMVKGSRFCRGGGTSDMPLFRRFGNFIFTKMANLVCGCHYTDLVYGYHA
FT                   FRRQILDSLCLRSDGFEIDTEMYIRAARIGLKVKEVPSYEARRLAGTGKLRSFHDGARI
FT                   LRTILRENFHG"
FT   gene            151751..152758
FT                   /locus_tag="DehaBAV1_0152"
FT   CDS_pept        151751..152758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0152"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16743"
FT                   /protein_id="ABQ16743.1"
FT                   /translation="MIKICLIGDFKVCPDRSIYKMAAQLADFLSKEKDILLLLCPREHF
FT                   TRPRSLNRIRRFQPDIIHLLGKPDAAELFRLKMAKLSAPRAKTVISAQQPVNTRTVRNM
FT                   LPYIKPDMAICLSQKSASFFREAGIETVILPNGVDMATFQPVSPEIKAELRRRYCLPHN
FT                   KLLLLHVGPIRAGRGVDLLRRMQNPDTQVIMAVSNPGIFNRTLLENLRKSGCMILTSFR
FT                   PNIADLYALADAYVYPMLLEEDANHQIFSSEMPLSVLEAMSANLPVITTPFGALPEVFP
FT                   AGEGLYYAHDDFEFLKAFQAYTQNPPANTRHKVAACAWPLIITSLKELYTKLLA"
FT   gene            complement(152771..153682)
FT                   /locus_tag="DehaBAV1_0153"
FT   CDS_pept        complement(152771..153682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0153"
FT                   /product="Protein of unknown function DUF1616"
FT                   /note="PFAM: Protein of unknown function DUF1616"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16744"
FT                   /protein_id="ABQ16744.1"
FT                   /translation="MNFLRRYDLYLVLLFIVLAVLAAEGGWVLPLRLLFGVPLVLIVPG
FT                   YALMSVLYPSRLSLSRSGRFMMGLGLSLSVSILAGLALNYTVGLEQASVLYALSGFSLV
FT                   FCLIAIGRRQHLPPNEKPGLILTPPDTKRHLPPNTSQIFLNVILSVCLLGVGGVAAKQL
FT                   LQVYSPSEFTRFYLLGLNDTAENFPSLFILNGEQVAGVKYGNQPAVVAVSARFKLVISN
FT                   SGQSEMVYQVEALLNGQNYRFSLKEGGEFDGLVKVPVDTIKSLELYFAPFEAGDNQVLE
FT                   IWLYAGETAVFTKPLKIVFSTV"
FT   sig_peptide     complement(153614..153682)
FT                   /locus_tag="DehaBAV1_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.904 at
FT                   residue 23"
FT   gene            complement(153774..154277)
FT                   /locus_tag="DehaBAV1_0154"
FT   CDS_pept        complement(153774..154277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0154"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16745"
FT                   /protein_id="ABQ16745.1"
FT                   /translation="MSSKLPEPSEGPVLFQARLKNEAEASGYHLNPDGSFVKMLAEGLL
FT                   ANRQRYGYPSCPCRLAKGDKKADLDIICPCDYRDADLSEFGSCYCALYVNSHIAKGEKK
FT                   AQAVPERRHLPETRPETKPAEAPSGLAYPVWRCRVCGYLCGRDEAPDECPICKADKERF
FT                   ERFM"
FT   gene            complement(154274..154549)
FT                   /locus_tag="DehaBAV1_0155"
FT   CDS_pept        complement(154274..154549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0155"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; Glutathione S-transferase,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16746"
FT                   /protein_id="ABQ16746.1"
FT                   /translation="MEKIIGRNAGKIKLYALSTCGWCRLTRQLLAELGVAYEFEYVDLL
FT                   TGAEREKAVKELTALNPSSSFPTMVIGENRVIIGYKESEIREALKA"
FT   gene            complement(154740..155126)
FT                   /locus_tag="DehaBAV1_0156"
FT   CDS_pept        complement(154740..155126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16747"
FT                   /protein_id="ABQ16747.1"
FT                   /translation="MNIRVIVIGFQSRFFGVCDAASVTERNVVSMQMLLNQDIINKCVC
FT                   HKCPVQNQSECVHTQMAELKNSLKETPLDPHKIPKAYCVNGKSLCKGIDHSKPCICGSC
FT                   DVYAKYHLSEGEPGGFYCFEGKSV"
FT   gene            complement(155284..155814)
FT                   /locus_tag="DehaBAV1_0157"
FT   CDS_pept        complement(155284..155814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0157"
FT                   /product="protein of unknown function UPF0157"
FT                   /note="PFAM: protein of unknown function UPF0157"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16748"
FT                   /protein_id="ABQ16748.1"
FT                   /translation="MVRRVTVEEYNPCWAEQYDAEAVRLQALLADNLLEIHHIGSTAVP
FT                   GLSAKPIIDIMPVVKDISAIDRLQKTFERAGYLYLGEYGISGRRFLVRGTDKIRFAHVH
FT                   IFGVSSSDIERHLAFRDYLRCHAAEAAEYSCIKKALALKFPEDIEAYINDKSGFVRDLE
FT                   TKALKWFRANLQT"
FT   gene            complement(155818..157125)
FT                   /locus_tag="DehaBAV1_0158"
FT   CDS_pept        complement(155818..157125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0158"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16749"
FT                   /protein_id="ABQ16749.1"
FT                   /translation="MTVKEIVVIGAGAGGLVAAGRAAECGGKVILLEKSEQPGKKMLIS
FT                   GQGRCNISNSRDMAEFITAFGPNGRFLYSAFSRFFRQELVELLARYGVETKTERGGRLF
FT                   PDSDKAGDVVGALMKYASAATLIAGQKVSQILVNDGQVVGVKTEKETFRADAAVIATGG
FT                   ASYPGTGSSGDGFRMAEALGHTIVKLRPALVPLVVKEIALVQSMQGVALKNIRLTSYRC
FT                   EADKIPLDLILQDWGRGITGKKPPKAVIESRMGELMITHFGLGGPLTMLMGLPVAEALE
FT                   QGAVSVAIDLKPALSLDKLRLRLQRDFDTFGKRSFQNLLSELLPQKMIRPFVDLTGIDP
FT                   FKCGGQITASEREVILANLKCLRFNITSTLPLTSAVVTAGGVNLKEIDPRTMESKLIKG
FT                   LYFCGEVMDIDADTGGYNLQAAFSSGYLAGESAAGA"
FT   gene            157300..159741
FT                   /locus_tag="DehaBAV1_0159"
FT   CDS_pept        157300..159741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0159"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16750"
FT                   /db_xref="GOA:A5FP73"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FP73"
FT                   /protein_id="ABQ16750.1"
FT                   /translation="MAEKYNPQETEKKWQDKWAADRLYHASEDSPKPKWYSLTMFPYTS
FT                   GNLHIGHWYAEVPADCFARYKRLRGFNVMRPVGFDSFGLPAENAAIKHNIHPRIWTLNN
FT                   VENMRRQLKTIGAMFDWDREVITCLPEYYKWTQWFFLKLYEAGLAYRAKAPVNWCPSCQ
FT                   AVLANEQVVDGTCWRCETPTTRRDLEQWFFRITNYADELKDHEGLDWPEKITAMQRNWV
FT                   GKSYGAEVSFALDCPTAFEKEIKVFTTRPDTIYGVTFMVLAPEHPLVEKITTPENKAAV
FT                   DAYIKKSRTCTEIERLSTEREKDGVFTGTYVTNRVNGQKVPVWIGDYVLQSYGTGAVMG
FT                   VPAHDERDFVFAQKYHLPVITVIAPSAYDGKPLEAAYINEGVMLNSGPFNGTPNTEGKE
FT                   KVCDYLAEHGWGKKTVNYKLRDWLISRQRYWGAPIPMVYCEKCGIVPVPEKDLPVLLPE
FT                   DVGFRSGGESPLKYNEGFVNTICPVCGGKAKRETDTMDTFMCSSWYFLRYTSPGYDKGP
FT                   FDPVKLKYWMPVDLYTGGAEHAVMHLFYSRFFTKALRDMGIIDFGEPFKKLFNQGIIVS
FT                   NHQKMSKSKGNVVTPDNLVAEVGTDAVRAYLMFVGPWDQGGEWNDSGLSGMSRWLNRVW
FT                   NLFTEEYTPQTASAEAERELKRTLHQTIKKITMDIERLRFNTVVAALMELSNSLAKLKE
FT                   TAAISAENWQNTLQTFALMLAPVAPHIAEELWANLGMKYSIHNQNWPTWDEELAKDEVI
FT                   TLIIQVNGKLRERLEMPAGISEAEAKETALNSERVKPHLLGKTPVTVIYVPGKLVNIVV
FT                   K"
FT   gene            159743..160546
FT                   /locus_tag="DehaBAV1_0160"
FT   CDS_pept        159743..160546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0160"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="TIGRFAM: pyrroline-5-carboxylate reductase; PFAM:
FT                   NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16751"
FT                   /protein_id="ABQ16751.1"
FT                   /translation="MNIAFIGGGNMGEAILGALIQKNICPPQNITVSEIKAERRTYLET
FT                   SYGIKTTASNPDAIKSAEVVLLAIKPQNLPELSAELKGKLADKQLVISIIAGATLSKLS
FT                   GGLAHKAVVRVMPNTPAMIGMGMSVWTALPSVSPAQKDQAKAILSAMGKEIYTGKETML
FT                   DAATAISGSGPAYFFLFMEGLEKAALEMGFTPEEASILVSQTAAGSAIYAGKSGFALTQ
FT                   LRKNVTSPGGTTAEAIKAFEEAGLEATIIKAAKAAFNRSVELGKG"
FT   gene            160640..161128
FT                   /locus_tag="DehaBAV1_0161"
FT   CDS_pept        160640..161128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0161"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16752"
FT                   /protein_id="ABQ16752.1"
FT                   /translation="MNWLDIVLLISLGIQTVSGFFTGLIRNFLHLVGLIIGIILAGRFY
FT                   PTVAEWLSFISSPEWANIVAFLLILMTIWVATTLIAKLLDTMIKPTFLNWVNRLGGAIF
FT                   GLLVSGIFTAALLAIWVKFFDSGSVITDSAVAQILLDKFPLILSLLPDEFGVIQDFFN"
FT   gene            complement(161239..161493)
FT                   /locus_tag="DehaBAV1_0162"
FT   CDS_pept        complement(161239..161493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0162"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16753"
FT                   /protein_id="ABQ16753.1"
FT                   /translation="MSFKITDDCISCGACEPECPNKAISEGETIYIIDPEKCSECVGAF
FT                   DTPQCVEICPVDSCVKCCNESNDELLAKWQKQHPGESPK"
FT   gene            complement(161582..162061)
FT                   /locus_tag="DehaBAV1_0163"
FT   CDS_pept        complement(161582..162061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0163"
FT                   /product="Phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="TIGRFAM: pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16754"
FT                   /db_xref="GOA:A5FSN4"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSN4"
FT                   /protein_id="ABQ16754.1"
FT                   /translation="MIAIYPGRFDPVTLGHLSVARRASGFCDRLIIAVFDNPAKPGLFT
FT                   AAERVDFIKQSIKDLPNVEVRSFSGLMVNFARKMGASLIIRGLRVGADFEREMEMYVMN
FT                   RRLDEGIELCCLFSEPQYQYLSASLIKEIVILGGDSSGLISEHVAVALKNKLASV"
FT   gene            complement(162033..162611)
FT                   /locus_tag="DehaBAV1_0164"
FT   CDS_pept        complement(162033..162611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0164"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM: conserved
FT                   hypothetical protein 95"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16755"
FT                   /protein_id="ABQ16755.1"
FT                   /translation="MRIIAGDAKGKNIIVPQRKATRPATELVRGAMMSMLEAVAEDWSE
FT                   VLDIYSGSGSLGLEALSRGAGHVDFVEHERCCCDIIKQNLETIGCASHAHVYCLDVPKA
FT                   MAFLKKQYDVILADPPYRNQQIGEVLEKLGNSGLIGENTVMAVTHSAHLTLAECYGRLK
FT                   MLKEHRHGDSLITIYRKDSSFDSHLPGPV"
FT   gene            162990..165971
FT                   /locus_tag="DehaBAV1_0165"
FT   CDS_pept        162990..165971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0165"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16756"
FT                   /protein_id="ABQ16756.1"
FT                   /translation="MRSQFSRRDFLKISGGTAGLFATAGLFRGPIKGVEPKMVDTRPRW
FT                   VKETTTICPFDASGCGFICYTDSAGNLTNMEGDPDNPVNRGSACSKGASLIQLHNNKHR
FT                   LEKVLYRAAGANDWEEKSWDWAFGEIAKKVKASRDSGFVAKNAAGKTVNRTEAIASLGG
FT                   ATLDNEECYLLSKMLRALGIVYLDSQARLSTASSLEALAASFGRNAMTNSWTDVSNANV
FT                   ILDMGGNPAENYPACFSHLGEAMGKGAELISVDCRLTRTAAKAGTFVAARSGSEIAFIG
FT                   GLIKYVISDIEAHPANYNLTYITEYTTASMVVNSNFKGPADLDGMFVGYNTASHSYDQS
FT                   NWNFTKASNGEPVIDKTLTNPNCVFQLLKKQYARYTPEMVSATCGCSQADFAKVCASFA
FT                   ATGKADKAGAIVYAMSSTQHTSGAQTVRAYAVLQMLLANIGVSGGGLFALGGESNVQGA
FT                   ADNGVSWNKLPGYLSAPNEDDTTFAAYASKAGDQSAASLLKAWYGSNASSSNGFGFGFL
FT                   PKTDNNTNYSYINAIKQMAAGKIKGAFAWGANPVVESAAAGQATQALAKLDWLVVTDMF
FT                   ESETAAFWKKDGVTSQTEVFLLPTACSYEKEGSVTNADRWIQWRNKAVSASGEAKSELE
FT                   VISSLLSRLQTLYQGESGLNAEAITKLSWTYSTNPSAADVAKEMNGYKISSLQQLESPE
FT                   DLRADGTVACGNSLYIGSFTNAGNQMARREQTGAFHAGWAWSWPMNTRIMNNRASVDLS
FT                   GKPFNAAKPVISWNGISWTGDNVDGKNAPFNQSGGLPFKGTNGNTAQLFAAMADGPMPE
FT                   HYEPWESPVDNALSGTQNNPTAMVFEGDTQGSAGEYPVICTTIRTVEHSLGGQLTRNMP
FT                   FLVELAPAAYVEISEQLASEKGIKAGDIVKLTSARGSVSVAAAVTKRLKPFSIGGKTVH
FT                   QVAIPNHWGFMGIAQGDSANVLAPNTADSNSSTPEFKAFLVKVEKAADGTVPTITGRYK
FT                   VLED"
FT   gene            166059..167270
FT                   /locus_tag="DehaBAV1_0166"
FT   CDS_pept        166059..167270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0166"
FT                   /product="Polysulphide reductase, NrfD"
FT                   /note="PFAM: Polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16757"
FT                   /protein_id="ABQ16757.1"
FT                   /translation="MFSAIKGWVNKLEQTGNPNVPLFGKWGLLQIILGLGALTVAALKL
FT                   AYGLGPITNLSDNWPWGLWVAFDVGAYIASAAGGFTMAAIVYIFGYEKFRPLVRPAILI
FT                   GALCYTIGAIGIMIDLARSIRIVHPIWMWNHESIMFEVGWCVMMYLTVLYLEFSNNIFE
FT                   RIGWKKLGNLQHAFIIPLVIFGIMLSFLHQSSLGALFLINPAQQPLWHGPLMGHLFLVS
FT                   AMALGLSVLTYFSVILSRSWKMTLRMDILSKLGLIIAWIMLVYLAARGVDYAITGNLAT
FT                   GLNGDWYTVLWVAEVGIGMLLPMILLFIKKIRSSRSGLLWSTGLMIMGVVLNRINTLVI
FT                   SQAPNREGSYFPHILEFVFTFGLIAGAMYVFRLCAKYLPLYTDHMKGLTPEQVKKAPAV
FT                   IPAD"
FT   gene            167271..168119
FT                   /locus_tag="DehaBAV1_0167"
FT   CDS_pept        167271..168119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0167"
FT                   /product="Uncharacterized protein involved in formate
FT                   dehydrogenase formation-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16758"
FT                   /protein_id="ABQ16758.1"
FT                   /translation="MNTNRLERINSEIERYRAAQPELETILALYQKVFDIQESASSQEE
FT                   PAPLISDEDAIAKLAAGEYILKDIPFEPSAELFHQTGLKLGRAFTQTAGEKFPTPALLK
FT                   LIESHPGGLSGFITAMLSDNLDYLAKFTQNTSFNPETLLFFVTNLVSPFLTAQAKYYQP
FT                   QVDLLGWDKNTCPFCGSSPRYSCLAKDNGARRLFCSLCHTQWNYRRIKCAYCSNANAEK
FT                   LRHFYSAIFPYQRVDVCEKCKTYIKTTDERRLGRECLPEVEDAVSIHLDSIAQNEGYQP
FT                   G"
FT   gene            complement(168301..169266)
FT                   /locus_tag="DehaBAV1_0168"
FT   CDS_pept        complement(168301..169266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0168"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16759"
FT                   /protein_id="ABQ16759.1"
FT                   /translation="MSLTVLWVIFAVMVLCMMALDLGVFHRRAHEVKTKEALVWSGVWI
FT                   ALALIFGGLVYSSLGSETGLNYLSGYIIELSLSVDNLFVFIMIFSYFCIKREYQHKVLF
FT                   WGILGAIIMRAVFIAAGITLIENLSWVLYIFGVFLIYTGIKMVKDQNKEIHPDKNPLVN
FT                   FVCRILPMTNKLHGDHFFIKENGRKLATPLILVLVSIEAMDLVFAVDSIPAVMAITLDP
FT                   FIIFTSNIFAVMGLRAMYMALSGVIQKLHYLHYGLAAILAFLGIKMLISDFFHMPVTAS
FT                   LGVVAVILAISIAASLLKPPKEIKPVEVPHPACPVDEGDK"
FT   gene            complement(169433..171118)
FT                   /locus_tag="DehaBAV1_0169"
FT   CDS_pept        complement(169433..171118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0169"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16760"
FT                   /protein_id="ABQ16760.1"
FT                   /translation="MSFESFNFDPAVMAGVRACGYKEPTPIQAQAIPPIMAGHDVIGLA
FT                   QTGTGKTAAYALPIIQKMLSTPRGRVRTLVIAPTRELACQISDSFRSLGQRARIRECSI
FT                   YGGVNMDQQIRRLRSGVDVVVACPGRLLDHIWRGTIDVCGVETLIIDEADRMFDMGFQP
FT                   DIQSILKCLVQPHQTLLFSATMPPEVRKLTLETQTNPVTVQVGTQSPVSSVSHSVYPVK
FT                   SHQKTPLLLEILKTVETKSVLIFARTKYGAENLADEISKAGFTTASLQGNLSQNRRHAV
FT                   MEGFRRGNFKILVATDIAARGLDIDHISHVINYDMPDSPEDYTHRIGRTGRFDRTGQAF
FT                   SLVTGRDGDMVRDIQRLLSSPIQRLRVDGFDYATTRNDGQNQSQRRDFAPRRGYSHGGY
FT                   NRPEMAVNETSQTDTPSEMPVSPARPFNPGFRPSRPANSAPRFHREGNFAPRMQSHSSF
FT                   EGTSAPAARPAARYNDRPAFRKENSFQTTEASRPSFRKETGFTPREHTQADFENSEQPS
FT                   GRRPARFNGKASFADRPARSGNKVGKPPFFRRSKPAVSEKNETY"
FT   gene            171591..172550
FT                   /locus_tag="DehaBAV1_0170"
FT   CDS_pept        171591..172550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0170"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16761"
FT                   /protein_id="ABQ16761.1"
FT                   /translation="MMKGILPIECKYCGSRHTRRYGHSRAQKQRWLCNDCCHTFVETSA
FT                   QPGMRTPPEQIGAAVSMFYEGLSLSAICRQMKQIHNISPSDGTVYGWITKYSKEAIARA
FT                   KDIKPKVGDVWLCDETVLKIAGKNIWFYDIIDMKTRFLLASHLSDKRYLGDARTVLHRA
FT                   GIKAGKSPKVVITDSLNSYPQAIGDVFGADVRHIKYKGITKSPNNNILERFHGTLKART
FT                   KVMRGLKSMETARLFTDGWLVFYNFMRPHESLDNQTPAHRAKVQLLNQTWHEVVKTSEF
FT                   KAEPVKWLEKPPSFLKQSIPSSVKRAIGLGNKLPRGLR"
FT   gene            172547..172819
FT                   /locus_tag="DehaBAV1_0171"
FT   CDS_pept        172547..172819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16762"
FT                   /protein_id="ABQ16762.1"
FT                   /translation="MIKITLKEYYFSVFSCEIGSFLAIKLFIDEDDLIPKIALIILALL
FT                   SISAFVMLIRKGGINKRQYNHGERKETKYPEPDAINGKFRNNKEE"
FT   gene            complement(173038..173325)
FT                   /locus_tag="DehaBAV1_0172"
FT   CDS_pept        complement(173038..173325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16763"
FT                   /protein_id="ABQ16763.1"
FT                   /translation="MTGIVFLFGLLIGILGTWLWYTAKERSIKLAWVDYLLIAIFVLMA
FT                   GGGIWFVNTFTEESVASAARSSGLIFGLLALLVLGVTWQLIRRRNHKSGI"
FT   gene            complement(173374..174741)
FT                   /locus_tag="DehaBAV1_0173"
FT   CDS_pept        complement(173374..174741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0173"
FT                   /product="reductive dehalogenase"
FT                   /note="TIGRFAM: reductive dehalogenase; PFAM: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16764"
FT                   /protein_id="ABQ16764.1"
FT                   /translation="MDEKINRRDFVKGAGLASAATVATLMATASTVSAEELVNPGGKAM
FT                   DEMGNASIKRDLPESFYKRIENKAGYIGTTRVVAPTQRLDAREHGFSQIVRRGSTGDWS
FT                   GEPGDWGPILLAAVQEKKKHAAEISPLEAADYTWSNAFQIAMDRWHITLEPGRYQQAPI
FT                   AATKVELSPEEMTARIKKICRWFGCEQVGICEVTEDMKPFFYSVGRTRGTYTTGHANYV
FT                   DNGREIPWPYPYKYCIVMADKCDTDTLNALTGPLVEASAKIACSQSDFAPHYLESIIRS
FT                   LGHDAKANIFSDTDIMDTPFAVKAGLGELGRSGLVISPWGAQMRIMEVFTNLPLVPDKP
FT                   IDFGLQEFCKVCKKCADNCPASAISMDDEPSEVDTVVKSIRWFQDGKKCLAQRLAYGCS
FT                   KCQGVCPWSKPDTLIHEVGRMVGQNPAFAPFLVKLDDFFYNRYPEGHATGEWAPWR"
FT   sig_peptide     complement(174637..174741)
FT                   /locus_tag="DehaBAV1_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 35"
FT   gene            174984..175583
FT                   /locus_tag="DehaBAV1_0174"
FT   CDS_pept        174984..175583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16765"
FT                   /protein_id="ABQ16765.1"
FT                   /translation="MVHQNLLSETSMITRTQSAELEKAISGILPSETAKLIDLVDQMFD
FT                   DYIRGAIHHNEIRRLIGIIQNKAGKAQTMPRSCAPIAIFNPISFIPPGITLLEAYLKLN
FT                   GFVPVVLGLDEQTIKKMAGQIHPTVVVSLTLFHHIDKLAKLKPCFEAAGLNVLAGGVPF
FT                   MYQNQNKDKLSFCSFPDSFKQIVCKLSEDLLNENRK"
FT   gene            175567..177360
FT                   /locus_tag="DehaBAV1_0175"
FT   CDS_pept        175567..177360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0175"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16766"
FT                   /protein_id="ABQ16766.1"
FT                   /translation="MKTENNKVGVVTCVSMSNFVKNWALHRNLDARIYPITNSCFYSVK
FT                   IEMLSYYIERAILENGYCILNYGMCNESITQLKNHYAGRLSVVELDNCYEAAIGTAIYH
FT                   ERIEQGHIFRNPTTMSCWHNMPTLEVMQPVEAGIYPAPITFILENGEEEKAASYVNNLK
FT                   NTTILDYSVEILHPQPHFLEDKLDQAYAQIQLASDEEDETSHQLIFPFSFHNSDEYLYI
FT                   LDKHDNVIFSPYVAPATPNQICEKLLQLILSRQPDRSFQVKGLDSLLKQRGLYLDKCKR
FT                   FANRSSLTTEYEIIQNGESTWIKEILWVSYDDNCSISNICGRMEDITKVKTSEKSIAES
FT                   YTKECLLRQALQDETKKRQAHLKALVHEIRTPLTPLLAASDALVNVSEKGTELYNLASS
FT                   IREGAETLNSRIHDLIELERGKIGMLKLKMAGYSIEDIMEELQLRYMPIFLKQHKSLVF
FT                   CDETANSEIYCDKERLLQILTNLIDNALKYTKPEDSVSVATRLDNESLRFTVSDSGAGV
FT                   PACLIPDLFTEYGKLSGGHNLSGLGLGLPIAKLYVEAHGGNIIYSPREPKGSEFSFTIP
FT                   VKTVSRNERDNIRIANEYFNS"
FT   gene            177341..178021
FT                   /locus_tag="DehaBAV1_0176"
FT   CDS_pept        177341..178021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0176"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16767"
FT                   /protein_id="ABQ16767.1"
FT                   /translation="MNILIVEDNDAAASTISSILKLSYHDAKITICRTGYEALESINSD
FT                   KADLVMLDLGLPDMNGLKVLDEIRPITGAPIIVVTACEEEENVLKALEQGADEYIIKPF
FT                   RHLEFLARVKKALSKNISPNTAIIKFGDLTIDCAKHELTFRNDRVLLTRVETMIMSLLL
FT                   QRGGQIVDYRDISDTLWGHAYPGSDESIRVYVSRLRIKMEKNLKTGGIIKNEAGIGYRL
FT                   SFAE"
FT   gene            complement(178952..179650)
FT                   /locus_tag="DehaBAV1_0177"
FT   CDS_pept        complement(178952..179650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16768"
FT                   /protein_id="ABQ16768.1"
FT                   /translation="MGAFSINGTSLVTSSTGTSLGSTKYYPYGLTRSGSIPTDEKFTGQ
FT                   KLDDTGLYYYNARYYDPTIGRFISPDTLVQNIHNPQCLNRYSYVLNNPLKYIDPSGHRM
FT                   VIPGNPPQNGIPFPGPEDPGGSSGNGSSDDSDDSDSNSGSFFETDGDNTAPPRMNAVDA
FT                   IVGTTILAAGAMMAVTGAIVFLAVFIPGGALAAPEVGLGFWTIGGLLISEGVKRLFHIE
FT                   YFYIPGLIGP"
FT   gene            complement(179904..181679)
FT                   /locus_tag="DehaBAV1_0178"
FT   CDS_pept        complement(179904..181679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16769"
FT                   /protein_id="ABQ16769.1"
FT                   /translation="MNKILDALNKVLSQFDQETKTISERDVPKAIRSIGDSADPSDIPM
FT                   QFTAEAMAFDFCEDYHDQVTGWGTYYGPMMVFNNGDGTATEAPSITRITEEIISYWSDR
FT                   SKTAKHPILRTRYADLVWDFQKRITGQAPHYSMAQIVIDSTIEIAQRNCHSVKVDVIKR
FT                   LERALSIAIALNDDDRLQRVADATIAYEDAVTDDSKPGLWGFAWDMLFDNDKVKLTADQ
FT                   RQKLIGDLEGHLQRASNTTDEGDIDPWLVEAAALRLAKYYRKTGRGEDTKRVIIAIGEA
FT                   FGQASSKGSGLQASAWLQRVHSTFKEFGLTDEAEKVAIQLREVGEKAKSELKSFSYTME
FT                   VPKEKLEQYIAALTEGELDVALKRITAHFIPKKSEVEKQLKELASKAPVAFLIPHELQD
FT                   DMGRPLAKVGSLEEDLLGHTVKQMSQNMGIESIFLRQALEALVKKYPAFENLCLDYLFR
FT                   SPIFKDDRKPIIQQGLKEYIDGHHMEAVHLLIPQIENALRVLVETAGGSILKPARGGGF
FT                   HLKVLDDLLREPIVTQVFGEDMVFYFCTLLVDQRGWNLRNCVCHGLCDASEFGPRMSDR
FT                   IMHVLLCLALVRKKE"
FT   gene            complement(181715..182533)
FT                   /locus_tag="DehaBAV1_0179"
FT   CDS_pept        complement(181715..182533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16770"
FT                   /protein_id="ABQ16770.1"
FT                   /translation="MDWNFLTGLGTLILAIATILYVTQSRLQTQVLMKQVNLQIGQQIP
FT                   RLFIRQVTFEANSLKMEIQNAGSTPAYWVGLETRFFVIGQRLYSDQHSDNEINWGEAVK
FT                   LHEQGNTIYSKYFWTGPTKLRFENKEVDADTAVSFLSPQGVSVYFPPNSVVLTETRPMF
FT                   LVSWKGDQGLPASKGFEYNEFREFLLSNNIRAVAVVMSLMCKDAGETVHGQGYVASFVV
FT                   RTDLDHSLVESSKNSHRFDFIPLSHEEQLSGNSWTRYDDYRNTFSNWHVF"
FT   gene            complement(182628..183593)
FT                   /locus_tag="DehaBAV1_0180"
FT   CDS_pept        complement(182628..183593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16771"
FT                   /protein_id="ABQ16771.1"
FT                   /translation="MTTSFKNVLILRTLISLCKNDRKLPHVFYDLGYTQIRIDKTIRLP
FT                   DNKTVEPDLIMSSRQQNHSIVWESKSGRNIENDQARKLAQVTENIFTEQLLFNLRTDGS
FT                   FVFDVAYACDDGQCQNIRIDLNRLSNGHSTVGEFPIVGFSQDRVIKHSGQFKHSTIESV
FT                   FNAGISVDLNEIPVAYLPFDKDCSLSEIAPFVIRSLVSYVTSQEGNFSSEQIAKESYGS
FT                   GWEYIASNRTKNELVHKVEEILVEGTRNELRGYLSKTGRGKTRSPKWRLSYANVKGGAY
FT                   PAGRLKKLQRRCKEFVNRLRIEESGVKQLRLPLFLEDEPI"
FT   gene            complement(183577..184734)
FT                   /locus_tag="DehaBAV1_0181"
FT   CDS_pept        complement(183577..184734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16772"
FT                   /protein_id="ABQ16772.1"
FT                   /translation="MIKAELRRTRLDMASYLQEKMRTGYERYLDEQKLEWEGGLLKTYL
FT                   VEADVITRPSDSHNQIFSFLQKQTAALNYTAEQLDEENFFALIARSRVSRQAKSDIFYI
FT                   DASDYRFWITYSIGHSSRTDRFIDKFVSHSPKLDNAWFPMQFLSKLADTKGIFTGLGGR
FT                   FNNSPFTKDEEEQLRISLKLWGNLAKDVFDAFQKSDMLKRAFSLSNVRLKRYLQNTDES
FT                   VTDDINYSGKITSMGQSFDSHLDLVNSIYREEYRNTLVGIIEKELAIGFDTDSSGGFLK
FT                   GEPIFVSFQKTIPNVEKFVKDLFSGTSPFRLWGLQEMVKKDFARIYAVDMHLGRPLTFE
FT                   VFPDTIRIFLHSGTCGNSIIRFFTLFQHHYDSSAELSGGKHDHLF"
FT   gene            complement(184727..187846)
FT                   /locus_tag="DehaBAV1_0182"
FT   CDS_pept        complement(184727..187846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16773"
FT                   /protein_id="ABQ16773.1"
FT                   /translation="MNEERLSRLIEEFTSKNLNLFFRGKCENFAETPEDLRRYDDDRFS
FT                   DFQKLGEIRFDSDDKLVITSSLASGDLSERSGKKAQYEKAKKILKELAVYDAGFFIFYD
FT                   RSGSFRFSLVYAQFQGTKRSFSNFRRFTYFVSKDQTNKTFRIRVGGCTFSSLEAVMDAF
FT                   SVEKVNKEFYNHIARFFYRLTGYDRKREMTLPSVSDDDKETYQEFAVRLIGRAIFCWFL
FT                   KHKKSTNGVSLIPESMLSSESVKQNEQYYHSTLEKLFFEVLNTPLEQRHKNILPDADKI
FT                   PFLNGGLFEPHTNDFYSGKPLYNLVIPDQWFEEFFEILEQYNFTIDENSTVDADVSVDP
FT                   EMLGRIFENLLAEVNPDTGETARKATGSYYTPRIIVDYMVDQSLKQYLLSKTKIDEDRI
FT                   TALLSYEAPESALNEREKASIISALDEIKIIDPACGSGAFPMGILHKMILVLQKADPDL
FT                   KLWLKNHLGNIEPGIFKDRLIERIRNENWEYVRKLLIIQKSIYGVDIQTIAVEISKLRF
FT                   FLSLIVDEQIDDLKSNRGVEALPNLEFKFVAADSLIGLPPVMNRQVGLGIVNEEVVRLK
FT                   ELRSKYLRSYGTEKKQIERDFLETRGKLIEQNINWGNKDALALQLVNWNPFTNEASEWF
FT                   DPDWMFGEDRFDIVIANPPWGVDLSKETKLLLKERIPEIDSSTPNSFAYFVGMANRISK
FT                   LNVAFILPDSILIKDYAKTRKLIAPKLLSLDWYQNTSVPENFRPFIYVEHDVCVIIFNN
FT                   ENKEDIRCCKHEYDSQAKSVVHNEWAAQKSEMIFPEYDYVFNLMLEEKDRLIHEKLLKY
FT                   KTIDSFAQCHEGIHTGNSRDILFVKGRKNGYCKPLFYGGRAGDFIANYVSKTSGWYVDY
FT                   REELIDKDRGYYASLRDENIFKYPKIYITRTGNPFKCFYDENTYASNNFFSLQFKTKSE
FT                   NTKENLLVLLAIINSKLTQYFIRTFPAPRLGDTYIETKIIHLLKVRAPNMSKELKDDFL
FT                   PLIYQILAKRESNIEADISILETKINHMVYELYGLTPEEKAVVEGRAQDD"
FT   gene            complement(187849..191217)
FT                   /locus_tag="DehaBAV1_0183"
FT   CDS_pept        complement(187849..191217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0183"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16774"
FT                   /protein_id="ABQ16774.1"
FT                   /translation="MSTDTTFITNEGNKKLKDRIAELIAHSKELKFLVGFFYFSGIREL
FT                   YTSLKNNPNIQLDVLVGLNVDKTVHGLTEYGDTTKGLTDKEKFEQFLGSISKSINSDDF
FT                   DNQVFYDQARFFLEAIKQDKLRIRKTYDPNHAKLYIFKLKDELATIKKAFFITGSSNLT
FT                   KAGLSHQNEFNVEISDYGAKEAEDYFDELWEEAVKVTEIASFKDRLINLLEKKTLLTEV
FT                   TPYEAFALVLKTYIELQEQKQIKQSLVDLLKKKGYRAYKYQTDAVAQAISILDQYKGVI
FT                   VADVVGLGKSIIAGLIAKSLGKRGIILCPPGLIGDDNAASGWRKYREDFALHDWEIRSS
FT                   GLENLKKALDLVRSNPEYEVVIIDEVHRFRNQDTEAYEVLSNICRDKLVIMLTATPFNN
FT                   TPADILSLLKLFIVPGKSNITLANDLTARFRSYTQTFRRLSNIRKNCNSPSLPKRNQAI
FT                   ADYEVMFGANKIDLNNVRDRTRYLSKSIRNVISQVTIRRNRIDLRKDPEYSKEIYELSD
FT                   VQDPCEIFYELTPEQSEFYDRVLQDYFGERGQFTGAIYQPFLYETGQLEPDEETLNQAE
FT                   NRESLIQRNLYDFMRRLLVKRFESSFGSFRQSIINFKSVTEKVQTFIENSNGKYILDRP
FT                   LLEKIYEADIDEIEEELAGFEQRISEGTFPKTEKVYKVNDFISKDKFNTDIQSDIDLFD
FT                   QILDELDSLKLVNKDPKLKKLATEVKNILKKKDNPEEPERKIVIFTEYIDTARYLEAYL
FT                   EKEFPSCCITVKGDLNKTKSDEVLRNFDTTHKKPEDSYKILITTDKMSEGFNLNRAGAV
FT                   INYDIPWNPTRVIQRVGRINRISKRVFKNLYIYNFFPTLQGATYVKSREIATEKMFLIH
FT                   NTLGEDAKIFEPDEEPSASQLFKRIMENPDNMEEESFQTKIRQLYADIVVSSPEVIKRI
FT                   SELPPRIKVAKNFNENNLVLFIKKGLGLFTRGILSDDKKPQDLVFENTLELIECKKEEK
FT                   AIPFSDSFWDSYYNVKEFKETSGPPSSEISIEKKALNNVNTLLQGKIPELESYLPFLRE
FT                   LREDILEYKTLSDYTLRRIANLNSLNKDNAKIQKTKDELEKLQQELGADYLDKVKSKLG
FT                   QLQTEVIIAIENVKE"
FT   gene            complement(191300..191470)
FT                   /pseudo
FT                   /locus_tag="DehaBAV1_0184"
FT   gene            complement(191603..192088)
FT                   /locus_tag="DehaBAV1_0185"
FT   CDS_pept        complement(191603..192088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16775"
FT                   /protein_id="ABQ16775.1"
FT                   /translation="MSKNINTMIDDLVGTLTDPIIVYPGGWGDSLPEWLKNAITLERLT
FT                   ENMKGSKGEQPSGTDAEACAYLNTASLTMPMDSDWSQIYLYVAGKTYTRWRKGEMPKDI
FT                   RVDSLNNQQMADLNRLKEWLYCRRTTAKQELERAERRQQKEEEVAKRESEQPALFEF"
FT   gene            complement(192130..192447)
FT                   /locus_tag="DehaBAV1_0186"
FT   CDS_pept        complement(192130..192447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16776"
FT                   /protein_id="ABQ16776.1"
FT                   /translation="MNSLFVINAAFNTGQIVATRGVFDLACENPEFAQFIQKSLNRHVK
FT                   GDWGDVDDEDKQTNDQALKQGTRLLSAYNDERFPKNGVATIWIITEADRSATTILFPDE
FT                   Y"
FT   gene            complement(192501..192983)
FT                   /locus_tag="DehaBAV1_0187"
FT   CDS_pept        complement(192501..192983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16777"
FT                   /protein_id="ABQ16777.1"
FT                   /translation="MATGQMDLFDGVKLAEPEPTTTVRLGRKAAQIPLRKKRREAIKRL
FT                   MEILEELEGKDIYIGSYDAGGRHFWLDNLKLPRLQMEWHPMRLKSDQTYIPSVIVLWGS
FT                   KSAAVRIFTDYLVAVREQEYQGYWHYLLDFRNGFWQSPIDNFRSHYSCLHITRFKD"
FT   gene            complement(193972..195231)
FT                   /locus_tag="DehaBAV1_0188"
FT   CDS_pept        complement(193972..195231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0188"
FT                   /product="DNA polymerase III beta subunit family protein"
FT                   /note="PFAM: DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16778"
FT                   /protein_id="ABQ16778.1"
FT                   /translation="MNIEGKRSGEGFCAHKTILVNALSRALAERVVLMDFTIGRKGFLT
FT                   YIKSLGGSNVVKVVPSSNGDASGLRVADKRLKVVCGANTSYLDDMAWVGEKTPLTLCDV
FT                   RVSPSNAVKPNLGALELSEALSRVVPFTAKEDNRPVLQSVLFKVADGKLTMVSADGYRL
FT                   AMVKLDFDGDEGQVLINRDELRGVISALRRAYRVRVGFEKSGESLDGMSLVLDTELIRY
FT                   KWRGADGNFPEYEKLIPANFNTFVSFDTNEAIRAVSSLKVLSDSKAYPIDLTIGNGKLT
FT                   MSSPDDKGMAEIPADTQGDGKIRLDGSYLADALRACGGMVELKLVDSKSPMLFTSPDYE
FT                   LVVMPMFAGESQTPKGEAQTAEPVEVETEPAEDTEPTEPEAEMVSEAEKANAVAEAEAI
FT                   TKAEKPKRKRSKAKEPVAVA"
FT   gene            complement(195367..195978)
FT                   /locus_tag="DehaBAV1_0189"
FT   CDS_pept        complement(195367..195978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16779"
FT                   /protein_id="ABQ16779.1"
FT                   /translation="MVTLCCPQDDNPLSYDRLNGEWAQWFRTAQRFEHKVPAQDRGDIR
FT                   HSIILELALTRARNGNKSFSEAMMCRIASCVVALYWRKQYKLTNGLDCGSCSQKQRAKC
FT                   KAGYLYGECPKAIKIEYLSKPITDGDGNVTEFGNTIADDKAIDVGAWIDARTFLLSFPN
FT                   RLVEIAYKRLEGTPLDKKDQKYLERFRRHEQIRLLQYVAN"
FT   gene            196354..197508
FT                   /locus_tag="DehaBAV1_0190"
FT   CDS_pept        196354..197508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0190"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16780"
FT                   /protein_id="ABQ16780.1"
FT                   /translation="MDTALFKNSPSGKLVRAAGGYWAFVPNSLPSTIEWDTALVSQVSR
FT                   ADLAVGTLSGLGETLPNPHLLIYPFIRREAVLSSRIEGTQSSLSDLLLFEATQIEKQRD
FT                   VREVQNYVRAMEYGLKRLNELPLSLRFIRELHGILMEGVRGEHATRGEFRQSQNWIGSA
FT                   GATLNEATFVPPPVPEMLECLNQLEKFLHADTELPPIVQAAMVHYQFETVHPFLDGNGR
FT                   IGRLLVTLLLCQKNVLAKPLLYLSAFFEQHRQEYYELLLKVSQRGAWREWIEFFLKAVT
FT                   EQADDAVSRSRRLLDLLHQYSQMAREKRLSPTAGQLVELIFMKPVLNAKTAQEFLKVSY
FT                   PSAQYALSSLEEAGILTEITGRKRDKAYSAKDVLKALDGETTRE"
FT   gene            197565..199514
FT                   /locus_tag="DehaBAV1_0191"
FT   CDS_pept        197565..199514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16781"
FT                   /protein_id="ABQ16781.1"
FT                   /translation="MSKKQNKGKENKHILEDMGNSMSVESLFSTYVLLDTFLSSGLMSK
FT                   AKSFDTKMKGRHAREAFRQGYKLLLIASLDNYIDEIIRSPELIGIDPDLDYRDYWAFTK
FT                   GRGREITRAVARPGHHISKFVGRASSYIDEILTLDTWEGIEAFGERTKSFRDCLRLISE
FT                   KAYVVSRGGRKVDVRNAILEASSTILWSNSGNPLPIAHMYTDYFIGRKNDEVGIHDLDE
FT                   IVRECESSPGMTRLDFSRVDPTFFPRPLPAQWALGYAFILHESLKMLTPDNKHVASLKS
FT                   LDEFVLNTKNWDDIEKYDKKLETVYGLPKIFRGYGYAMHHIITDDDRQALIADVEGPSS
FT                   PERLLSIFGNRARIVERGSPGAFGSFECLLDGALKRSARTKEKAKVAIIVHKNYREQED
FT                   YSTAIFMPAYGGGWISTNASMWWVFYLIGNNHSGGASYRWKLVFNKIKRNRRAIDLTVI
FT                   YAGEEEFYKYCEDPGYLRLNNAVVLTNRVANDVRGAFPELLLANMLTNMGCRIVRIGFE
FT                   PKLLKPLKGELDVLGVKYANDSPQRILLFESKGQATVDDELQKEINRFSKNVETVKENL
FT                   ESFCSELELPHSDGVEIEATFVSMDTLEYVTNIEVPSNVKLWNFNDLVSSLKRNKIPPK
FT                   YLELLKMNRVAVSM"
FT   gene            199571..201061
FT                   /locus_tag="DehaBAV1_0192"
FT   CDS_pept        199571..201061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16782"
FT                   /protein_id="ABQ16782.1"
FT                   /translation="MEHFVIVPYLKTSETVTIRGIQFRSSLDLTSVPVSAQQHLTTLFP
FT                   MFFLKDDLHIKQMSYAYLKVDNEKDLERLKKRLSEVHHLLAFLYSSPHPTLLDPFLKEE
FT                   HATLYTFIPEPVSQFLIYPEDRNLECVSPEYPYPKPDDRHEMSGYTGTLNSESIIWVTR
FT                   GSRIYPPSGRFWLNLSQDLYADLLRGSSSSHGSGAWSLLKASEPKFGPIEDRIFTALNW
FT                   YNRSNSICSSDEAALLHLAIAFESLLSLEQAPQITQRFKDSVRLLVGPVPKLENWADQF
FT                   YNARSRIVHKGCGADLAFYALGTGSKVSAQYRSLISLGRSIFRICLNAAVAGADMACKT
FT                   GLASLLITNQERFENICKTLSSVKPGASDALISLNKEITDIDEYKFVPEDNLRIDTIIA
FT                   ANRLAAQYFIGKNPNVSQELITLFSDLANAASSADHFLELQAVSKIADYIGAYNAPQYT
FT                   SPVNDTDLIFSLTRSVHHYAFMHYYSLKEQREKNQNAK"
FT   gene            complement(201126..201662)
FT                   /locus_tag="DehaBAV1_0193"
FT   CDS_pept        complement(201126..201662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16783"
FT                   /protein_id="ABQ16783.1"
FT                   /translation="MVIRLAPTRGGFLRPFGCGWFIREYLLGNGPEGSRKVDPRRGAPQ
FT                   ADINFEYKEALARATARERAERIISNMVVKHADVTEAEAEKIYQRELKRVSRKFTHMRY
FT                   HSFLMYFGVLKRLGWVEVTNRTEASTIQDNYPSAPERTYYRLTKKGIDAGEDLWSNPLF
FT                   TLYPEIGSSHMKKVE"
FT   gene            complement(201666..203210)
FT                   /locus_tag="DehaBAV1_0194"
FT   CDS_pept        complement(201666..203210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0194"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16784"
FT                   /protein_id="ABQ16784.1"
FT                   /translation="MAGQVKITIEDKEWLASLSSTYWELVQGLGDIPGMDAGTGMLFDL
FT                   SYTQYITVTTEPMLFPLDIAFLSEDLVITEIYHNVEPGYLVHATMPSRYFIEVNAGEME
FT                   GIEIGEQVSIELLALQDIPTEPDWVSAMISFTGFTLMGFLIVGMVKDMVRKMSDESTKT
FT                   LPARSYATTPVYNRVSKSVSSGECAFCANSGHQCNVCEKISPRDYHLLSWVGAPVPDYS
FT                   FTVEPETKERKIDDVLKRLKEGVDGIQQSENFRTFLLTMSKFHEYSIGNLILIMLQKPD
FT                   ATRVAGYSTWKDLYRWVKKGEKGIAILAPCMPPKKKELEPSESVNAPDAKEKQEEETEI
FT                   RPIYFKVVYVFDVSQTEGKPLPEFEVPPLTGDANEDLFERVMHLAELQGLDVSFEPKPD
FT                   QDPDIKGFYTGKTIWVRPEESRAQQLKTLLHEVAHYYSEGVFRIPRSDAETIAESVAFT
FT                   IGAHYGFDTGARSFPYVAIWSKDKKVLEANLAAIRKVSEKIFDGLEQTTKKPVGVA"
FT   gene            complement(203508..204203)
FT                   /locus_tag="DehaBAV1_0195"
FT   CDS_pept        complement(203508..204203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0195"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16785"
FT                   /protein_id="ABQ16785.1"
FT                   /translation="MKAYLEPEEVERLEQSAEYMRDRLLIRLLFHLGCRVSEALGIKVS
FT                   DIDFKQGLVTIQHLKQRIKLSCPKCSARLGKGHKFCPVCGQKVEKVVAEEKEHRKFRNL
FT                   PLDTVTLGMLKEYIKRGGASSKKGNQQLFNLTRHRAWQIVKECAEKAALPDLINPESGK
FT                   VHNVSPHKLRDAFAVHAVKLDDSGDGLRLLQEHLGHQSITTTMKYRKVSGEEQKEWYEK
FT                   LWQGGKQDG"
FT   gene            complement(204203..204676)
FT                   /locus_tag="DehaBAV1_0196"
FT   CDS_pept        complement(204203..204676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16786"
FT                   /protein_id="ABQ16786.1"
FT                   /translation="MVLDIVLKPMALSPQTFTVGDKVRVTVSFKYVIGVTATVKLFAGP
FT                   YYTNIFGKHMVNACVGQADLSLAATSTPTAGTATIDFLLIPKDQGGIEDGTYGLRVWIE
FT                   DTKAMAEQDNVIIVTGNPSSGDMFSSIMPMLMMLMMMGMIMPMTQQMGEGVEG"
FT   gene            complement(205657..205983)
FT                   /locus_tag="DehaBAV1_0197"
FT   CDS_pept        complement(205657..205983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16787"
FT                   /protein_id="ABQ16787.1"
FT                   /translation="MERLFIALVALVGGLVSALIGWLDSGEHFDPRKFGGSAVRSLIAG
FT                   VVFAVGYHLSGAVSILDLFYAFLGGAGIDVLGNRISSKLGNGSFPLPGSSSLGDSTISE
FT                   KKDE"
FT   sig_peptide     complement(205927..205983)
FT                   /locus_tag="DehaBAV1_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.677 at
FT                   residue 19"
FT   gene            complement(206168..207424)
FT                   /locus_tag="DehaBAV1_0198"
FT   CDS_pept        complement(206168..207424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0198"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16788"
FT                   /protein_id="ABQ16788.1"
FT                   /translation="MRYTVIAKGKPLSQVEVEVKKAGATNIRVAKLLGQIFCELDENQA
FT                   KAIAQISGLSLKPIKEYKTDQVVAEMPPVESLADVFYMLRAYFNPPLTSTGLTVAVLDS
FT                   GIRKSHEALQNKVVYEANLTDSPSATDIFGHGTQVAFIIAGGFHAIGSKAGVSPGAALM
FT                   NIKVISDEGIGNDEDIVLGIDRVCELAEEAREKGLWPTDDLYPNVINLSLGAEDDGDPD
FT                   NPVRSACRKASTEYGLDVIAAAGNSGPKMTTVMLPACDPEVIAVGAVETTGDLVIWEKS
FT                   SRGPTMQGETKPDFVIWGTNLEMASHKADDEYLTKSGTSFAAPMISGLTGLLWESGRRA
FT                   YGESWQFRWTDARQYAPYFSTKPSDAPLNKDNAYGYGLPAMGTMLGEVSQVGASSQGGM
FT                   EMLPMVMMMAMMSALTGGS"
FT   gene            complement(207438..208577)
FT                   /locus_tag="DehaBAV1_0199"
FT   CDS_pept        complement(207438..208577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16789"
FT                   /protein_id="ABQ16789.1"
FT                   /translation="MLRGTIDISKFGKNGKENYSQLCRSFNRNFISLLYSGFAQVNYGL
FT                   TDIDGIYRTCEIDRDRPLLGVTQPALHLPFASQDMLGVQVGSSDAVAGPLDFDLGNRVI
FT                   HADASPETANVVMEGVRYTGSTSTRNIYAANWVIQTFHVPWAVNAYAIRLYCYRAGDLS
FT                   ARTLTVSIRKTDGAWNPTGGELAVGTATGVELQGITTDANGQWFEVAMTSPCVLRPYTR
FT                   YCIIVRIDGGDYSNSLRWQYGGSGSSSGYRLYRGGADCSGSSSNSGGSWSLSDNYHQSN
FT                   YFLVMGRHSVGLCHYPTIVRTISFPTPPPDMQFTIERFFHNFSGSAITLRETGLYASAP
FT                   TSASYENFVYLIARDILTAPIIVNNDELLKVSYAVQISV"
FT   gene            complement(208587..209246)
FT                   /locus_tag="DehaBAV1_0200"
FT   CDS_pept        complement(208587..209246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16790"
FT                   /protein_id="ABQ16790.1"
FT                   /translation="MTDIEIKTQPNLKVIKEEIPHLLAEGEIGAILELTVSDKNGNITQ
FT                   KRVMKSESFVRQFLELLWVNFQNLDYRSGRYCADVYGGVACVRADRRLWTAGGAIGETH
FT                   RGILVGTGTNVPTINDYTIQTLISHGTGAGQLQYSAVTFGAPSSDATTSQFTVTRNFAN
FT                   GSGAQVTVHELTLVVQSYADSNIQYSHMVIRDMIPGGIAVPNGQTLTVNYRIQVTT"
FT   gene            complement(209261..210178)
FT                   /locus_tag="DehaBAV1_0201"
FT   CDS_pept        complement(209261..210178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16791"
FT                   /protein_id="ABQ16791.1"
FT                   /translation="MSLLIKIKGITRLSELEIDADKDWQTKGITNLKQVAAMMSKGDIA
FT                   VRDTSILVRLPPGPEDYCLTSAGSGKLPSWQPKGGMLKFYYPVYIASNHTESKPSVAQS
FT                   LNKPIIPDLDKRYAYSDSPSDNLRMFSPFVTLAKNSAIATVNQSHSKNAPIGRDISILV
FT                   DGAVSETSIGVQTDETAAARDSNGNDMNLCPMTPAVDDKYYFGFDRLFPRVWLNIGMSG
FT                   AGNWANVLEYWNGSTWVQASDEEDHTSDFTKSGINRINWTIPGDWARNTILGMNLYWLR
FT                   CRTITFVNQTVKPLGTQVWACLSA"
FT   gene            complement(210179..210436)
FT                   /locus_tag="DehaBAV1_0202"
FT   CDS_pept        complement(210179..210436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16792"
FT                   /protein_id="ABQ16792.1"
FT                   /translation="MGIFWGTSGCLLVRPKTMHKLSELVIDTDKLWGEKGILNVKEIAE
FT                   GMTKGDMVFSDGVKLVKITPGSIGTMLTAHDLGNDLTWSY"
FT   gene            complement(210436..210903)
FT                   /locus_tag="DehaBAV1_0203"
FT   CDS_pept        complement(210436..210903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16793"
FT                   /protein_id="ABQ16793.1"
FT                   /translation="MPGEFYVETKGGKVNLVPIETSLTDLQAKVDAIKAQADKLAGEIP
FT                   GQGSTTADWQLSEADVVSIGTAGVRYKLHDLTVSIHNLTGTQIRVRFYKKVNDIERKVY
FT                   DQLFDASLDPPGLPVINGSWAIHGVLRVTLESNDAADNSKAVDYDFMLEAM"
FT   gene            complement(210903..211568)
FT                   /locus_tag="DehaBAV1_0204"
FT   CDS_pept        complement(210903..211568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16794"
FT                   /protein_id="ABQ16794.1"
FT                   /translation="MARCPGDTHGCGHTGGNGCLGFFTGEESHQRRGGEVPAMTTSLSI
FT                   MSGELGDIFWDLPPAVSYIAGLDLGCSIYVANPTEIEREYALIARLYKGETLISEEALP
FT                   VFGYTWFKVEPGDFIKLNGALRFSESDASLMVLLVEKDTEEVTDSVSTHLVQVSSSVLP
FT                   PWPGSTATTTDWSSMLGFMLPFLMLGIMAVTLKPQSEKKESISQTKEERKLLPAGRQG"
FT   gene            complement(211621..212151)
FT                   /locus_tag="DehaBAV1_0205"
FT   CDS_pept        complement(211621..212151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16795"
FT                   /protein_id="ABQ16795.1"
FT                   /translation="MPYTMVPEGYRALLIGSATSIGDLGTFAPLEESADEGAFFLMRLD
FT                   LVDLPSAESLGQLEQGLIDAGVEIWPGYDHYVYAVQNEPVVYIVWQKGLAWIPIIVGIL
FT                   VTTVLPPLLMAGIWLILPAEVKSLITGFINLGMMALVMFIMMQVMKPLTASNKEKPKKI
FT                   EQPKQPKPEEVAA"
FT   gene            complement(212169..212756)
FT                   /locus_tag="DehaBAV1_0206"
FT   CDS_pept        complement(212169..212756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16796"
FT                   /protein_id="ABQ16796.1"
FT                   /translation="MTEKIVTQQYPGYPGTRPPKGWVPPLGQSLTLLGVYDNESGYWMG
FT                   LPLQVLREALLNAEALHTEDRIDERDKIEVTVPNVSAQDVVKTTEFEVPAGEVWFLNRL
FT                   NLITEAEVSGNIRISKFPKVSDIDKKYLGTDQAAGTDTDYDLATPGQLGADLRLVGGEK
FT                   ITVVATVMAVGGTTADRKVTLNPYGRKAKRLV"
FT   gene            complement(213369..213581)
FT                   /locus_tag="DehaBAV1_0207"
FT   CDS_pept        complement(213369..213581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16797"
FT                   /protein_id="ABQ16797.1"
FT                   /translation="MGKYASWNEFEKNVPITYKEKATPEAFRTGMNGIAPSGLKVKEGR
FT                   VNHYRDGVDGKGEVMVSGYKRAMFE"
FT   gene            complement(213999..214247)
FT                   /locus_tag="DehaBAV1_0208"
FT   CDS_pept        complement(213999..214247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16798"
FT                   /protein_id="ABQ16798.1"
FT                   /translation="MNSWFAPLQWLVFLALWRMSYETANINKLANSEKSFLIEKTPPQE
FT                   TGNPREKEWTEKAVKKYADAQAKKWQHWNEAMFERSD"
FT   gene            complement(214511..215332)
FT                   /locus_tag="DehaBAV1_0209"
FT   CDS_pept        complement(214511..215332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16799"
FT                   /protein_id="ABQ16799.1"
FT                   /translation="MDDQFLEEIKKRKEQGQSERQMATELGVSRSKVHNVLQDLKLTET
FT                   GASLVPEDKLRVIIREELERVRNGEEEEAKTSSEFPIIRKMGGGMEMIAPEAVLKHYMG
FT                   GTPEGEVELRAIMKFRAAMLMVMDLVNIQKGSAEADARRMEPILRLMKETREEQDAAAA
FT                   RAKASSEEIAERTAQATAGQLFGAISQSNTQVNSTLAQIKQMVGGQSNDPFSQVVSMLQ
FT                   SMQQMSQMFGMPLPGMMPGAPQGGGPPGGQPPSDPPPIEKHTAKEWEERNV"
FT   gene            complement(215506..216429)
FT                   /locus_tag="DehaBAV1_0210"
FT   CDS_pept        complement(215506..216429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0210"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16800"
FT                   /protein_id="ABQ16800.1"
FT                   /translation="MKEGDMELITEIARFEASVDMEKEYRIGWSWRHVRVWPATLSRLF
FT                   KDGYLDNVFRSNSFTGYKLTEKAKAILLANQQEATTESQLESLVNPDDDLFTDIIGHED
FT                   VKALLKAILLSEKPVHVMLTGPPALAKTLFLWDIEQTFGEQAIWLVGSATSKAGLWDLV
FT                   AEREPKILLIDEMDKMNAVDMAALLTMMEGGRLVRVKRGRELDINNPLKVIAASNRLEK
FT                   LSPELRSRFAIRKLNPYSRSEFLTVVKGVLVRKEGLPNDLAEEIARKLDGQSQDVRDAI
FT                   RIARLAPQVGVDKAISLLLGGEPCTS"
FT   gene            complement(216459..216614)
FT                   /pseudo
FT                   /locus_tag="DehaBAV1_0211"
FT   gene            complement(217143..219338)
FT                   /locus_tag="DehaBAV1_0212"
FT   CDS_pept        complement(217143..219338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16801"
FT                   /protein_id="ABQ16801.1"
FT                   /translation="MPELVFSEAVPQLLAEHLTHLSEGSGISLDVIKERGYRSILGKDE
FT                   LAKAGFTSSQQRTTGILIPLWGVDGGQVGYQYRPDNPRLDSRQRPVKYESPVGSSNHLD
FT                   CPPRCKQILGDPKTPLWITEGSKKADALATHGACVISLTGVWGFKGKNEFGAITLLSDW
FT                   DRIAIKDRLVYLAFDSDIVSKEMVRKALEHLGEHLSRKGATILVVYLPQEGNQKVGIDD
FT                   YLLNHTLEEARKLATDFKIDDTANRERFVPGFVLHDGTVGEMVVSKEDERAFIIVINGS
FT                   VRKVFRYETPKAIYLPTDDPLVTEVVHFATTATPYDSQARLFEEIRSFVHKYLELSADF
FT                   EEISSLYVLLTWVYEFAPSIPYLRVIGDWGTGKTRFLQVVGSVCFRPTFASGATTPAPI
FT                   FRILEQFRGTLVLDEADFKDSSSWVEMVKLLNNGYRPGMPVLRADKENGKWFPRSYQVF
FT                   GPKLIATRFPFKDEALESRCLTSEMMSLTRDDIPRVLPPTFDKEIDDLRAKLLTFRLAN
FT                   LIKLKGKTFGNDLLEPNLQPRLQEILIPLKAMLNGDRSMVEAITSFVHRLQDSLFIRRR
FT                   ESAPGRVLAALMELHEEGKELTSENVAKKANETDDEVEQLSAEKVGRMTKRLGFAKERT
FT                   GKSRQRLICWDESRVTKLIGSYGLQMALPLSQEKPSEPSLLSALATKQADSNKGGSVYC
FT                   PPYCPPKTEADSSVGADSRTERTVTDDELTKEASAGE"
FT   gene            complement(219388..220368)
FT                   /locus_tag="DehaBAV1_0213"
FT   CDS_pept        complement(219388..220368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16802"
FT                   /protein_id="ABQ16802.1"
FT                   /translation="MPIKGVTGVVRLPRLGKVRLGVKKENASGISYPCPTDHFVCPEEV
FT                   KKVFGEKPKELRIMFPTDDQTQWASQYLRCYSASRGLVCRGDGETAVAKIDTRTGEIAN
FT                   RESVETEMKEVTCNPAKCTYYQLARCRRVMNLQFLLPDCPGFGVYQLDTSSFYSIVNVN
FT                   SSLELIRGTCGRLSMIPLSLKLVEQEVQPEGKKKTVRVLSMTAPFSLVEIQRYAQIPPG
FT                   QVLLLPPPDNEAPDDLFPDEILSKEEPAKTILGSDKDLMLLWDRVKSKVWQMDMQDYQV
FT                   SHWFQKNCNLDFHLTDLDPLTPPTRIKTEHLENFLKTLERYTDRS"
FT   gene            220889..221284
FT                   /locus_tag="DehaBAV1_0214"
FT   CDS_pept        220889..221284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0214"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16803"
FT                   /protein_id="ABQ16803.1"
FT                   /translation="MMENFGEYLRTLRVEKRLSLREVEQQSGVSNSYLGLIERGQRPIP
FT                   GADILKKLAPVYDVPVRDLLKAAGYLKDEDISISENDEIEMAFNYVMNDPRYKSGTRIK
FT                   GGLTTDVKRFIVEMYEKATGKKLLPGG"
FT   gene            221289..222218
FT                   /locus_tag="DehaBAV1_0215"
FT   CDS_pept        221289..222218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16804"
FT                   /protein_id="ABQ16804.1"
FT                   /translation="MKSFSDLRYFCEYIVNKYGSPSNASEDDKAQEFRKIYLRDLPLDI
FT                   RTLRAIASACGIYVNGVDSKNLPQNIRGYHDVFDDKRNIYYKKGDTKSGIENTVLHEFR
FT                   EMIEPVFAELYTDYSPLRTNAVHLAANKFATAVLLPKEEFRDKVYELGFDVIALSKFYS
FT                   KSCSQVLLRMGEVLQGSVFLYSALYEQGPEIDNWILNYWTGSANNDDPEANIYGADGLF
FT                   PRKGRAVVPGSLVEMVIKAKKPQLVRRITILDSQEDDGLVAIANPLVITGSLVKVALVV
FT                   VLSHSIGLLQPQIERLNPVEVEGFHKHL"
FT   gene            222243..223796
FT                   /locus_tag="DehaBAV1_0216"
FT   CDS_pept        222243..223796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0216"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16805"
FT                   /protein_id="ABQ16805.1"
FT                   /translation="MENRAKKVAIYARVSSDKQDVDLSISAQLKAIREYAKNNGYEVVR
FT                   EFVDEAETGRTTARPAFREMISLARHPQKPFDVILVWKYSRFARSREDSIVYKAMLRKS
FT                   EVHVISINEPFDDTPTGRLLEAIIESLDEFYSDNLGEEVTRGMRESAARGFYLSSKPPY
FT                   GYRKVRFKDGEKEHTKLEIEPNQAGIVSSMFTDALKGKGLTEIAKELNHKGIASPRGKG
FT                   WGKTAVRTIMSNEAYAGSFVWGRNSKRGLAPIRVENACPAIISRQVFDNAQKLIRERAP
FT                   KLTHPKRTCSRFLLSGFTFCSHCGKAMIGQDAKSGKYSYYVCGTLNKKGAGSCPSHYFN
FT                   SRSFEETVVKVIRENILTEEHLKRLIEMVNQEMDVNSRGYQEELDAVLEEMNETNRRLE
FT                   RLYDAVETGKIPLADLAPRIHDLKLRIEKLQERKIQITNNMSDRKVELASPEIVKSYVK
FT                   DMRQVLQESELTGKRAFLKGFIKKIEVKDRQGIIHYLLPINGVLEERIGVLPIVQYGGQ
FT                   "
FT   gene            complement(223784..223859)
FT                   /locus_tag="DehaBAV1_R0004"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(223784..223859)
FT                   /locus_tag="DehaBAV1_R0004"
FT                   /product="tRNA-Val"
FT   gene            complement(223909..224403)
FT                   /locus_tag="DehaBAV1_0217"
FT   CDS_pept        complement(223909..224403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16806"
FT                   /protein_id="ABQ16806.1"
FT                   /translation="MKKFPKRTYSNPIQFFSDIGFILRNRRKLKESRLSGFPGPAFRER
FT                   LMLAVTGVNECRFCTYAHTKMALESGISQSEVKALLDGDFGNCPPDELGAVLFAQHWAD
FT                   TAAKPSAKMQGKFEADYGAEKSGFINLYLRMIRIGNLSGNTADKLLYYISFGKMGLDRQ
FT                   L"
FT   gene            complement(224517..225551)
FT                   /locus_tag="DehaBAV1_0218"
FT   CDS_pept        complement(224517..225551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0218"
FT                   /product="L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16807"
FT                   /protein_id="ABQ16807.1"
FT                   /translation="MKIIDLRSDTVTRPTPEMKKTMCDAPLGDDVFGEDPTVNRLEKMA
FT                   AGKTGKEAALFTPSGTMSNLLSVLSQTRPGDEIILGSEAHILWYEVGGASAVGGVVMRA
FT                   VPNQPDGTIYLADIKDAIRGSNLHFPPTRLICLENTHNRCGGAVLSPSYTAGVANLARM
FT                   RGIKVHLDGARLFNACVALGVSAKELCQGMDTVSFCLSKGLSAPAGSLLCSDQETINRA
FT                   RKFRKMLGGGMRQTGVLAACGIVALETMIERLALDHAMAKTLAEGLFDIDNHTLDKQIV
FT                   QTNIVIFNPPFGLGADEFLEQAKQAGLLFTMGSHGRVRAVCHHDLSEADIQTALRRIAA
FT                   MKKA"
FT   gene            225636..226538
FT                   /locus_tag="DehaBAV1_0219"
FT   CDS_pept        225636..226538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0219"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16808"
FT                   /protein_id="ABQ16808.1"
FT                   /translation="MLHMKAKTYLLLLLGVFGIAAASVFTRLADAPPVIIASLRMLAAT
FT                   LLLLPFAARPVYLAIKRLSRRNLLLIILAGFLVGMDQFFWVSSLEYTSIASSVILVTSH
FT                   PVLVAIMSYIMWREQLNPKAIFGVLAAFGGMVLINLATTQVGEQAFLGNMLAMAATIPT
FT                   TGYLIIGRQMRNSIDFLPYITLLYGSAAFFLLAGAFISGDSFGGYPGTTYLMIFLLAVV
FT                   SQLVGHSSLNMALRLVPALVVSVAILGEPVGAIILGYLFLGEGLTFNEFLGGMLVLAGI
FT                   LIVMLNQPRTKKMEAEIPR"
FT   sig_peptide     225636..225725
FT                   /locus_tag="DehaBAV1_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.891 at
FT                   residue 30"
FT   gene            226535..227257
FT                   /locus_tag="DehaBAV1_0220"
FT   CDS_pept        226535..227257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0220"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16809"
FT                   /protein_id="ABQ16809.1"
FT                   /translation="MSPRNVYSRPEVIGKKSIVLEGKEIHYTLRKSRFSDLIRLAIRSA
FT                   TGLVVTVPHQYNMNGLDDILLQRSAWILKHQNKMNANRFVLEDGLHDGQQVPYLGKLYT
FT                   LRIKEGGERGHVSLAENTIHLLTGGKTPVEVMEKWYRHRAAGIVKTCLEKNASKMGLSF
FT                   GRLCIRAQKTRWGSCTSRGDLNFNWKLATIPPEVMDYVVIHELSHRVEMNHTDRFWVIV
FT                   EKYCPNWKALRKQLKTYE"
FT   gene            227481..227741
FT                   /locus_tag="DehaBAV1_0221"
FT   CDS_pept        227481..227741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16810"
FT                   /protein_id="ABQ16810.1"
FT                   /translation="MSKKSFSTKEALAVAKTLGITFKNYDIEQFRMGMDVELEHGTRDP
FT                   HTNVTSDDPVMTGKIALAHLNEIEDYYTRLAKMEAEAGVED"
FT   gene            227748..228581
FT                   /locus_tag="DehaBAV1_0222"
FT   CDS_pept        227748..228581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0222"
FT                   /product="Acylglycerol lipase"
FT                   /EC_number="3.1.1.23"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16811"
FT                   /protein_id="ABQ16811.1"
FT                   /translation="MRFTEGHFKGCQEYNCYYQALLPNGSPKAIVLVVHGLGEHSGRYS
FT                   ELAHYLADRSYAVYAYDHFGHGKTDGKAGYVSSYDVYIYDLISAFSMVQAKHPTSKIFI
FT                   FGHSMGGLITAAYASKNQYDAAGLIFSSIALKPNTGMPGVINQLIKPLSKIAPMLGVRK
FT                   INASTISHNKDVVKAYNEDPLVLHHRMSAQMAAEFLRICQDLPDFLKNISLPSLIIHGE
FT                   EDHLVNIKGSRELVQRIRSKDKTLITYPGMYHEVLNEPDCPQVWNDLFFWLENHI"
FT   gene            complement(228810..229313)
FT                   /locus_tag="DehaBAV1_0223"
FT   CDS_pept        complement(228810..229313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16812"
FT                   /protein_id="ABQ16812.1"
FT                   /translation="MFNVQSISLRKELVIAFLVMLGLATAAPLLGNQYLTGSLVNAVLF
FT                   ISAVTLGWKNAVAIGLISSTIALATGLLPIVMAPMVPFIMAANALLVTSFSALRGKSFW
FT                   LGAGVGAVLKFAFLWATSSLILNLFIEQNVADKIAGMMGLTQLFTALMGAVIAYGALRL
FT                   GKKI"
FT   sig_peptide     complement(229218..229313)
FT                   /locus_tag="DehaBAV1_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.704 at
FT                   residue 32"
FT   gene            complement(229353..231074)
FT                   /locus_tag="DehaBAV1_0224"
FT   CDS_pept        complement(229353..231074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0224"
FT                   /product="NAD(P)-dependent iron-only hydrogenase catalytic
FT                   subunit"
FT                   /note="TIGRFAM: hydrogenase, Fe-only; PFAM: ferredoxin;
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain protein; iron
FT                   hydrogenase, small subunit; hydrogenase large subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16813"
FT                   /protein_id="ABQ16813.1"
FT                   /translation="MVTLNIDNKQVTVPEGTTILQAAKEANINIPHLCYFEGLKSYSGC
FT                   RVCVVEIEGEPRLATSCSRKVAEGMKVNTHSARVRRARRTILEILLANHPQDCFNCERN
FT                   QNCDLLRLAFECGVKKLRFEESEKRVLPIDNTSPSIIRDPNKCIACGRCVRVCHDIQTV
FT                   NAIGFINKGPDTMVATSMDRGMGNVACANCGQCILVCPVGAIKERSAVDAVWAAIADPA
FT                   KHVVVQEAPSIRVSLGEELGLPAGTLVAKKMYAALRRLGFDAVFDTNFTADLTILEEGS
FT                   ELVERVKEGGVLPQLTSCCPGWVKFMEHYYPELAPNVSSAKSPQQMFGAVCKTYYAEKA
FT                   GIDPKTIVNVSVMPCTAKKFECQRPEMNDSGFKDVDYVLTTRELARMIKEAGLDFVSLD
FT                   EEPAEDLLGLYTGAATIFGATGGVMEAAIRSAYMLITGRELENLDIEPVRGLEGVKTAT
FT                   LNVDGLELKVAVAHGLGNARALLEEIKEGTSPYHFIEIMACPGGCVGGGGQPIRFDSSL
FT                   KKKRGEALYEEDRNMPKRCSHHNPSIAKIYADYLEKPLGKRSHKLLHTEYTSRPVV"
FT   gene            complement(231062..232315)
FT                   /locus_tag="DehaBAV1_0225"
FT   CDS_pept        complement(231062..232315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0225"
FT                   /product="NADH dehydrogenase subunit F"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain,
FT                   51 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16814"
FT                   /protein_id="ABQ16814.1"
FT                   /translation="MKDLKIITRHLNTANSADIDVYLADGGYQALKKALSMTPEEVIAE
FT                   VKRSKLVGRGGAAFPTGLKWELTRKEKANPKYIVCNASEGEPGTFKDRLILKNDPHMVL
FT                   EGFIIAAYAVGTSQGFIHAREVYTQEIELFQKAIDQATERGFLGQNIMGSNFSLDIQFY
FT                   KSAGAYICGEETALFESLEGHRGIPATRPPYPVQVGLMDKPTTVNNVETLCNIPAIINN
FT                   GADWFASIGHPDYPGTKLFCLSGNVKKPGVFELPLGTNLKDLLEAGGGVDGKFKAVLPG
FT                   GISSSLLTETDISLDFKTLAKAGTMLGSGAVIVINSDTSMVNVASNVAHFFDEEGCGKC
FT                   SICREGTRRAAEILSRFSRGQGNRNELEWLLELHEVMKDTASCGLGQVALNVAASAIRN
FT                   FKGEFLAQVRKEEGVWLR"
FT   gene            complement(232317..232784)
FT                   /locus_tag="DehaBAV1_0226"
FT   CDS_pept        complement(232317..232784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0226"
FT                   /product="NADH dehydrogenase (ubiquinone), 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 24 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16815"
FT                   /protein_id="ABQ16815.1"
FT                   /translation="MESIWKEKVDGVITQSGSSRLSLLPCLEAVQEECGYIPHEAVNYL
FT                   RECLSIPSIDIYGMITFYSLLSTNQKGKYVIRLCNSLPCYLNGTENILDTLVDNLGIEP
FT                   GQTTLDRRFTLELVPCLGLCDQSPAMVINGVVYGKLTAQLVTEVLDELRTY"
FT   gene            complement(233230..233643)
FT                   /locus_tag="DehaBAV1_0227"
FT   CDS_pept        complement(233230..233643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0227"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16816"
FT                   /protein_id="ABQ16816.1"
FT                   /translation="MENRLQVLFVCLHNAGRSQAAEAIFNNLSGGRVVAISAGTEPSSA
FT                   LNPEVVAVLKEDGINTDGLKPKLLSQDMLDKASRIISMGCDVTLSCPGHLYGQEDWGIT
FT                   DPRGKNLAEVRLIVGGIRQKVENLLAELEKSEG"
FT   gene            complement(233645..234310)
FT                   /locus_tag="DehaBAV1_0228"
FT   CDS_pept        complement(233645..234310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0228"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16817"
FT                   /protein_id="ABQ16817.1"
FT                   /translation="MPRMGFDRHLKELENDLLLLGSMVGKAIDRSTQAMKERDIALAKQ
FT                   VIEEDKLINCKRFEIEEKSIELMATQQPMARDLRIIVAVLNMIVDLERIGDHAAGNAKI
FT                   VLMLGEEPPLKPLVDIPRMAVKTQEMLNRALGAFINRDSAEAINVINDDDEVDNLYDQV
FT                   FRELLVFMAEDPHTISRATRLIWAAHNLERSADRVTNICERVLFVITGKSEELGSSNY"
FT   gene            complement(234323..235078)
FT                   /locus_tag="DehaBAV1_0229"
FT   CDS_pept        complement(234323..235078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0229"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16818"
FT                   /protein_id="ABQ16818.1"
FT                   /translation="MDPKIKIRGVNFFYHKHQVLKNINMDFPERQITAIIGPSGCGKST
FT                   LLRVLNRMNDIVSGARLEGAVLLDNENIYSPNLDVVNLRKRVGMVFQQPNPFPKSIFDN
FT                   VAFGPRMLGTTAQSRLDEVVEKSLRQAALWDEVKDNLHKSGLALSGGQQQRLCIARVLA
FT                   IEPEVILMDEPCSALDPVSTMRIEELMQELKQNYTIAIVTHNMQQAARASDWTGFLLTG
FT                   DLVEYGRTGEIFSRPRDKRTEDYITGRFG"
FT   gene            complement(235079..235930)
FT                   /locus_tag="DehaBAV1_0230"
FT   CDS_pept        complement(235079..235930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0230"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16819"
FT                   /protein_id="ABQ16819.1"
FT                   /translation="MLKFTSRSTQKVAFSLLWTAGIITLLILLLIIGYIIIRGLPGFSW
FT                   DFLFTPPAGGLAGDGGISSTIVTTLYLVGLTLLILVPVGIGAAIYLVEYAPDNRLTRFI
FT                   RYGVQTLAGVPSILFGLFGFALFVTVLHFRFSILSGALTLACLLLPVLITATEEALKTV
FT                   PRSYRAGAMALGATKWQSITHVILPAALPGIATGVILCAGRALGETACLYVTMGGSAAM
FT                   PDSLLSGGRSLALHVFYLATETNAIDKAMATAAVLIVIIVGLNALTNFISRRFQKRMSG
FT                   GV"
FT   gene            complement(235923..236783)
FT                   /locus_tag="DehaBAV1_0231"
FT   CDS_pept        complement(235923..236783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0231"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16820"
FT                   /protein_id="ABQ16820.1"
FT                   /translation="MLPRYFTDKLAKYGVFITALVSILVLLAIAIFIIKGGLPLFGEVN
FT                   PLDFLFGQSWSPTYGEYGILSMIVGSLLVTLGAMVIAVPLGIACAILLAEVAPRRVRDL
FT                   LRPAVELLVGIPSVVYGLVGIMVIVPAVRNLGGTGYSILAAVLVLSIMVLPTIISISED
FT                   SLRAVPRTYREGSLALGASHWQTIWHVLLPAARSGVGASIVLGMGRAIGETMAMIMVIG
FT                   NAVIIPSSPLDPARTLTGNIAVEINYAAGLHENALFATGLVLLILILILNSLATLVLKR
FT                   GEQHA"
FT   gene            complement(236858..237712)
FT                   /locus_tag="DehaBAV1_0232"
FT   CDS_pept        complement(236858..237712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0232"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein, family 1; TC
FT                   3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16821"
FT                   /protein_id="ABQ16821.1"
FT                   /translation="MNKIASNKKIMLPVTAIMLLALGVAGCGNDTDDNNDDNTTALSGT
FT                   INEAGSTTVQPLAEKLAAAFTALNPNVKVVIGGGGSSVGVKSVTEGTVDIGAASRDLKD
FT                   TETGLTKHLLAKDGIAIVVHPDNTAVNNLTIDQVRDIFSGVITNWSQVGGPDKAIHVMA
FT                   REEGSGTRTAFEELVMGADVRIVTNAVLQNSNGALKTALSGDKDAIGFISFGYIDSAVK
FT                   ALSINGIAATSENGKNGTYPIIRPLYFLTKGTTSELVQAFIDYCLSDAVQQIITEEGYL
FT                   SVN"
FT   sig_peptide     complement(237632..237712)
FT                   /locus_tag="DehaBAV1_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.498 at
FT                   residue 27"
FT   gene            complement(237752..238186)
FT                   /locus_tag="DehaBAV1_0233"
FT   CDS_pept        complement(237752..238186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0233"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="TIGRFAM: methylglyoxal synthase; PFAM: MGS domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16822"
FT                   /protein_id="ABQ16822.1"
FT                   /translation="MERITLALVAHDNKKQEMVELVKKHETDLASLNLVATRTTGKLIQ
FT                   ASTSLNVTLLQSGPLGGDQQIGAMVASGVVTAIIFLRDPLTAQPHEPDISALMRVCDVH
FT                   NVPLATNVSTAEAVLHLIFEHPEELKEHRLKSQLLNSLNS"
FT   gene            complement(238395..240140)
FT                   /locus_tag="DehaBAV1_0234"
FT   CDS_pept        complement(238395..240140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0234"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein; histidine kinase, HAMP
FT                   region domain protein; histidine kinase A domain protein;
FT                   PAS fold-4 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16823"
FT                   /protein_id="ABQ16823.1"
FT                   /translation="MTRSLKWRLITLFCLLIAGCVGILSIFLSNHLENSYMDNLQSRLI
FT                   QEVTLFSRVVPEYITESPDSFDAGVKKLGASLDIRLTVIALDGQVLADSLQLPSEMENH
FT                   STRIEFIDALASGIGISIHPSASLGYEMLYVATLVKSGQDVLAVARVALPVEEVYAAVR
FT                   EVDRTILLGAVISILAAGLLAVWVAASVTRPVKELTAISRRIAQGQMDTIQIDVSGKGE
FT                   MEELAKAFRLMTERLRDSIKAVSSERDHLSAVLERMGDGIFLLDREGSINLLNHASERI
FT                   FKLEAGGVIGHSFVEAIRDHEINAVFERAKSSGKQEMGFVELTAGKRFLGIIATPLVSQ
FT                   SGYLVLVQDLSELRRLEKVRRDFVANISHELRTPITSLKLLTETLQEGAASDPDVAAGF
FT                   IDKIHLEVDKLAQLVTELSDLSAIESGQAVLNLQPGDIRTAIKLAAERLSPQAERAGII
FT                   LGVELPETLPQVRLDENRVEQVLVNLVHNAIKFTPKGGKIKIGVRTQSQTLVVYVTDSG
FT                   IGIPEDDLTRVFERFYKVDKSRSGGGTGLGLAISKHIVQAHGGSIWAESVYGKGATFSF
FT                   SLPLA"
FT   sig_peptide     complement(240042..240140)
FT                   /locus_tag="DehaBAV1_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.494 at
FT                   residue 33"
FT   gene            complement(240143..240835)
FT                   /locus_tag="DehaBAV1_0235"
FT   CDS_pept        complement(240143..240835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0235"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16824"
FT                   /protein_id="ABQ16824.1"
FT                   /translation="MPEHKILVVEDDATLRELLCYNLAKEGYQLECAEDGLKALSVYRL
FT                   FKPALVILDVMIPGIDGFELCRLIRAESSVPILMLTARSSEADKVNGLEAGADDYLSKP
FT                   FGMKELLARMRALLRRSQMLNSQADIAGGLKIGDLEIFIERHLVIRNGVALDFSPKEFD
FT                   LFSFLVQNRYRVFSREQLLEKVWGYDYPGGTRTVDVHISWLRQKIEVDPSKPRHLITVR
FT                   GTGYKFEE"
FT   gene            240968..241387
FT                   /locus_tag="DehaBAV1_0236"
FT   CDS_pept        240968..241387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16825"
FT                   /protein_id="ABQ16825.1"
FT                   /translation="MKMPLNIFKRESGFTLIEILVVVAILGALAGVVIPNVIKFMHEGK
FT                   VESANTELANVRLAVLSAMVDVKTNTLNDGGTVGPGHTSSVTYGSPSVSLPVHNFIMGA
FT                   VIGIYTLDEKGLIASAEMPEDSDWAGLTFVNGAWQ"
FT   gene            241477..241689
FT                   /locus_tag="DehaBAV1_0237"
FT   CDS_pept        241477..241689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16826"
FT                   /protein_id="ABQ16826.1"
FT                   /translation="MQIPEAVCTKCGGHYHGWALLNARHQSCAQCGGKLVITTEDEIIQ
FT                   GYSPFSAEEVNLKAPKQTPSKKTQS"
FT   gene            complement(241693..242652)
FT                   /locus_tag="DehaBAV1_0238"
FT   CDS_pept        complement(241693..242652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0238"
FT                   /product="L-alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16827"
FT                   /protein_id="ABQ16827.1"
FT                   /translation="MPTLILSRKDISGLISMPVVIQAVEQAFKDWAVGLADMPSKVYLT
FT                   LPGGDFRAMPASLPGAAGIKWVNVHPGNRALHMPTVMGLIIYSDPDTGYPLAIMDGTDI
FT                   TAYRTGAAAAIASRYLARQDATTLGIIGAGRQAITQIMAHKVLFELREIRVYDISPDAG
FT                   LRLIEYFPDLNIRQTSLEETAASDIICTLTTSTKPVLFLKHLKPGCHINAVGADAPGKQ
FT                   ELDPLILKQAVVVVDDMDQAIHAGELNVPVKAGAFNKEMVKANLGQILMGGKSGRSSVR
FT                   DITVFDSTGVAIEDIAVAKWLYQRASNLGTFLSLPLVE"
FT   gene            242759..243331
FT                   /locus_tag="DehaBAV1_0239"
FT   CDS_pept        242759..243331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0239"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16828"
FT                   /protein_id="ABQ16828.1"
FT                   /translation="MKFSNYRNQPDVILLIIITCVVVFFGVNFVPQLGPYLALQPATAI
FT                   SHPWTIVTSLFVHADLWHLFANMLTLYFFGNALLQMISQRSWLIIFFGGGLAGSLLFIL
FT                   LNAGSYGYVIGASGAVFALGGALAVLRPNSKVMVFPLPIPIPLWIAVIGSFIILSFLPS
FT                   VAWQGHLGGLLVGLACGYLIQQGKFKF"
FT   gene            243476..243868
FT                   /locus_tag="DehaBAV1_0240"
FT   CDS_pept        243476..243868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0240"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16829"
FT                   /protein_id="ABQ16829.1"
FT                   /translation="MTDKKYRVLVVEDEPSICQVCLRTLEGMGLDVTIAINGQIGQSLI
FT                   QRDTFDLCLVDIRTPVMNGKNLYAYVLNHYPNIAKRIIFTTGDLLDETTRGFLDATGQP
FT                   FLPKPFTPNDLKTIITETFQKLGEQN"
FT   gene            243949..244320
FT                   /locus_tag="DehaBAV1_0241"
FT   CDS_pept        243949..244320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0241"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16830"
FT                   /protein_id="ABQ16830.1"
FT                   /translation="MSKIKILIADDEEHIRQLVCSILDKGYQIVQARNGEEAVKESREQ
FT                   NFDLILMDIMMPKLDGLAACCMLKGDKQTSSTPIIMLTGVGYELNKKLSQQLGADGYIT
FT                   KPFNPQELRNKVSEFIKHD"
FT   gene            244313..244729
FT                   /locus_tag="DehaBAV1_0242"
FT   CDS_pept        244313..244729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0242"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16831"
FT                   /protein_id="ABQ16831.1"
FT                   /translation="MTDALPLYRLEIPSHSQTEFIDITPQIRSVIHQSGITSGLCLIFV
FT                   PHTTAGLTINENADPDVITDIKAQLEQIVPSVTPFLHAEGNSAAHVKTSLMGNSLNLII
FT                   EEGMILLGTWQGIYLAEFDGPRKRTVNIKILKEK"
FT   gene            244769..246160
FT                   /locus_tag="DehaBAV1_0243"
FT   CDS_pept        244769..246160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0243"
FT                   /product="hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolysing) / cobyrinate a,c-diamide synthase"
FT                   /EC_number="6.3.5.9"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16832"
FT                   /protein_id="ABQ16832.1"
FT                   /translation="MNFPRIVIAGVSSSSGKTTISSGLTAALAQRGHKVAAYKCGPDYI
FT                   DPGYLTLASNNPCHNLDSWMLSKDAMTEVFFHGLKNRDIALVEGVMGLYDGYSGERPGG
FT                   STAEIARLLSAPVILLVNISHMAESAAAIVLGYKNLDPRINIAGVILNQAGSTRHYEIC
FT                   RKAIEKYASTPVIGYLLRNKDLVIPERHLGLKTTSEGGELETFIQNLATRIESTIDIDR
FT                   ILEIARNAPPLPEKPLPCLFPETPACPVTRIAVAKDEAFSFYYQANLDMLSDWGAELCY
FT                   FSPVHDTCLPPDIGGIYIGGGFPEIMAAELSANQPMKDTLTKAAADGMPIYAECGGLMY
FT                   LSEAIEDFDSTKYLMLGLLPGISVMQKKLHRLGYTRAAVQNDNILSAKGTELRGHIFHW
FT                   SKLPSPQTKPAYTLLEPAEFIGQNEGFIVGGSTNVLASYLHLHFGTNPDLAKNFIRISK
FT                   DFCTI"
FT   gene            246239..249426
FT                   /pseudo
FT                   /locus_tag="DehaBAV1_0244"
FT   gene            complement(249514..250638)
FT                   /locus_tag="DehaBAV1_0245"
FT   CDS_pept        complement(249514..250638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0245"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16833"
FT                   /protein_id="ABQ16833.1"
FT                   /translation="MDENRVKNFGAVISRLISKENLSREEVKDCFSQIMRNEQPDLQQG
FT                   AFMAALTAKGETASEIAGVWEAIYEQDTVRVKLQVNKPVVDNCGTGMDSLKTFNISTAA
FT                   SIVAAAGGVVLAKHGARALSGSCGTIDMLESLGVDVETDVETVKRSIETVGIGIFNGMS
FT                   AKVHPQALFRILSQIRFGTTLNIAGSLANPALPHYAVRGVYSSELLQPVAEVMREIGYK
FT                   KALVIFGSAPGGRGMDELSNLGESRIAELGEDGQITEYSLSPADFGLKVRQAEDILTSG
FT                   DKQGETLRLLRILSGNENGAAFEVVCLNTAPVFYVAGAVSSLREGYAKAAEIIRSGVAI
FT                   AKLRQWIQAQNANPEAGIARLESLLGELDGAKIS"
FT   gene            complement(250653..251684)
FT                   /locus_tag="DehaBAV1_0246"
FT   CDS_pept        complement(250653..251684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0246"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16834"
FT                   /protein_id="ABQ16834.1"
FT                   /translation="MKAVLLEKPGELRLAEVVTPYCPKGGVLLKVLCCAICGTDVKMFR
FT                   RGHRDLEYPRILGHEIAAEVVCSGHPDFEVGCRVQVYPGIACGVCPLCLQGRENLCRKV
FT                   KIIGFNYDGGLAEYMALPPESLPVGLNIIPEHVSDEEASLAEPLASCIHAQSVCRVGDG
FT                   DRVLVLGAGPLGLLQAMLARHNGAEQVLVAEVLPERVNGAELASPDGIIDLGKTSLKQG
FT                   VFDQTGRAGVDVILIASSGVEVGELPFILSPGGRINFFSGLPKDRSELIIDANAVHYQE
FT                   LVINGSYGSTAADNAEALRLIGKGIIPVKRLLSRITGISDIEAAFLGVERLDGLKTVIK
FT                   FHK"
FT   misc_binding    complement(251798..251990)
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 106.60"
FT   gene            252226..254028
FT                   /locus_tag="DehaBAV1_0247"
FT   CDS_pept        252226..254028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0247"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16835"
FT                   /protein_id="ABQ16835.1"
FT                   /translation="MAKTKKPVEKLEPAEETKKDGKVVSTKRTKGSEFFWTQSRCTGCN
FT                   RCASVCPVDAIKLERDKMPTKRVGTSPCTRACPAGLDIPRYVRFVADGNAPAATAVMRE
FT                   KIPFPSVCGYVCFHPCELECQRQKFDEPIAIRALKRYAAENDDGSWKNNLKIAPPTGKK
FT                   VAIIGSGPTGLTSAYFLTLLGHEATIFESMEYAGGKMFYSIPEHQLPKEILNKEIKTIT
FT                   DLGVTIHTSCQVQSVQTLFKQGYDSVLLSTGVLGVDEGLLLPCDETAKSDLIKGSDFLK
FT                   GIKSTTKETLGDKVIVIGGGSEAYNSAFAAKNLGVSEVNLVCSRHTGSKEASPEEVDRA
FT                   IDAGVTVQPSLDFVKLVKLNDKIEGVELFRIRSYGYDKENKLHYEIINDTRRLISADTI
FT                   ITTVAQNDKPGSDYLSVVQPGVFAAGDGISGARSVIEAMAAGRSVAGLIDKYLGGEGNL
FT                   DETLAPPEKTIKPLGEPKSQNRSQVELNLVKQAGGDKVEIEKTLSPNAAKKEAQRCLRC
FT                   DIVHQVHDYSLDTSSCTYCGRCVDACYWDAITNGYGYEAAAKKRKAEAAALEEKNSVYN
FT                   YAIRILPIAIGLMILAAAIAKLST"
FT   gene            254159..254446
FT                   /locus_tag="DehaBAV1_0248"
FT   CDS_pept        254159..254446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16836"
FT                   /protein_id="ABQ16836.1"
FT                   /translation="MKQLNDDEIYRIAQKRVKEKKDFYNHLSVYVVINAMIIGIWAFTG
FT                   SSYPWFIFPLGGWGIGLIFHFLSVFGFMRDESDWESKEIQKEIGRLKKNL"
FT   gene            complement(254443..255939)
FT                   /locus_tag="DehaBAV1_0249"
FT   CDS_pept        complement(254443..255939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0249"
FT                   /product="pyruvate carboxylase subunit A"
FT                   /EC_number="6.4.1.1"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein, ATP-grasp; protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; RimK domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16837"
FT                   /protein_id="ABQ16837.1"
FT                   /translation="MLNKILVANRGEIAIRVMRACRELGIKTVAVYSDADKGALFVKYA
FT                   DEAYHIGPSQLSESYLNIKKIVAVAKKSGVDGVHPGYGFLSENPGFALALEKAGIKFVG
FT                   PSSRVIELMGNKIAARREMKKAGVPVLPGTEGCVSGIEQATEAAAAIGYPVIIKPSGGG
FT                   GGIGMRVANGPDELKDAIESSQKVAGNTFGLAEVYIEKYISNPRHIEIQIMGDSQGNIV
FT                   YLGERECSIQRRYQKLIEESPSPVITPELRKKMGEVAVKAGKWVNYEGAGTIEFIFSNG
FT                   QFYFLEANTRVQVEHPVTEMVTGIDIVKEQIMVASGSELSFKQEEVEMRGWAIECRINA
FT                   EDPLNEFAPSAAKLKGYRSPGGIGVRVDSGVHTRYNIPYLYDPMISKLIVWGRTREEAI
FT                   ARMRRALYEYIIVGVKTNIPFHKAVMVNPNFVAGNLHTHFIEKETTLLDEMKRIMSEEQ
FT                   PLEEKLSEIFDDTRRIAAIAAVTALTQLPAEIDEDEITGV"
FT   gene            complement(255932..257680)
FT                   /locus_tag="DehaBAV1_0250"
FT   CDS_pept        complement(255932..257680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0250"
FT                   /product="pyruvate carboxylase subunit B"
FT                   /EC_number="6.4.1.1"
FT                   /note="TIGRFAM: oxaloacetate decarboxylase alpha subunit;
FT                   PFAM: biotin/lipoyl attachment domain-containing protein;
FT                   pyruvate carboxyltransferase; Conserved carboxylase region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16838"
FT                   /protein_id="ABQ16838.1"
FT                   /translation="MGIKITDTTLRDAHQSLIATRMRTRDMIDIAARLDKAGFHSLEVW
FT                   GGATFDSCIRFLNEDPWERLRLIRQKAPNTPLQMLLRGQNLVGYRHYADDVVREFVRLS
FT                   VKNGIDIFRVFDALNDIRNMEVSIQTAKELKAHVQGTICYTTSPIHTVEKLAEMAVELE
FT                   KMGCDSICIKDMAGLITPTAAAQLVKSIKSKVKLPVDLHSHCTSGMAPLAYYAAAEAGV
FT                   DIIDTAFSAFAWGTSQPTTESFVAAFKGTKLDTGLDLELMSEIGEEFNKISASYRCLYT
FT                   CEATQPSISVLLHQIPGGMISNLVSQLRQQNAFDKLSEVLAEVPRVRADLGHPPLVTPS
FT                   SQIVGTQAILNVLSGERYKQVTKETKNYLMGYYGKIPGKVNEDIRKAIIGDEKPISVRP
FT                   GALLEPELPKMKAEGEKLGILKTEEDLLTYAMYPEVAAKFLKGECKEECLLPSTPEAAK
FT                   PVKTEAKPVPAFSGSAEYSVEVDGEVFTVKVSAKAGVAGEAPKALKPTASHPGAIVSPM
FT                   QGMLLSLKVKEGDKVTEGEVVATIEAMKMENDVCATVNGVVVGIYAYEGEVVGSKDVIM
FT                   VIEPDA"
FT   gene            257974..258516
FT                   /locus_tag="DehaBAV1_0251"
FT   CDS_pept        257974..258516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0251"
FT                   /product="DJ-1 family protein"
FT                   /note="TIGRFAM: DJ-1 family protein; PFAM: ThiJ/PfpI domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16839"
FT                   /protein_id="ABQ16839.1"
FT                   /translation="MSRFAVLLAEGFEEIEFCTITDILRRADLEVKIVGLKNDLTGGSR
FT                   GIRIMPDIHIDDLKTTDYEVLVLPGGNPGFINMGKDQRVLELIRTAHAENKYLAAICAG
FT                   PAVLSRAGVIDGKEVAIYPGVKHLLKNCTACDLRVKVEGRLITGRSPQAAMDFALTLMD
FT                   MFAKPQSAKVVRDEMLV"
FT   gene            258696..259334
FT                   /locus_tag="DehaBAV1_0252"
FT   CDS_pept        258696..259334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0252"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16840"
FT                   /protein_id="ABQ16840.1"
FT                   /translation="MAKAKQNNISRDKILSAATHLFLNSHDAGKVSIEDIAVKANVSPT
FT                   TIYNNFGGRKALVLGVVEKIIDNSLIQSKDIMARPLPFPAKIQLILSNKNDMAGKMPEE
FT                   ILKKLVNMDDDVTALIQEIYQQEIQPMWQKLIADGKAEGYVDPSLSEEAVFIYLKVVRD
FT                   GFNANAALFEPAKEKINLMMELSRIMMYGFFKKDACLIPDIKSGHAKTG"
FT   gene            259346..260212
FT                   /locus_tag="DehaBAV1_0253"
FT   CDS_pept        259346..260212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0253"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16841"
FT                   /protein_id="ABQ16841.1"
FT                   /translation="MSQISISVEKLSYWYGDLKAVNQISFEVAQGEILGFLGPNGAGKT
FT                   TTQKMLTGQLRPKDGRATLLGFDVAKDTEEIHRRIGICFEQTNLYEQMNALENLQLFAD
FT                   LFGVNNFNGYALLKRVGLAGREKDKVAGYSKGMKQRLMVARSLVNTPSILFMDEPTSGL
FT                   DPVSSESIRDIILEERKRGATIFLTTHDMWEADKLCDRVAFINEGSIAALDAPVNLKQQ
FT                   YGKRSLIAKVKSANGQLENREIALDTGKTAEEVSKLLSSERVLTLHSEEATLEDIFIKI
FT                   TGRRLTE"
FT   gene            260209..261267
FT                   /locus_tag="DehaBAV1_0254"
FT   CDS_pept        260209..261267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0254"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16842"
FT                   /protein_id="ABQ16842.1"
FT                   /translation="MNFSVIKALLKKDFSLFLQNRFYMLMTIVGLVFYIIIFFIMPNKV
FT                   DEQLKAGIYAPVMPPAFSILVADPASSLTSYASLEEAKAAVENGDSQVAIVLPADIMQT
FT                   WASGGKPEVEIYYASSAPLELRDAVISLVKELSYIQTGQSLTFDTNEQVMGQDMLGEQI
FT                   PMRNRMVPLLAIFILMMEILSLASLIAEENEQGTARALLVTPMTVPELFAAKGIIGVGM
FT                   ALGQVVLFMLLVGGFNSQPLITLGVLLLGSLMVTGLGFLLASLTKSLMSVTTWGMLLFI
FT                   ILAIPGMGIMFPGLISNWAKVIPSYYLTDTVNRVVNYGADLSVVGGNLLILVGFTAVIV
FT                   TAGIVVLRRRYQ"
FT   gene            261264..262337
FT                   /locus_tag="DehaBAV1_0255"
FT   CDS_pept        261264..262337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0255"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16843"
FT                   /protein_id="ABQ16843.1"
FT                   /translation="MSIKHIITLFNREVIHGPKDVTFIMVVVTPILISLFISLAFGNIF
FT                   SEKPKLGLTDLGNSQIVNLLKENNTLLIKEYPDEAALKEAATSGAVDMGLVLPADFDTS
FT                   LIQTNTLKANAYVWGESLAKSRMIIPAVLADTARQITGANVPVEINSISLGDEMNVPWA
FT                   DRLFPFVVLMAMFFSGLMLPASSLIDEKQKRTLEAVNITPATLGEIFTAKGAIGTLLGV
FT                   VMGLIILALNSAFGNSPLPLILMLGLGSLMASLLGLLAGAFIKDMNTLFAVWKFGGLLL
FT                   FGPAFIYLFPQIPQWIGYFFPTYYILKPVVDLSVYDAGWTDIALNAGISVILVVILLVA
FT                   VSKVVSRMSNSALRLYT"
FT   gene            263015..263818
FT                   /locus_tag="DehaBAV1_0256"
FT   CDS_pept        263015..263818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0256"
FT                   /product="formate dehydrogenase beta subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16844"
FT                   /protein_id="ABQ16844.1"
FT                   /translation="MPNGMLIDTTRCTGCRGCQVACKQWNENPAVKTTFSPEVTNPLEQ
FT                   NAFNYNLLECREIEEDGKLQWIFAHKRCLHCYEPACVSVCPVGALHKRPNGAVVWDQDK
FT                   CFGCRYCQNACPFEIPKFEWDDNWAKITKCTMCWNRVDEGMEPACAATCPTGAIKFGER
FT                   ADLLAEAYERLSNNPDKYYPYVYGEKEAGGTHVLYLSSVHPEKLGFDMHEHEFFPSFTR
FT                   EFLGNIPLEISIVASLMVGVWYFRGRRIQAQAHDAEHAENKAGKH"
FT   gene            263871..264935
FT                   /locus_tag="DehaBAV1_0257"
FT   CDS_pept        263871..264935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0257"
FT                   /product="hydrogenase (NiFe) small subunit HydA"
FT                   /EC_number="1.12.99.6"
FT                   /note="TIGRFAM: hydrogenase (NiFe) small subunit HydA;
FT                   PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit;
FT                   Nickel-iron dehydrogenase small subunit, N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16845"
FT                   /protein_id="ABQ16845.1"
FT                   /translation="MFNTKLTRRDFVQLAAGSTAALSLGALKLPEFEKMFAEALKEIPV
FT                   IWLQGAGCNGCTISTLNVVSPTIQDLLLTSVVPGTHVSMQFHPTIMAAQGDLAMNTITD
FT                   TAAKGPFVLVIEGSVPLKDGGIYAEVGEKDGEGITLLEHVLNLAPKALAVVAAGTCSAF
FT                   GGITAAAPNPTGAKAVSEILKDHNITTPVVNLPGCPPHPDWVVGTLATVLMSGLDALDL
FT                   DDMGRPKAYYGKLLHDQCPRRGHYEKGLFATKLSEPYCLFLVGCKGPVTYADCSDRLWN
FT                   NKTRWCVEADSPCIGCAHPGFPDAVSPMFEAPPVINSTDKLAIGIAGTAVVLTAGVAAV
FT                   ELAKKAKRNAAKKG"
FT   sig_peptide     263871..263957
FT                   /locus_tag="DehaBAV1_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.580 at
FT                   residue 29"
FT   gene            264966..266546
FT                   /locus_tag="DehaBAV1_0258"
FT   CDS_pept        264966..266546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0258"
FT                   /product="nickel-dependent hydrogenase, large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16846"
FT                   /protein_id="ABQ16846.1"
FT                   /translation="MQKIVIDPITRIEGHLKIEATVDGGEVKDAKCVGTLFRGFEIFMK
FT                   DRDPRDAVHITQRICGVCPTSHGTTAALNLDAAFGVADKIPNNGRILRNLIQGANYIAS
FT                   HIVHFYHLAALDYVDVTEVADYDGTDPELLKVKDFIARALAAGDMSMLAPFYPRYEGDY
FT                   RLPKKVAQAAVAHYVEALNMRRLAHELSAIYSGRMPHSVAVVAGGVTSHPSIDSISSFM
FT                   SKLNTLRHFIDNVYLPDVIAVAETYPDYFGIGVGCGNLLSYGVFDLEANGTNLATRQRL
FT                   FTQGTVSASDLTLHTFDPNKITEDIKYGWFKGETNEYPLNEVTEPDHTKAEGYSWLKAP
FT                   RYENTPYEVGPLARMVVNYVAGDPVVQKMVNDTLAHFGAGPAALFSTLGRHAARALECK
FT                   IVADEMVKWVMELKIGEPVCADYEIPESAEGMGLWEAPRGALGHWIKIENHKISNYQCV
FT                   VPSTWNCSPKDGQGVNGPVEQALIGTKVRDNDNPFELVRIVRSFDPCLACAVHLVSPTG
FT                   NEISRFRVY"
FT   gene            266549..267031
FT                   /locus_tag="DehaBAV1_0259"
FT   CDS_pept        266549..267031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0259"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   peptidase M52, hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16847"
FT                   /protein_id="ABQ16847.1"
FT                   /translation="MFFNPGDESPKPILVLGTGNILLSDEGAGVRCVERLSRFPVPEDV
FT                   ELYDGGTAAMDLLDVISGREKMFILDAVHGGDEPGMIYRFRPEDIKTQPKIDISFHQMG
FT                   LMEILNLAKYHDAIPKDIIIYGIQPGSMAPGFELTPAVDKAVNRVVEMMKEELGIK"
FT   gene            complement(267098..269017)
FT                   /locus_tag="DehaBAV1_0260"
FT   CDS_pept        complement(267098..269017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0260"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16848"
FT                   /protein_id="ABQ16848.1"
FT                   /translation="MKKFFQEKPGAVEFLLPALVFTLAISLFPLFGSGMTWILGDRFGQ
FT                   GAGVLGLIALTVFSLSFLAKPLRRFLCSYKAIIFSAGGVGILSLLAQIGFSEPLLNFVC
FT                   SALGLSLFGIFLCVYLDSARVRGPSAVGHFGAGAVFGLLLNAALSAGFGTYDLLNQPSF
FT                   FPLLVSAVMVGFLLFLLTVHMPLAEGPAASNDGLGWLAIGPFLFLELVVFGNIARLSAL
FT                   SGFSSPVASMFVLGALSLGLVGILWVLSLSERHIRLLTLISSLCLILSLTGISDGVAFV
FT                   SLIQQVLGQLAVVLLFGVILRYIGGRKADGHSESLNLPSGLGMLVFVILLLGYYAVYQV
FT                   AVPYDNTVLELVAGLIVVGLALYSGRESLPLLDFKSDRFILPAMSVLLLTLPLLGLLTY
FT                   KTPPSPPQFEGSLRIMTYNLHNGFNTQGKLDMEALARVIEDSGADVVALQEISRGWVIS
FT                   GRVDMLEWLSQRLNMYSAFGATAGEYWGNAILSKYPILDTHNISLESEGLPIKRGYLNA
FT                   VLDLGGRYLYLAATHLHHVPEEGDVRLIQAGELADFWDNAPATIILGDFNAEPDSEEIG
FT                   LLRQAGLSDSLEGQTSVLTYHSADLYQRIDYIWASPEIEYIDSYTIVSLASDHLAIIAD
FT                   IRLS"
FT   gene            complement(269080..270384)
FT                   /locus_tag="DehaBAV1_0261"
FT   CDS_pept        complement(269080..270384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0261"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16849"
FT                   /protein_id="ABQ16849.1"
FT                   /translation="MEFQIWGYLVFVLGLAALALAFRAMRRKRLVDDIPTSRTHGVFIG
FT                   LVELKGTAESEKPFTGFLSAEQCVYYYYKVEERWSRMVTESFTDAKGHVQFRTRQESGW
FT                   TQVASGKEMQPFYLKDETGIILIQPEGADIQPKNLFNRTCGQNDPLYYAKGPQASIPNS
FT                   DHQRRFTEEAIPLHAGLYIMGQSRERQDIVAPEIAKDKSAPLYVISTRTEKQISRTYSG
FT                   WFWFWVGLGLLLASGSGLLLSQEGTSGFNPDFGVAVLWLGLYLICWLFGWLWAGYNSLV
FT                   GLRNRVCQGYAQVDIQLKRRFDLIPNLAKSVEGFGKHERELQEMLAEVRTISKVNGQDP
FT                   KDIQGASAILVFNMERYPELKADTLFLKIQEELAATESWIALARDYYNSIATFYNTRRE
FT                   VFPDRLLAGIFGFKERVLINASALERAVVKVKLAE"
FT   gene            270583..271422
FT                   /locus_tag="DehaBAV1_0262"
FT   CDS_pept        270583..271422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0262"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16850"
FT                   /protein_id="ABQ16850.1"
FT                   /translation="MTIKIVTDSTADLPADIVKNLGITVVPLYVHFGNEVFRDGVDINK
FT                   ETFFDRLAHGGIHPKTSQPSPEDFANVYRELAKDNATGIVSIHISSKFSGTYQSAMEGA
FT                   KISGVSCPIEVIDSRLLSMGMGLVIKAAAIASRSGKKLGEVVEDCKNNIPKIKLMGFFD
FT                   TLRYVQVGGRLGKAKILMGSLLGVKPVLTVADGEYQPCGRVRNTGKGLERLVEFAKTGK
FT                   NIVDMSVIHSTTPETAHKLAEMLSDIFPKDQTIIAQLGAVLGTHGGPGTLWVAYKEA"
FT   gene            271569..271934
FT                   /locus_tag="DehaBAV1_0263"
FT   CDS_pept        271569..271934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16851"
FT                   /protein_id="ABQ16851.1"
FT                   /translation="MSFAAIFSIIAGVLVIFQWRENLNRRAIQDPNKGYKVRWGTYELI
FT                   LRSAAEFATALMLILAGTGLLSEQSWGESIYLLATGMFIYSAVNSPGYFVQQKNWAVVA
FT                   VYAIALELAILGVILFL"
FT   gene            complement(272052..273038)
FT                   /locus_tag="DehaBAV1_0264"
FT   CDS_pept        complement(272052..273038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0264"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16852"
FT                   /protein_id="ABQ16852.1"
FT                   /translation="MSIEPEIRETLGKINVAASGRTLANLNLLRDIEIQPDKIKISVAS
FT                   AGLSASSQQILRQDISLCLKPLLNKQTLEIEYISVPLNELNHVKKVVAVMSGKGGVGKS
FT                   LITGLCAVALNRQGYRVGILDADITGSSIPKMFGANQHLAGNEEAILPAQSRAGISLVS
FT                   TNLLLTNQDDAVIWRGPLISKMINQFWDDVLWGELDYMVVDLPPGTSDASLTVLQSLPI
FT                   SGILVVFTPQGLVEMVARKAVSMAEKMGKPIIGLVENMAYLKVPELDKKIEVFGTGHGE
FT                   ELAKSIGVPFIGQMPLDPALAALCDSGDIEKYQHPLLDELEGAISRS"
FT   gene            273519..274457
FT                   /locus_tag="DehaBAV1_0265"
FT   CDS_pept        273519..274457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0265"
FT                   /product="phenylacetyl-CoA:acceptor oxidoreductase PadC
FT                   subunit"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16853"
FT                   /protein_id="ABQ16853.1"
FT                   /translation="MTDKGKEGTTRSTHPPTRRDFIKSSGGVLGLAAITKLDERTQNFS
FT                   AAVAPPSTVSFPAEETAFIPNSTKEDPLIRMQAELRRAMQKPAAERHWAMVINLRKCVG
FT                   CHACTEACVSENKLPPGVIYRFVMDEEIGQYPNVSRRFTPRPCMHCDNPPCTQVCPVGA
FT                   TFKQADGIVVIDYQRCIGCRFCIVACPYTARTMDYGDNYLEDEPEDSGLVLGYEQGGVW
FT                   QSASNFEYGNEHSRTPKRDSPIGNARKCHFCLHRLEKGMLPACVTTCIGRVNYFGDSND
FT                   PDSLVSELIANPGIIQLKSELGTDPSVYYLF"
FT   gene            274478..275659
FT                   /locus_tag="DehaBAV1_0266"
FT   CDS_pept        274478..275659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0266"
FT                   /product="Polysulphide reductase, NrfD"
FT                   /note="PFAM: Polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16854"
FT                   /protein_id="ABQ16854.1"
FT                   /translation="MNWKRIALGILILSLAAGVWGFLMLLNNGQQMLGLGSFVVWGLWM
FT                   ALYVFFASTAAGMFFIASLDLLFKVKTFAGTGKIFMLASLASLGAGLIHILINEGRPER
FT                   VMNVFLHPNFDSVLAWSVWIYTLIALATAAILLVLFIPQKRLPFRKEPVIKWLMILGFP
FT                   VAVIASGAVGFTLSTQSSHSFWSVGLFPVLFPIFGMSAGFALSRIIVALYGDKTSPGYP
FT                   RLAKTMAISTIALLLSITYIIGSVLFVGIYDATPPTIEAANYIMFGQYWYGFWIVQIGL
FT                   GIVVALGALIKVLSKPGLSKKPAWGLTIGVLVLLGAAVARLNFIIPAQIVAGADFLSSP
FT                   IIDSRYIDSYIPTLPEWALSAGITAAVILAFYIIAKMMKLIPVRIGNEETGDE"
FT   sig_peptide     274478..274543
FT                   /locus_tag="DehaBAV1_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.690 at
FT                   residue 22"
FT   gene            275652..278864
FT                   /locus_tag="DehaBAV1_0267"
FT   CDS_pept        275652..278864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0267"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: molydopterin dinucleotide-binding region;
FT                   molybdopterin oxidoreductase Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16855"
FT                   /protein_id="ABQ16855.1"
FT                   /translation="MNKEKPEKNPSGGITRANFIKVSALLGGTALLSGCDLGTKPRRIL
FT                   GSSDYPLSKAEDIIYSTCQQCATQCSIKVKLIDGVIAKIDGNPFSPWNMMPHLDYKTPV
FT                   TTSAFTDASICPKGHSGAQTSYDPFRLVKVIKRDGPRGSNKWISIPFAQAIDEIANGGK
FT                   LFSNVPGEENRTVEGLKDIWALRSPEITKAIKNDITAIWAEKDATKKSALVAVFKEKHK
FT                   DYLDKFIDPNHPDLGTKNNGFCFMFGRTQGGRVDFIKRFTNDAMGSVNAHGHTAVCQGS
FT                   LFQSAKALSAQFDSGTGSFSEGEKFYWMADIGKSEFVIFTGASPFEASFGPTSRSMRIS
FT                   EGLDTGRMKYAVVDPRFSKAASKAWKWLPAKPGTEGALALALIRWIFDNSRYDARYLAN
FT                   ANKAAADADGEPTWSGSSWLVKIDAAGRAARLLRASDIGLEQGNFSFDTPLVMKQGQFT
FT                   RFDPNDKVNAVEGELLVDTTVNGLRVKSSLQILRDEASSHTIEEWAEICGVKADDLAEI
FT                   ASEFTSHGKKAAADIHRGVSQHTNGFYNSLAWWNLNMLIGNYDWQGGMLKGSAYDIKGG
FT                   KADGPFNLGQMRPGALTPSGVNIVRHGNIYEDTTLYQSTGYPAKRNWYPLSEDIYQEVI
FT                   PSAGDAYPYPIKALFLHMGSPVYVVPAGHTALEFLTDPEKLPLLVVTDIVVSETSMYAD
FT                   YIFPDLTNMERWEFAGSQNTIPFKSQPVRQPAIAPLVETVKVFGQDMPLSMETMLLGLA
FT                   EEMGLPGFGPDGLGQGIPLSHFDDLYLRMAANLAFGEKADGSDAVPDADEEEIRIFTQA
FT                   RRHMPDSIYNLERWSSLAGENWPKVVYMLNRGGRFQDYEGGYPANQQLGNKYGRLFNVF
FT                   LEKTTEVKNSQTGESIPGHACYITAGRDCYGQELNDEKNGYDLSLITYREIARTPTTAS
FT                   NYYLNPLLPENTILINQQDADRLGLTETDIVRVVSESNPKGVWNLRNGQEWPMNAKLSI
FT                   MQGIRPGVIAFSLGYGHFAYGGLDITIDGQLIPGEAKRTKGVNANAAMRVDPHLKNTCL
FT                   VDTVGGSAVFYDTKVRLEKVNT"
FT   gene            278887..279576
FT                   /locus_tag="DehaBAV1_0268"
FT   CDS_pept        278887..279576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16856"
FT                   /protein_id="ABQ16856.1"
FT                   /translation="MNTYLNPEKNRIPTGLTLAVIGSVWGLLEMALGGFLHTIHFANQG
FT                   AVMGGLAISLMAIFLSITKKPALIPLLGIIAASFKPFSAFIFGEPVFSAYVINPAIAII
FT                   MEAIAFGAIAFIFKKAMEKHLFAQITTGFLAGALGIVLYAVIASVFGLGKWPMLDMAGK
FT                   LDTIVSTGLPVALAGTITLAAGYYLGKFGMPKLANFKTNYPRLYYVTSAAAVVSCWVIP
FT                   AVFHLGG"
FT   gene            279577..280722
FT                   /locus_tag="DehaBAV1_0269"
FT   CDS_pept        279577..280722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0269"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /note="PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16857"
FT                   /protein_id="ABQ16857.1"
FT                   /translation="MNLIITGEVGSGKSSHCQRYAKHLQECGFKTGGVICRPVFQETTK
FT                   TGYKVTDIRTSAETIFSLTHPPSEFTGEKVGKYSICQSGLSFAGKAIQEAIQTGCTVIF
FT                   LDEIGHLEIAGKGLAEHAHLAYQKAPHTISVVRKSLLSKFLAAFAPDKSNNIFVIQDTQ
FT                   TDTDIHTHYFENRADTVDISCIILAGGKSTRLGSNKVTATLNSQTLLERAIANLAGYGD
FT                   EILVVTAYSKTDDKTRQLAGIKIIQDILPDKGPLAGIYSGLMASNSPLNLVIACDMPFI
FT                   NQPLLEYMRAQAEGYEAVVPRLAQRPEPLHAIYSKSAGEKALGLINEGKFAVSDLLACL
FT                   KTRYIEEAEINRFDPEHRSFFNINRPEDLEKARNIAETESI"
FT   gene            280911..281219
FT                   /locus_tag="DehaBAV1_0270"
FT   CDS_pept        280911..281219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16858"
FT                   /protein_id="ABQ16858.1"
FT                   /translation="MPEFGSPFSGMAKGQPLSNEELIRAIRFMVAAEYEAIQLYMQLAE
FT                   STTNRLAIEVLRDIANEEKVHAGEFLRLLKELAPDEENFYADGAKEVEEEIEKRKNK"
FT   gene            complement(282146..282451)
FT                   /pseudo
FT                   /locus_tag="DehaBAV1_0271"
FT   gene            282499..282777
FT                   /locus_tag="DehaBAV1_0272"
FT   CDS_pept        282499..282777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0272"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16859"
FT                   /protein_id="ABQ16859.1"
FT                   /translation="MPRKSFTPEQIINKLREAEILISQGTTLAVMLKKIEVSDCTYYRW
FT                   RQEYGGMRIEQAKRLKELEVENTRLKKLVADLSLDKAILKEAARGNS"
FT   gene            282918..283613
FT                   /locus_tag="DehaBAV1_0273"
FT   CDS_pept        282918..283613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0273"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16860"
FT                   /protein_id="ABQ16860.1"
FT                   /translation="MADIIELASKYGRYGYRRITALLNERGWRVNHKRVERIWRTEGLR
FT                   VPKKQPKRSRLWLNDGSCIRLRPERKNHVWSYDFVTARTADGRAFRMLNIIDEYTRECL
FT                   AITINRRLTSEDVIDQLFNLFIFRGIPEHIRSDNGPEFTAKAIRKWLTRLGIKTLFIEP
FT                   GSPWENGYIESFNGKLRDELLNLEIFTTLAEARVLITDWRRQYNQVRPHSSLGYRPPAP
FT                   EAIMAVVTT"
FT   gene            complement(284016..284702)
FT                   /locus_tag="DehaBAV1_0274"
FT   CDS_pept        complement(284016..284702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0274"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16861"
FT                   /protein_id="ABQ16861.1"
FT                   /translation="MNVVIIEDDDVIIESLTLLFRMRWPEAKLVSSNLGDKGLELIVDW
FT                   NPNLVILDLGLPDLDGLEVLKRIRLFSNVPVIILTVRGDEAEIVKGLEYGADDYITKPF
FT                   KQLEFLARVKALTRRQEVPAIATCYQKGPFQLVSATHKLYLKDKEITLTNTEYLIFYKL
FT                   LENANMVISHSTLSKMLWGEDYPDSIDAIRVYISRIRQKIHDDSSEPSIILTKPGLGYM
FT                   LSTSKA"
FT   gene            complement(284702..287914)
FT                   /locus_tag="DehaBAV1_0275"
FT   CDS_pept        complement(284702..287914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0275"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; Two component regulator
FT                   propeller; Two component regulator three Y domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16862"
FT                   /protein_id="ABQ16862.1"
FT                   /translation="MKHILLFIAVICLIILPVYSNPVQAQEFTRFEHISIDDGLSQSSV
FT                   TAIIQDREGFIWFGTRDGLNRFDGSTMHTFSNNPENPGSLSDSYINCLFEDSRGIIWIG
FT                   TLSGGLNKFDKMTETFSTFRHSEGNSETLASDNVRMMREDLAGFLWLATPNGLDRFNPH
FT                   SNSFEHFSLHNGLSNNSVWSILITKEGTVWVGTEDGIDQFQSENGIYKHSNRLTSDLSG
FT                   NTIRYLFEDKTGNIWISTYNGVDCLNPLSGIIAHFENIPGNPSSLGNNRIRTICQDTAG
FT                   SLWFGTTDGLDKLEQGTNEFIHFKNDSGNPDSISNNIIWSLMVDRSGVLWIGTLNGGVN
FT                   RLSLTKQVFICYRNNPGNANSLSNNIVKSIYQDQNGIIWIGTLGGLNKFDPLANTFYLF
FT                   NHDGSNPQSIAGDTIKTITGDTNGNLWVGTTSGLDKYSEQLNQFTHFTHNQSDTKSISD
FT                   DVIWSLFFDSQGQFWVATNRGLDKFNPDSSEFIHFGAVYGLPETTIYTIFEYEPGVLLL
FT                   GTDYGLYRFDTISETSVPFRFDANNPTTINNNAVRCIYQATNGTILIGTHTGLNKFNIT
FT                   EGTFERYTQINGVTYGILEDNFGYVWISGNNGLIRLFLANETIKTFNKTDGLQSDEFSE
FT                   GAYFKGSSGLLYFGGINGLNVFDPSKLQTETAKPNIIITSLDLIGGNASFKLPEQISGG
FT                   ITLEYENNSFTINFTALDFETYQKVKYYFQLVGFDKDLRIANYDQRDISYTNIDNGKYT
FT                   FKIYAADQDESWVSDTAYLNIRITTPFWESWWFYSLCGVSSIATIYFIVKLRIWAIQKQ
FT                   KNHLESLVEVRTDQLKTEIEKQQIIENKLKDEIENRAKFTRALVHELKTPLTSLSISSE
FT                   LFTGEATNEPFVSLSRSIERSVTNLSKRCDEMLDLARGETGLLKISKQMVDLDSFVEGI
FT                   KTDLLSIAFSKGIHLTFEYAKNTRKAYIDPDRINEVINNLTDNALKFTPPNGTITIKTD
FT                   ISNEQFIFEISDTGCGINKDYQKRMFSPGYQGETNPRLDGLGIGLILAKMFIELHKGTI
FT                   WVKSKPKSGSIFGFSIPIGEKD"
FT   sig_peptide     complement(287837..287914)
FT                   /locus_tag="DehaBAV1_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            288132..289703
FT                   /locus_tag="DehaBAV1_0276"
FT   CDS_pept        288132..289703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0276"
FT                   /product="reductive dehalogenase"
FT                   /note="TIGRFAM: reductive dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16863"
FT                   /protein_id="ABQ16863.1"
FT                   /translation="MANFHSVINRRDFMKALGLVGAGAGAAAAVAPVFRDLDDLVASPT
FT                   ATFPRAWWIKERDLWDITTEYDWKAMSRHDTCETMWIKHSWAKYVGVDKVKEAAASAAA
FT                   IKKEALETGKPGMDLRATALGSTSGLYNAPQPYFSYTKTAQGWGGGKSFTGQSTIKGPD
FT                   VLGVPKWQGDPDANLRMLRAALRFYGAAQIGVVPYDTNVKNKLTCVREGGMASMSDKYI
FT                   EKWPIPAVDARPFVFEDVEKGYETAEKLVIPDKKELFVVSVIQPMSREMWRQGSGNLRV
FT                   ATNGHRYSLASVWQTKIQGFLTTLGYQGLGYPTRAYGPMPTIPGFIFSGLGELGRSNNV
FT                   CLSPEYGSTHGSFHFLTDLPLTPTKPIDAGMWRFCKTCAICAENCPSQSISYDKEPSWE
FT                   ITPSKYAPNVPVEYSVPGKKVFWRDEPSCKQWTESCGYSCGICMGSCVFNVDNASMIHQ
FT                   VVKGTIATTSLFNGFMKQADKFFGYGLTPESEWNNWWDMNLPAYAFDTTVGVTDGGYKA
FT                   KGLLQQ"
FT   sig_peptide     288132..288221
FT                   /locus_tag="DehaBAV1_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.630 at
FT                   residue 30"
FT   gene            289727..289999
FT                   /locus_tag="DehaBAV1_0277"
FT   CDS_pept        289727..289999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16864"
FT                   /protein_id="ABQ16864.1"
FT                   /translation="MWMIIGILVGLAIWGVVQFAKNKGLNLTWYDWVIGLLGLGLLLFT
FT                   FQNFIGAFAEAEDKAAYLFLLVTGLPSLILLAVAWQLAIRRTKKV"
FT   sig_peptide     289727..289789
FT                   /locus_tag="DehaBAV1_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.616 at
FT                   residue 21"
FT   gene            complement(290133..290546)
FT                   /locus_tag="DehaBAV1_0278"
FT   CDS_pept        complement(290133..290546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16865"
FT                   /protein_id="ABQ16865.1"
FT                   /translation="MFAFLALISGCEQTQPPSVQTEIPAACPDSQVEIDKLILSEFPFE
FT                   SEGTTESVTVFNSGIRQIYCTFWLTDDLCCTVITLQLKDNAQVLFEWKMNGNQIGFPQT
FT                   VIMEFETGLGTGQYLLEIYMDKKMRVNFELVIV"
FT   gene            complement(290722..292206)
FT                   /locus_tag="DehaBAV1_0279"
FT   CDS_pept        complement(290722..292206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0279"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16866"
FT                   /protein_id="ABQ16866.1"
FT                   /translation="MKILLVNPGTEYKPRFRTYAVFPNGLLYIASVLERAGHEVRIFDN
FT                   VVSELTPPDYAKDFAPEVVGFSVLTGPCIGNALVQSKEFKALLPGVKVVWGNVHATCTT
FT                   EQTLNEEAIDFVVRGDGEYTFLDLIEHLEKGEENYAEIQGLAWKDREGRVIINQPRPFI
FT                   HNLDELPNPAWHLIDVPKYWDITLNTSRGCPFKCSFCYNIPFHQGHRADLSVERIIAQI
FT                   EHLQKNYKVKFIRFFEDNFTFNRKRMREFCQTVIERRIKIKWDTESRADMSEEDVALMA
FT                   KAGCTSVGIGVETGSKRMLEYLNKGVDLDEMGRTFWRFVKHGIMPRLYIMLAVPTETVE
FT                   DFTETQDMLHRMEDPPFMYMRFVPYPGTPLYNQLVQDNRIKPPESLGEWAKFSVYFATK
FT                   GNLSELSDEVINQAISHWAHSYASRRVMFTLRHNPRYLLSAVKNPSEFFKAVSSLIKNS
FT                   LPVVFNKNTNIKPLVLEAVPNKMPGKQEPRLISNYE"
FT   gene            complement(292229..292978)
FT                   /locus_tag="DehaBAV1_0280"
FT   CDS_pept        complement(292229..292978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0280"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16867"
FT                   /protein_id="ABQ16867.1"
FT                   /translation="MKVYHLIYEPSYKSAVFHHWTECNLDCKGCFCRVEKLDFGLFPDA
FT                   LERLKDKAPETAPTDFLESPEEALKLLEGCELERAVFIGTEPALDPDLPALAKALHQKY
FT                   GSYNVLLTNGVRLCDLSAIDEIIFSLKAVTNAIYQDYTGRSNEKTLDNFKKVHASGKKL
FT                   QAECLLIPGLIEADEVEKIAKFIATVDKDITLRIDGYFPIPGCPWRGATPKEVTEASQR
FT                   AGKHLAKVNYLSADLPRQGEKPLRLFG"
FT   gene            complement(293045..294457)
FT                   /locus_tag="DehaBAV1_0281"
FT   CDS_pept        complement(293045..294457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0281"
FT                   /product="reductive dehalogenase"
FT                   /note="TIGRFAM: reductive dehalogenase; PFAM: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16868"
FT                   /protein_id="ABQ16868.1"
FT                   /translation="MTNYHSSVSRRDFMKAMGLVGAGMGAATAVTPAFRDLDELTATAD
FT                   LSVYNKWWIKENDFGQLTTEIDWKVFSSFDPAKHPMPVMFGPTANGAMSAKNLANRKKR
FT                   QTDGILNKWPGSTLRDLALDGATGGNYPSIPWTGPNATTPESRGVPKWEGTPEDNTIMC
FT                   KAATHFYGAPRCGAIEVDDNVKKFFNTSVVWENIDTAYIGDDGKQHVPNKCKWILTWLT
FT                   KQNHAMNKYTLRNDPNDPWYNTVFRQGKAGENMAYSHAPQIQYQVMGFLKGLGYQAIKA
FT                   TASGNTQFGVWSGLCESGRTTYALSPDYGLMVRYIDFAITDLPLAPTKPIDAGLAVFCK
FT                   NCMTCAKVCPSNTISLEKEPSWNTKDPGNNPGLKTWYLNWTTCAEYGGPFDCVNCQTVC
FT                   PFSHDNDKSAIHNIIRGTVGTTHLFDGFFANMEKFWGYNTQLSDQAHTDWWYRDLDTWE
FT                   HDTLLGFGTKGW"
FT   sig_peptide     complement(294368..294457)
FT                   /locus_tag="DehaBAV1_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.973 at
FT                   residue 30"
FT   gene            complement(294482..294757)
FT                   /locus_tag="DehaBAV1_0282"
FT   CDS_pept        complement(294482..294757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16869"
FT                   /protein_id="ABQ16869.1"
FT                   /translation="MWFLIGIAVGAAVLGIVTLLRAKKIALTWYEWVLGIIGLGLLLFT
FT                   LQNFFGSFAELETKAAYIFLIIPGLPSLIMLALAWQLAARRQNKSV"
FT   gene            complement(294908..295174)
FT                   /locus_tag="DehaBAV1_0283"
FT   CDS_pept        complement(294908..295174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16870"
FT                   /protein_id="ABQ16870.1"
FT                   /translation="MWLGLFLGLVFGIGAMWLLKKGLVIKWHIWALSALAFLSLYGGIT
FT                   HYVGSIHEYEPTAGLFGLIIFGAISLILAGFAFQLGWRQNKSR"
FT   gene            complement(295198..296688)
FT                   /locus_tag="DehaBAV1_0284"
FT   CDS_pept        complement(295198..296688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0284"
FT                   /product="reductive dehalogenase"
FT                   /note="TIGRFAM: reductive dehalogenase; PFAM: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16871"
FT                   /protein_id="ABQ16871.1"
FT                   /translation="MSDFHSTLSRREFMKALGLTGAGVGAVAASAPVIHDVDELLASAE
FT                   ESEIKHQNPWWVKERDYFNPTVPIDWDLKWRVDGRNARLYNVQDSKWFFNAYSETQAQI
FT                   YADACMKEDPDFKWGDARRMALEAGCSFAQFGSLTLNSGTYSLHSYLGNPPNRTPERDG
FT                   YAKWVGTPEENLLLLRGAVRFFGGDDVGVMEHDTHLDRVLCTYDMNGFKNSFEDIDEPY
FT                   QTTNPKVTGIPNSYKWCFTWTLRQPMDVTRRQQGGIMRAYPNYNKYGEAESVGVWRAYS
FT                   ELAIVENRLQLFLRGLGYRGIAGGMSAITSGNAIATVAGCMEHARMGQVAVHPKFGSTV
FT                   RGTYKMMTNFPLAPTKPIDAGIYEFCKACQICAEHCPTGIIQKNDPTWTTGRNPEDGND
FT                   NGTFGEPLPYQAQGFEGWRTDIGKCPHCPVCQGTCPFNELPNASWVHTLVKATAANTTL
FT                   FNSFFAQMDRTFEYGRKPFIGYWDDFGTRPTYDLDTYR"
FT   sig_peptide     complement(296602..296688)
FT                   /locus_tag="DehaBAV1_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.486 at
FT                   residue 29"
FT   gene            complement(296763..297491)
FT                   /locus_tag="DehaBAV1_0285"
FT   CDS_pept        complement(296763..297491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0285"
FT                   /product="putative ATP binding protein"
FT                   /note="TIGRFAM: putative ATP binding protein; PFAM: protein
FT                   of unknown function DUF71, ATP-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16872"
FT                   /protein_id="ABQ16872.1"
FT                   /translation="MADVFISWSGGKDCCLSAYRAIRDGHNIRYLASIITNNTGRLWPH
FT                   LLTPEVLNMQAQAMGIPLLEWDTDISNYNSEYIKMLQYLKGKGVNHGVFGDVSIGNAQA
FT                   NEHKSWIDSVCVPNGIVSHLPLWDETRESLWRDLLESGFEAIIIAVDNDKLGKDYLGQR
FT                   LDKNLLSELKVRHQLSPTGEVGYYHTFVVDGPIFSHRLKLVKAEPIQYAVPKDVWYLDI
FT                   QECKLEKKESYSPSLKISQY"
FT   gene            complement(297683..298363)
FT                   /locus_tag="DehaBAV1_0286"
FT   CDS_pept        complement(297683..298363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0286"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16873"
FT                   /protein_id="ABQ16873.1"
FT                   /translation="MKILVIEDNKDIIEFISLAFQVGWPSVKLEIAHKGEDGLELVEKE
FT                   TPDAVILDLGLPDIDGFEVLKRIRLFSQIPIIILTVRKEELDIVRGLELGADEYMTKPF
FT                   GQMELLARLRAMLRRQNILTEEPSIIAGPFRFSYYMHKLHYNNKEIPLTTTEGMILYHL
FT                   AINSGNIISHKSLAETVWGEEYDGAADSLKVYIRRLREKIEEDPSDPKIIITKSGVGYM
FT                   LVKK"
FT   gene            complement(298344..298790)
FT                   /locus_tag="DehaBAV1_0287"
FT   CDS_pept        complement(298344..298790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0287"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16874"
FT                   /protein_id="ABQ16874.1"
FT                   /translation="MNKQIFITDLPDKLPLVWGDEERIQQIILNFLDNAFKYTPRDGQV
FT                   TLKAYTHGNKIAIEVRDTGPGILDEEKARIFKAYTRFKKQCRRESGLGLGLALAAMIVE
FT                   LHKGKIWCDSVGNQGSVFGFSIPINLLKLDKPDGNGELNENPSD"
FT   gene            298979..299257
FT                   /locus_tag="DehaBAV1_0288"
FT   CDS_pept        298979..299257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0288"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16875"
FT                   /protein_id="ABQ16875.1"
FT                   /translation="MPRKSFTPEQIINKLREAEILISQGTTLAVMLKKIEVSDCTYYRW
FT                   RQEYGGMRIEQAKRLKELEVENTRLKKLVADLSLDKAILKEAARGNS"
FT   gene            299398..300093
FT                   /locus_tag="DehaBAV1_0289"
FT   CDS_pept        299398..300093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0289"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16876"
FT                   /protein_id="ABQ16876.1"
FT                   /translation="MADIIELASKYGRYGYRRITALLNERGWRVNHKRVERIWRTEGLR
FT                   VPKKQPKRSRLWLNDGSCIRLRPERKNHVWSYDFVTARTADGRAFRMLNIIDEYTRECL
FT                   AITINRRLTSEDVIDQLFNLFIFRGIPEHIRSDNGPEFTAKAIRKWLTRLGIKTLFIEP
FT                   GSPWENGYIESFNGKLRDELLNLEIFTTLAEARVLITDWRRQYNQVRPHSSLGYRPPAP
FT                   EAIMAVVTT"
FT   gene            complement(300086..301930)
FT                   /locus_tag="DehaBAV1_0290"
FT   CDS_pept        complement(300086..301930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0290"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: histidine kinase
FT                   A domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16877"
FT                   /protein_id="ABQ16877.1"
FT                   /translation="MKANKIQINDIPKLFDMFFNESRDGLLLLDAPTGIIKLANPEFQH
FT                   QICLPLEKILGKHIWDLRPPKDRPLGKALYQQRFNSNVKLSTHEVIYKRGDNTEIIVEL
FT                   LSKLLEYDGEKNLIIITRDVTGLKRLDRISRITQFVVDNAGDAIFWLDNLGNIVYANNS
FT                   TALLLGYSKEELLSLTIFDINVNLNQLNWESYFIDSGNTSANNKETLFKAKNKQNVPVS
FT                   IISNRLIYEGVAYNCVFARDLSESNRNKEALLMTQFAIDRAADSIFWLDDQGQFIYSNN
FT                   ATSLLLGYTQAELSNMQIFEIDINFSRSIWRKEFKKLKNDTAGYVETLYRTKESDFIPV
FT                   SVMGNYLQYDGKGFNCCFVRDLSKVKQADKAYRMAQFAIDTSGDAIFWLDRNGKIIYAN
FT                   RATTELLGYTASQLSNMTVNQIDPTVVLEEWPNRFDILKSMGSDVVESILKTKDGSILP
FT                   VSIMGNYMYYDGKEYNFVFVRDISERLKIEESLRQQQTLLEKTVLERTSELTDTNSLLQ
FT                   VEITERKNAEIKLEKLLEQEAFLRQQIEGQMAQRIEFTRALVHELKTPLTPILGASAML
FT                   ANNFTEEPWHSIALNIENGAQHLNKRVDLPPIVIPLFK"
FT   gene            302601..302891
FT                   /pseudo
FT                   /locus_tag="DehaBAV1_0291"
FT   gene            complement(302909..303697)
FT                   /locus_tag="DehaBAV1_0292"
FT   CDS_pept        complement(302909..303697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0292"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16878"
FT                   /protein_id="ABQ16878.1"
FT                   /translation="MKLIDRQYLATPFYGARKIALELKKQAGLTVNRKRVRRLMQLMGI
FT                   RAIYRRPRTSTPATGHKVYPYLLRELEITRPNQVWAADITYIPMSRGFLYLVAIIDWYS
FT                   RYVISWRLSNTLDADFCVAALEEALSKGTPEIFNTDQGSQFTSEAFTALLKEHNVGISM
FT                   DGKGSYNDNLFIERLWRTVKYEEVYLKAYQDGREARISLCKYFRFYNTNRIHQSLGYLT
FT                   PVEVYAGAMDKTCNDVVKSSITKPAGMAELSLNKVPILSY"
FT   gene            complement(303835..304119)
FT                   /locus_tag="DehaBAV1_0293"
FT   CDS_pept        complement(303835..304119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0293"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16879"
FT                   /protein_id="ABQ16879.1"
FT                   /translation="MEENRRKHSPSFKAKVALEAIKGEETIAQLASRFDVHPSQVHKWK
FT                   KELAEGAVGIFGDERKHQKPDNQQLVSQLYQQIGQLKVERDFLENALGR"
FT   gene            304200..304961
FT                   /locus_tag="DehaBAV1_0294"
FT   CDS_pept        304200..304961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0294"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16880"
FT                   /protein_id="ABQ16880.1"
FT                   /translation="MFDGKEYNCGIVRDITNRKIIEEELRCKNIQLEKKGKRIKALSKA
FT                   YVQAQEQEREWISIEIHDRIIQPLTSLFQQMQTVFSVDPTNERIVDGKLLVLVKSAIKE
FT                   TRNIMNDLYPSDLGRHGLVKVMNEQLLELENRTGIKTQLSMGFCVTIPHSIEVTLYRIF
FT                   HEALLNIERHSQANNVSVYLTLSDDRTLIELLVKDDGQGFDLETILNNSKSKGIQSMKR
FT                   RAEVVGGELFLDSRRGKGTAIEVHLPVKEMN"
FT   gene            304962..305693
FT                   /locus_tag="DehaBAV1_0295"
FT   CDS_pept        304962..305693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0295"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16881"
FT                   /protein_id="ABQ16881.1"
FT                   /translation="MVNNQQYQSTKHSNHIEHKIRVILVDDHEIARQGLRTILSSASDI
FT                   QVIGEAANFEQMMDLLNDTIADVALIDIQIPGKNGIELAKELQICFPQMATLLITGYQS
FT                   NLYVAEALNCGIPGLITKDSRQGLIINAVRVAANGGSVWENAVLSETIKSMTRLCEAQY
FT                   SMRTYSGNSQFQQGKTVLLSPKQLELIKLVACGLTNKQIGSKMGYSEATVKKYLSVLMY
FT                   LLGVSKRTQVGIMATHFDINQ"
FT   gene            305957..307495
FT                   /locus_tag="DehaBAV1_0296"
FT   CDS_pept        305957..307495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0296"
FT                   /product="reductive dehalogenase"
FT                   /note="TIGRFAM: reductive dehalogenase; PFAM: 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16882"
FT                   /protein_id="ABQ16882.1"
FT                   /translation="MEMNIYHSTISRRNFMKGLGLSGAALGAATASAPVFHDLDEMITS
FT                   VPKSTTQHAWWVKERDYEDITTPVDWTVWSRREALKNPMPPGFAGNYVPKEQARLQSFR
FT                   NEIKRGITEKIPGATLRDWALSEAGRSNTTSSSWMGLDVKPPWLWGEASALPVEPWPEG
FT                   APKWESTPEDNLRTVQAAGHYFGTPQVGAMEINEHMIRMFDKDGFEHNYSASYEKPMMR
FT                   FRSEWFEDIPVGFQDANQVKHIPKSCKWAVTYIAAKENALQMTYGMRTGDPQDPWYKRI
FT                   FPLGYTTGEAYSKADYVKVQFMKFIKMLGYQTYYMGLAGGTSSNSPAGIFSGLAEEARP
FT                   ALACSPYYGNAVRHIGIIVTDMPLSPTKPIDAGIVNFCKVCKKCAETCPSGAISMETEQ
FT                   QWEPACTGNNPGRKTWYLDWFKCRPWGSPYYCPNCQTVCPFNNPNKAIIHNAVRMTAAT
FT                   TPIFNSFFSSLDKSFGYAHQRSDEERLNWWYRDLNTWQYDDVFGMGTKDPKSWL"
FT   sig_peptide     305957..306052
FT                   /locus_tag="DehaBAV1_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.769 at
FT                   residue 32"
FT   gene            307553..307783
FT                   /locus_tag="DehaBAV1_0297"
FT   CDS_pept        307553..307783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16883"
FT                   /protein_id="ABQ16883.1"
FT                   /translation="MVFYWIRSKHYKLTWYEWVIGISGALLLLFTIQNFLGSFAELQTL
FT                   AAYLFLLVTGLPSLIMLAVVWQLVVRRAKKT"
FT   gene            308094..308381
FT                   /locus_tag="DehaBAV1_0298"
FT   CDS_pept        308094..308381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16884"
FT                   /protein_id="ABQ16884.1"
FT                   /translation="MLDALSWGLHLIVLTGVCQLLDATARYLIDRDIAPDSRVMVIENP
FT                   ACPDEKITSCSLAGVSSQRFGCFSVMVGFNKLGVNKRSSNLRLKNNFLKN"
FT   gene            complement(308492..308707)
FT                   /locus_tag="DehaBAV1_0299"
FT   CDS_pept        complement(308492..308707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0299"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16885"
FT                   /protein_id="ABQ16885.1"
FT                   /translation="MTKKTIEQRFGERIRVLRKKAEISQEELAFRAGVHRTYLGGIERG
FT                   ERNPSLKNIEAIAKALEVPISDLFIN"
FT   gene            308790..309389
FT                   /locus_tag="DehaBAV1_0300"
FT   CDS_pept        308790..309389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16886"
FT                   /protein_id="ABQ16886.1"
FT                   /translation="MEDILVIKFIRSVATGLLIIMAGLALLNWVNSSESDNPISSTVAY
FT                   IPTKSSILQSPLALDSLKTSAHYADGYVFLDFYDPYRLSNYLNKYDYSETHQPYAEGER
FT                   YGMYFSDVFYLVPGDNLKIVIYSDVPLGTDLACEISEYKNNGVSGSTPAYTVERYENGY
FT                   RAIISCHATESGEYQFKLWHRDKSQSERCAIVFYFE"
FT   gene            complement(309434..309559)
FT                   /locus_tag="DehaBAV1_0301"
FT   CDS_pept        complement(309434..309559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16887"
FT                   /protein_id="ABQ16887.1"
FT                   /translation="MGRKKIAKTTTIDPQVKQRLEILSRIITRQYLIDKAKKRAR"
FT   gene            309679..310638
FT                   /locus_tag="DehaBAV1_0302"
FT   CDS_pept        309679..310638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16888"
FT                   /protein_id="ABQ16888.1"
FT                   /translation="MPRKKAPSIKETREWLDLYESGWSEALLAQRKGRDIRTIRRYLAK
FT                   AQDERRLDLVESELIKSALAKHQEQLLLTLDNLYSAIALPEPYLSLNSTGNNGRIELNS
FT                   GRVVVTQVAESTGVAVHLESEDSVLFSLVEEHLDHDLLFLMLNEWKSKLENYVRACSYI
FT                   KESRTERLSRRGADERSYNIKEKSADEQICKSICMSDLSEFIYKNSLNYIIKNDKSVLT
FT                   KARERLAINKERGELILKPGNTLLSCPGKEAEYLQKTLELLTEESLQEHKGPIQQAYRK
FT                   LEDETSKLKKVIEEIKLCNFIPGECRVCRRLKGQGGLR"
FT   gene            310635..312281
FT                   /locus_tag="DehaBAV1_0303"
FT   CDS_pept        310635..312281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0303"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16889"
FT                   /protein_id="ABQ16889.1"
FT                   /translation="MKVALYARVSSEAQDVELSIAAQLRALRDYAAKNEQQIVYEFIDE
FT                   AESGRTASRPEFKKMIALAKSNTSPFEAILVWKYSRFARNRVDSITYKTLLQKKGIKVI
FT                   SINEPLDDTPTGKLMEGIIESLDEFYSANLGQDIKRGMKENALRGFFNGSQPPLGYRII
FT                   KVKDGPKQRNRLEPESDTSSGIKTVRHIFGLAGKGQGCKEIAVTLNREGYRTRAGERWG
FT                   RTTVHKILTNEAYIGTLVWGARAGRPASKNGEGVKLGNAFPGIIDKEVFQRVQQNMTAR
FT                   QPGNIHPRTIPSQYLLSGLAFCGCGASLTGHSAKSGRHFYYQCNRKFKQGNEVCNGQAI
FT                   PKSKLESAVITQIKSRILTEENLENLVSLVNKDLELASVQYNERLAVIDTELEDIRQRL
FT                   NRLYEAIESGKLDYSDLSPRIKDLRSRQSDLEKSRIVAEAELLASGSESIKIEQVKAYA
FT                   GDLKQLLAEAEISECKAFLKTFVKKIEINGNKATLKYRLPLPGLKNGKEVLPIETLGGA
FT                   EGIRTPDLLLAKEALSRLSYSPTEHHYTKFE"
FT   gene            complement(312176..312251)
FT                   /locus_tag="DehaBAV1_R0005"
FT                   /note="tRNA-Ala3"
FT   tRNA            complement(312176..312251)
FT                   /locus_tag="DehaBAV1_R0005"
FT                   /product="tRNA-Ala"
FT   gene            complement(312287..313114)
FT                   /locus_tag="DehaBAV1_0304"
FT   CDS_pept        complement(312287..313114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0304"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16890"
FT                   /protein_id="ABQ16890.1"
FT                   /translation="MPKSKVPKIGIALGGGAARGIIHIGVLEVLEKEGLPLDLVTGTSM
FT                   GAIIGALYASGHKPQEMKEIVHNLSWKQLMPLLDLAAPRAGFLSSRKIKSYLKELIGDI
FT                   TFAELKKPFACVAADVKTGEEVIFNEGLVIDGVIASMSLPIIFRPVKNKNRFLVDGGII
FT                   TPIPAQIVRDMGADFVIAVNAIYRHDYIKQNSDSEPSVFDTAFQIVNIMSIHMAQENLL
FT                   AADIAIEPDLSGIGPGDFLKAPEIVLRGELGATDAVPHLKHLLLQKFSYAPPI"
FT   gene            complement(313092..313727)
FT                   /locus_tag="DehaBAV1_0305"
FT   CDS_pept        complement(313092..313727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0305"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16891"
FT                   /protein_id="ABQ16891.1"
FT                   /translation="MPDIFEATNGQGFKQAVVESQNLRLRIIQAADAYKAFSLIKDPEV
FT                   TRYLMWDGPKTINELRLAYQDEAADFETGHRYSFAIERVDKPGLIGSLAFRLIGYKEQA
FT                   LIGYWLGHKYWTKGYMTEAIRLSVHFAFKHLKAERIFGGVFKGNQPSRRTLEKNGFQLD
FT                   GTLRRDILVRGTWTDVWFMSLLREEWEQNPARYIPLTEEVIHAQIQSA"
FT   gene            complement(313732..315324)
FT                   /locus_tag="DehaBAV1_0306"
FT   CDS_pept        complement(313732..315324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0306"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16892"
FT                   /protein_id="ABQ16892.1"
FT                   /translation="MTTENKLGIVIGGSLSGGVDVRLNGETLVEDMAVGRYVTIQGKTK
FT                   RFLGMITDVSLGVTDQRLMLTPPASDEKFLAEILSGTAAYGDLKVIPYLVLGSDEKSLL
FT                   DGPQPVKTIPSHYAPVDIASNEDIEMVFGKEDATHFYVGNPLDMETRLCLNLPELVKRS
FT                   NGIFGKSGTGKTFLTRTLLVGMLQKGSCVNLVFDMHSEYGWEGTSEKKHKVKALKQLFP
FT                   DRVAVFTLDGESSRKRKVSVDFEVKIGYDEIEPEDISLLRQTLNLTEQAVEAVYQLRKH
FT                   FKKNWIKEANNIGDEEEDKKLLDTLSIHESTFQNLRRGLNTLTRLPFIVENAPVKAVDR
FT                   VLEYLNRNINVVLEFGRYTDITAYILVANLLTRRIYTSYRDHMEQAMAEDASKPTPLVI
FT                   TIEEAHKFLNPEVASRTIFGTIAREMRKYNVTLLIIDQRPSGIDPEVMSQLGTKITALL
FT                   DNEKDIDAVLSGVSGKNELKGVLAKLASRQQALIFGAAVPMPVAFVPREYDQNIYNEVS
FT                   QKKISSEEIEELF"
FT   gene            complement(315321..315920)
FT                   /locus_tag="DehaBAV1_0307"
FT   CDS_pept        complement(315321..315920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16893"
FT                   /protein_id="ABQ16893.1"
FT                   /translation="MDNLSTSRIGEVIDTSTTDFTAQCYQLYNTPALGALVKTGEGENT
FT                   IYAAVYHATTSSIEPGRKPIARGQDAVSEEAIYAQSPQLSKLLRSEFSCLILGHRGQGQ
FT                   ILHYLPPRPAHIHSFAESCTPEETAEFCKSFGFLNILVNSELPVPPDEVTAACLRHLSA
FT                   AAPDKQTFLVKAGKELAKLLPGQYQRLKVILERIQL"
FT   gene            complement(315990..317195)
FT                   /locus_tag="DehaBAV1_0308"
FT   CDS_pept        complement(315990..317195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16894"
FT                   /protein_id="ABQ16894.1"
FT                   /translation="MSLNLDKTALQIQDMVSELKGRDLEHQKHLQACLDGMARTPAEYQ
FT                   RLLDKVERSKTTFLLARPAEIPNAVHQPPVLPQSYRILATDGSQIDVDRHQLSRCYLIN
FT                   IGRVQLEYGKAPSASLESLPVLYARPEDMVISCGSKELAVEGTLLGIKRSVEETRHLSE
FT                   MADAAAPGLPTLALGDGTLILWSLLSKEFPEYVVENLLVDGYLKYLEQIKNLNTKDRQV
FT                   ALASYISYPRSTDVVNTLRLLYCPYEPANCISKCDQLANGKRPCDILSGITDSMLFDRI
FT                   LKPGERSALFASSSSILEKYYGEHHVYFYYLKTSEEIARVELPAWTVHCAELLNLSHSL
FT                   ILEQCRLGHGYPVSLSEAHEQAVVSGQDRRIFNQLVEEMLTASQINPSSSAKSLSKKTR
FT                   WV"
FT   gene            317320..317943
FT                   /locus_tag="DehaBAV1_0309"
FT   CDS_pept        317320..317943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0309"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16895"
FT                   /protein_id="ABQ16895.1"
FT                   /translation="MTFMLTTLLSVMVISFSGVLMPGPMFALTLSRSYHTPWAGAQIVL
FT                   GHILVELPIILLIYFGFAGFFELIWVQILLSLAGGVMIVYMGLGMIKARREASQDKASF
FT                   KHNTVVSGAAMSALNPFFLVWWATVGAMLVMKVSDYGLAGLGALAATHWLVDLAWLCLI
FT                   SFIVYRTHRLWGSRVRELVFIGCGLLLVVFGVYFIISGLKLWLA"
FT   sig_peptide     317320..317382
FT                   /locus_tag="DehaBAV1_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.326 at
FT                   residue 21"
FT   gene            317970..318995
FT                   /locus_tag="DehaBAV1_0310"
FT   CDS_pept        317970..318995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0310"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16896"
FT                   /protein_id="ABQ16896.1"
FT                   /translation="MAVGLVYNHIYLNHDTGTHVENPDRLLAIMEYLETHGLKDRLVHV
FT                   EPKRVGMRELESFHKRSYISRVEEVGFSGGGWLDQDTVISLDSYEAALYAVGGVIEGVD
FT                   KVLSRELDSVFVLCRPPGHHALPEASMGFCVFNNVALGALHALNKHKLKRVAVVDFDVH
FT                   HGNGIQHVCLNDPRLIYLSLHQIHHFPFTGDSRENGPFQNILNIPLPAGCGDSHYQKAF
FT                   DEVIGPYLRKFAPELILVCAGYDAHFADDMGEMCLSQQGFAGITRAIKHAAEEVCGGKL
FT                   VFSLEGGYHYLGLAEGVGATLAVLLNEALPPPNTKAPEGAVGNPDIDLMINDLRHINGI
FT                   R"
FT   gene            complement(318969..319904)
FT                   /locus_tag="DehaBAV1_0311"
FT   CDS_pept        complement(318969..319904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0311"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16897"
FT                   /protein_id="ABQ16897.1"
FT                   /translation="MATRKTRAASFSIASNSTLIAMKTVVGFVTGSVSILAEAIHSTLD
FT                   LIAAVIAFFGVKASDKPADIDHPYGHGKWENVSGTVEAVLIFVAAIWIIYEAVNRLIGG
FT                   SAPEMLEWGVVIMGISVVANTLVSRYLKKIAHETDSVALEADASHLTTDVITSAGVLVG
FT                   LVLVKITGWVILDPIVALLVALLIIKAAWDILNKSFGALVDARLPKEEVEAITSLINEH
FT                   TSKLVEFHNLRTRKAGSYRYVDLHLVMPKTLSVEKSHAICDHLEQDLKDKLKVDYVTIH
FT                   VEPCTEENCPECQMSCKKRHSELPDTVNMP"
FT   sig_peptide     complement(319839..319904)
FT                   /locus_tag="DehaBAV1_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.728) with cleavage site probability 0.334 at
FT                   residue 22"
FT   gene            complement(319927..320832)
FT                   /locus_tag="DehaBAV1_0312"
FT   CDS_pept        complement(319927..320832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0312"
FT                   /product="protein translocase subunit secF"
FT                   /note="TIGRFAM: protein-export membrane protein SecF; PFAM:
FT                   SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16898"
FT                   /protein_id="ABQ16898.1"
FT                   /translation="MNKIIQHRPLFIFISALIILAGLASLLIFGLKPGIEFSSGSMLTV
FT                   KFDQTVSIDELTQELRSLGQNEAIVQVTGDGDYLIRTSQLDVSQKISLETSLEETFGNL
FT                   TERGFENVDPMIARQTTQMALIAIGAALVGILLYVTWAFRRMPKPFHYGTCAVIALFHD
FT                   ALVVLGIFALLAGIFGWEINLMFIIGIMAVIGYSINNTVVVFDRIRENQLKGIHPSFEV
FT                   VVNQSIMETVVRSINSSFTVIITVVALMLFLGASIQNLSIVMLIGLIAGTYDSLFVAPS
FT                   LLVTWENGDWGKLLKPFKKA"
FT   sig_peptide     complement(320758..320832)
FT                   /locus_tag="DehaBAV1_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.452 at
FT                   residue 25"
FT   gene            complement(320825..322174)
FT                   /locus_tag="DehaBAV1_0313"
FT   CDS_pept        complement(320825..322174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0313"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16899"
FT                   /protein_id="ABQ16899.1"
FT                   /translation="MRRKNGLVFLAILAAMILAFTIVLPTDKGTLLGKGILFGLDLKGG
FT                   LHMVYQADLSNVDESDIDGVMDGVVEVISNRINPLGVTEALIQRQGDDRIVVELPGLDI
FT                   TDEQKARIGRTALLEFGELAADGEDYKWENSLGKWKPVTATIDGVEYALTSAYFKDSTY
FT                   VNRDQYGNILLVFEWDATGAKLSKEITTRLLNQQLGIFEGDEALSGDDGVPIAPVINNV
FT                   IETSGVIEGLSYNEADMLSNQLNAGRLPVPLESIYEQTVSPTLGQNFVDLAVKAGLVGI
FT                   ILVMIFMIAFYRLPGLLSSIALVFYGVIVMALFKLVPVTLTLAGIGGFIVSAGMAVDAN
FT                   ILIFARLKEELLSGKTLGAAVEAGFSRAWSAIWDSNVTTFIACGILFWVGGTIAAGAPV
FT                   KGFAVTLFLGVAVSMFTAIFVTRTLLRLFVGTKTGKKLALFTTQTRGKNE"
FT   sig_peptide     complement(322109..322174)
FT                   /locus_tag="DehaBAV1_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.576 at
FT                   residue 22"
FT   gene            complement(322188..323684)
FT                   /locus_tag="DehaBAV1_0314"
FT   CDS_pept        complement(322188..323684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0314"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase, HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16900"
FT                   /protein_id="ABQ16900.1"
FT                   /translation="MTNKNQLLHTDKKTAALLEDLHRLLSAEGTETYLVGGFLRNLVLK
FT                   KPTADIDLCVIGNGFSAASKISRHFKATQIVLDADNDVTRVMLPGFQLDISGTPDISAN
FT                   LARRDFNLNAMAAPLSALNHGNLQIHAIVDPMQGLRDIENRVIRVTSSEVFRADPIRLI
FT                   RAIRLSAELGFELDEQTQSLITTHAGLISTVAGERIREELLKLLETSQTGIWEKCLELG
FT                   LLLSIFTELDPCYRHPQPYEHTWDVLEHSIKTIYALDAILGKSVWPYQKPEITSEIYRD
FT                   SNFEKYFIQQISGTSRIRTLAKLAALLHDIAKPQTRSTDPDGRVRFTGHPLEGSRITSE
FT                   ILTRLRFSKKEISLVEKMVCYHLRPVQMNPDGQLPSSKAIYRYFRDLSEAATATLYLSL
FT                   ADHLATDGPNLMVANWQEHVNIVAHILSEQKRQLTRLTPKRLITGTDLIERFALRPGPR
FT                   IKILLGEIAEAQAAGEIKTRREAFKFISQRLGGKPENNLN"
FT   gene            complement(323844..324245)
FT                   /locus_tag="DehaBAV1_0315"
FT   CDS_pept        complement(323844..324245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0315"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16901"
FT                   /protein_id="ABQ16901.1"
FT                   /translation="MSKATSSNGWADLGEIIRQQRVKIPLTLQELAAKTSVSPSHLGRI
FT                   ERGERFPSARILKRIAHPLGFEEDELFTLAGYLTPQKDSISEMEAEYTSIPRQLDPYVA
FT                   KVLAQEPIELQRAVIAILAMLKSISKSMT"
FT   gene            complement(324505..326952)
FT                   /locus_tag="DehaBAV1_0316"
FT   CDS_pept        complement(324505..326952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0316"
FT                   /product="replication restart DNA helicase PriA"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: helicase
FT                   domain protein; type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16902"
FT                   /protein_id="ABQ16902.1"
FT                   /translation="MAFAELAVNTPVLRPGSFSYSIPLGLEIKPGQAVWAPFGPKIVQG
FT                   IVLEVSDQPAFGQTREICGVISDTPLLSFHQLNLAAWISQTYLCSIYEALSPMLPPSFE
FT                   RRSVAYISLEPSPLNKSEKPPATLSPSLQKIFDWLQTRDITPQTELENIFGKKTTQTAI
FT                   PKLINQGLINRTYQISPVRTQTKFEKHFGLSEQALAFIKDQTLTKLSPRQTEVFECLRE
FT                   NPQGISKSRLNLLVKNNAAILKALEKKELILSEEHQVFRQPINYSQIETLPHLKLSPPQ
FT                   EKCLESINRSLNTPPEDDQNPRTFLLHGITGSGKTEIYLQALAEALRLGKKAIVLVPEI
FT                   SLTPQTIARFAGRFPGRVAVLHSRLSPGEQFDEWQRIKNGQADIVIGPRSALFAPLDKP
FT                   GIIIIDEEHEWTYKQQNSQPRYHTRTVALKMTEEYGAVLVLGSATPDIDSYFKAQNGLY
FT                   QLLELPERLTPYRGASLPKTELVDMRTELSEGNRSIFSRNLHASIEKVLAKHEQAILFI
FT                   NRRGGASFIQCRDCGYVAMCKSCDTPLTYHPDQENLVCHQCGRHYPNPLTCPNCKSRRI
FT                   KYLGMGTQKLEEETGLAFPQAKLLRWDSDVTKGKDSHQQIMDKFSRHQADILIGTQMVA
FT                   KGLDLPGVTLVGVINADISLNLPDFRAGERTFQLLAQVAGRAGRGLAGGKVVIQTYTPE
FT                   NYAIQSAVCHDYPGFYAKEIAYRRELNNPPFQKLACLVFSHLNHDFCQQQAILLAQTLR
FT                   EKADSTGSGTLEILGPAPAFIQRLRGRYRYQIILRSPNPANFLRDINLGQGWSIDIDPY
FT                   GLC"
FT   gene            complement(326973..327368)
FT                   /locus_tag="DehaBAV1_0317"
FT   CDS_pept        complement(326973..327368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0317"
FT                   /product="LSU ribosomal protein L19P"
FT                   /note="PFAM: ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16903"
FT                   /db_xref="GOA:A5FSC8"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSC8"
FT                   /protein_id="ABQ16903.1"
FT                   /translation="MEETMNNQEAPETSEEETVAVENTKAEKVLPNFGPGDTIKVHARI
FT                   KEGDKERIQMFQGVVLKVKQAADGGNFTVRRISYGVGVERTFPFLSPNVTKVEIMKKGR
FT                   VRRARLFYLRKLSGKAARIKEVKQTPS"
FT   gene            complement(327492..328238)
FT                   /locus_tag="DehaBAV1_0318"
FT   CDS_pept        complement(327492..328238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0318"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /note="TIGRFAM: tRNA (guanine-N1)-methyltransferase; PFAM:
FT                   tRNA (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16904"
FT                   /db_xref="GOA:A5FSB5"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSB5"
FT                   /protein_id="ABQ16904.1"
FT                   /translation="MKIDVLTLFPEMFQSPFEESIFKRATDNNLVRLEIHNFRDFAHDK
FT                   HHAVDDSPYGGGAGMLLKPEPLFEAVEDVLREDPTPAPVILLSPQGRSFNQEVARELAK
FT                   HERLIIICGHYEGFDERVREHLSTDEISIGDFVLTGGELAAMVVIDAVSRLIPGVLGSG
FT                   ESSQDDSHSNGLLEHPHYTRPPVFRGWGIPDVLLSGNHAQINRWRRKESLRRTLKRRPD
FT                   MFEKIPLSKADRKLVDEILAEENTQG"
FT   gene            328421..328849
FT                   /locus_tag="DehaBAV1_0319"
FT   CDS_pept        328421..328849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0319"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16905"
FT                   /db_xref="GOA:A5FSB6"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSB6"
FT                   /protein_id="ABQ16905.1"
FT                   /translation="MFFGEFEYKLDEKGRFPLPPAIRPSLKDGLILAPGTGEKCIYAYP
FT                   LCEWKKLAESLKSTTVAPSKMRRLNRALFALAFDVNLDAQGRLTLPAPLKTYAGVNIEV
FT                   IVAGVNNYLEIWDKETWESEKKASQEQAWQIIETLEEH"
FT   gene            328856..329905
FT                   /locus_tag="DehaBAV1_0320"
FT   CDS_pept        328856..329905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0320"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16906"
FT                   /db_xref="GOA:A5FSB7"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSB7"
FT                   /protein_id="ABQ16906.1"
FT                   /translation="MIEYPHIPVMLEESIQGLGVIPGGRYVDCTLGAGGHSEAILEHSY
FT                   PGGQLLSIDADPSAITLAAERLKSFGSSVLLVNDNFANLKDICQRYEYMPVHGILFDLG
FT                   LSSMQLDRQESGFSFQTEAPLDMRFSPEQELTAADIINGYDVTELSDLIWKYGEEPFSR
FT                   RIARAIAEKRPFKTTTELAAAIERAVGGRHGRIHPATRTFQALRIAVNEELSHLESALS
FT                   QAHSLLGHGGRLVVISYHSLEDRIVKQYFQKEAKGCICPDDIPQCVCDHQPSLRIINRR
FT                   VITPSDEEISRNPRSRSAKMRVAERIIEPGEGRFFSSREDELVNHVSRTGSVQHGQAKH
FT                   KGVVQRGGS"
FT   gene            329976..331202
FT                   /locus_tag="DehaBAV1_0321"
FT   CDS_pept        329976..331202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0321"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16907"
FT                   /protein_id="ABQ16907.1"
FT                   /translation="MKNRIVTAIDVGTTKICTIIAEVNPVGGVNVVGVGIGPSQGLHKG
FT                   LVVNINDARESIRESIRKAEQASGYKVESAYVGVTGRHVTSMNNKGVVAITRNDRLVRS
FT                   DDLKRVMATAQNISVPNDRKLLHVIPRTYAVDGQSGVKNPVGMHGFRLDVETHIITAAA
FT                   TSVQNLVKCIRGLGIDIDDLVLEPIASSEAVLTDDEKQVGVILADIGGGTTDICVFKDG
FT                   SIWHTAIIPVAGYQLTRDVAIGLGLPFDVAEEMKKRYGSVLPVYETKMESPSPICEDGH
FT                   GVSYQDLCDIIRARVEEVLRLIMLEIPNSDYDSLVPAGLVLTGGSSNLAGMETLGRDIL
FT                   RIPVRVGNPDKVYGIVDSLHDPAYATGVGLLLWGAKHQPVKKSWLDNIGFFGRMRNLLK
FT                   GFAGLFGTN"
FT   gene            331242..332372
FT                   /locus_tag="DehaBAV1_0322"
FT   CDS_pept        331242..332372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0322"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16908"
FT                   /protein_id="ABQ16908.1"
FT                   /translation="MAKTSFVPNPARIKVFGCGGGGCNAVTRMVREEIQGVEFIAINTD
FT                   AQALAITEAPIRLQIGERVTRGLGAGGDHNMGQKAAEESRDEIREIVNGADMVFVTAGM
FT                   GGGTGTGSAPIVAEESKKSGALTIAVVTKPFTFEGAHRASTAKEGINRLLGKVDTLIII
FT                   PNDRLLDLCDQKTGVDAAFKMADDVLRHGVQAISEVITVPGLINLDFADVRAVMRDAGP
FT                   AWMSIGYGSGKNRASDAAKSALASPLLDVSITGSKGVLFNIVGGPDLSLMEVNEAADVI
FT                   KQAVDPDANIIFGVASDASMGSNVKITLIATGFVSKMGMAEEEGDDAITRQLKGIKTED
FT                   ELDVPSFLRRPLFNRARPVAPPVDTRSNKPSSRISW"
FT   gene            332516..333043
FT                   /locus_tag="DehaBAV1_0323"
FT   CDS_pept        332516..333043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0323"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16909"
FT                   /db_xref="GOA:A5FSC0"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSC0"
FT                   /protein_id="ABQ16909.1"
FT                   /translation="MNCPYCSHPDSKVIDSRDVDDGVRRRRECVVCGQRFTTYERFQPA
FT                   GLFVVKKDQRREEFNKEKLLSGLRRACEKRPLPAGAVDKVAGDIEAELYNMGKAEIPST
FT                   LLGDMVMERLKMLDNIAYVRFASVYREFTDITQLKKVVDNLVNGQDEGIHKGQLSLLPE
FT                   DKAAPKTRYQRR"
FT   gene            333045..335645
FT                   /locus_tag="DehaBAV1_0324"
FT   CDS_pept        333045..335645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0324"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit, N
FT                   terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16910"
FT                   /protein_id="ABQ16910.1"
FT                   /translation="MVNHVSGKKPTPVNRNRVARAMFVAAASMGISDRVQIETLISQLI
FT                   KRLEKPVGLPGMEDLLPSDLKAPAVLATDDEIDIMVKEVLDAGNKDKQNQIETQAKEEE
FT                   PMPVKVQVKSEMKADARTEGLKLTDNAMCVLERRYLKKDKQGKTTETVEDMFRRVARTI
FT                   AMGELIYNPKADVRSREDEFFNLMTRLEFLPNSPTLMNAGRELGQLSACFVLPVDDSIE
FT                   SIFDAVKHTAMIHKSGGGTGFSFSRLRPEQDRVGTTGGVASGPVSFMRAFDVATDVIKQ
FT                   GGTRRGANMAILSIDHPDIMKFVHAKDKAGVLTNFNLSVAITDKFMQAVKDGVDYDLLN
FT                   PHNGEVVSSLNASEVFNKIVHMAWKTGDPGIVFIDRINAYNPTPQLGRIESTNPCGEQP
FT                   LLPYESCNLGSINLSRMVTVSGGQNTVDYKKLSRVIKSAVRFLDNVIDVNKFPLPQIEE
FT                   MTKKSRKIGLGVMGFADMLLELGVPYNSENSIKLAEEIMCFVNDEAHKFSSELAVERGV
FT                   FPAYRGSIYEKSGRPMRNASCTTIAPTGTLSIIAGCSSGIEPHFALCFTRNILDGTKMI
FT                   EVNPYFERAAKEGGYYSEELIKSLAEGAHLDEVDVPQDAKDLFVTAHQIVPEWHVRIQA
FT                   AFQKCTDNAVSKTVNFSRDAGECDVAEVYKMAHASNLKGITIYRDGSREDQPMSTGKAE
FT                   NKIETPAVAVNPNLMPRKRSKVTQGITERVTTGCGYIYVTVNSDEHGICEVFSSLGKAG
FT                   GCASAQLESTCRLISLALRSGMEVASVVKQLRGIRCPSIAWDDSKAVLSCADAIASVLE
FT                   KHVNGYSQPVAASTKTGSVSGLVRNIAGQCPECGSILVYQEGCFICPGCGYTKC"
FT   gene            335639..335758
FT                   /locus_tag="DehaBAV1_0325"
FT   CDS_pept        335639..335758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16911"
FT                   /protein_id="ABQ16911.1"
FT                   /translation="MLKNIGGYKMENTKDMLALVLVAAGFMYLMIVTVAGLIA"
FT   gene            335875..336459
FT                   /locus_tag="DehaBAV1_0326"
FT   CDS_pept        335875..336459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0326"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16912"
FT                   /protein_id="ABQ16912.1"
FT                   /translation="MTDTLERVMIFIDGSNMYHYLKSHFQRTDIDFGCFCSKIAGHRRL
FT                   VRIYYYNAEVGRKEEPERFNDQKKFFTSLEKIPYMELRLGRLVYSGWPATPPYEKGVDV
FT                   LLSTDMLSHGFKNNFDTAILVAGDSDFVSALQAVKDNGKNVEVALFGKESTSVELRKVA
FT                   DKIIAVDGRLLRNCWKQQRNNYGTQRPPQES"
FT   gene            336428..338062
FT                   /locus_tag="DehaBAV1_0327"
FT   CDS_pept        336428..338062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0327"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16913"
FT                   /protein_id="ABQ16913.1"
FT                   /translation="MARKDRLKNRKELSRTRVSYASSQRVAGESGVVIKDWGGRLPLAV
FT                   AYPNSYYVGMSNLGLHTLYRLINNYPEYLAERFFWEGGTAKGRPTLSVESRRPLTDYVA
FT                   LLFTLSYELDFLNIPSMLADCGMPLYARERDEAFPLVIGGGACIMSNPSPVADFFDAFC
FT                   IGEAEAILPELLAVLSETAGESKGLILERLAKIPGLYVPSIPPEQPIERVFPSELTQGV
FT                   GTAVFSTATELGEMYLMEVERGCGHQCRFCLVAGVFCPLRYHPLELLLKQAEEGMLKRK
FT                   RIGLVGPVVSDHPQVTELVSRLRNMGFGLSVSSLRIKPLSEKMLDELALSGVSSLAMAP
FT                   EAGSERLRRIIRKGITEDDIIRAAALVAEKGFRQLKFYFMLGLPGEADEDVEEMIVLAE
FT                   KAQQAMSSKGRGVRLSLNIAPFVPKPATPFQWLGMEDAALIKRRLDTIRLRLEGQGIEV
FT                   RAESPEMSQIQAVLSRGDSSLSNLLATAGGDSLACWKRAAKSLEIDSQSLAKTRFDLAD
FT                   ELPWHMLENQKQRQKLETEYKAAFKEI"
FT   gene            complement(338112..338561)
FT                   /locus_tag="DehaBAV1_0328"
FT   CDS_pept        complement(338112..338561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0328"
FT                   /product="GatB/Yqey domain protein"
FT                   /note="PFAM: GatB/Yqey domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16914"
FT                   /protein_id="ABQ16914.1"
FT                   /translation="MPTLKEKFGEEVKLSLRQGEKLKCSVLRMLVSAISYAEIAKQKTF
FT                   TDEEIIGVIAKEIKQRRESIDAYKQANRPELVEKEQQEMEILQSYMPEQMGEAELTLII
FT                   KKVISETGASTPQDKGKVMGKLMPLVKGKADGQMVNAIVTALLNN"
FT   gene            complement(338563..338757)
FT                   /locus_tag="DehaBAV1_0329"
FT   CDS_pept        complement(338563..338757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0329"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16915"
FT                   /db_xref="GOA:A5FSB3"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FSB3"
FT                   /protein_id="ABQ16915.1"
FT                   /translation="MADVRPENNESFESMLKRFNRKVQQDGILSEARRRTRFERPPTRR
FT                   KRKDAAKRRLAIKAARKAT"
FT   gene            complement(338931..340652)
FT                   /locus_tag="DehaBAV1_0330"
FT   CDS_pept        complement(338931..340652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16916"
FT                   /protein_id="ABQ16916.1"
FT                   /translation="MALLIVALPLSPVSAAASITLYPNSGPAGSLVNFSIATTATNGTT
FT                   AWILFGGTQITTATVSGGSASGSFTVPTTVTRGAYTVSTLGLESVASATFTVTPSITLA
FT                   SATGYVGDSVAVTGSGFAPSTTVNFYLSGSTTAFAHLNSSSTGTVSGTITIPPAKQGVL
FT                   SITANDSGTPGTAPVNFTINPKITLSTDNPGVGDSITVTGSGFYEGIIQISVDSGTAAN
FT                   AGVSVGSNGSFSTTFTIPALTRGIHTLTANDAWNKSAQATFDIAQKISVTPTSGTVGTS
FT                   ITVKGSGFNTTGSVTLTYFGQSVTVALTSGTFTTTFVIPGVQAGVYTLSATDGSVIATT
FT                   TLTVTTNITMSPTNNASTPGSVGQEITLTGSGLKANDTVLVTFDSAQLTITPSPIVDSN
FT                   GGFSLIFKIPATTAGPHTITVISGTTSKTFTFFVEGTAPATPAPLTPEMGLKAKQPVVF
FT                   DWEDVTDPSGVTYVLEIATDENFATILYQIKDLTDSTYTMTEAQKLESVSSDSPYWWRV
FT                   KAVDGAGNASAYTGAGSFTVGFSLDLPAWATYVLIGIGGLLLLALGFWLGRRNADY"
FT   sig_peptide     complement(340599..340652)
FT                   /locus_tag="DehaBAV1_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.478 at
FT                   residue 18"
FT   gene            340905..341219
FT                   /locus_tag="DehaBAV1_0331"
FT   CDS_pept        340905..341219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16917"
FT                   /protein_id="ABQ16917.1"
FT                   /translation="MTLLENDLRIEEADLLPELTSYPDQGCEFSKTCLGCPLPVCIFDQ
FT                   PRGRQRWLKRQRDKEIVSLFQHGQSERELADRFRLSIRTIQRVLKKSLAGVNINRNAEV
FT                   "
FT   gene            341229..342593
FT                   /locus_tag="DehaBAV1_0332"
FT   CDS_pept        341229..342593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0332"
FT                   /product="phage portal protein, SPP1"
FT                   /note="PFAM: phage portal protein, SPP1"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16918"
FT                   /protein_id="ABQ16918.1"
FT                   /translation="MVQVFNPGELASRDLDRLKRYMNLLDFYQGKQWEIRPSRNEKQLT
FT                   FNYARVVVDKLCSYLMSGVNFGAEAVTDQGSEKAALARSMLNEVYQQNNLEQLDLETEI
FT                   DCAVLGDGCFKVIWDAAAGRVRVSAPDIQGIYAWWSPDDMSRIYRVASRYALNSEEAAV
FT                   SYGLELSAKRSFLTEVWTEETFELWLDEKLLESKPNPYGFIPFVIFPNLREPKRFWGVS
FT                   DLDEIMEPQRELNRALSQLSRILELSGNPIAVLENVEQSEDIAVRPGAVWNLPEDTRAY
FT                   LLDLLQGGGVGLHINYVDLLYRTLHDIAEAPRAAFGGSGRDLSGVALEIELQPLLQRVW
FT                   RKRLIRSVAYRKRSGMILRLLEKYRGLDFNGVDPSISFSPVLPRDLSVVVGNEQTMVQS
FT                   GIHSRRKAMNELGIKDPDAEFERWCEERRRILEMNRDSSVKSGKQRQSERVALEE"
FT   gene            342617..343066
FT                   /locus_tag="DehaBAV1_0333"
FT   CDS_pept        342617..343066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16919"
FT                   /protein_id="ABQ16919.1"
FT                   /translation="MKTTEKEPEPLVSETEAVSTEDSAESMDSLKERLALSQSRAEELL
FT                   KSQQEACERVTQLEVELRLAVESYRRLMVEQNPEVIPELISGQTVEEINRSLEVSRKLV
FT                   ARVKQSLEKDAVLARVPLGQASRQKPDFSSLSAREKIKYAVGGTN"
FT   gene            343069..343989
FT                   /locus_tag="DehaBAV1_0334"
FT   CDS_pept        343069..343989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16920"
FT                   /protein_id="ABQ16920.1"
FT                   /translation="MAISLTEASKLSNDILKQGVIETIVRESPVLANMPFIEVMGNGLT
FT                   YNQEKTLPDISFYDTGDTWDESTPTFEQKTAQLKIMGGDADVDNFLKTTRSNVQDLETA
FT                   IIELKAKALKDKFEEVFIYGDSAVSSKQFDGLRKLINPASASSQLVAAGASGASLSLAK
FT                   LDELVDAVKGGKPDMLLMSRRSRRKLNALLRAGGGMLETDRDKWGNFIQFWDGIPIGVS
FT                   DWILDTHVVAEGLETATSGGGCSAIYALQFGEGGLCGLSSPGFVQVEALGSLEDKDASR
FT                   TRVKWYCSLALFSAVKAAALIGVTD"
FT   gene            344057..344656
FT                   /locus_tag="DehaBAV1_0335"
FT   CDS_pept        344057..344656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16921"
FT                   /protein_id="ABQ16921.1"
FT                   /translation="MNLVAMRTLVRRDLHDEDEVNRRWTDAELDRHIGHALEELSRSVP
FT                   LETECLIPVTDGDREFTLSTLEGFIRLQAVEYPIDSYPPVFHRFDCRADKMKLLDEVLP
FT                   EDGYIRLYYSASHTMTAESTSLPSYLEDLVAIGAEGFASLEWAVFCVNRVNSGGTDTPK
FT                   VFEAIGRERLVYFRNELRRLCSQNKVRVNSLFTPAG"
FT   gene            344703..344942
FT                   /locus_tag="DehaBAV1_0336"
FT   CDS_pept        344703..344942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16922"
FT                   /protein_id="ABQ16922.1"
FT                   /translation="MNFYRELWSRIGGRPWTYILRDFWHKYEGLCILALVAGGAFLGHW
FT                   LWHNVLWYLLNFTFGYIAGHLFWGKDYIPDQKGD"
FT   gene            344943..346943
FT                   /locus_tag="DehaBAV1_0337"
FT   CDS_pept        344943..346943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16923"
FT                   /protein_id="ABQ16923.1"
FT                   /translation="MYPLSPSLLSAQQSACACPKVKLTVRNRLDGASKLKWEEIYAGTQ
FT                   PEGYHSVAIAGDGAMIRIRIGDNPDNYRLYFQRVAQPAPGADFGQWTYSGSYFFSRAGV
FT                   VSFGNKVCVVAVDYNRNMFIFESTNNGQTWSAPVKIGTSNTSHVYGVSIAFKPNGDMAV
FT                   FYIERTLLCYKKRVNGNWQSRQQWDKSTDVLSGVSAVYDGDWRLAVSGTDLFGCSKVWS
FT                   LSLGDGADFAVGVWSSLYEFASAPAGGLYSYTSVSMDCPDVFRVCYLENYTGSVADKRA
FT                   FLSHLVADTGFNDNIWRESVPTSMSSDYGFAMVNDGQYVYLAGISRIYRAKIAQNSLEI
FT                   GADILRLESACGNLKGSLAVELDNSSGRYTGAGNGELDMLAPGSEIEFYPGYETESGNE
FT                   YGPGQLYVIQSLGRRIAGGKSSLLIRAEDAFCRLKRWRATNQMRWNRNSSQLSVRGILG
FT                   YVLSKAGIRMEVLNASAQLGNFYPDFTIHVGDDGFELMGKLLSFVTDLVFLQGNCLYSI
FT                   YPQAADNPLYSYGVTHPVFSGIYADTSSEVNRVVLEGVDAASNLFMVQGFVWEEIYQNH
FT                   DLTLRLYDRNINTLAQAGERLDSCLRMAVLKQQMGQIVVPINCGQQLFDVISISQPECG
FT                   LEGLIRRINGIRTSYEPCKGIYRQELSLGKV"
FT   gene            346953..347165
FT                   /locus_tag="DehaBAV1_0338"
FT   CDS_pept        346953..347165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16924"
FT                   /protein_id="ABQ16924.1"
FT                   /translation="MDIKRAVLKVFNSTSYTASIQLAGDYKSVLEEVKVARNIPSSEML
FT                   AGRNLGVWFYDDHNTKDTLVIAVYS"
FT   gene            complement(347280..348653)
FT                   /locus_tag="DehaBAV1_0339"
FT   CDS_pept        complement(347280..348653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16925"
FT                   /protein_id="ABQ16925.1"
FT                   /translation="MINKLRPYQQDVARAVLRSIFNQQGQTFSVEIARQGGKNELSSQL
FT                   ELLLLTLYMFEPKNLVKCAPTFKPQLNISMMRLKDRLNEAGFTNIYHTEGGYIIRLNQA
FT                   RAVFLSAEPSASVVGNTAHLLLEVDEAQDVNKEKYSKEFKPMGATTNVTTVLYGTTWDS
FT                   FSLLEEIKEQNIEKEQKDGLKRHFRYDWEAVAAHNPAYLAYALSEKERLGENHPLFLTQ
FT                   YRLLPVSGGGGMFSNEQLDLLKGNHPCQIYPEKGKVYVAGLDLAGEDSQTGGISPTTVN
FT                   LRRDSSVLTIAELDYTFAKAPYNLPQVRLVCHYSWQGTRHALLYEKLVELLGKVWKCRK
FT                   VAVDATGLGQPVASFLRESLGSRILPFAFQPASKSRLGFNLLSAVNSGRLKMYAANGSS
FT                   EYTLFWQEMGLARADYRQSQQMNFYVETTRGHDDYLMSLALCLEAAEAYAPRSAKGSN"
FT   gene            complement(348643..349005)
FT                   /locus_tag="DehaBAV1_0340"
FT   CDS_pept        complement(348643..349005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16926"
FT                   /protein_id="ABQ16926.1"
FT                   /translation="MTQEFIERKKGAPYGNQNARKHGFYSRVLDTDELEDYEQATLTEG
FT                   IDEEIALLRVKIKSVLRHDPDNLKLLMQAVTTLSLLLSARYNISRQDKGGLKEAIFNVL
FT                   RDVAVPLGIIKATFDK"
FT   gene            349113..349808
FT                   /locus_tag="DehaBAV1_0341"
FT   CDS_pept        349113..349808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0341"
FT                   /product="protein of unknown function DUF164"
FT                   /note="PFAM: protein of unknown function DUF164"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16927"
FT                   /protein_id="ABQ16927.1"
FT                   /translation="MQLAKELYQLQELELDLESHLMQASKLQAILQDDSALRQAENNLV
FT                   EAASHLKEQQASLRELESQSADLDAKINEIKKSLYSGRINNPKELSNLSKEQEILEAKR
FT                   TQIDDQALAGMDRLEELQTNCNQVMEGLETARSEWQQNQTQNTQSLNLILLEIEKLKNE
FT                   RHEFMSCFEQPDLVLFQTLRKSKGRAVSKVEQGNCRGCGLKLTAAWMQRARAGTLVQCS
FT                   GCQRILYLD"
FT   gene            349848..350231
FT                   /pseudo
FT                   /locus_tag="DehaBAV1_0342"
FT   gene            350362..350665
FT                   /locus_tag="DehaBAV1_R0006"
FT   misc_RNA        350362..350665
FT                   /locus_tag="DehaBAV1_R0006"
FT                   /product="RNAse P"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 243.33"
FT   gene            complement(350773..351390)
FT                   /locus_tag="DehaBAV1_0343"
FT   CDS_pept        complement(350773..351390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16928"
FT                   /protein_id="ABQ16928.1"
FT                   /translation="MLGRLLLVLLGLSMLSGIYLAVQQSHLSAFLNTTSQTNFVIPSYL
FT                   HLCEEAVDQATLGLNILLAVSFVSGMFYLYLSHAFYVNLHRITPRYKSRRVFPGFLIPV
FT                   INLVFPLLFTAETWQLSKQPLETQTALPEYKINLLFKFWWILCLLAVTLFVFPQISPFA
FT                   LSDSYSSRESVANIFTVATVIAASGGSFILFYQFNTRLKLSN"
FT   sig_peptide     complement(351325..351390)
FT                   /locus_tag="DehaBAV1_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.791 at
FT                   residue 22"
FT   gene            complement(351502..351675)
FT                   /locus_tag="DehaBAV1_0344"
FT   CDS_pept        complement(351502..351675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16929"
FT                   /protein_id="ABQ16929.1"
FT                   /translation="MRSIIYNQSNPLVNLTNGWYLCILSILALKSSLFEASRVPDFIIW
FT                   ENHPPADITCNS"
FT   gene            351733..351963
FT                   /locus_tag="DehaBAV1_0345"
FT   CDS_pept        351733..351963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16930"
FT                   /protein_id="ABQ16930.1"
FT                   /translation="MEDLNISALDFVQFCHRRCGQEWPELYDEMCRVAGRRLYRGMGYY
FT                   ELNNLGIPLDLANLDSTLALVDQFKSNQKCS"
FT   gene            352061..353194
FT                   /locus_tag="DehaBAV1_0346"
FT   CDS_pept        352061..353194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0346"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   PDZ/DHR/GLGF domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16931"
FT                   /protein_id="ABQ16931.1"
FT                   /translation="MTFRIKVLLGTILSMVGLLGSFALGYFSGGVSALNSDENLSSIVT
FT                   AWQIITTEYVEPDIIDQAALAEAAIKGMMDELNDPHSVYLNAEDYQASLEYDDGQYVGI
FT                   GATVQIEDGVITLIPYEGSPAALAGIQAGDILLEVDGQSVDGFSLADLSPLVRGEKGTL
FT                   ITLKVERSISAQPLLFNVTRDEILIPSVSSEMMGDIAYIRLSRFSERTDAELEQVLKNL
FT                   GDAKGIVLDLRGNPGGLVSSVINVTSRFVSSGVVLTTVDNAGNSEEYKIVPKAVTTSLP
FT                   MVVLVDQYSASGSEALSGALQDYGRATIVGKTTYGKGSVNRTFDVTGNTGIYLTIGRWY
FT                   TPNGRMIEGQGITPDIELELAGDEAVNWALNFMHGEA"
FT   sig_peptide     352061..352162
FT                   /locus_tag="DehaBAV1_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.837 at
FT                   residue 34"
FT   gene            353310..354350
FT                   /locus_tag="DehaBAV1_0347"
FT   CDS_pept        353310..354350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0347"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, alpha
FT                   subunit; PFAM: phenylalanyl-tRNA synthetase, class IIc;
FT                   aminoacyl tRNA synthetase, class II domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16932"
FT                   /db_xref="GOA:A5FS95"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS95"
FT                   /protein_id="ABQ16932.1"
FT                   /translation="MEEIKNITDITQSALAELEAITDLKDLEAWRVRYLGKKSLLTGAL
FT                   RNLASLPIEERKAAGAAANEAKAALEAAFLQKEQISKEKQFASRNEGLDITLPGRPWPI
FT                   GRIHPLTQVTNEVTTIFSSLGFSVVEGPEIEDDYHNFEALNIPEDHPARENMQTFWIDR
FT                   PNDNGRLDTLLRTHTSPMQVRYMEKNKPPIRIVVPGKVYRYEATDATHIPMFTQVEGLV
FT                   VDRGISMAHLKGTLMEFCRRFFGANRKVRFRCDYFPFVEPGVEVAVSCTCGGKKECSVC
FT                   HGSGWLEILGAGMVHPKVLERVGIDSEQYTGFAFGMGLERLPMLRYGIDDIRLFYSNDT
FT                   RFLRQF"
FT   gene            354352..356781
FT                   /locus_tag="DehaBAV1_0348"
FT   CDS_pept        354352..356781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0348"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="TIGRFAM: phenylalanyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16933"
FT                   /protein_id="ABQ16933.1"
FT                   /translation="MKIPLKWLKEYLPTDIQPAELAERMTMAGTEVTVLNSHKDKWPNV
FT                   YVGQIMEVNRHPNADRLVLVKVDWGQGQETVVTGAPNCKVGDKVVFARTGAVLIDGHNG
FT                   KEIVLKPAVLRGVESCGMVCSERELGLSDEHEGILVLPADALVGMLASEYLGEVILDLE
FT                   LTPNRGDLMCVTGVARELGALIDRLPAISDPDFKATGPDIKEKIEIEINNSKLCTRYTA
FT                   SLIEGIKLGESPDWLKERLIACGMRPINNVVDATNYVMLEFGQPLHAFDYDQIKSRHII
FT                   VRPAAEGEVLTTLDGVERKLSPDMLLITEPDRIIALAGVMGGENTEVTEKTSRILLESA
FT                   TFDKQSIRKTARGLKLQSEASARFEKGLSYELAPIALKRATQLILEIAGGQAASGLIDV
FT                   LPNKKERNGIVLSLAKVNQILGYEKEPPDACKIAKRLGFIWLPEYVPGMEEFGYGATED
FT                   MVRIYPGYWRMDIETDIDMIEEVARIAGYHTIPCLPLDKAIPKIETPPLPGMKRFLRQI
FT                   LSGYGFQELISYSFTSREMLSRVSSGAEPEFLAISNPMSSEQEVMRTSLRPSLYASLAA
FT                   NRRFEKDGLRLYELGRVYLPKENKKQEEPEMLCAVIAGGSSQSRWQRNTAGFDFFDVKG
FT                   IVESMVSRLGLSADFVVSHEHGLSHGYQAGILVGDMPVGILGQVSPQIADIFDITEPVY
FT                   MFEINLSKLITRAMVRRKFNPINRFPAVERDLALVIDRHITNRQVIDILSEYDLVKNAE
FT                   LFDMYQGKQIAENKKSLAYHLLFQSDTHTLKDAEVDGVMSQILGRLNTETGAVLRS"
FT   gene            356871..357506
FT                   /locus_tag="DehaBAV1_0349"
FT   CDS_pept        356871..357506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0349"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16934"
FT                   /protein_id="ABQ16934.1"
FT                   /translation="MLSDSSKKIKKEVEAINSEFKTIVGCGEAKCPKLKRLRLASTPDI
FT                   TLTVMIEIPKGSRNKYEYDKERKVIKFDRMLFSAVHYPSDYGFIVDTLAEDGDPLDALV
FT                   LVWEPTFPGCMIETKPVGLFKMYDEKGPDAKLLCVPIGDPHFNFIRDLSDVPPHLLKEI
FT                   FHFFNIYKELESKKTGVEGWEDRESAIKTYWESHQRYLDTLKDTKQEK"
FT   gene            complement(357571..359280)
FT                   /locus_tag="DehaBAV1_0350"
FT   CDS_pept        complement(357571..359280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0350"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; YbaK/prolyl-tRNA synthetase associated
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16935"
FT                   /db_xref="GOA:A5FS84"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS84"
FT                   /protein_id="ABQ16935.1"
FT                   /translation="MRYSRLFGKTQREIPSDAETISHQLLLRSGMIAQLTAGVYSFMPL
FT                   AWRSIQKIETIIRQEMNKAGCQELAMPVLQPVEIWQQSGREAPFGQTLFHLKDRKDRNL
FT                   VLGPTHEEVITDLASRYIQSYRDLPQRLYQIQAKFRDEPRPRGGLIRVREFIMKDMYSF
FT                   DASPEGLDDSYQTMKQAYESVYRRCGLESMVIDADSGAIGGKASHEFMIVAESGEDSII
FT                   YCPKCSYAANAEKAVFKKKTLSKETLKDLEEVATPGQKAISDVARFLAVKPENTLKAVF
FT                   YMADGKFVMAVIRGDLDINEVKLKNLLKCNDLRLAEDGEVKAAGVVAGSASPVGLKNIL
FT                   IVADDSVENGSNFVAGANKDGFHLKNVNCGRDFRADKMADIALAAEGSACPFCDGTFAS
FT                   KRGVEVGHIFKLGTFLSERFGANFTDAEGVSHPIIMGCYGMGVGRLLAAAIEQNHDEKG
FT                   IIWPMPIAPYQVYICGLFLDNPVVRESAEKIYKELEAKSIEVLFDDRELTAGVKFNDAD
FT                   LLGIPLRLTISPRNLDKGGVEFKLRRNKESELVPLDSIVERVIATIKSESDL"
FT   gene            complement(359374..360420)
FT                   /locus_tag="DehaBAV1_0351"
FT   CDS_pept        complement(359374..360420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0351"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase; PFAM: IspG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16936"
FT                   /db_xref="GOA:A5FS85"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS85"
FT                   /protein_id="ABQ16936.1"
FT                   /translation="MITRRQSTEIRLGNLTIGGSAPISVQSMTKTDTRNIPATIAQIKE
FT                   LEECGCEIIRLAIPDMEAASALKSIRPKVKIPIVADIHFDYRLALASLSAGVDGLRLNP
FT                   GNIGDPERVKAVVKSAKEREIPIRIGVNAGSLPKDLPPELTIAQKMVKAAMGHIKILEG
FT                   LDFGLIKVSLKAFDVPTTIEAYTQIASLIPYPLHVGITETGTPKTGLVRSAVGIGNLLY
FT                   MGIGDTIRVSLTAPPHEEVFAAYEILKSLNLRQRGPILVSCPTCSRTEVDIVGIASQVQ
FT                   EALNKIDKPIRVAVMGCAVNGPGEAKEADLGIACGKGQGLLFRKGEKIAVVPEDELVDA
FT                   LLREIASL"
FT   gene            complement(360456..361493)
FT                   /locus_tag="DehaBAV1_0352"
FT   CDS_pept        complement(360456..361493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0352"
FT                   /product="site-2 protease, Metallo peptidase, MEROPS family
FT                   M50B"
FT                   /note="PFAM: PDZ/DHR/GLGF domain protein; peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16937"
FT                   /protein_id="ABQ16937.1"
FT                   /translation="MLLTVVSFLIIFSIVVISHELGHFFTAKAIGVKVEEFGFGYPPRI
FT                   FGRKFGQTEYTLNWLPLGGFVKVEDDPVNNKGLSSKSAGKRLLFFSSGALVNAILPIIL
FT                   FAFALIVPHDVLVGRVNVEEVVPNSPAAEAGLVTGDTILSINDQEIRNTAEFSRASQLN
FT                   LGQSIEITVLHADQTQSTVSLTPRWQPPAGEGPVGISLQTLDYQITSESESVLKAIPLS
FT                   VKQNFETLVLFKNSILGLIMGSVPFDVVGPVGLAQMTGDVARAGVGPLLEFTAFLSLNL
FT                   AIINLLPLPALDGGRIFFVFIEWIRGGRRISPKVENLIHMIGFFLLIGLMLTVTFQDII
FT                   RIAGN"
FT   gene            complement(361494..362627)
FT                   /locus_tag="DehaBAV1_0353"
FT   CDS_pept        complement(361494..362627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0353"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase, N-terminal domain protein;
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase, C-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16938"
FT                   /protein_id="ABQ16938.1"
FT                   /translation="MVHSIKKVVILGSTGSIGRQTLEVIRSLPDHFKVLGLAGGANVNL
FT                   LKEQAGEFRPEYIYCRDCHKESACNSRFIPMEEMAALPEADVIVVATPGGAGLQPVLAA
FT                   AKASKVIALANKESLVSAGEIVTGIVRENKAKLLPVDSEHSAIWQCLSGEVTPPSRIIL
FT                   TASGGPFRSLTKNEIDKVTPEQALKHPSWKMGLKVTIDSASLMNKGLEIIEARWLFDMH
FT                   IQNIQVVIHPQSIIHSMVEFADGSLKAQLSRPDMRFPIQYALTYPERVANHTLPRLNWA
FT                   EVGKLDFEIPDMTRFPCLGLAISAGEEGKTFPAALCAADEVAVDLFLKGKISFGQIPEL
FT                   IAKVLDAHQPVSKPDIDDILAADAWARQKVTELAGNL"
FT   gene            complement(362612..363415)
FT                   /locus_tag="DehaBAV1_0354"
FT   CDS_pept        complement(362612..363415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0354"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16939"
FT                   /protein_id="ABQ16939.1"
FT                   /translation="MLKKRILSGCLLALISLVVIWVDQPIAWLTLAMAVVVALALNEFY
FT                   NAVTVYLKSQPFKALGIFWGMLIVISPHLQIESILPFLLGSFSLTSLIYLLTLKDRTDA
FT                   FPRWAWTLSGVIYIGLLASFWVALRELPMGREWVLWTLILTSATDTMAFFIGSRFGKQK
FT                   MAPSISPNKSWQGAVGGAVFSIIVAPIFADLMDLPINMFIAMLLGLLVSVAGQTGDIAE
FT                   SLFKRNMHCKDSGNLIPGHGGIMDRLDSLLFTGIVVYYYVIWFIQ"
FT   sig_peptide     complement(363347..363415)
FT                   /locus_tag="DehaBAV1_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.737 at
FT                   residue 23"
FT   gene            complement(363419..364129)
FT                   /locus_tag="DehaBAV1_0355"
FT   CDS_pept        complement(363419..364129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0355"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16940"
FT                   /protein_id="ABQ16940.1"
FT                   /translation="MDTTATINNTPPDHIAIIMDGNGRWAERRGLSRLEGHKAGLENAR
FT                   RVIRHLSSLGVKYVTLYSFSTENWKRPDAEIKGLFGLINDVISSYIPELAGNNIRLRHL
FT                   GHLDKLPAMLKHKLESLLSETSQNSGLTLSLAFDYGGRDEIIQAVKKLVKDGIEPDKIS
FT                   EELFAGYLFTTGIPEAGLIIRTGGEIRLSNFLLWQSAYSELYFSEVMWPDFGEKEIDRA
FT                   ISAFNQRQRRFGGL"
FT   gene            complement(364194..364715)
FT                   /locus_tag="DehaBAV1_0356"
FT   CDS_pept        complement(364194..364715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0356"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16941"
FT                   /protein_id="ABQ16941.1"
FT                   /translation="MSASLDVLLQELSGIRTGRSSPALVEHIRVEYAGVPTPINHLANI
FT                   SAPDPRYITIQPWDRSCLSAIEKAIMKSDLGLMPNNDGNIIRLNIPPLSEERRQEMIKI
FT                   VNKRLEEDKIAMRNVRRDAMDEMKKLEKAKEISQDDLKRGSDQLQKITDNFIAKADKLG
FT                   ADKEAELRQV"
FT   gene            complement(364753..365478)
FT                   /locus_tag="DehaBAV1_0357"
FT   CDS_pept        complement(364753..365478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0357"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.22"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16942"
FT                   /protein_id="ABQ16942.1"
FT                   /translation="MAEIKYKRILLKLSGEAFKGATGYGIDIPTVRNIAQEIKHICLMG
FT                   VEVAIVVGGGNIWRGATAAKEGIDRVSADYAGMLATIINAITLQDALEREGIVTRTQSA
FT                   LSVQQVAEPYIRRRAVRHLEKGRVVIFAGGTGNPYMTTDTAAALRAIEIEASVLLMAKN
FT                   KVDGVYTADPQKHPEATLFQHLTYMEAINKRLQVMDATALSLCLDNKLPIIVFDLQSSE
FT                   SLVSAISGQPIGTLISSES"
FT   gene            complement(365493..365996)
FT                   /locus_tag="DehaBAV1_0358"
FT   CDS_pept        complement(365493..365996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0358"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /note="PFAM: ubiquitin-associated- domain-containing
FT                   protein; elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16943"
FT                   /protein_id="ABQ16943.1"
FT                   /translation="MAINAEQIKELREKCGAGVMECRNALVDANGNVEKAQEILREKGL
FT                   VKAAKKAERETVQGIVESYIHTQGRIGALVELNCETDFVARTDAFKELAHNLAMQVAAM
FT                   CPLYLSEEDRPAECEVEAENACLLLQPYIKDPSKTINGLIIETVAKVGENIRLKRFARF
FT                   ELGG"
FT   gene            complement(366021..366758)
FT                   /locus_tag="DehaBAV1_0359"
FT   CDS_pept        complement(366021..366758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0359"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="PFAM: ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16944"
FT                   /db_xref="GOA:A5FS79"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS79"
FT                   /protein_id="ABQ16944.1"
FT                   /translation="MPTTNIKELLEAGAHFGHQTSRWHPRMKKYIFTKRNGIHIIDLEK
FT                   TVVMLDKACNYINQVVSDGGKVLFVGTKKQAQEILAEEAKRCGMYFINQRWTGGILTNF
FT                   HSIQSRIDYLVRLEDQQARGDFSRLPKKEAQKLGEEIARLNRTMGGFKEMTRLPDVIFV
FT                   VDPIKEKIAMAEAKRMGVPLVAMVDTNCNPDEVDYPVPSNDDAMRAIKLICSKMADAVI
FT                   EAQNAMKVTEVETTGEAQAETAG"
FT   gene            complement(366944..367711)
FT                   /locus_tag="DehaBAV1_0360"
FT   CDS_pept        complement(366944..367711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0360"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16945"
FT                   /protein_id="ABQ16945.1"
FT                   /translation="MSKVKTLILRTPGTNCDVETSYAFELAGSETELVHINKLLAKPSL
FT                   LSEFQIMAFPGGFGYGDDLGAGRVLANEVRLKLGEKISRFHESGGLIIGICNGFQALVK
FT                   TGILPGPMKDGQKITLTDNNSGRFECRWTYLSVNPFSTCVFTQGLDRLYLPVAHGEGKL
FT                   LGSPEVINKLNSAVYYTDKDGKRNAPYPANPAGTLMDIAGIADESGRIFALMPHPERFV
FT                   RGSQHPRWTGEGLKKEGDGLKIFTNAVKWAREV"
FT   gene            complement(367718..370579)
FT                   /locus_tag="DehaBAV1_0361"
FT   CDS_pept        complement(367718..370579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0361"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16946"
FT                   /protein_id="ABQ16946.1"
FT                   /translation="MHRIEVSLKPEWPDPKGNGVCHDIQDLGITSVSEVRVIDVYWLEG
FT                   NLSDSEVLTISGELLSDQIIQTFKYDANCPLAEADGFSAIEVTYNAGVTDPVQETILKA
FT                   ISDLGIKGITAARTAKRYLLKGEISADELKTIGNKLLINPIVQHVVTSSSNPFPPNPEY
FT                   TFKLKKIDLLAEKLKDNMASLGKEYSLSHQELSVIYEHYLKLGRAPTDAELETLAQTWS
FT                   EHCCHKTFKAMLDYDGQIINNLLKQTIAKATAELNKPWCLSVFVDNSGVIEFDDEWGVC
FT                   FKAETHNHPSAVEPYGGAATGIGGVIRDILGTGLAAKPIANTDVFCFGPPDLAEDKLPP
FT                   GVLHPRRVFKGVRSGVADYGNRMGIPTVNGAVLFDERYTANPLVYCGTIGLIPKKYALP
FT                   GKQSTGDLVVLIGGRTGRDGIHGVTFASGELNDRSTELSFTAVQIGNAIVEKRMLDTLL
FT                   QARDRELFVRITDCGGGGLSSAVGEMAESTGVKIYLDKVPLKYSGLTYSEIWISESQER
FT                   MLLAVNKEKLGEILALFENEGVEASVIGEFTSDRHLKLFYQDHQVADLQMNFLHNGRPQ
FT                   LELRATHHKTRHPEADFDCPKDFETELKNILSHWNVCSREWIIRQYDHEVQGGSVLKAM
FT                   VGAENDGPGDAAVIRPVLGSKKAVVISNGINPSYADVDAYNMAASAIDEALRQIIAVGG
FT                   NLERVALLDNFSWGNASRPESLGDLVHACQACHDLSLVFGTPFISGKDSLNNEFRYEDK
FT                   LITIPHTLLISAIGVMEDGDKAISMDFKKSGNLIYIVGKTAEELGGSHYFKNHRFIGNR
FT                   APAVNAKRAKENMQALSCATAGGLVAACHDLSEGGLGVTAAEMAFSGKLGAHIRLADVP
FT                   LAEKIEREDYILFSESNSRFLVEVAPKHQAEFEKLMSGCDFGLVGEVMSEPSLEITGRD
FT                   GKEILLNTPVSELKEAWQRPMRW"
FT   gene            complement(370583..371464)
FT                   /locus_tag="DehaBAV1_0362"
FT   CDS_pept        complement(370583..371464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0362"
FT                   /product="pyridoxal phosphate synthase yaaD subunit"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16947"
FT                   /db_xref="GOA:A5FS82"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS82"
FT                   /protein_id="ABQ16947.1"
FT                   /translation="METGTFKVKSGLAQMLKGGVIMDVTTPEQAKIAEEAGACAVMALE
FT                   RVPSDIRAAGGVARMADPTIIEQIMKVVSIPVMAKCRIGHFVEAQILESMGVDYIDESE
FT                   VLTPADENFHVWKHDFKVPFVCGCRDLGEALRRIGEGAAMIRTKGEAGTGNIVEAVRHM
FT                   RSVMGSVRRVQSMSPDELSAYAKEINAPLELVLELHKTGKLPVVNFAAGGVATPADAAL
FT                   MMQLGADGVFVGSGIFKSSNPSAMAKAVVKAVTHYKDAQILAEISKGLGDAMPGLDIKQ
FT                   IDPDKLISQRGW"
FT   gene            371649..372047
FT                   /locus_tag="DehaBAV1_0363"
FT   CDS_pept        371649..372047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0363"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16948"
FT                   /protein_id="ABQ16948.1"
FT                   /translation="MNIFKAIMGMCDTSPLADDVWSLMDSQIALDLAKVPALSEKGGAG
FT                   YMAGKGLAKPVLVVRGQDNNLYAYENACPHGGRKIDPMQGEAKLRCCSVNHSTFDYNGK
FT                   VLSGPAQHKHELRRLLTSQADGKLLISV"
FT   gene            372125..372199
FT                   /locus_tag="DehaBAV1_R0007"
FT                   /note="tRNA-Thr1"
FT   tRNA            372125..372199
FT                   /locus_tag="DehaBAV1_R0007"
FT                   /product="tRNA-Thr"
FT   gene            372228..372998
FT                   /locus_tag="DehaBAV1_0364"
FT   CDS_pept        372228..372998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16949"
FT                   /protein_id="ABQ16949.1"
FT                   /translation="MSKFIDRLKNVSKGYVRPMGFNAVASAPQPKMLLAVELGIEDLTA
FT                   KEVFGGADVVLLSTGKTGAKKLKEAAGLLGDTVWGVMLGDKADEAEKMAKAGADFVVFS
FT                   PDAEVSPLTALEKTGKIIMLENNLTDFMIRAADCLSVGAVIVDGQPDALSLSWRKIMLY
FT                   QRFADILSKPFLVRVSANISLPELQALWALGIDGVLTNGSEGLSGLRTIIDGAEWAAKR
FT                   KRGHMSAIVPSIKMPASESVSPEEPEEPDEDDEE"
FT   gene            complement(373077..374222)
FT                   /locus_tag="DehaBAV1_0365"
FT   CDS_pept        complement(373077..374222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0365"
FT                   /product="IMP dehydrogenase family protein"
FT                   /note="TIGRFAM: IMP dehydrogenase family protein; PFAM: IMP
FT                   dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16950"
FT                   /protein_id="ABQ16950.1"
FT                   /translation="MTVPEFKTLRRTYGFDEVAIVPGGLTVNPEQVEVDFKIGDINFSI
FT                   PFIASAMDAVTNVDTAVAMSKMGGLSVLHLEGIYTRYENPQEILDQIISKPIDEVTSFM
FT                   QKVYTAEPIKEHLISKRVSEIKAKGGICAVSLMPANAKKLAPIAVEAGADIISVASTVT
FT                   SARHVSKSSHGLVFEEFVKMIKVPVLVGNCVSYQACLELMRTGVHGVIIGVGPGAACTS
FT                   REVLGIGVPQITASMDCAAARETYYKETGRYVPIITDGGFKKGGDVCKAICAGADAVML
FT                   GSPFAKATEAPGRGYHWGMSHPHPSLPRGTRIKVGTTGSLEQILFGPTSVTDGTQNLVG
FT                   ALKTSMGVCGASNIREMQQVEMVIAPAITTEGKSYQLSKCQ"
FT   gene            374484..375308
FT                   /locus_tag="DehaBAV1_0366"
FT   CDS_pept        374484..375308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0366"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16951"
FT                   /protein_id="ABQ16951.1"
FT                   /translation="MALYVVATPIGNLEDITLRALRLLSEVKLIAAEDTRHTRKLLSAH
FT                   NIKTPLTSYFEHNRLSKLDYILEVLREGDVALVSDAGMPGISDPGYELIKAAHENGIKV
FT                   VPVPGASAVITAVAVSGLDSGSFSYLGFLPRQKSERRKALSEVEMLGASIVILEAPHRL
FT                   QGCLLDIKEVLGDRQISVCRELTKIYEEIFRGSISQSISHFSQPRGEFVLVVEGNRQIP
FT                   AQPELTGDIISELGLLKKQGKSAKESVALVSQKNGLSKKEIYRAWLKIDKAL"
FT   gene            375333..375548
FT                   /locus_tag="DehaBAV1_0367"
FT   CDS_pept        375333..375548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16952"
FT                   /protein_id="ABQ16952.1"
FT                   /translation="MRRGCISLGEVVCTGCNNTVPYPERYLAVDEENGKEVDKGTTVHY
FT                   CVECALKKGYASYKEEKGERILTFLP"
FT   gene            375557..377218
FT                   /locus_tag="DehaBAV1_0368"
FT   CDS_pept        375557..377218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0368"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM:
FT                   methionyl-tRNA synthetase, class Ia"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16953"
FT                   /db_xref="GOA:A5FS74"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS74"
FT                   /protein_id="ABQ16953.1"
FT                   /translation="MSERIFIGVAWPYANSQLHLGHVAGAYLPADIFARYHRTRGDEVL
FT                   MVSGSDMHGTPITIRAEQEGITAAEVAERYHQRFMASWPKLGISWDFYTSTATANHART
FT                   AQEMFLSLYEKGYIYKNTVCQPFCSHCNRFLPDRYVEGTCPHCKYEGARGDQCDNCGKP
FT                   LNAAELLNFRCKNCGNPPEFRETEHFFLKLSAFEEELIRWVETKTHWRTNVLNFTLRYL
FT                   KEGLKDRAITRDLDWGVPLPLPGYEGKRLYVWFEAVIGYLSASKEWAASKGQPNAWQKY
FT                   WGVDTKSYYFIGKDNIPFHTIIWPAMLMGKGGLNLPYDVPSNEYLTTESQKFSKSRNNA
FT                   IWVDDVLSRYGVDTLRYLLSANMPESSDTDFSWREFVRRNNDELVATYGNLAQRVLTMV
FT                   CRNYDNKVPEYGELDERSLTLIEKTAAMLCETDKALYNCNFREAIRLAMALAQEANRYL
FT                   DEKAPWKEIKVDKAAAARSLYVAMVALSGLRVAFYPFLPESSGRLSTYLGFGSELEKEG
FT                   WILKMPVVGQELTPPEPLFKKLEDSVVEEETARMGL"
FT   gene            377240..378214
FT                   /locus_tag="DehaBAV1_0369"
FT   CDS_pept        377240..378214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0369"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16954"
FT                   /protein_id="ABQ16954.1"
FT                   /translation="MLKLSSIYAPINEGLKGVEDEFKLVSESRKKSFPEMAEMLDYILV
FT                   GGKVLRPALSMLSAMCFGAGIKKVLPLATSSEMLHIATLVHDDAIDKADTRRGRRTVNA
FT                   VWGLEKAILLGDFLFAHAAETAAETGNMGIVTLFSQTLQIIASGELKQAYASFNPDQSY
FT                   ENYLERISGKTAALFVMATKGGAILADASPSDEEIMRSYGYNLGLSFQIVDDILDFVGN
FT                   AKDMGKPIGSDLNNGTVTLPALLLMDRYPDNNPIKDMLNATDRIPHVAKAVEMINSSDI
FT                   IDLSYKEAKRYADLACRNLSQLPKTAARESLYQLAEFIVERKN"
FT   gene            complement(378429..380243)
FT                   /locus_tag="DehaBAV1_0370"
FT   CDS_pept        complement(378429..380243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0370"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16955"
FT                   /protein_id="ABQ16955.1"
FT                   /translation="MNSNWKRSTIIYVVMLVAIIAIFSFLVPNAQKPEEVPLSQIITLS
FT                   QEHKIAEITVDSETIEVTTTDGTKLSTVKEYIASIYEIEGLDLTDVKVNIQPAGGLDWG
FT                   TMILTYLPFLIFGGLLIFIFTQARGANNQAVSFGRSKAKLFNMDKPTITFANVAGVDEA
FT                   KQEVGEVVEFLKSREKFQALGARIPKGILLIGPPGTGKTLLAKAIAGEAGVPFFSISGS
FT                   EFVEMFVGVGASRVRDLFDQAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQI
FT                   LVEMDGFDTDTSVIVVAATNRPDILDPALLRPGRFDRRVVLDKPDITGREAILKIHAKG
FT                   KPLADTVNLENLGKQTVGFSGADLANLLNEAAILAARKNRKVIETEDLEESIDRVIAGP
FT                   ERKSRRISTQEKEVTAYHETGHGLVLRLVQGADPVHKISIVARGMTLGHTRQLPTEDRY
FT                   LMTRSQFKGMMAGLLAGYVAEELTFKELSTGASDDLRRATDIAHKMVTSYGMSDKLGPR
FT                   TFGNKEEMVFLGREISEQKDYGEKIADMIDDEVHGLIEEAHQKARKILTENKNRLKFIA
FT                   EKLVEKETLEGVELESLFTGELPIAEST"
FT   sig_peptide     complement(380151..380243)
FT                   /locus_tag="DehaBAV1_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.965 at
FT                   residue 31"
FT   gene            complement(380315..381145)
FT                   /locus_tag="DehaBAV1_0371"
FT   CDS_pept        complement(380315..381145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0371"
FT                   /product="Endonuclease IV"
FT                   /EC_number="3.1.21.-"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   SMART: AP endonuclease, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16956"
FT                   /protein_id="ABQ16956.1"
FT                   /translation="MAGLLFGTAGIPYSTPKHTTQNGIHRVAELGLDGMEIEFVRGVYM
FT                   KAPDTNPVRILSELLRIKLSAHAPYYLNFNAVEENKVKMSQHLLYQSAKMAHLCGAGSL
FT                   VFHPGFYLTDSPSAAYESIRDNIRPVASRLQEEGFDITLRPEVSGKVTQFGDLKETMAL
FT                   CSEIPGLLPTIDFSHYHARTGKYNSYSEFSFMLSTMADYLGENAVLNMHIHVSGIDYSP
FT                   RGEKQHLNLADSDFNYKELLLALRDRGCAGLVICESPNIEEDALLLKETYFSLA"
FT   gene            381265..381609
FT                   /locus_tag="DehaBAV1_0372"
FT   CDS_pept        381265..381609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0372"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16957"
FT                   /protein_id="ABQ16957.1"
FT                   /translation="MESIDIARQMVSMASEKQAEDIVLLDVRELVSYCDYFVLMSGASS
FT                   RQLSAIADVVEKTLKPLKIGPRHREGDADSGWILLDFGGVIAHIFTPEIRSYYKLDRLW
FT                   ENAPKLVAIQ"
FT   gene            complement(381610..382038)
FT                   /locus_tag="DehaBAV1_0373"
FT   CDS_pept        complement(381610..382038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0373"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16958"
FT                   /db_xref="GOA:A5FS65"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS65"
FT                   /protein_id="ABQ16958.1"
FT                   /translation="MERTLLLVKPDGVNRGLSGEILGRMEKLGLKLIGLRMLQMDAVLA
FT                   DKHYAPHRARPFFKDLVTYITSGPITAAVFEGENAVEKMRKAMGATDPAKSEKGTVRGD
FT                   LGIDIEQNTVHGSDSAENAKHEISLFFSESELVNYDRR"
FT   gene            complement(382048..383418)
FT                   /locus_tag="DehaBAV1_0374"
FT   CDS_pept        complement(382048..383418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0374"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: peptidase M22, glycoprotease; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16959"
FT                   /protein_id="ABQ16959.1"
FT                   /translation="MPVLIAIDTATPDTGLAILRDNEIVAQYNWLSHQNQTVELLPRLD
FT                   WLLESAGLSLKDATAIAVSIGPGSFNGLRIGLSTVKSLAYALDIPLCGIGTLELAAYPY
FT                   LASGLTVWALLPSGQQEYAAGAYVKDKEGLKEEIKPHITSLADLAAKITEPCVICGPIS
FT                   QNVQTELKTLLGDKKTVFAPADIRPSRAVSLARLAKKRIEDGLTDNPAGLQPLYLRRPQ
FT                   ISPRKHPTGLPLSQNKAVIWDMDGVIADSAPLHFRAWQTTFTEMGYTFSEADFYRTFGL
FT                   RNDMIIYSVLGEKSEADIIHTLADRKEHLFREYAGQDIKIFPGVMDLLKSLKAAGYRMA
FT                   IASSAPLANIKLVMTKLGIGDYFLATISEKDVTKGKPNPQVFLLSAARLCTRPEECLVI
FT                   EDAPGGVEAAKKAGMKCLAVTNSQQPETLKEADLIVDTLGKIGVEDIAGFIGSPGAK"
FT   gene            complement(383396..383887)
FT                   /locus_tag="DehaBAV1_0375"
FT   CDS_pept        complement(383396..383887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0375"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16960"
FT                   /protein_id="ABQ16960.1"
FT                   /translation="MNQLELVSHSTQQTQDLGKIIGELASAGDIIFLVGNLGAGKTNLT
FT                   QGLAKGLDITENALSPSFVLAREMYGRLPLYHIDLYRLDLSEEIEELGLEDYFYGSGVT
FT                   VVEWADKANELLPPENLQIEIAYLDDDTRKLTLSAWGIRYEELLNEIAQRVKDAGFNSH
FT                   "
FT   gene            complement(383884..384894)
FT                   /locus_tag="DehaBAV1_0376"
FT   CDS_pept        complement(383884..384894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0376"
FT                   /product="thiamine-phosphate kinase"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16961"
FT                   /protein_id="ABQ16961.1"
FT                   /translation="MKVSDIGECQLIDRLNILLHQKPDENTPARENLILDIGDDAAVFL
FT                   PQGYQLVTVDSLIENVHFNRSMLNWADLGYKALAINMSDIAAMGGLPQYAVVNIDLPPD
FT                   TLVSSVTDCYNAMYSLANKYQTVIIAGDTNQSSIINLAITLLGSAENPSCLLTRNAAQA
FT                   GQKIAVTGYLGNAAAGLDMLLNQTEVTDESRQIFYRSFYRPEPRINEARLLVKEGVHCC
FT                   IDISDGLVTDLGHILRQSRVSARIELDKLPLHPSLRLSYPLQAQNMALYGGEDYELLFT
FT                   ASAKVIEQISVQSHIPVTIIGEIIPGKPEELKLVDKDGRALQPEKNGWEHFKKPK"
FT   gene            385186..385962
FT                   /locus_tag="DehaBAV1_0377"
FT   CDS_pept        385186..385962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0377"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16962"
FT                   /protein_id="ABQ16962.1"
FT                   /translation="MSSLAEAPIQDPGFDSEEAHKRKQYMVDLFVVQAKNYDFHDDVFG
FT                   LYAHRFWMRTVLKIIGKFMKGRTSTKMLDLACGTGFVTFNTARNFENIDIDSFDISPDM
FT                   LAVAKERYEKYFKGRSIKFWQGDAEVPFGENKYDLITTSFAYRNFANKGLATENVFRAL
FT                   KPGGLFIIQDLTKPEHHPMRGLYIFYMKYVLPLFTSILGTEKSAARWLYKSAMMMPTNG
FT                   QIAKLMESKGFEKCQYKSLSLGIACVIWGFKPEKSE"
FT   gene            385964..386731
FT                   /locus_tag="DehaBAV1_0378"
FT   CDS_pept        385964..386731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0378"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16963"
FT                   /protein_id="ABQ16963.1"
FT                   /translation="MSSINVSVKDPGFESEEAQARKRYMLQLFGFQAKHYDLHDDIMGM
FT                   GIHRRWGKEMVLEILTYTRNMPQVKMLDLACGTGFVTFNTLRYMKNVDIDAFDITPEMV
FT                   EVAKGRLKKNFADRSVKFWVGDAEIPYGDAKYDVIGTCFAFRNFANKNLAAANIFKALK
FT                   PGGLLVLQDMTKPEKQPMRGIYLFALKNLMPVMARIIGTEKRSARYLANSVLAMPSNAE
FT                   ITAILQNQGFINIKSRYQSGGMGTLTVAYKPEN"
FT   gene            386733..387827
FT                   /locus_tag="DehaBAV1_0379"
FT   CDS_pept        386733..387827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0379"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16964"
FT                   /protein_id="ABQ16964.1"
FT                   /translation="MGKVDTLAYDIGNNRTRHVYIGSGILDSLPGYARELNADKFFIIT
FT                   DSNLENILKDKIKNLLAGVAETHILAFPAGEASKTLSTLEDIGSKILDLRATKSSVIVC
FT                   LGGGVVGNLGGLTAALLFRGLRFFHIPTTMVAQIDSAIGQKQAVNYKMGKNLFGQYYAP
FT                   EFVFIDFDFLRTLPERQIRAGLAESVKHGLCQESTFFDYIEEHAGDYSPKVIDYISRHT
FT                   IELKLELLKIDPFEGKLDPQLELGHTIGHAVEIIKNGQLLHGESIAIGMVAEAALSCEM
FT                   GYMKPELAAKIERIFKKLGLPTRIPADVPLEGVLEALRYDNKRRTARTDFFLLEDFTRF
FT                   HKENGKIGTKVSEEVLKKVLESAY"
FT   gene            387811..388731
FT                   /locus_tag="DehaBAV1_0380"
FT   CDS_pept        387811..388731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0380"
FT                   /product="1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16965"
FT                   /protein_id="ABQ16965.1"
FT                   /translation="MKALTSERPGFQDWIQAARLKFLPQGVMPVVIAGALAFSEGTFNV
FT                   ANFIVAFSAAAAVQIGLTMFNDTLDYVYGTDCKPIDAKNPFSGGSGVFTCGLIKPRQSL
FT                   MVIFGLYLFALMCAIYMALDMGWGVMWIAIIGATISILYSAKPLRLAYHGLGELVMLLG
FT                   YGPVLTAWGYFVHTGMVSWDVLLIGVIPGLCMWTMILINEIPDYEEDRAAGKRNLTYRL
FT                   GPKNAKNLFIISLVVLYAYILALVFSGVMPPLSAIALGGIPLAVMAVRIAHRYYDDPIK
FT                   VAMANKLMVIIYSVTTATVAIGMLT"
FT   gene            388731..389333
FT                   /locus_tag="DehaBAV1_0381"
FT   CDS_pept        388731..389333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0381"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16966"
FT                   /protein_id="ABQ16966.1"
FT                   /translation="MVAPSFFEKVAPVYEFLTRMFMLGTFESARNRMLNEDTSEFSVLD
FT                   LCTGTGYIANKIEAKRIVGLDQSVQMMALNDRTKRPNKTLVRGNAYHLPFEDGEFERIY
FT                   CSSASHEFKLFGKVLAECFRTLKPGGKVAIYDIYQPKNKFYSLIVNTIYRYPVEHNIMW
FT                   VHTLDEWRKLLTEAGFEVEELEAVRGVFVFVRAVRPA"
FT   gene            389414..390193
FT                   /locus_tag="DehaBAV1_0382"
FT   CDS_pept        389414..390193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0382"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16967"
FT                   /protein_id="ABQ16967.1"
FT                   /translation="MDSAPLTNYALMVSLGMRYAVMADIHANLEALNAVLEDAYKRDAT
FT                   EIWCLGDIINYGPDPTACLEILMNHKHLAVAGNHDLAVAGKINHSLFELEAARCLAWTR
FT                   SQLSSDMIDYLAVLPEMLIVGDFSLVHGSLKRPVWDYITTPQLASENFGLMRTPYCLVG
FT                   HTHMPYVFTTGQNGICRGMPLMAGSMQPLRQTNLIINPGSVGQPRDGNPQASYGIYNDE
FT                   ARTFCLYRVAYNIPATQKKMQKAKLPPFLSARLSKGR"
FT   gene            390213..391088
FT                   /locus_tag="DehaBAV1_0383"
FT   CDS_pept        390213..391088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0383"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16968"
FT                   /db_xref="GOA:A5FS52"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS52"
FT                   /protein_id="ABQ16968.1"
FT                   /translation="MGKDVPLLVASAPSLMAQAKEMMEGYTLKARKGLGQHFLISQGVL
FT                   NKILAAADLKPTDTVIEVGPGLGVLTEELLKRAGQVIAVEVDDKLIDALTEKFKGYPNF
FT                   RLIHSDILKTSPEEILGQNVPYKLVANLPYYITSAVLRQFLEAKLKPESMVVMVQKEVA
FT                   KNIVAKTGDMGLLTLSIRFYGNPSLVSVVPGGAFYPPPEVDSAIVKIVIPQTTIMEGVS
FT                   EVDFFKLARAGFGTRRKTLLNALAQGLGISKPVILSLLNGAGIDPARRAETLSMEEWKK
FT                   LCLEYAGNPC"
FT   sig_peptide     390213..390272
FT                   /locus_tag="DehaBAV1_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.973 at
FT                   residue 20"
FT   gene            391082..391936
FT                   /locus_tag="DehaBAV1_0384"
FT   CDS_pept        391082..391936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0384"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase, C terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16969"
FT                   /db_xref="GOA:A5FS53"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS53"
FT                   /protein_id="ABQ16969.1"
FT                   /translation="MLTLLAPAKVNLSLEVLYRRKDGYHELRSIIQSLSLCDRLSFSPS
FT                   KTVHISSDSQDWQADLSLVSKAVELFSERCGQNTGVNLKIAKRIPLVSGLGGDSSCAAA
FT                   VLKGLNKLWGCGYPCWRLMEIGAELGSDVPFFIMGGTAMMEGRGETVTPLPTLTQMWAV
FT                   LLVPALDMPADKTAALYRNLRPDSFTSGEISDKLLESICQGKLSLSLCFNAFEKVAFEL
FT                   FPELVKYRWQFLEAGAYQISLAGAGPTLFTLLKDKNTAEKIYHNLCQKGHQAYLVSTLG
FT                   PLD"
FT   gene            391992..392489
FT                   /locus_tag="DehaBAV1_0385"
FT   CDS_pept        391992..392489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0385"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16970"
FT                   /protein_id="ABQ16970.1"
FT                   /translation="MSSSENLKSAFAGESQANRKYLFFADKAEKEGFAHVARLFRAAAE
FT                   AETVHARNHFNVLKGVGNTAANLEEAVAGESYEFTSMYPSFIKEAETEGNSAALLSFNH
FT                   ANKVEKIHHGLFEEVLKEVKFGTRAEDQVYYVCQVCGNTVPGAAPARCPICGAPASSFK
FT                   LV"
FT   gene            complement(392569..392820)
FT                   /locus_tag="DehaBAV1_0386"
FT   CDS_pept        complement(392569..392820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16971"
FT                   /protein_id="ABQ16971.1"
FT                   /translation="MELTLQIKKDLALTNKLLSQGMVSTRDPETGFRYIICASCPNDGG
FT                   DGTVSRIDRKDNVVERVLFCCSTCGKEFVVKPEDIFLT"
FT   gene            complement(392895..393704)
FT                   /locus_tag="DehaBAV1_0387"
FT   CDS_pept        complement(392895..393704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0387"
FT                   /product="Ion transport protein"
FT                   /note="PFAM: Ion transport protein; Ion transport 2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16972"
FT                   /protein_id="ABQ16972.1"
FT                   /translation="MTKYNLMKKVHNLLTFGFDSQPRRFISWFIISLICLNVLAVILGS
FT                   VDTIGRDYHDLLFGFEIFSVAVFSLEYILRVWSYTVELKYSHPFTGRIRFALSPLALMD
FT                   LLAILPFYLPFLIHVDLRFLRTLRLLRLFRLGHLKRFNETSRMILNVLRERREALIISF
FT                   AIILLLIIFTSSLMYFVENPAQPEVFKNIPDSMWWAVMTMTTVGYGDIYPITALGKLLA
FT                   SIISILGLATFALPTAILSAGLLEEFRNKKGIHEHICPACGQEIPKP"
FT   sig_peptide     complement(393582..393704)
FT                   /locus_tag="DehaBAV1_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.779) with cleavage site probability 0.772 at
FT                   residue 41"
FT   gene            complement(393697..394947)
FT                   /locus_tag="DehaBAV1_0388"
FT   CDS_pept        complement(393697..394947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0388"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16973"
FT                   /protein_id="ABQ16973.1"
FT                   /translation="MNAEELKSFLKNRLPPEINRLILHAAELAASQNLHLYLVGGLVRD
FT                   FLLNKTPNDADLVLATNAIKFGQGLLEGFNYKATLHPRFNNLSADINGFKLDISTARNE
FT                   FYPDPGKLPEVLEGDIKADLFRRDFKINAMALSLSPQDFGCLVDPYNGLTDLKQHKLSV
FT                   LHPKSFRDDPSRIWRALRYSERLGFDISSETLTLLQRDAQLITLIGADRLRYEMECIFK
FT                   EAKPENILLKAEETGVLKNSLPFIKADNWLADKFAEARNMYGENVSPEIYLCLLSVRLD
FT                   KSQAEALITGLHLSKYISACLRDYQCLAEHLAELGRVDLKPSRLYGILAKCKKEARQAF
FT                   YIANDNLIVRKHLMLFQEELSSIKPCLKGTDLLTLGFAPGPDIKAVLAELLNLKLDGKI
FT                   PSRTDEIDYVKRRQADD"
FT   gene            395028..395945
FT                   /locus_tag="DehaBAV1_0389"
FT   CDS_pept        395028..395945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0389"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16974"
FT                   /protein_id="ABQ16974.1"
FT                   /translation="MNTHAIKVSNLVKRYKDCTALDGLSLEIEQGECFGLLGPNGAGKT
FT                   TLVRILTSLSPSDSGKVEVMGLDLSHHLRQIKAMFGVIPQLDNLDAELSVTENLVTFAR
FT                   FFDIKPADARQRAADILKLFKLEQKANSEVKALSGGMRRRLLLARGLINNPSIIILDEP
FT                   SVGLDPQSKYLVWQKLKEFKANGITQLLTTQNMDEAAVLCDRIAIMHQGKVLDMDTPKG
FT                   LVDRHVGQCLIEIEVRSGEHETITAECIRRGLDFEDSGLIIQVFRCGEDNLLDELKALG
FT                   WNVWQRIGTLEDVFLRLTGKGLVE"
FT   gene            395942..396709
FT                   /locus_tag="DehaBAV1_0390"
FT   CDS_pept        395942..396709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0390"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16975"
FT                   /protein_id="ABQ16975.1"
FT                   /translation="MNWPTYRAFYMWLRNYNVFIRLFWSIAPGFVIEPVVLLVALGFGF
FT                   GSFIGDINGQPYMEFIIPGVIASYAMTSATFECTYNVFFRMDYRKTYDSILATPMNVSD
FT                   VVTGEVLWGATRSIITACIILLVAALFGIIHSPWALLAPIFAVLEGIMFASIGIFFASI
FT                   VPSIYSFNYYFTLFIGPMTFFSGAFFPVSSFPEAVQAISNVVPLTPAVSLIRGAVSGDF
FT                   SGVNVVISLLAVIGVSAAFYIATLFSMKRRVME"
FT   gene            396759..397310
FT                   /locus_tag="DehaBAV1_0391"
FT   CDS_pept        396759..397310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0391"
FT                   /product="Dephospho-CoA kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16976"
FT                   /protein_id="ABQ16976.1"
FT                   /translation="MKVVALVGMPGAGKTEASRMFSKNGFIRIRFGDVTDEKLRELGLP
FT                   LNEENERKVRESLRKQYGMEAYAVLNLSSIDENLKNDNVVVDGLYSWEEYKFLKSYYKE
FT                   KLIVVAISSSPSTRYSRLCERADRPLNYDNAVSRDYSEIENINKAGPIVMADITVLNEL
FT                   DLKDLEKQVKKLGLELRADA"
FT   gene            397307..397780
FT                   /locus_tag="DehaBAV1_0392"
FT   CDS_pept        397307..397780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0392"
FT                   /product="CMP/dCMP deaminase, zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16977"
FT                   /protein_id="ABQ16977.1"
FT                   /translation="MSRPNVDEYFLKIAAVVAERSTCVRHHVGAVAVRDKHILSSGYNG
FT                   APAGLTDCLELGCLRDQNGIPSGTRHEICRAVHAEQNVIIQASLHGTSLEGATVYATHT
FT                   PCVLCAKMLTNARIKRYVSYGKYADDSFIDMFKQAGIEVVIKDRPPCVVEYLD"
FT   gene            397868..398773
FT                   /locus_tag="DehaBAV1_0393"
FT   CDS_pept        397868..398773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0393"
FT                   /product="diacylglycerol kinase, catalytic region"
FT                   /note="PFAM: diacylglycerol kinase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16978"
FT                   /protein_id="ABQ16978.1"
FT                   /translation="MVAKVIVNPVAGARSTEQKWPHISRLMRDMGFSYDFQYTESQGHA
FT                   IEIARTAALNGYPYLVAVGGDGTINEVVNGILTASQDQKTLMGVVDTGTGNDFVRSLGL
FT                   DGNYLHSCQHLLSSKHTQVDAGLVTFQKDGRKVSRFFVNGAGVGFDAEVAAATEHMPKA
FT                   LGGTIPFVMALAKTLVGYRNKTIDIRLDTDDYTRRVLSVIVANGSYFGGGMKIAPSALI
FT                   TDSRFDVITLGDVNKLEILQTFPKIYKGTHITHPKVKTEHAHFVSISSGEGLYLQADGE
FT                   LLGKTPATFEVLPQALTMVF"
FT   gene            complement(398844..399356)
FT                   /locus_tag="DehaBAV1_0394"
FT   CDS_pept        complement(398844..399356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0394"
FT                   /product="Deoxycytidine deaminase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16979"
FT                   /protein_id="ABQ16979.1"
FT                   /translation="MSALAKEEILRLIKSAKPLLEDYPDLENQLQPNGFDLSLKQVRSL
FT                   EGEGVLPTDNARRRLPVNNPLEFDHNNQIKLMPGIYSVVYNEVVNIPKDVMALATPRSS
FT                   LLRSGCTVNTAVWDAGYSGRSESLLVVYNPAGLILERNTRLIQLVFFKLNAETGGYCGI
FT                   YQNENKN"
FT   gene            399507..399857
FT                   /locus_tag="DehaBAV1_0395"
FT   CDS_pept        399507..399857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16980"
FT                   /protein_id="ABQ16980.1"
FT                   /translation="MGVCVHKLRWKQSNLYQGGAVMAQDKTLVCRDCGNEFIFTAGEQE
FT                   FYASRGLKNEPKRCPTCRSARRSENRAEGGERRTYEVVCAACGVQTTVPFEPTEGRPVY
FT                   CKDCYAKTKESE"
FT   gene            complement(399945..400706)
FT                   /locus_tag="DehaBAV1_0396"
FT   CDS_pept        complement(399945..400706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0396"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16981"
FT                   /protein_id="ABQ16981.1"
FT                   /translation="MNKKQTSAEQPIIKIENIQKHFGRVQALRGVSLEVKKGEVVVIIG
FT                   PSGSGKSTLLRCINRLEEYDSGKITVDGITLDTTENINHVRREVGMVFQSFNLFSHLKV
FT                   IDNITLAQCQVRKRTKEEAAENAADLLKKVGIPDKAHAFPLQLSGGQQQRVAIARALAM
FT                   NPQIMLFDEPTSALDPEMIKEVLDVMTTLAKEGMTMVVVSHEMGFARAAADRVIFMDEG
FT                   LIVESAPPNEFFTNPKHERTKLFLSKILHNS"
FT   gene            complement(400706..401527)
FT                   /locus_tag="DehaBAV1_0397"
FT   CDS_pept        complement(400706..401527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0397"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16982"
FT                   /protein_id="ABQ16982.1"
FT                   /translation="MAENKIKPPEKIALIPGAEPSNRMDPWWWLVAGVFALAGGLMLFQ
FT                   PDPFLDIFKYVWVGIGITVLVAVVSYFLMLILGLFGGLGRLSQNTLIRGIATFYVEIVR
FT                   GIPLLVQLIWWYFAFPVIIQTIGQALNFGPMLNYQANPIVMAIWGMTFCYGAYMSEIYR
FT                   AGIQSIPKGQMEAARSLGMSHTQAMRFIILPQALRVILPPMGNEFISLLKDTSLVSTVA
FT                   VADMVRLGREFTATNFNPIEVWSMIALLYLILTLLSSRLINYIEKKTAFSR"
FT   gene            complement(401580..402353)
FT                   /locus_tag="DehaBAV1_0398"
FT   CDS_pept        complement(401580..402353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0398"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; SMART: ionotropic glutamate receptor; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16983"
FT                   /protein_id="ABQ16983.1"
FT                   /translation="MKRLSTILMTLLLSSALLFSGCQSSTDDTDDSTATLQITVVTDAT
FT                   WAPFEYVNEQTHAIEGFDIDLMKAIAEKANLEVTFQNVAWDALLAGMATGQYKVAISSI
FT                   TILPDRLEKWLFSEPYFNAGQMVCVQKTNTTILSHDDLTGKRVAAQTGTTGFFEAQKIA
FT                   NATVKSYDEIGLAFQDLINGQIDAVICDNPVAIDYVNANPDKLKKVGTAFTDEYYGISV
FT                   AKGQTEILSRINLGLAAVIADGTLDQLIAKWNLNP"
FT   sig_peptide     complement(402273..402353)
FT                   /locus_tag="DehaBAV1_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.386 at
FT                   residue 27"
FT   gene            complement(402553..403392)
FT                   /locus_tag="DehaBAV1_0399"
FT   CDS_pept        complement(402553..403392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0399"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16984"
FT                   /protein_id="ABQ16984.1"
FT                   /translation="MNIKIVTDSTADIPPQLAKSLGITIVPLYVRFGEKALKDGVEITQ
FT                   DQFFERLQTESVHPNTSQPSPQDFIDVYRELAPTCDGIVSIHISSKLSGTYDSAIQAKK
FT                   LLGKDAPPIEVIDSRSVSMGLGLLGLLGAEVASSGKNLKEVADTVRSSVEKIQMMGFFD
FT                   TLKYLALGGRIGKSKALLGSLLSVKPVLVVGNGELLPAGQVRSRSKGMEKLTEFTAGVK
FT                   NIAGLSVIYTTTPDEAVALADRLAEFFPRKQIVISRLGAALGVHAGPGTLFVATRSN"
FT   gene            complement(403848..403922)
FT                   /locus_tag="DehaBAV1_R0008"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(403848..403922)
FT                   /locus_tag="DehaBAV1_R0008"
FT                   /product="tRNA-Met"
FT   gene            404163..405113
FT                   /locus_tag="DehaBAV1_0400"
FT   CDS_pept        404163..405113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0400"
FT                   /product="Mg2+ transporter protein, CorA family protein"
FT                   /note="PFAM: Mg2+ transporter protein, CorA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16985"
FT                   /protein_id="ABQ16985.1"
FT                   /translation="MALTQVKNNTSNIESITYGNLTWINIENPQEVDTEYLAANYPFHP
FT                   LDLDDVLSRRQRPKVDEYNEYLFFVLHFPFYNKELRTTVPAQLSVFIGGNYLITLHTGN
FT                   LKPLVKLYREMELDESSRPEYFDHGSGFLMYRIVDRLVDYCLPITVKLLDNLEEVEDDI
FT                   FAGSNSDLNIVKDIALLRRDIIATRRIIWPMRAVIGCLENKLRKFINQDMSVYFGDMTD
FT                   HMDKIWDTLDETKEVIEGLSSTFDSMSSHRTNRAMRILTIVATILLPFTMVASIFGMNI
FT                   PLPFQNSENAIYFVAVITAIIVSLMLYMFRRVRLI"
FT   gene            405135..405794
FT                   /locus_tag="DehaBAV1_0401"
FT   CDS_pept        405135..405794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0401"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16986"
FT                   /protein_id="ABQ16986.1"
FT                   /translation="MNVSSRLLIVSGLYITCLITANLIAVKIIALGDVFLPAAVIVFPF
FT                   SYIFGDVLTEVYGFHWARRIIWLGFICNLIFVVFVALGQVLPGAPFWEGQAAYETILGY
FT                   TPRILLASFLGYLVGEFVNSFIMAKLKLRTKGRYLWLRTIGSTLAGQGLDTSIFIMVAF
FT                   LGTPVFVPMMILYHWGSKVLIEAAATPLTYRLVNYLKKAENSDHFDTATNFSPFKL"
FT   gene            405815..406591
FT                   /locus_tag="DehaBAV1_0402"
FT   CDS_pept        405815..406591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16987"
FT                   /protein_id="ABQ16987.1"
FT                   /translation="MEIVFLGAHNCETKTTRPSCLMLSGGVVLDAGAITGSLTLDELYS
FT                   LKAVILSHAHYDHIKDVPLLAMNLAYGLKSVDIYGSQAVEEVVTKPPFSGGFYPDFFTR
FT                   PPSAPALRFNKITPGLEFDCQGYRILPVSVPHSRDTTGFWVKDLNGHSFFYTSDTGSGL
FT                   GAVWEQVNPELLIIELTMPNKLTELALTSKHLSPELLETELLLFREMKGYLPQIVTLHT
FT                   TPLFEEEIKTEIQAVADRLAADIFMASEGLKLRLGE"
FT   gene            406594..407097
FT                   /locus_tag="DehaBAV1_0403"
FT   CDS_pept        406594..407097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0403"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16988"
FT                   /protein_id="ABQ16988.1"
FT                   /translation="MFAVSEPPRFLVDQNVGKLAVYLRMLGFDARRFGNGSDRQLLSEA
FT                   LAEGRVILTRDHLLRERRLVKKGNLKVMLFEIEVAEDQLRQLLSDMALHSFILPFSRCI
FT                   ECNYPLYPVMKETLSEKVPPYVYQNQTEFKECHHCGRVFWKGSHWQAMQEVLNRLGVDN
FT                   NPSC"
FT   gene            407134..408672
FT                   /locus_tag="DehaBAV1_0404"
FT   CDS_pept        407134..408672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0404"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16989"
FT                   /protein_id="ABQ16989.1"
FT                   /translation="MEIISSVQMRQIEDACLKQGISTETLMENAGRAVAVFARHLLEEQ
FT                   NGCRVLILAGAGNNGGDGLVAGRYLRSWGEKVSIFVPFIDTPKGKTVQGCLEASGDIFA
FT                   GLAELEEHLADADLVIDALLGTGVNRPLEGIYKEALQMTANVRNTRPEMQVLAVDLPSG
FT                   LNADTGQADDACLKADFTLSLGIAKQGLFTHRGLELSGAVSVADIGIPPELTTDIQAVL
FT                   IEKDWAKSVLPVRSPHANKGNFGRVMIVAGSDRYIGAAILAGSAAMRVGAGLVTLALPE
FT                   SLTGAVASRIPEATYLPLPEVSSGTADNSAARFVLSELGKYDVLLIGPGLGQTGYSARL
FT                   VTEVLSNLPVGLKVIIDADALNILSAITDWWLEYKFDAVLTPHPGEMARLAKTTTEAVQ
FT                   SDRFGLCQKFACKWGKTLILKGAGTIVTSPQGETLCNPAANPVLASAGTGDVLAGIIGG
FT                   LLGQGVSLFEAAGLGVYLHSLAAEALRSEIGDAGVLASDLLLKLPVIIKGLKQG"
FT   gene            408676..409467
FT                   /locus_tag="DehaBAV1_0405"
FT   CDS_pept        408676..409467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0405"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16990"
FT                   /db_xref="GOA:A5FS34"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS34"
FT                   /protein_id="ABQ16990.1"
FT                   /translation="MNKQAATEKLVAVDIGNTSVNIGIFEGEQLLANWHLGSVAQRMAD
FT                   EYASLLLGLLQHAGIQAGELNRVIMCSVVPPLTTTFEEVFKTYFKATPLVVGAGIKSGV
FT                   KIRMDNPREVGADRIVNAAAARVLYPGACIIVDMGTATTFDTLSESGEYIGGAIAPGIA
FT                   TSAQAIVEKTSKLPKIEIIHPAKAIGSNTVSAMQSGVYFGYIGLVEELVRRIQAELGQK
FT                   ARVVATGGYASLIAEGSRIFDIVRSDLTLQGLRFIYQMNKV"
FT   gene            409570..410751
FT                   /locus_tag="DehaBAV1_0406"
FT   CDS_pept        409570..410751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0406"
FT                   /product="Phosphopantothenate-cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16991"
FT                   /protein_id="ABQ16991.1"
FT                   /translation="MNKEQTVVLGITGSISAYKAGDIASKLLAEGYTVKAVMTEDACRF
FT                   ISPLTIRTLSHQPVVTSMWDINSEYSVEHVSLAEEADVILVAPATANIIAKLACGLAND
FT                   MLSATILACKSPVIIAPAMNDNMYSNPVTQQNISKLKERGFIFVEPEYGRLASGKTGQG
FT                   RLASLDKILGSVTQVLAKNGPLAGKKLVISAGGTREPVDPVRYVGNRSSGKMGYALAEE
FT                   AVRRGASVRLVSGVTDRPVSFGVDIMYTETALEMFAALREAVKGADALIMTAAVADYRP
FT                   ERLAADKIKKGAEGLDLHLVANPDILASLQGDFVKVGFAAESRDLMINALKKMTDKNLD
FT                   IIAANDISQPDSTFGSDTTRLTLFFKNGRVEELPLLKKQEAAARLLDEISGLL"
FT   gene            410839..413481
FT                   /locus_tag="DehaBAV1_0407"
FT   CDS_pept        410839..413481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0407"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="TIGRFAM: valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16992"
FT                   /protein_id="ABQ16992.1"
FT                   /translation="MAQCSDLPEMAKAYEAAEVEKKWYQYWMEKGYFKPNPNSDKKPFV
FT                   IIMPPPNVTGELHLGHALTATLEDIMIRWHRMQGEPTLWLPGVDHAGIAAQVVVERELA
FT                   KQGKTRQQLGRELFLEKMWEWVNPCREKIRHQHMRLGASCDWDRETFTLDAGPVKAVRE
FT                   IFTNLYEKGLIYKGERIINWCPRCGTAVSDLEVDHKDLAGHIWHLRYPLEDGSGFVTVA
FT                   TTRPETMLGDTAVAIHPDDTRYAGMVGKNVVLPIMNRRIPVIADEAVDMAFGTGAVKVT
FT                   PAHDPNDFEMGLRHNLPMITIQNRDTTMNENAGPCSGMTAKACREYVVSEMKSLGLLLK
FT                   IEDYTHSVGHCQRCSAVIEPMVSKQWFVKMEPLAKPALEAVNSGRIQILPERFNKVYQN
FT                   WMENIRDWCISRQLWWGHRIPVWYCPCGEMIVAKVDPTVCPKCGGTELEQDPDVLDTWF
FT                   SSGLWPHSTLGWPDQTEDLKRFYPGTVMETAYDIIFFWVARMIVMGMEDMNEVPFRTVY
FT                   LHGLIRDDKGEKMSKTKGNVIDPLKVIDQYGTDALRFAVTFGTSPGNDSKLGQTKLEAA
FT                   RNFANKLWNASRFVIMNLGEAKELTPEAELPLEDRWIISRMNRVTADVTRLMEEFQFGE
FT                   AQRVLQDFIWGEFCDWYIELAKVRLRDEASVSPRPVLVRVLSSILRLLHPYMPFITEEL
FT                   WSYLRPYLPESLRETDIIVAPYPAADKTCFDEQAESVMGSLVEIVRSLRNLRAEHNVEI
FT                   SRYIQANIYAGDKASVLGNYLGAVETLSRARPVNILPGHYSGASTATEVVLVLNGIEVV
FT                   VPMSTMVDLEVEAKRVKAEISELEIQIERLSTRLSDEQFLAKAPQAVVDKERIKLEGYI
FT                   EKVSRLKSA"
FT   gene            complement(413478..414551)
FT                   /locus_tag="DehaBAV1_0408"
FT   CDS_pept        complement(413478..414551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0408"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein; histidine kinase,
FT                   dimerisation and phosphoacceptor region; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16993"
FT                   /protein_id="ABQ16993.1"
FT                   /translation="MTETRFKPPALCHRCLFENASDAIWFYDRKGHIVYANRASAELTG
FT                   YTRTELKQKNLKDLLTTASEYDQIMDMNSRIAVGEEVKMPYEQKIRRHDGSVAVLRMAT
FT                   TLVKSADEVLGFQNIARDITEELRRQQNMKSFVQDVIRAQEAERKRISRELHDEVAPLL
FT                   LLLMQKIDNLSKQSERDIADCKPQLDALRTQSEEALESLRRIAQDLRPRILDDLGLIPA
FT                   LEWLTEKLAQDGQIHTESNVKGREVELTAEIQLLIFRIAQEAFNNIRKHSLATWVRLEL
FT                   EFKPKAILLTIQDNGKGFNLSEQTDNLAQNGKLGLAGMHERAQLIGGHIHILTHPGQGT
FT                   TVIAEVPTTNPDTKPAS"
FT   gene            complement(414532..415230)
FT                   /locus_tag="DehaBAV1_0409"
FT   CDS_pept        complement(414532..415230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0409"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16994"
FT                   /protein_id="ABQ16994.1"
FT                   /translation="MAKTKVLIADDHAVLREGMSRLLSQEKDIEVIGEAGDGQEAVDMV
FT                   AQLKPDVVLMDIVMPRLTGVEATKLIKKNNPSTCILILTAYSDIRYILGLLEAGASGYL
FT                   LKSAKSDEIVGAIRAIKAGESVLDSVATRKLLERVVNVSKESDEDKVRGQLSPREIEIL
FT                   QLASKGLSNREIADKLTLSMRTVKAHLSNIFNKMRCSCRTEAIVKGFREGYVMLEDVPQ
FT                   GIDGYDRNTL"
FT   gene            complement(415333..416016)
FT                   /locus_tag="DehaBAV1_0410"
FT   CDS_pept        complement(415333..416016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16995"
FT                   /protein_id="ABQ16995.1"
FT                   /translation="MTEILNGQTPELVIARLRAAIEKGQAWYPALLEAVAVWPLDSEEY
FT                   DGRHYQYLIGGEALDLILLFERFSRELEDLIPAQERDNLLFKGIAPQELTADELLAFLG
FT                   EVRYRQYLNYFYGITVEEALLVVTQSEVRKEHRSLGVRREGTVIDEAFVQLYERTHDEM
FT                   LDQFRREKRYSKTGTIKIHQLKEFTYWLFKYRLLHSEKARVASDTNKSLNYLKKYARRL
FT                   QQKSN"
FT   gene            complement(416041..418899)
FT                   /locus_tag="DehaBAV1_0411"
FT   CDS_pept        complement(416041..418899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0411"
FT                   /product="protein translocase subunit secA"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   helicase domain protein; SEC-C motif domain protein; SecA
FT                   DEAD domain protein; SecA Wing and Scaffold; SecA
FT                   preprotein cross-linking region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16996"
FT                   /db_xref="GOA:A5FS29"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS29"
FT                   /protein_id="ABQ16996.1"
FT                   /translation="MFKFFSSFGDSNEKEIRALEPLVDKINQLENSFTTLSDEALKAKT
FT                   IEFRARLKDTFETTTAGIQEDITSTTAELAEAQKIADNSKQSRLKAKLESLNKDLSAKE
FT                   TTALNGILPEAFAAVREASRRTIGLRHYDVQLIGGMVLHHGKIAEMRTGEGKTLVATLP
FT                   LYLNSLLGKGVHLVTVNDYLARRDAYWMGPVYHALGVSVSSIYPMQTPTEELPSRLFDP
FT                   DYTSEIPGDPWTHFRPISRQEAYKADITYGTSTEFGFDYLRDNLRPDLAQCVQRDMNYA
FT                   IVDEIDNLLIDEARTPLIISAPDTEAGKLYDVFARLSPRLVAVKDYEINEKDRNAELTE
FT                   DGWANVEKLLSREGVMKGNSLYDPQNAPLIRHLRNALSAKEFYKKDHQYVVKEGEIIII
FT                   DEFTGRMMLGRRYSEGLHQAIEAKEHVKVQQESKTYATVTIQNLFRMYRKLCGMTGTAA
FT                   TEAEEFSKIYKLEVVIIPTNKPAVREDYGDQIYKDQSAKFKAVVNEIDEMRKLGRPVLV
FT                   GTVSIENSEMLSNMLKRQGIEHKVLNAKQHEKEAQVVAEAGKPGAVTVATNMAGRGVDI
FT                   LLGGKEPTKDDAKVYNEWQAHHQQVLEAGGLHVIGTERHESRRIDNQLRGRSGRQGDPG
FT                   SSRFYVALDDDIMRRFGSERIQGIMEWAGMDENTPIENGLVSRTLENAQKRVEGYHFDV
FT                   RKHLVEYDDVVNKHREVIYAERRKILSGADLKSNILDMIREEIITQTAEHTRGYDSSEW
FT                   NLDGLVTHLNGIFTLPAEINAEALAKLSQEEITDLLTRTAEELYQKKEDETGAGSMRLL
FT                   ERIIMLHTLDSLWVEHLTIMENLRREIGLQAFAQRDPLIAYKNEGHVRFQELLETIKHD
FT                   VVHNIYRIGIQIQHQTESATAKAASSPVQQQKPLPAAPAAAIPGVSAKAATQSTTPAAK
FT                   EIGRNDPCPCGSGKKYKKCCGK"
FT   gene            complement(418903..419877)
FT                   /locus_tag="DehaBAV1_0412"
FT   CDS_pept        complement(418903..419877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0412"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16997"
FT                   /protein_id="ABQ16997.1"
FT                   /translation="MLVNGNLTEELKIFTGNANPDLAKAVAEYLKVQMGKCEVFQFSNE
FT                   NIFVRIQESVRQKDVYVIQPTCSPVNQSIMELLIMMDALKRASSERITAVLPYYGYGRT
FT                   DKKDQPRVPITARLVADLLTTAGASRILTVDLHAPQIQGFFNMPVDELTAENLLANYFK
FT                   KKNIKDLVVVATDVGISKKARDFAAKLDAPLAIIEKRRMGNNDITRTINIIGDVEGKNA
FT                   LTFDDEIDTAGSLVGNVNILISKGVKEVYSCATHPVLSGPAIQRIATSPIKELVVTDSI
FT                   PLTPQKKIDKITVLSIAPLIGEAIYRIHTGNSIGEMYDQMQME"
FT   gene            complement(419893..421140)
FT                   /locus_tag="DehaBAV1_0413"
FT   CDS_pept        complement(419893..421140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0413"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16998"
FT                   /db_xref="GOA:A5FS31"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS31"
FT                   /protein_id="ABQ16998.1"
FT                   /translation="MSFLKTSDPAVYNAIMQETTRLKETIDLIASENYTSKAVLEAQGS
FT                   VFTNKYAEGYPGKRYYAGCEYADAVEELAIDRAKTLFHAEHANVQPHSGAQANMAAYFA
FT                   MVKPGDTIMGLTLSHGGHLTHGSKVNFTGKLYHVIEYGLNAETERIDYDNLEKLAMEHR
FT                   PRMIVTGASAYPRILDFERFRAICDKVDAKLMVDIAHIAGLVAAGLHPSPVPYADVVTS
FT                   TSHKTLRGPRGGFILCKEQYAKAIDQAVFPVMQGGPLMQVVAAKAVAFQEAMQPGFVTY
FT                   QKKTLENTQVMAEELRKLGLRLVSGGTDNHLVLVDLSPIGVNGYDAQLALRRAGIVINR
FT                   NTVPFAENQTANVPAGIRLGCPAATSRGFGPAEIRQTVGWIGKILKNIGNEDVEKQVLA
FT                   EVIHLCRKFPVPGIDI"
FT   gene            421274..421894
FT                   /locus_tag="DehaBAV1_0414"
FT   CDS_pept        421274..421894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0414"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ16999"
FT                   /protein_id="ABQ16999.1"
FT                   /translation="MHDKEELLKGIYIEIARCVRCNLHTTRTCSVPGEGNADAKIMFIG
FT                   EAPGFNEDQQGRPFVGAAGKFLTELICSIGLTREDVYITNVVKDRPPGNRDPLPDEISA
FT                   CCNFLDRQIEIIKPKIIVTLGRFSMARYFTGITISKIHGQPMRRDGIIYYPMYHPAAAL
FT                   HQGGLRKEIEQDMLRIPGLLEELKCAEALLVPKEPPARQVGLF"
FT   gene            421901..423556
FT                   /locus_tag="DehaBAV1_0415"
FT   CDS_pept        421901..423556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0415"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17000"
FT                   /protein_id="ABQ17000.1"
FT                   /translation="MAKPKLKIVPLGGLGEIGKNMMSVEYGEDIILIDCGLMFPEEEML
FT                   GIDLVIPDISYVLENREKVRGIVITHGHEDHIGALPYILPQINVPIYCTKLTQGLISVK
FT                   LKEAKLLHQTKINVIPSDGTFKLGKLKVDFYPVCHSLPDSVGLVIQTPIGAVVHSGDFK
FT                   LDYTPVDGKPTNLSRLAMLGARGVLLLMSDSTHVELPGYTPSETVVGENIDRIIGAATG
FT                   RVLVTTFASLISRQQQVIDAAAKYGRKLFFAGRSMTEIHKMATDLGYLKVPEGLVCNIE
FT                   QLQRVPPEKVVLMTTGSQGEPTSALVRIANRDFRHVHIMKGDTVIISASPIPGNESLVS
FT                   RTIDSLFRQGAKVFYDRIAKVHVHGHASQEELKLVLNLVKPKYFVPVHGEYRHLTMHAE
FT                   LARTMGVAPENAFVMEDGDILELNTKSGRITGKVPSGNVYVDGLSVGDVGGVVLRNRRM
FT                   LSQDGIVVAIVAINKQTGMLVGRPDIVSRGFVDPDESKAMLDASRDLIIKLLDHDGKDI
FT                   PEGAMYNDVKETLNKFYYEQTKRRPMVIPVMVKV"
FT   gene            423576..426026
FT                   /locus_tag="DehaBAV1_0416"
FT   CDS_pept        423576..426026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0416"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17001"
FT                   /protein_id="ABQ17001.1"
FT                   /translation="MPKKEDPRETLRNARPRAKTPAKITASKRKKPAPVSSKTKKIASK
FT                   KAFSSTPAKGGASWLWVMLVASAMAFVVWQWEGVMDFFANFGSGTAGLFGWGLLLVLLG
FT                   IIIAIVALRFDQMSEWAHRYRLNLWNKWLGGVVLILAAWGMLGMMDAGGDIGLGILGGK
FT                   TDVNGFMRVLALIVLGVILIAPGAVWTSLSGLFKGIFRPSRRSNMPEVARLDRTVVSRP
FT                   VFGGHEDSISPDMGEPVRRLANTKPASKIELPSIKLPSFGKTESRVIEIKNPLAAKTAP
FT                   QTELPNMPAENTSREPKPADDRSDADRRQVASEVWKKYGEAEGLVEMDGWKLPPIEMLD
FT                   KTTEIGFSEADNLQRARAIEDALASYGVEGKVIQINAGPTVTQFGVEPGWDRKFKEIKE
FT                   RDKDGETTSRQVEVSKTRVKVDRIASLANDLALALAAPSLRIEAPVPGKSIVGIEVPNT
FT                   SFGVVSMRSVMETNTFQKILARSPLALALGKGAGGEAVSGDLTKMPHLLIAGATGSGKT
FT                   VCLNSIICCMLLNNTPASVKFIMIDPKRVELTPFNGLPHLATPVIVDVEKALSALRWLA
FT                   AEMDRRYQTLAAAGSRNIEGYNKTRVGSDRMAFIVLIIDELADLMMAGFDEVEHILCRL
FT                   AQMARAVGIHLVVATQRPSVDVITGLIKANFPTRISFAVTSQVDSRTILDMVGAEKLLG
FT                   RGDMLYMPTEAAKPKRLQGCYVSDAESERLIYFWTNQKDISPSEALKVEEITAPPPAQK
FT                   SRTKDPLFDEAMALISEHNNIISASFLQRKMHIGYPRAARLADELREAIEGDDGKAEVP
FT                   KDEY"
FT   gene            complement(426065..426214)
FT                   /locus_tag="DehaBAV1_0417"
FT   CDS_pept        complement(426065..426214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17002"
FT                   /protein_id="ABQ17002.1"
FT                   /translation="MKDPNKTPQTRQEQREQRLLSRRKQMAQHGKGLAQVYKDAVEKKT
FT                   KQKP"
FT   gene            complement(426211..428205)
FT                   /locus_tag="DehaBAV1_0418"
FT   CDS_pept        complement(426211..428205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0418"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase
FT                   domain protein; UvrB/UvrC protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17003"
FT                   /protein_id="ABQ17003.1"
FT                   /translation="MPSFKIVSDFALTGDQPQAVEKLAEGLVRGLTDQTLLGVTGSGKT
FT                   FTMANVIARVNRPTLIISHNKTLAAQLYSEMKEFLPENSVEYFVSYYDYYQPEAYVPQK
FT                   DMYIEKDSDINEEIDKLRHAATRALFERRDVVIVASVSCIYGLGEPEEYRSFVLPLKKG
FT                   QSFRRDLILRRLVDMQYERNDLDFSRGKFRLRGDTLEIQPAYEELALRVEFFGDEIERI
FT                   VSLDPVSGELLADIEEINIYPAKHFVTSAEKMAEAIKSIQAELEDRLKELEAEGKMLEA
FT                   ARLKQRTNYDLEMMEQAGYCSGVENYSRHLAGRKAGSAPWTLLDYFPEDFLLIVDESHM
FT                   SLPQIRGMYAGDSARKKTLVDYGFRLPSAMDNRPLSFDEFKARVKQAIYVSATPGPYEK
FT                   EHSLQVVEQLVRPTGLLEPVMTVKPTVGQIDDLLEEVKKRVAKNERVLITTLTKKMSEK
FT                   LADYLVEMGVKTHYLHSEVDTLERIEILRDLRLGVYDVIVGINLLREGLDLPEVSLVAI
FT                   LDADKEGYLRSEQALIQTMGRAARHVDGQVIMYADKITGSMQRAMDEIIRRRKIQEDYN
FT                   RLHNITPQGIRKAIKDINERIRSVTAEVSGPEFRPTPTLREDIARLIKELESQMKKAAK
FT                   NLEFERAALIRDRVVELRAALEIDPLGRK"
FT   gene            complement(428251..428835)
FT                   /locus_tag="DehaBAV1_0419"
FT   CDS_pept        complement(428251..428835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0419"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA, domain
FT                   I; SMART: Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17004"
FT                   /protein_id="ABQ17004.1"
FT                   /translation="MISSLNGILEASGKDWAVINVSGVGFRCHMPATSSALIGGLGQRV
FT                   RVFTHLHVREDALSLFGFATTEELSLFETLIDVSGIGPKLGLAMLSVMNAEALASAIIS
FT                   GNAELLSTIPGIGKKTSSRIILELKDKIAKNWEAGVLSQVTEANSDILATLTALGYSSS
FT                   EAAKAISSLGDNGDLPLEERIKLALNYFNNK"
FT   gene            complement(428832..429335)
FT                   /locus_tag="DehaBAV1_0420"
FT   CDS_pept        complement(428832..429335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0420"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="TIGRFAM: crossover junction endodeoxyribonuclease
FT                   RuvC; PFAM: Crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17005"
FT                   /db_xref="GOA:A5FS25"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS25"
FT                   /protein_id="ABQ17005.1"
FT                   /translation="MRILGIDPGTLVVGYGIIETANDELTLVGFSSLTPPACAPIPQRL
FT                   AYIYKGLVEVIELYQPDEVAVESPFADKNIKSALAIGKAQAVALLAAANHSLPVTEYSP
FT                   ACIKSRVAGSGNASKEQIQEMVRLLLNLAEIPQPNDAADALAVAICHHSQRAFTNIISQ
FT                   GDLT"
FT   gene            complement(429339..430094)
FT                   /locus_tag="DehaBAV1_0421"
FT   CDS_pept        complement(429339..430094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0421"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17006"
FT                   /db_xref="GOA:A5FS26"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS26"
FT                   /protein_id="ABQ17006.1"
FT                   /translation="MSGHSKWATIKHAKGAADAKRGQLFTKLSREIIFAAKQGGPSPEG
FT                   NARLRLAIQKAKDSRMPSDNIERAIKKGSGELEGTTVIEMILEGYGPGGVAVLVNGMSD
FT                   NRNRTVSDVRHMFSKGGGSLAESGAVSWIFEAKGVIGVETARLDTDELSLKAIDMGAED
FT                   VNTDEGYMEIYTAMPDMEKIRQQLETQGVTIDSAEINMVPKNTVKLDEETAMQVLKLLD
FT                   KLEELDDVQTVSSNADFDPEVVEKYHSQA"
FT   gene            complement(430211..430570)
FT                   /locus_tag="DehaBAV1_0422"
FT   CDS_pept        complement(430211..430570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0422"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17007"
FT                   /db_xref="GOA:A5FS12"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS12"
FT                   /protein_id="ABQ17007.1"
FT                   /translation="MLYTGTDIIEIRRIKAAEARWGEHFLNRIFTPAELSLCKDRFPSL
FT                   AARFAAKEAVIKVLSLPKNQSYTEIETLNLPEGQPSVNLYGQARDKANILGIKHLSISL
FT                   SHCREYAIAMVVAQD"
FT   gene            complement(430612..431076)
FT                   /locus_tag="DehaBAV1_0423"
FT   CDS_pept        complement(430612..431076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0423"
FT                   /product="NADH dehydrogenase subunit E"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 24 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17008"
FT                   /protein_id="ABQ17008.1"
FT                   /translation="MDKPVNKTYTPVLSLYEAKKENLIPILLAFQRNFSYLSRDMMQKV
FT                   AAYVGVPESSVYNIATFYSQFRLEPPGIHRVHVCRGTACHVMGAERLLRNIEKRLGIKA
FT                   GETTLDNEISLDTINCAGICGLAPTLEVDGKLYTRLNGSSLNRILGKKKR"
FT   gene            431313..432863
FT                   /locus_tag="DehaBAV1_0424"
FT   CDS_pept        431313..432863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0424"
FT                   /product="propionyl-CoA carboxylase carboxyltransferase
FT                   subunit"
FT                   /note="PFAM: carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17009"
FT                   /protein_id="ABQ17009.1"
FT                   /translation="MAVQDQLDNLNRLKKQAEMGGGEAKIEAQHKRGKLTARERIELLF
FT                   DKGTFNELGAFASHRCRDFGLEKQRNAGDAVVTGSGLVNGRLVFTYSQDFTVLGGSISE
FT                   VVGQKVAQVIDMAIRAGAPLIAINDSGGARIQEGVASLSGVGDILLRNTIASGVIPQIS
FT                   IVVGPSAGGAVYAPALTDFIFAVKGISQMYITGPDVIKTVTGEDISHEALGGAEIHAKK
FT                   SGVAHFLCENEKECFEQVRELMGFLPQSNREKPPRGKNKDNEERKTRDLRDIIPDNPKR
FT                   AYDMKKVITEVADEKEFFEVHKNYAQNIIVGFVRMGGQPAGIVAQQPSHMAGVIDINAS
FT                   LKAARFIRFCDAFEIPLVSFVDVPGFMPGTDQEHSGIIKHGAKLIYAYAEATVPKITVI
FT                   TRKAYGGAYIVMSSKHLRGDVNYAWPASEVAVMGAEGAVNIVSRKAITESANPEETRQK
FT                   LLEEYREHFANPYQAAQLGYIDDVIDPADTRSKIIKALRSLENKILVNPPKKHGNIPL"
FT   gene            432844..434139
FT                   /locus_tag="DehaBAV1_0425"
FT   CDS_pept        432844..434139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0425"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17010"
FT                   /protein_id="ABQ17010.1"
FT                   /translation="MGIYLCKGRLHKQNMGKTLAEKILSLKSGSDASAGDIVVSMVDLA
FT                   FVQDTTGPLTVREFWDNGFTKLANPLRTALFLDHAAPSPQRQLSTDHILLRKFARDTGA
FT                   LIFDVGEGVCHQLVAEKLARPGDVIVGADSHTVTAGGLCAFATGMGSSDIAVAFALGKT
FT                   WFRVPETIKVVVSGRFKHGLYAKDLILHLIGLIGADGATYKALEFSGNVVNNMTVAERL
FT                   TIANMAVEAGAKVGLFPSDRQTLEYLRSVGREADYQPLAADADAVYERVIEIDATALEP
FT                   TISKPHTVDNTATARELKGTKLDQVFIGTCTGGRLDDLAVAAAIFKNRKRHPQTRLIVT
FT                   PASQKIYLEAIRLGYIEILVQAGANIMPPGCGACLGVHQGVLGDGEVCLSTANRNFKGR
FT                   MGNPEGFIYLASAATAAASAIKGEISDPREVM"
FT   gene            434139..434642
FT                   /locus_tag="DehaBAV1_0426"
FT   CDS_pept        434139..434642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0426"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17011"
FT                   /protein_id="ABQ17011.1"
FT                   /translation="MLKGKAFKFGDSISTDHIAPGRLVHLRSNLPELAKHVLEDADPTF
FT                   AQRVKPGDFVVAGNNFGLGSSREHAPLIIKMAGVSAVMAKSVARIFFRNAINLGLPILI
FT                   CDTDKIAEGDELEVDLDGGKIYDRTNGAELTFGKIPPAMLKILDEGGVMPYIKKYGDFK
FT                   LNEV"
FT   gene            434657..435736
FT                   /locus_tag="DehaBAV1_0427"
FT   CDS_pept        434657..435736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0427"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17012"
FT                   /protein_id="ABQ17012.1"
FT                   /translation="MYHNVTLIPGDGIGPEISEATRRVLEATGVKFNWEVVNAGADVVA
FT                   EYGTPLPDIVLESIRKNKVAIKGPVTTPVGSGFRSVNVGMRKALNLYTCLRPCKTYPGV
FT                   PSRYDNVDIVIVRENMEDLYAGIEFEKGSAEALRLIEFIKENKKVEIRTDSGISIKPIS
FT                   VFGTERIFRWAFKYAKDNNRKKVTAVHKANIMKYSDGLFLAVGRKVAEEYPEIEFEDRI
FT                   VDNMTMQLVKTPTQFDILVCPNLYGDILSDLCAGLVGGLGVAPGANIGDEYALFEPTHG
FT                   SAPKYKGLNKVNPMAMMLSGVLMLRYLKEEKAADKLENAIAAVIAEGKSVTYDMLSPDK
FT                   QAVAVGTSQVADAIIAKMK"
FT   gene            435816..436739
FT                   /locus_tag="DehaBAV1_0428"
FT   CDS_pept        435816..436739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0428"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: malate dehydrogenase, NAD-dependent; PFAM:
FT                   Lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17013"
FT                   /db_xref="GOA:A5FS18"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS18"
FT                   /protein_id="ABQ17013.1"
FT                   /translation="MPKISVIGAGNVGATLAQRLIEKDFADVVMLDVVEGIPQGKALDI
FT                   SQSASVLGFRHAITGSNDYAETAGSEIVVITAGIARKPGMTREELLAINQKIMTDVVSN
FT                   CLKYSPEATLVVVSNPVDTMTYLAWKLSGLPRKRVVGLSGVLDGGRLATFVARELGVNP
FT                   SAVSPCVMGEHGGSMVVMPRFTLVNGKPLSELVSPEKADELAKRAVNGGAEIVAFLKTG
FT                   SAFYAPSASVAAMVEAIFLGSGKVMNCAAVLDGEYGLRNIVLGVPVKLGKGGIKEIITL
FT                   PLDGQENARLQVSAEMVKAQIASLSL"
FT   gene            436762..437133
FT                   /locus_tag="DehaBAV1_0429"
FT   CDS_pept        436762..437133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17014"
FT                   /protein_id="ABQ17014.1"
FT                   /translation="MSKDKEFLDAFLKLKTELDDTVYKLEDVVINGNLEEKIAALKEAE
FT                   ESLPPALERFDTLPEPEAENVKNARDSYKKAMHLYQQACSHYVKLLTEQNREEGKEGAY
FT                   KMKQAGDLFVKASEYLEGK"
FT   gene            437134..437976
FT                   /locus_tag="DehaBAV1_0430"
FT   CDS_pept        437134..437976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0430"
FT                   /product="fumarase alpha subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate alpha region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17015"
FT                   /protein_id="ABQ17015.1"
FT                   /translation="MREIAASRISAVLAELIVKISTELGEDILTALHKAYEAEESPAGR
FT                   DILQSLLENARIAKEKKIPLCQDTGTAIVFAEVGQEVHVTGNFTDAINLGVRQGYEQAY
FT                   LRKSIVSHPFSKRINTNDNTPAVIHTEIVPGDRLKISFMAKGSGAENMSRLFMLKPGVG
FT                   REGVIEAVLETVEKAGGSPCPPIIIGLGVGATAEKAMFMAKKALLRPLGITHTDPEAAA
FT                   LETEVLKQVNKLGIGPLGLGGRVTALGVMAETAPTHIASLPVAVNLQCHSARHGEAVL"
FT   gene            437976..438545
FT                   /locus_tag="DehaBAV1_0431"
FT   CDS_pept        437976..438545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0431"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17016"
FT                   /protein_id="ABQ17016.1"
FT                   /translation="MSSIKLNSPFDPSELEKLQAGDSVLISGVIYTARDAAHKRLVETL
FT                   KQGKKLPFDLKGQTIYYMGPSPAKPGEVIGSAGPTTSSRMDPYTPELLDAGLRAIIGKG
FT                   NRSAEVSRAIVNKKVVYFISIGGAGALLSQCIKESRMVAYPELGAEAILALTVENFPAI
FT                   VAIDSQGNNAFTLGQSLYRVVGTKEA"
FT   gene            438547..438888
FT                   /locus_tag="DehaBAV1_0432"
FT   CDS_pept        438547..438888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0432"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17017"
FT                   /protein_id="ABQ17017.1"
FT                   /translation="MGCLFCAIAKGEIPAQIVYKDEDLVAFKDINPQSPVHILIIPRRH
FT                   IANLTDLDEADTELAGKMILLAGKLAREMDIAESGYRLVINSGREGGQVVQHLHLHLLG
FT                   GRQLGGQLG"
FT   gene            complement(438885..439415)
FT                   /locus_tag="DehaBAV1_0433"
FT   CDS_pept        complement(438885..439415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0433"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17018"
FT                   /protein_id="ABQ17018.1"
FT                   /translation="MVEKILSSHYIYCGNLVKLRKVTVELPSGKTAPRELVEHNPCVVV
FT                   VALDTDGKLLMVKQYRLAAAQDMLELVAGSMDSGETPEESTRRELREEAGYKPNTLRRL
FT                   GGFYSSPGFLTEYLYVLVATDLEYAPLTAEDTEDIEVFRYTPAEVKAMIANQQITDSKT
FT                   LAGLMLYFSQTPG"
FT   gene            complement(439432..439908)
FT                   /locus_tag="DehaBAV1_0434"
FT   CDS_pept        complement(439432..439908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0434"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17019"
FT                   /protein_id="ABQ17019.1"
FT                   /translation="MYTIDKATIKDATTIHKLVNNFADHGQMLARSLAEIYENLRDFYV
FT                   IRGDNGEVIACAALHISWADLAEVKSLAVSEERHRQGLGEMVVKACLEDAKALRIPTVF
FT                   CLTYKPAFFLKCGFHEVEKNALPHKIWGECYRCPKFPNCDETAMMLSLAEVNSV"
FT   gene            complement(439892..440746)
FT                   /locus_tag="DehaBAV1_0435"
FT   CDS_pept        complement(439892..440746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0435"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17020"
FT                   /db_xref="GOA:A5FS02"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS02"
FT                   /protein_id="ABQ17020.1"
FT                   /translation="MYKKIGIIYHPLNPAACDLAIKLAAKLDSLGIENWSDSAWQADKL
FT                   TPKMQNTQLILTTGGDGTILRTAHAILPLEIPILSVNLGKVGFMTELSPEDAISGLEKV
FT                   LAGDGWIDERSLLEAEYLPHDSAQSRQFFVMNDAVVARGQVARVICVSVDINSQPFTTY
FT                   KADGAIVSTATGSTGYSYAAGGPVLQPNSADIILTPILPHLGRGYSLVLPSDSIVDLKV
FT                   NTWHEATLSIDGFINMQVSSGDTLRLRQSSKKIQFIRLRPENYFYKGLDTKLKGNNESV
FT                   YDR"
FT   gene            complement(440818..441141)
FT                   /locus_tag="DehaBAV1_0436"
FT   CDS_pept        complement(440818..441141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17021"
FT                   /protein_id="ABQ17021.1"
FT                   /translation="MRIGPIEILLIGGLIAIVWAVSKFGKLGKKSDTTEDAKSKPARVA
FT                   PKAPPRSHTSYRLQYLGIIVLFGGLLLGGISFLLVKQLAYGIVWGVAIAGIGLLLLFFS
FT                   RRK"
FT   gene            complement(441231..442097)
FT                   /locus_tag="DehaBAV1_0437"
FT   CDS_pept        complement(441231..442097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0437"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; NADP oxidoreductase,
FT                   coenzyme F420-dependent; NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17022"
FT                   /protein_id="ABQ17022.1"
FT                   /translation="MKIGILGGSGKMGQWFGRFLTENGHQVWLWGRNPSKLAPIATRLG
FT                   AQAATQPDMLGDMDCLIISVPIDAFEDTLRELAPFTKPDQLVFDLCSVKERPVELMHQY
FT                   LPHCRTLGTHPVFGPGAESLKGYNFILTPTTAPETDLAQGVKTWLEKQGGNVSLISPEE
FT                   HDRLMSVVLGLAHFIAIVSADTLLGQNLPGISSAGGTTFRLLDTLTKSVLTEDPGLYAS
FT                   LQVNMPKLPKLEADFIKRATEWAELVKNGDKAEFARRMQTLKDNLARTEPGFEKAYQAM
FT                   YHLNQPR"
FT   gene            complement(442094..443170)
FT                   /locus_tag="DehaBAV1_0438"
FT   CDS_pept        complement(442094..443170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0438"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="PFAM: prephenate dehydratase; Chorismate mutase;
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17023"
FT                   /protein_id="ABQ17023.1"
FT                   /translation="MNLSDLRKQIDNLDTELVKLMAKRLEVSDQIGKIKEETNSPVQDL
FT                   SRESEVLNRVQSLAQSLGLDPQDIESLYQEILFISKKQQRFTVSFQGAAGAYSEETALK
FT                   IFGPNTLTLPCEQLDATFEAVEKGMARFAVVPVENSLEGSISRTYDLLLDSNLMVAAEH
FT                   ELRVSHCLIANPATNLEAVKTIYSHPQALGQCQSFLKHLRAELIPTYDTAGSVKMIKEK
FT                   GLLNGAAIASERAAVIYNMKVLEREIEDNINNYTRFFVLAKQDSAPTGSDKTSVVFAVK
FT                   HQAGALYDFIKELASRGINMTKLESRPTRLKPWEYNFYLDIEGHRQDENVKQALAKADD
FT                   HVIFMKVLGSYPKMKKHI"
FT   gene            complement(443167..444261)
FT                   /locus_tag="DehaBAV1_0439"
FT   CDS_pept        complement(443167..444261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0439"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17024"
FT                   /db_xref="GOA:A5FS06"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS06"
FT                   /protein_id="ABQ17024.1"
FT                   /translation="MSNSLGKLFQITSFGESHGDCVGVVIDGVPAGLAINVDEIQIEVD
FT                   KRKSGAKAHTTPRREDDRIEIFSGIFNNFTTGAPICLVIWNKNIDSSEYERTRSKIRPG
FT                   HADFTGFMKYGGFNDYRGGGRFSGRITAGHVMAGAIARKLISTIGIEVIGYTAELGGIT
FT                   AKLPKHKDIRQNISQSDVNCPDLAASKQMVALIQQAAEEGDSLGGVVECIGLNLPVGLG
FT                   EPVFDTLEGELAKAIFAIPAVKGVEFGAGFGASRLRGSKNNDPFNIQSDQIRTTSNNCG
FT                   GILGGISDGMPLHIRVAVKPTPSISLSQPTVNLDTMTNTSLEIRGRHDTCIVPRAVSVV
FT                   EAMTCIVLADLALRAGIIPRVIKQ"
FT   gene            complement(444254..445516)
FT                   /locus_tag="DehaBAV1_0440"
FT   CDS_pept        complement(444254..445516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0440"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17025"
FT                   /db_xref="GOA:A5FRZ3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRZ3"
FT                   /protein_id="ABQ17025.1"
FT                   /translation="MKIHLDKSLPGGNIAVPSSKSYTIRGLIAAAQANGQSHIISPLIA
FT                   DDTLATRQVLSGLGININTDTGSESWEITGNTFKAPSGNLFCRESAATLRFMSAVCARL
FT                   PFECHLLAGHSLMRRPMLPLIQALHQLGIEIETRGNTTVINGQVITRSKVSLPGNISSQ
FT                   YVSALMLMAPACTHGLEIHLATPPASLPYLKMTKQTLGSFGIKVHSSIDWQEISIPPQP
FT                   YLPARYRVEGDWSSASSFLALGAIAAPVFISNLDTDSFQADRIMIKFLAEMGAEIESGQ
FT                   NWVKVNPKPLSGINADLTHSIDLLPALAVAAACAKGQSILSGVRQARIKESNRIRAVSQ
FT                   GLSAMGINIIEEDDRLIIEGGQPKGAEIDSFGDHRIAMAFGILGSVVGETHISDAECVT
FT                   KTYPDFWKNLESLGGKVTQDV"
FT   gene            complement(445497..446027)
FT                   /locus_tag="DehaBAV1_0441"
FT   CDS_pept        complement(445497..446027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0441"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17026"
FT                   /db_xref="GOA:A5FRZ4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRZ4"
FT                   /protein_id="ABQ17026.1"
FT                   /translation="MKTKNNIALIGFMGAGKSSISKLLSEKLGKPLVSTDACIETREGL
FT                   SISHIFKENGEDYFRQMESKVLEDICQNPNQIIDCGGGIVTRPHNLSIMRLNCLVVYLE
FT                   SRPEDLENRLKNHTNRPLFNAERSDKMLKLLESRLPLYRDAADITVSTHNKSCHEVCEE
FT                   IEDSLRKYENTSG"
FT   gene            complement(446011..446871)
FT                   /locus_tag="DehaBAV1_0442"
FT   CDS_pept        complement(446011..446871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0442"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17027"
FT                   /db_xref="GOA:A5FRZ5"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRZ5"
FT                   /protein_id="ABQ17027.1"
FT                   /translation="MQTIPDALFGIIGYPVSHSVSPAMQNAAFKHCKLNYLYLTIAAKP
FT                   EDLQNVIASMRPLNIRGLNVTIPHKIEVIKYIDTLDPAAKKIGAVNTIVNENGQMKGYN
FT                   TDFGGFVRLLEHNRIAPAKHRFALLGAGGSAHAISLAICTLGGHLTVLARQEEKAKDLA
FT                   AKMCLRFKGKAQGLELNEANLEETLAESDIIVNCTPIGMGNLAGQSLISPRLLRPDLTV
FT                   IDAIYNPCKTRLLEDAEKKGAKIINGLEMLVWQGAMSFEIWTSQKAPFRVMMKEAEMAL
FT                   DENEK"
FT   gene            complement(446855..447523)
FT                   /locus_tag="DehaBAV1_0443"
FT   CDS_pept        complement(446855..447523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0443"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type I; PFAM:
FT                   dehydroquinase class I"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17028"
FT                   /db_xref="GOA:A5FRZ6"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRZ6"
FT                   /protein_id="ABQ17028.1"
FT                   /translation="MKIPPICCVITQLPQAETLKKSEGAAFYELRLDLLGENWRETAVL
FT                   LNKPFMATCRRSAEGGSFKGNEAERINRLEKAASAGAFMLDIEYSTPNLEEVLGRLRPQ
FT                   AKCLLSHHNFTDTPSAAKLKTLLKDMLTHQADIYKVITTATSINDNINLLNLTKEIPDK
FT                   KIVAFAMGEPGILSRILCPLAGSPFTYASLNDGNKSASGQMTLAQMIEIYRSVNYANHT
FT                   "
FT   gene            complement(447520..448599)
FT                   /locus_tag="DehaBAV1_0444"
FT   CDS_pept        complement(447520..448599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0444"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17029"
FT                   /db_xref="GOA:A5FRZ7"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRZ7"
FT                   /protein_id="ABQ17029.1"
FT                   /translation="MKSIGLNLSGREYKILIGSDLLSETATLLREAIPCDRVVVITNID
FT                   INRIYGKKLKKHLESKGIESLFLELPEGEIHKTLDMAAHIYPQLINHFAERNTPILALG
FT                   GGVIGDLSGFVAATYQRGVPLIHLPTSLLSQVDSSIGGKVAVNHGGVKNIVGSFYQPRL
FT                   VIADTGCLKTLPEKEFACGMAEIIKSAAIGSSELFRMLETNTQAVKDRSPEVMEDIISQ
FT                   TAAIKAGIVCQDETDRGIRNILNFGHTLGHALESTSSFSQSHGAAVAIGMCFAARLSVR
FT                   LGLCENETALRLEKLIADFGLPTNPKDIDPDKIIEAMHHDKKVSDGRIRFILLKRPGEA
FT                   LIAENILKPDVLSVLEEMK"
FT   gene            complement(448619..449674)
FT                   /locus_tag="DehaBAV1_0445"
FT   CDS_pept        complement(448619..449674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0445"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17030"
FT                   /protein_id="ABQ17030.1"
FT                   /translation="MIIMKKDASQEELENVIAEVRRCGLKTDVSKGAFRTIIGLIGDEK
FT                   SIPFAYFSSLPGVKEARMVETPYKLISREYSNLWQAEGMTREIKVKDIIIGGDEPVFIA
FT                   GPCAVESKEALMKIAEGAKMAGAQILRGGVYKPRSSVHSFQGLGSAGKDEATEALSWLK
FT                   EAGERFEMAVMTEVRGESQADLVAEFVDILQVGSRNMYDQDLLATVARKGKPVMYKRHF
FT                   GASMEEFLSFAEYIAAEGNKDIILCERGIVPVGKGKSFTRYNLDLAAVPIALKETYLPI
FT                   MVDPSHATGRRDLIYSMSCAAMAAGANGLMVEVHTNPAEALVDASQMITPPELKELIDT
FT                   CRQINKLVKKH"
FT   gene            449929..450048
FT                   /locus_tag="DehaBAV1_0446"
FT   CDS_pept        449929..450048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17031"
FT                   /protein_id="ABQ17031.1"
FT                   /translation="MVVIGRAADKCPEADGGVLQLQTSGLSVMGGVDIHILLC"
FT   gene            450195..450629
FT                   /locus_tag="DehaBAV1_0447"
FT   CDS_pept        450195..450629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0447"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17032"
FT                   /db_xref="GOA:A5FS00"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FS00"
FT                   /protein_id="ABQ17032.1"
FT                   /translation="MPTVNQLVRKGRTSAAKKYKAPALHYSFNSLRNKVAFGDGSPQKR
FT                   GVCTQVKTTTPKKPNSALRKIARVRLSNHMEVTAYIPGEGHNLQEHSVVLIRGGRVPDL
FT                   PGVRYHIIRGTLDTAGVANRQQGRSRYGAKKGKAAPAKKK"
FT   gene            450643..451113
FT                   /locus_tag="DehaBAV1_0448"
FT   CDS_pept        450643..451113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0448"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17033"
FT                   /db_xref="GOA:A5FRY6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRY6"
FT                   /protein_id="ABQ17033.1"
FT                   /translation="MPRRARKFKRAVAPDSRYNSLMLSNFINKLMMHGQKATAQRIVYD
FT                   AIDIMGKQENKEGLAVFEQGLKNATPFIEVKPRRVGGATYQVPIEVRPDRAQTMAMRWI
FT                   IKAARKRTGKSMAERLASEMLEASREQGAAVKKREETHKMAEANRAFAHYRW"
FT   gene            451169..453250
FT                   /locus_tag="DehaBAV1_0449"
FT   CDS_pept        451169..453250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0449"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17034"
FT                   /db_xref="GOA:A5FRY7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRY7"
FT                   /protein_id="ABQ17034.1"
FT                   /translation="MSDRKYPLERVRNIGIIAHIDAGKTTTTERILYLTKRTHKIGNID
FT                   EGTTVMDWMEQEKARGITITSAATSAYWNGHHLNIIDTPGHVDFTAEVERSLRVLDGGV
FT                   VVFDGVAGVEAQSETVWRQASRYGVPRICFINKMDRTGANYERTLGMIAERLKAKYLPL
FT                   QIPIGCAETFRGNCDLLDFKCYGMDNSPEEPVETFDLPAAEKERAVKFRNMMIERLAEE
FT                   DDEVMEAYLAGEELPIEKLKAAIRRVCLANKAIPIFCGTSLRNKGVKRLLDAVCDYLPS
FT                   PLDIPAMKGTDPKTGESIERHTSDTEPFSALAFKIVSDPFVGRLVYFRIYSGSISAGSG
FT                   AYNSTRGERERIGRLIRMHANDREEIEYADAGEIVASLGLRNTFTGDTLCDQNAPILLE
FT                   NIKFPEPVINLAIEPKTRSDQDKMTEGLQKLAEEDPTFKVKFDDETGQTVIYGMGELHL
FT                   DVLVSRLLSEFKVNAGVGKPRVAYREAITAHAKAQGKFVRQSGGRGQYGDVTIEIEPRE
FT                   RGAGYEFVDNVKGGAIPRNFLMAAESGIRDTLETGVYAGYPMVDVKVIATDGSYHDVDS
FT                   NENAFKMAGSMAIKAAVAKAKPILLEPIMKLEAVTPEEYMGDVIGDLNSRRGQIISVEP
FT                   SPETTVITGTVPLAESFGYTTDLRSVTKGRATFSMEFESYREMPGELATQVVEAAGKK"
FT   gene            453275..453583
FT                   /locus_tag="DehaBAV1_0450"
FT   CDS_pept        453275..453583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0450"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17035"
FT                   /db_xref="GOA:A5FRY8"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRY8"
FT                   /protein_id="ABQ17035.1"
FT                   /translation="MAKQKIRIKLKGFDHKILDQSALQIVEALERTGATISGPVPLPTR
FT                   IQRYSVIRASFIDKDSQEQFEIRTHKRLIDIVETTSKTIDALTNLNLPAGVSIDIKL"
FT   gene            453592..454209
FT                   /locus_tag="DehaBAV1_0451"
FT   CDS_pept        453592..454209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0451"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17036"
FT                   /db_xref="GOA:A5FRY9"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRY9"
FT                   /protein_id="ABQ17036.1"
FT                   /translation="MIQGIIGKKIGMTQIFQEDGKAQPVTLVEAGPCVVVQVKTEKQDG
FT                   YEAVQLGYGKAKHITSAVKGQCRGFGEFKVLREVDVDDIAAVSVGDQITVSDFKDGEKI
FT                   DASGVSRGRGFSGVVKRWHFAGGPKTHGQSDRHRAPGSIGSTTTPGRIYKGKHMAGHMG
FT                   NEAVTIRNLVVLKTDAEKNLLMVKGAIPGGKNTIILIKKTGK"
FT   gene            454212..454844
FT                   /locus_tag="DehaBAV1_0452"
FT   CDS_pept        454212..454844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0452"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17037"
FT                   /db_xref="GOA:A5FRZ0"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRZ0"
FT                   /protein_id="ABQ17037.1"
FT                   /translation="MEIPVYNASGEIVKNINISEDVFGVPFNEALVHQAFVAQQANARQ
FT                   GTQSTKTRGEVQGSSRKIYRQKGTGNARMGTNRSPVRRHGGVAFGPRPRDFSKDLPKKM
FT                   RRQAIRCVLSFKLESGELKVIDQLSFDEPKTRDMAKILTALQVISPTLIAVDNPDTNFI
FT                   KSARNIPAVKTTPANLLNISDMLKNKQLVMTEEAVRQVEELWGQRSG"
FT   gene            454857..455141
FT                   /locus_tag="DehaBAV1_0453"
FT   CDS_pept        454857..455141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0453"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17038"
FT                   /db_xref="GOA:A5FRZ1"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRZ1"
FT                   /protein_id="ABQ17038.1"
FT                   /translation="MNLYEVLRRPLISEKNSVHATQNKYAFEIAKGANKRMVKLAVEQA
FT                   FNVTVEDVNMLHIPGKQKRMGRNLIQTAGLRKAIITLKEGDKITLFEGV"
FT   gene            455167..455991
FT                   /locus_tag="DehaBAV1_0454"
FT   CDS_pept        455167..455991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0454"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17039"
FT                   /db_xref="GOA:A5FRZ2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRZ2"
FT                   /protein_id="ABQ17039.1"
FT                   /translation="MAIKIYRPTSPGRRHHSVSSFEEITKSRPERALLVSVKNDSGRNN
FT                   QGRVTVRHRGGGSKTQIRVIDFKRNKLDVPGRVAAIEYDPNRTARIALVFYTDGEKRYI
FT                   LAPSDLKVGDVIMAGENAEPKSGNALPLSSIPTGTFIHNIEIIKGKGGIMVRSAGAAAQ
FT                   LMAKEDDYALVRLPSGEMRKVRSDCSATVGQIGNIEHGTLEIGKAGRNRHLGWRPTVRG
FT                   SAMSPNNHPHGGGECRCPIGMTGPKTPWGKPALGYRTRKAKYSDKLIVKRRG"
FT   gene            455998..456279
FT                   /locus_tag="DehaBAV1_0455"
FT   CDS_pept        455998..456279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0455"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17040"
FT                   /db_xref="GOA:A5FRX9"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRX9"
FT                   /protein_id="ABQ17040.1"
FT                   /translation="MSRSVKKGPALCPKLMKKVEVASATNQKSIIKTWARWSTITPLMV
FT                   GLNVGVHDGRRHVPIYITENMVGHKLGEFTTTRNFRGHAKAEKVSQVK"
FT   gene            456310..456639
FT                   /locus_tag="DehaBAV1_0456"
FT   CDS_pept        456310..456639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0456"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17041"
FT                   /db_xref="GOA:A5FRY0"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRY0"
FT                   /protein_id="ABQ17041.1"
FT                   /translation="MEVKAIVKDTGYSALKVRLCVDLVRGKKVSEAITLLRFMTSPTAK
FT                   VVSKVIKSAAANAENNFQMNPADLKISQIYADEARMLKRMRPQARGRVSPILKRSSHIT
FT                   VVVAD"
FT   gene            456648..457484
FT                   /locus_tag="DehaBAV1_0457"
FT   CDS_pept        456648..457484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0457"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3-C-terminal domain protein; KH, type 2 domain
FT                   protein; Ribosomal protein S3, N-terminal domain; SMART: KH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17042"
FT                   /db_xref="GOA:A5FRY1"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRY1"
FT                   /protein_id="ABQ17042.1"
FT                   /translation="MGRKVHPIGFRLGIIKDWSAKWHASDKNFAECLTEDLKLRKAISK
FT                   KYVDAAISQVDIERQSNKVTVSVRTARPGIVIGRGGQRVDEMRHFLEDLIGKKVQLNIV
FT                   EISQAELDAFLVARSVAEQIERRVAYRRAMKQAIFRSMQAGAKGIKICASGRLGGVEIA
FT                   RREVMHEGRVPLHTLRADIDYGCTRAHTALGDVGIKVWVYRGDILPEAKEKSESAVTEM
FT                   AAVMADAPAAVVTETKVADIAAKPKRVVKKAEAEIPAEEKPKRVVKKAENITKEEE"
FT   gene            457486..457935
FT                   /locus_tag="DehaBAV1_0458"
FT   CDS_pept        457486..457935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0458"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17043"
FT                   /db_xref="GOA:A5FRY2"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRY2"
FT                   /protein_id="ABQ17043.1"
FT                   /translation="MLQPKRVKFRKVQRGRRDGAAHKGNTVAFGEFALQSLEAGWITAR
FT                   QIEATRRAITRYIRRGGQVWIRIFPDKPITKKPAETRQGGGKGAPEEWVAVVRRGRIMF
FT                   EIGGVTPEAAKEAMRLASYKMPVKTRFVARDIPVVAGETEVEEAE"
FT   gene            457937..458134
FT                   /locus_tag="DehaBAV1_0459"
FT   CDS_pept        457937..458134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0459"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17044"
FT                   /db_xref="GOA:A5FRY3"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRY3"
FT                   /protein_id="ABQ17044.1"
FT                   /translation="MNISDIRGLSDTEIKKKLEDSHKELFELRLKLSTRQLVNHRELPR
FT                   VKNDIARILTVMRERELQIR"
FT   gene            458142..458414
FT                   /locus_tag="DehaBAV1_0460"
FT   CDS_pept        458142..458414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0460"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17045"
FT                   /db_xref="GOA:A5FRY4"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRY4"
FT                   /protein_id="ABQ17045.1"
FT                   /translation="MEIKNKTRIGHVISDKMEKTIVVGIDVVKRHPLYKKTYRRTMKYL
FT                   VHDEKNEAKIGDMIEIVECRPISKGKYWRLSKIITKGHIVAAQEA"
FT   gene            458430..458798
FT                   /locus_tag="DehaBAV1_0461"
FT   CDS_pept        458430..458798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0461"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17046"
FT                   /db_xref="GOA:A5FRY5"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRY5"
FT                   /protein_id="ABQ17046.1"
FT                   /translation="MVQQYTRLNVADNTGAKKIMCINVLGGSHKIQAKVGDVIVAAVKK
FT                   SSPDAQAKSGTVVKAVVVRITKPYARPDGSYIKFDDNAAVILNDKMEPKGTRIFGPVAR
FT                   ELRDKKFTKILSLAPEVL"
FT   gene            458809..459120
FT                   /locus_tag="DehaBAV1_0462"
FT   CDS_pept        458809..459120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0462"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; SMART: KOW (Kyrpides, Ouzounis, Woese) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17047"
FT                   /db_xref="GOA:A5FRX2"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRX2"
FT                   /protein_id="ABQ17047.1"
FT                   /translation="MRLKKNDNVLVIAGKDKGKTGKVRYAYPRTDRVLVEGVNMIKRHS
FT                   RAKGQAKQAGIIEREAPLHVSNLMLLCSKCNKPARIGSRELADGKSVRYCKSCNEVID"
FT   gene            459120..459659
FT                   /locus_tag="DehaBAV1_0463"
FT   CDS_pept        459120..459659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0463"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17048"
FT                   /db_xref="GOA:A5FRX3"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRX3"
FT                   /protein_id="ABQ17048.1"
FT                   /translation="MLKVEERYTNAVPELQKFFNYGNIMQVPKLVKVVINTGVGEAVSN
FT                   SKAMETAEADIVAIAGQHPVVTRAKRSVANFKLRAGMPIGLKVTLRGQRMYDFLNKLFF
FT                   ITLPRVRDFQGVPNTAFDERGNYTLGFKDHSVFPEIDFNKIEKPRGLEICIVTTANTPE
FT                   EGKKLLELLGMPFSKD"
FT   gene            459668..459853
FT                   /locus_tag="DehaBAV1_0464"
FT   CDS_pept        459668..459853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0464"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17049"
FT                   /db_xref="GOA:A5FRX4"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRX4"
FT                   /protein_id="ABQ17049.1"
FT                   /translation="MAKTSKIVQSQRASKFKVQHHNRCSRCGRPRGYINRFGLCRICFR
FT                   ELALQGQIPGVRKSSW"
FT   gene            459887..460282
FT                   /locus_tag="DehaBAV1_0465"
FT   CDS_pept        459887..460282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0465"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17050"
FT                   /db_xref="GOA:A5FRX5"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRX5"
FT                   /protein_id="ABQ17050.1"
FT                   /translation="MISDPIADMLTRIRNGVMARHEVVIMPASRMKQYLAKVMKQEGFI
FT                   AGYEVIGAKPKRQLKIVLRYDEGGASFVSGLERISKPGLRVYVQRGEIPRVYGGLGVAI
FT                   VSTSKGVMTGSQAWRQGLGGELLCKVW"
FT   gene            460298..460846
FT                   /locus_tag="DehaBAV1_0466"
FT   CDS_pept        460298..460846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0466"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17051"
FT                   /db_xref="GOA:A5FRX6"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRX6"
FT                   /protein_id="ABQ17051.1"
FT                   /translation="MSRIGKMPIKVPLGIKVDINGNDVTVKGPKGTLSRSFRPEVTINR
FT                   EGDYLVVAPVGTDKATRAFFGLSRTLLDNMIVGVKDGFDKNLEIVGVGMRADKDGDKVV
FT                   FKVGFSHSVTVAPPAGITLSVDGTTKVKVSGINKEDVGQMAAEIRSIRKPDHYMGKGIR
FT                   YAGEYVRIKPGKAIGKGAK"
FT   gene            460846..461211
FT                   /locus_tag="DehaBAV1_0467"
FT   CDS_pept        460846..461211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0467"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17052"
FT                   /db_xref="GOA:A5FRX7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRX7"
FT                   /protein_id="ABQ17052.1"
FT                   /translation="MAKVNAREARIVRHERLRKKVSGTEARPRLCVFRSIENIYTQVIN
FT                   DNCGSTLVQASTKDAELKAELDGKTKTEQAVVIGNLIAKRSLEAGISEVVFDRGGYKYH
FT                   GRVKALAEAARSGGLKF"
FT   gene            461228..461746
FT                   /locus_tag="DehaBAV1_0468"
FT   CDS_pept        461228..461746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0468"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17053"
FT                   /protein_id="ABQ17053.1"
FT                   /translation="MLAKVERIDPSELELNDKLIFINRVTKVVKGGKRMGFAALVVTGD
FT                   GKNHVGIGVGKAKEVPSAISKASANAKRNLSRILLNGTTVPHEIVFKYGAAQVLLKPAA
FT                   PGTGIIAGGSVRAVLESTGIKDVLTKSMGCSNKANVAKATLGGLTAMRDPKATVTKRRS
FT                   SLKEEATGG"
FT   gene            461739..461921
FT                   /locus_tag="DehaBAV1_0469"
FT   CDS_pept        461739..461921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0469"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17054"
FT                   /db_xref="GOA:A5FRW2"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRW2"
FT                   /protein_id="ABQ17054.1"
FT                   /translation="MAKIKITWVKSTIGYKFDQAATIKALGFKKLNQSVIQDDSSAIRG
FT                   MILKVRHLVVLEEVI"
FT   gene            461921..462382
FT                   /locus_tag="DehaBAV1_0470"
FT   CDS_pept        461921..462382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0470"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17055"
FT                   /db_xref="GOA:A5FRW3"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRW3"
FT                   /protein_id="ABQ17055.1"
FT                   /translation="MRLHELSPAPGSRKDRKRVGRGDAGRGNYSGRGMKGQKARSGGAT
FT                   RPGFEGGQLPIYLRLPRKRGFFNPFRIKYAVVNIEQLNMFEAGTEVTPETLLAAGLIRN
FT                   FVKPVKILSSGHIDRALEVSAHKFSQAAKAQIEAAGGKVQEIDYAAEIE"
FT   gene            462363..463679
FT                   /locus_tag="DehaBAV1_0471"
FT   CDS_pept        462363..463679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0471"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17056"
FT                   /protein_id="ABQ17056.1"
FT                   /translation="MRQKSSRPRLLQAMIDAFSLPDLRRRLLITLGILIAARFIAHVPL
FT                   PGVDSVALQELFDQNGALGMLDLFSGGAMRYFSVAALGVYPYITASIIMTLLTPVIPKL
FT                   SALSKEGDAGRNKINTITHWLAVPTAALAGYSQLLLLQREGAVAQTEPLAAIAIVLSIV
FT                   AGTMFMVWLGEQITSYGIGNGISLIIFAGIVAGLPDMIGRGLMASDQFAGLAVYAFMAL
FT                   LTTVLIVIFTEAHRRIPVQYAQTVIRSGKMYRRGGESHIPLRVNSAGMIPLIFASALVM
FT                   LPGLVASYFMAGSTAEPNFWNSVYTIFSSTASMPGGLVYWSLYFFMTIIFAFFYTMVTF
FT                   EQQDIPVTLQRQGGFVPGIRPGKMTDQYLSGVIGRITWAGALFLGFVAIMPFLAREVTG
FT                   IQVIQLSSFGMLIVVGVALDTMKQLEAQLVMRRYEGFIK"
FT   gene            463689..464339
FT                   /locus_tag="DehaBAV1_0472"
FT   CDS_pept        463689..464339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0472"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="PFAM: adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17057"
FT                   /db_xref="GOA:A5FRW5"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRW5"
FT                   /protein_id="ABQ17057.1"
FT                   /translation="MYNVIFLGAPGSGKGTQGEVVAKELKLAHMATGDLFRKAIECGDE
FT                   LGDTVKSYMERGELVPDEITISVVLKHLAGLKDVTGIILDGFPRSLRQAEALDEALVQQ
FT                   GQGIGRVIYINVPEDELVRRLSGRWVCRSCQSPYQSGCAEVTKGKCSRCQGELYQRPDD
FT                   TPETVKERLKVYFSKTAPLIEYYRSKGKLSEIDGMAEISEVTKRIISAIKCGK"
FT   gene            464347..465102
FT                   /locus_tag="DehaBAV1_0473"
FT   CDS_pept        464347..465102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0473"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17058"
FT                   /protein_id="ABQ17058.1"
FT                   /translation="MAIILKTEKEIAIMRRAGHILAVALEEVKKNVRPGITTRELDEIA
FT                   ERELLRRGTTPSFKGYQGFPASLCASVNEEIVHGIPGGRVLKEGDIISLDIGNILEGFQ
FT                   ADMAVTVGVGEISPAAQRLISATQAALTVGIVQARAGGHLGDIGAAVEEYAQSRGYGVV
FT                   REYTGHGIGRNMHEDPQIPNFGRRGKGPELKKGMTLAIEPMLNIGTEKTKVAPDCWTVY
FT                   TADGSLSAHFEHTVAITDGEPEILTLIEE"
FT   gene            465112..465333
FT                   /locus_tag="DehaBAV1_0474"
FT   CDS_pept        465112..465333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0474"
FT                   /product="bacterial translation initiation factor 1
FT                   (bIF-1)"
FT                   /note="TIGRFAM: translation initiation factor IF-1; PFAM:
FT                   RNA binding S1 domain protein; S1, IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17059"
FT                   /db_xref="GOA:A5FRW7"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRW7"
FT                   /protein_id="ABQ17059.1"
FT                   /translation="MPKKDAIEVEATVLEALPSAAFRVQLSNGHEVLAHISGKMRVHYI
FT                   RILPGDRVLVELSPYDLTRGRVTYRFKS"
FT   gene            465362..465475
FT                   /locus_tag="DehaBAV1_0475"
FT   CDS_pept        465362..465475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0475"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17060"
FT                   /db_xref="GOA:A5FRW8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRW8"
FT                   /protein_id="ABQ17060.1"
FT                   /translation="MKVRASVKTMCEKCKIVKRNGVVRNICTNPKHKQRQG"
FT   gene            465485..465874
FT                   /locus_tag="DehaBAV1_0476"
FT   CDS_pept        465485..465874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0476"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17061"
FT                   /db_xref="GOA:A5FRW9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRW9"
FT                   /protein_id="ABQ17061.1"
FT                   /translation="MVRIAGTDIPDNKQVYFSLQYIFGIGPARSEKVLVQAGVDKTIRV
FT                   NKLTDEEINRLREIIDKEYRVEGDLRKEITLNIKRLIDIGCYRGIRHKHNLPVRGQRTK
FT                   TNARTRRGPRKTVAGRGQKRGATKK"
FT   gene            465900..466292
FT                   /locus_tag="DehaBAV1_0477"
FT   CDS_pept        465900..466292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0477"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17062"
FT                   /db_xref="GOA:A5FRX0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRX0"
FT                   /protein_id="ABQ17062.1"
FT                   /translation="MAVKKRAGAKKKEKKVIPVGKAYVQATFNNTIVTLTDLQGNVIAW
FT                   ASCGTAGFKGSRKGTPYAAQMAAQTAARKAAESGLRQVEVLVKGPGSGREAAIRSLQAS
FT                   GINVTAIRDVTPIPHNGCRPPKRRRV"
FT   gene            466332..466925
FT                   /locus_tag="DehaBAV1_0478"
FT   CDS_pept        466332..466925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0478"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17063"
FT                   /protein_id="ABQ17063.1"
FT                   /translation="MCRRSGDKLFLKGDKCVTKCVFEKRPKPPGPQLGRPRRLSDRGQQ
FT                   LRQKQSIRWSYGMTERQFRRFFGLANAQPGVTGDNMMILLERRLDNVLFRLGFGTSRAQ
FT                   ARQIVMHGHILVNGQKTDIPSYLIKEGQEITVRETSKATAYFKTLAENIEAKAIPGWLS
FT                   LDRKTLSGKVISLPNAGDIDARFDAQTVVEYYSR"
FT   gene            466946..467938
FT                   /locus_tag="DehaBAV1_0479"
FT   CDS_pept        466946..467938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0479"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase, alpha subunit domain protein; RNA
FT                   polymerase, dimerisation; RNA polymerase, insert; SMART:
FT                   RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17064"
FT                   /protein_id="ABQ17064.1"
FT                   /translation="MSDLAIPTISCTESDGKYGRFVVEPLEKGFGTTMGNSLRRILLSY
FT                   LDGVAITRVRIDGIQHEFCALPKAKEDTLDFLLNLKNIRVESLSGLEGILYLRASGSKV
FT                   VTAADIEPSNDFEVVNPELYLLTLDSDDAVLNVELEVELGRGYRPPESAENTPIGTIPV
FT                   DAIFTPIRKVNFTTEPMHVGRETSLERLVLEVWTDGTVEPATAVSRSADILVKQFASLV
FT                   SHSKVVAEIEASEPVKYTIPEEKYNMPIEQLDLSVRAVNCLRHAGITTVGEVINRGTKE
FT                   LLTLRNFGLKSLTELEDRLKTIGLSLNPEDELFEEAENNKKKNKGIDED"
FT   gene            467969..468322
FT                   /locus_tag="DehaBAV1_0480"
FT   CDS_pept        467969..468322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0480"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17065"
FT                   /db_xref="GOA:A5FRV6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRV6"
FT                   /protein_id="ABQ17065.1"
FT                   /translation="MRHKVSGRRFDRPTGQRMSLYRNLVTDLLNYEEITISEPRAKEIR
FT                   SMAEKMITLGKKGTLASRRRALAFVYMPGIVEKVFEDLSKRYAERPGGYTRMTKLGPRQ
FT                   GDGAEMVKLELIK"
FT   gene            468359..469099
FT                   /locus_tag="DehaBAV1_0481"
FT   CDS_pept        468359..469099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0481"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17066"
FT                   /protein_id="ABQ17066.1"
FT                   /translation="MVIEYEGTRYSGFQIQDKGATIQGELETAIRKLTSEQTRVSGSGR
FT                   TDAGVHAAYQVVSYLTESSLGLEKIKGGLNYYLPPDIAVKEVHFVAENFDVRRRAISRE
FT                   YSYHILNSKTRSPLARLQAWQVPYKLDIKLMEQAFKMLEGEHDFIAFASGLGPEIKKTV
FT                   RRVNWTRLDIAEDRLILRIEANSFLTHQVRNTIGVLVELGRGTISMGEFGALFEAKTPG
FT                   LAGPAAPACGLSLVRVNYREPFGS"
FT   gene            469101..469532
FT                   /locus_tag="DehaBAV1_0482"
FT   CDS_pept        469101..469532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0482"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="PFAM: ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17067"
FT                   /db_xref="GOA:A5FRV8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRV8"
FT                   /protein_id="ABQ17067.1"
FT                   /translation="MNTYTVKASDIKRDWHVIDASGRVLGEVAAEAAKYLMGKHKPMFC
FT                   RNLDCGDYVVIVNAKKITVTGNKLDQKMYYRHSGFPGGFRQEKLGDLLKTKPLFVIEHA
FT                   VKGMIPRNTLGAQILAKLKVYEGAEHPHASQTGVVSKES"
FT   gene            469545..469943
FT                   /locus_tag="DehaBAV1_0483"
FT   CDS_pept        469545..469943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0483"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17068"
FT                   /db_xref="GOA:A5FRV9"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRV9"
FT                   /protein_id="ABQ17068.1"
FT                   /translation="MVEKNTYFIGVGRRKTAVATVKLMSGNGVIVIDGKPIEERFTRIQ
FT                   ERNVILNPMMVTDTMGKFNAVIKVLGGGVTGQSGAIAHGIARALEKTDEKLRATLKSNG
FT                   LLTRDDRTKERKKPGLKRARKAPQYTKR"
FT   gene            complement(470019..470213)
FT                   /locus_tag="DehaBAV1_0484"
FT   CDS_pept        complement(470019..470213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17069"
FT                   /protein_id="ABQ17069.1"
FT                   /translation="MKTSLFYLGLGIVMIGIGIFTYLQPTDIDSLSFSQTVLGILCMAI
FT                   GLLTAIIGVVRYFRDERGN"
FT   gene            complement(470610..471677)
FT                   /locus_tag="DehaBAV1_0485"
FT   CDS_pept        complement(470610..471677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0485"
FT                   /product="bifunctional phosphoglucose/phosphomannose
FT                   isomerase"
FT                   /EC_number="5.3.1.8"
FT                   /EC_number="5.3.1.9"
FT                   /note="TIGRFAM: bifunctional phosphoglucose/phosphomannose
FT                   isomerase; PFAM: sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17070"
FT                   /protein_id="ABQ17070.1"
FT                   /translation="MDIINLDDLNIYEKLDPHHMLDELKRMPLLCKQSWETAEALSLPE
FT                   DYRTIKQVVILGMGTSGVGAQLAERIVRDECKIPIYLHQDYLLPAYVSADTLVIASSSS
FT                   GSTEEVVSCFNQALNRHAKLLVLTTGGQLKEMATAHNIPGLIYDYTYRPSTAIAYGVLP
FT                   ILSILHQLGFIPNKSAEVSESLIVLSQIAERLSEKHQTTNNSAKQLAGKLEGRAVMAFG
FT                   SGVTFPAARRFKTQLNENAKCFSFAEEIPEMNHNSVVGYELPRSSGRYWAAVMFKTTYL
FT                   SKRIHQRMRITTDMLHLAKIPVFSIDGYGFSPLCQTLSLILQGDFVSLYLAFLTGVDPY
FT                   PIDAVDYFKRKLAES"
FT   gene            complement(471702..472946)
FT                   /locus_tag="DehaBAV1_0486"
FT   CDS_pept        complement(471702..472946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0486"
FT                   /product="Phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17071"
FT                   /protein_id="ABQ17071.1"
FT                   /translation="MVAEVMAASGIKTYFGSCPTPTPVISHGVVNLKAAGAVIITASHN
FT                   PAIWNGFKVKSADGASAPTYMITAIETEIAKLGDNPSVSRLDFDTAVSRGLIELTDLAP
FT                   AYFEQISKLVDIEKLREAGFNIAIDSMYGAGIGYFKHLLEGGCNRLNEINAEPNPNFPD
FT                   MLQPEPIAPNLNKLMRLVKDIRSDIGLATDGDSDRLGVVDEMGNFLNQLQVFSLLALYI
FT                   LEVKGLRGPLVKTITNSSMIDKLGKLYNVPVFETKVGFKYVSPVMIEQNALIGGEESGG
FT                   YGFAGHVPERDAILAGAYFLDFMITTGKSPAKMLEYLYSKVGPHYYNRVDYTFDEARRE
FT                   EIMNHLANQKPDSLAETKVSSTDRLDGFRYKLEDGSWLLIRFSGTEPLLRIYAESPSQD
FT                   KTAALLENGRRLSGI"
FT   gene            complement(473113..473316)
FT                   /locus_tag="DehaBAV1_0487"
FT   CDS_pept        complement(473113..473316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17072"
FT                   /protein_id="ABQ17072.1"
FT                   /translation="MIKTLLLAFFGAIVVELAVIMLATVMGLAGLTFVIIVLFLPVVLI
FT                   LGAIIFMLSKFFKGDSRNNKPN"
FT   gene            complement(473347..474567)
FT                   /locus_tag="DehaBAV1_0488"
FT   CDS_pept        complement(473347..474567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0488"
FT                   /product="methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17073"
FT                   /db_xref="GOA:A5FRV2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRV2"
FT                   /protein_id="ABQ17073.1"
FT                   /translation="MSQTFGNSSKYLFTSESVTEGHPDKICDQISDAVLDAIIAKDPTA
FT                   HVACETAVTNGLVVVMGEITTSCYVEIPELVRGVIKDIGYIKPEYGFDDRTCGVLTSIN
FT                   RQSPDIALGVNKSQEAKSGQVDELDLTGAGDQGMMFGYACTETPEYMPLPISLAHRLSK
FT                   RLAEVRKNGTLPYLRPDGKSQVTVEYHNGKAKRISSVVIGAQHDPDITTEKIQADIIRN
FT                   VIKPIIPTNLLDENTEYYVNATGRFVVGGPVSDTGFTGRKILVDTYGGFARHGGGAFSG
FT                   KDPTKVDRSACYMARYIAKNLVAAGLADRLEIQVAYVIGVAHPLSVSIETFNTARMNHE
FT                   DILSIIQKHFDLRPEAIIRNLGLRRPIYRQTAAYGHLGRPELDLPWERLDKVDAIKATI
FT                   ESLSVSK"
FT   gene            complement(474577..475833)
FT                   /locus_tag="DehaBAV1_0489"
FT   CDS_pept        complement(474577..475833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0489"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase; Acetohydroxy acid
FT                   isomeroreductase, catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17074"
FT                   /protein_id="ABQ17074.1"
FT                   /translation="MPNFDVKDMSLAALGKKRVDWAGREMKTLSLIKERFEKEKPFKGI
FT                   RIAACLHITTETANLGLVLKAGGADLTLCASNPLSTQDETAAALVEHGINTFAIHGENN
FT                   ESYYRHIAAALDAKPQLTVDDGADLVATLHSQRTELLNGILGGTEETTTGVIRLRALAD
FT                   SGKLRYPIIAVNDAKTKYMFDNRYGTGQSTLDGITRATNFLWASKTVVVVGYGWCGHGV
FT                   AMRAKGMGAHIIVTEVDPVKALEAVMDGFSVMPMAEAAKLGDIFITVTGDKHVIDKDHF
FT                   KVMKDGATLANSGHFNSEINIPALESLSCGKDTIRPSVEEYKMKDGRRIYLLGEGRLIN
FT                   LAAAEGHPAAVMDMSFANQALSLEYLVKNHTKLEKKVYAVPEEIDRAVAATKLASLNIS
FT                   IDTLSAEQIKYLSSWQEGT"
FT   gene            complement(475841..477403)
FT                   /locus_tag="DehaBAV1_0490"
FT   CDS_pept        complement(475841..477403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0490"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17075"
FT                   /protein_id="ABQ17075.1"
FT                   /translation="MSDLPLYAQAMLRPDFYPEPTTKVELVQTQMSFVFLTDHFAYKTK
FT                   KAVNLGYLDYSELSGRKALSEKELLLNRRLCDYAYLEVLPIIKNEGGYSLGGCGEVVEY
FT                   TLKMRRLPEGRMLVNLLSTGSVSSGMLEKLAEKLAIFHQTARTDAEVQKYGNLEAIKYN
FT                   TEENFEQTGSKVGITVSPQEYARISSFTRSFISKNQTMFNERVNRGKIRDCHGDLHAAH
FT                   ICFMDNICIYDCIEFNDRFRYGDVASEVAFLAMDLDHYGRADLSRQFINSYIKKSGDKD
FT                   LFKLLRFYKCYRAYIRGKVEGFKLDDPYISEAEKDKYAQKSKNYYHLADFYARSKPTLF
FT                   ITMGFCGCGKSTLAQSLAKISGSVVISSDIVRKGLAGIDCCQHRFEDTDQGIYSPEMTQ
FT                   NTYQAMYDQAEDALKEGYSVILDATFLKEHQRKQAEECARRNNAGFVILEVKLTPELAQ
FT                   KRLEKRLDKPSVSDGRWEVYLKQIKALEPLAVQPNHVIIDSSKSTDKQLSDILEFFKSN
FT                   QGE"
FT   gene            complement(477403..477603)
FT                   /locus_tag="DehaBAV1_0491"
FT   CDS_pept        complement(477403..477603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17076"
FT                   /protein_id="ABQ17076.1"
FT                   /translation="MNCATELNKINCNCTYEPCERKGKCCRCISYHLAMDELPACAFPD
FT                   NVEKTYDRSFKCFARMVSKES"
FT   gene            complement(477600..478631)
FT                   /locus_tag="DehaBAV1_0492"
FT   CDS_pept        complement(477600..478631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17077"
FT                   /protein_id="ABQ17077.1"
FT                   /translation="MTKTDFYFLPTMIGSMPHTDPKAAVDIITHYLRDIPVWPQLPRRS
FT                   YLEGMSAQFSQGLPGVNINQDKMWIEPNSGFEGELESLYQAYLDNDFNKFPIGVEYAAG
FT                   LYELASRSNLSPKLVKGHITGPLTYCMSIKDPSGKDILYDEVLSDAATKLLKLKASWQE
FT                   HFLKKICRNTIIFVDEPAMSAYGSAYLPLSREQVTGMFEEVFSGISGLKGVHCCGNTDW
FT                   SILMDTSVDIINFDTYAYADSLAIYTDALKAFIKRGGAVAWGIVPTDEKALKEETAASL
FT                   KDRLEAAMSHFDSKGLPFAELARHSLITPACGLGLKSLDAAERAPELLAELSALLRRKH
FT                   GTV"
FT   gene            complement(478624..479508)
FT                   /locus_tag="DehaBAV1_0493"
FT   CDS_pept        complement(478624..479508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0493"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="TIGRFAM: methylthioadenosine phosphorylase; PFAM:
FT                   purine phosphorylase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17078"
FT                   /protein_id="ABQ17078.1"
FT                   /translation="MTHYAKIGVIGGTGLYDIEGLTDIREHTLDTPFGKPSDIIVTGNL
FT                   NGVGVAFLPRHGRGHRILPSEIPSRANIYALKSLGVEHIIAINSVGSFKKEVKPGHLLI
FT                   PNQLIDRTSQRTNTFFGKGIVAHIAFSQPFCPNLRKLLFECAKEAGANVHNGGTYVVME
FT                   GPAFSTQAESRLHISWGADVIGMTALPEAKLAREAEICYAIIACATDYDAWHEEEEAVT
FT                   VDKVIATLRGNINLSKEIIKLAIGRISSTRNCECSTALSHAIMTSPEAVPNTRKHELAL
FT                   IIDKYMPAVSEND"
FT   gene            complement(479583..480581)
FT                   /locus_tag="DehaBAV1_0494"
FT   CDS_pept        complement(479583..480581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0494"
FT                   /product="methylthioribose-1-phosphate isomerase"
FT                   /EC_number="5.3.1.23"
FT                   /note="TIGRFAM: putative translation initiation factor,
FT                   aIF-2BI family; eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein; PFAM: initiation factor 2B
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17079"
FT                   /db_xref="GOA:A5FRU8"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRU8"
FT                   /protein_id="ABQ17079.1"
FT                   /translation="MKAIEWRNNRLIILDQTLLPLEEKYLELNDYHAVAEAIKTLRVRG
FT                   APSIGVAAAYGIAFGALSIETRYCSEFLPLYQQISAEIASTRPTAKNLFMAVERMDHVV
FT                   ASGTDVLQVKISLVDEAVKIHREEEEASRKISTFGADLIQPGWTVLTHCNAGPLATAGY
FT                   GTALGVIIAAHQQNKGISAFATETRPLLQGARLTALELKEAGVPFKLITDSMAGHFMKK
FT                   GVINAVVVGADRIARNGDTANKIGTYSLAVLALAHGIPFYVAAPSSTFDKSIESGNDIV
FT                   IEERKPEEITYLRGQRIAPENIDVANPAFDVTPANLIAAFITENGIIRRGE"
FT   gene            complement(480583..481680)
FT                   /locus_tag="DehaBAV1_0495"
FT   CDS_pept        complement(480583..481680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0495"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17080"
FT                   /protein_id="ABQ17080.1"
FT                   /translation="MRFWELGIRALKETYRDPMALGFLLGFPLMFMLLFGFAFSGGGSA
FT                   SYQIGVVDNDQTPLSSAFADEALSEVPSYEIIYINTPEEALTQLKQSDIRAYIIIPAGF
FT                   GQEVSKLWAGTGGNIYLDVTYDESDIQAASEILSQLNVVTRAFAKIEIPLNVNAQPVNI
FT                   ENKITNIDFISPGIIVFGLLILIPTSARIIVRDKEKGFMSRMLTTPSRPVDFILGYSLS
FT                   MTLICIIQIIFFMLLGYLFGMDIMGNIALAFLIFFLTGLSSIGIGMVIAGFSKSENQSE
FT                   SISWFFSMPLAIVSGTWFSIQFMPDILKGLGYAFPYSHAIEASRLVILRGADFSAVSGE
FT                   VGILAIWTVAVFALGTIIFGRTMRS"
FT   sig_peptide     complement(481543..481680)
FT                   /locus_tag="DehaBAV1_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.403 at
FT                   residue 46"
FT   gene            complement(481677..482627)
FT                   /locus_tag="DehaBAV1_0496"
FT   CDS_pept        complement(481677..482627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0496"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: daunorubicin resistance ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17081"
FT                   /protein_id="ABQ17081.1"
FT                   /translation="MAATSKAQPDIPAIETLDLSRSYGQLLAVDKLNLNIRKGELFALL
FT                   GPNGAGKSTTINMLCCLLKPTSGTARVMGFDINTQGYQVKSIIGSSPQETAISDHLTPV
FT                   ENLELFGKLNHIDPAKLKEWIPRFLGIMGLEDRAKSQVRTFSGGMKRRLSIMMALIHNP
FT                   DVVFLDEPTLGLDPQVRHAMWEYIESLKGKKTILLTTHYMEEADHLADRIGIMDQGRIV
FT                   ALGTPVELKQSLIKEPTMRVQAFNISQRMVADLKNFYPKVEFSGGTLSISAEHLEFNEI
FT                   VNRLQNAGATIRSAQIKGPSLEDVYLKLTGKELRE"
FT   gene            482721..483143
FT                   /locus_tag="DehaBAV1_0497"
FT   CDS_pept        482721..483143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17082"
FT                   /protein_id="ABQ17082.1"
FT                   /translation="MPNIKYTLEDLRANPGLKLPPFNLVIERGLVDRFCRATGDDGANW
FT                   QNEAPPVLALTLGFGQMLEAISADDITVLHGSSELESFRTIEIGQEVMVETSLLSLRER
FT                   PGKMGLSSFLNFEMQVTNKQGELLARVCQLAIVYSA"
FT   gene            483140..483553
FT                   /locus_tag="DehaBAV1_0498"
FT   CDS_pept        483140..483553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0498"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17083"
FT                   /protein_id="ABQ17083.1"
FT                   /translation="MTSVFENITEGQEIASQTLILSSRDLVIWAGASGDYNPIHYDKDL
FT                   ALKKGLPGVVVPGQLAGAMLGKLASGFARPSGRLAKLSLSYKKMMPLGESLVLKGIVSS
FT                   KTDTPESKTLGLKLWAEDTAGDKTVTASAVIVY"
FT   gene            complement(483540..484100)
FT                   /locus_tag="DehaBAV1_0499"
FT   CDS_pept        complement(483540..484100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0499"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17084"
FT                   /protein_id="ABQ17084.1"
FT                   /translation="MIHTQGKLTRLRDKRLEDASLDYAWQTDPELSHLDAAEPLTISFR
FT                   TFLGEYIFVLENSLSLRVQFGIETLRGEYIGYCACYNLDIAASEAEVGIMIGQKEYWGK
FT                   GYGNDALGLMIDYVFEKTSLKRLHLKTLQSNIRAQQSFRKCGFKPCGEKESGLHRFMLM
FT                   GLSKADWLKHKSLQAEDCPANKL"
FT   gene            complement(484104..485054)
FT                   /locus_tag="DehaBAV1_0500"
FT   CDS_pept        complement(484104..485054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0500"
FT                   /product="HEAT domain containing protein"
FT                   /note="PFAM: HEAT domain containing protein; PBS lyase HEAT
FT                   domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17085"
FT                   /protein_id="ABQ17085.1"
FT                   /translation="MSQENPEISELFERLADENTSLKHTDLALLSDLNNQEIAAFKDFW
FT                   TGMSPERRLDIVSRLGELAEDDVSLDFDSIFVRTMHDPNPEVRAKSVDGLWECNRPSLV
FT                   DHLLSLSSEDPSMEVRIAATAALGRYSMMGEFGQLPEKTSQLLQTSLLAIFKNTNLPVE
FT                   LRRRALESVSPFGQPQVITAISQAHNSPEHLLRVGAVYAMGQNASDQWESVITSELNND
FT                   NNDLRYEAAVAAGELGLERFIPKLVSMIEDPDMEVQLASIQALAKIGGQDAKKGLTENL
FT                   ESTSSQAIREMITTALTDIEADESAAGMPAISPEE"
FT   gene            complement(485054..485884)
FT                   /locus_tag="DehaBAV1_0501"
FT   CDS_pept        complement(485054..485884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0501"
FT                   /product="protein of unknown function DUF75"
FT                   /note="PFAM: protein of unknown function DUF75"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17086"
FT                   /protein_id="ABQ17086.1"
FT                   /translation="MDKKYKLNSRPKLKSPCLLAAWPGISNVALIVATYLVRKLEFKEL
FT                   AEIDSPSFFDPIGVLVKDGVVEEPQFPQNRFYYLKNKQDNDIILFIGEDQPSTKSYELA
FT                   NLILDVGQRFGVKRIYTFAAALTRIHHSEQPRAWAVGTNTQVANELIERGLSGSGNLQI
FT                   SGLNGLLLGVAKERNMDGVCLLGEVPSYASRLQNPMAALVIVQILSKLLQLGVDVTELE
FT                   QIASEAKQHVSQIAAEAMEDYIDYFTEPIWESGEEDDDDDLDTDDDDNEEASNN"
FT   sig_peptide     complement(485798..485884)
FT                   /locus_tag="DehaBAV1_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.777) with cleavage site probability 0.457 at
FT                   residue 29"
FT   gene            complement(485898..487199)
FT                   /locus_tag="DehaBAV1_0502"
FT   CDS_pept        complement(485898..487199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0502"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17087"
FT                   /protein_id="ABQ17087.1"
FT                   /translation="MLEKILEQAKKVAEQAECFMVESESTPIHFESNQLKNIESKQSLS
FT                   LALRIVKDGKIGYAASSNPADWPRLVNMALETAAYGQTAHFQFPAAQTYPEVKIFDPEI
FT                   ETVSLEEMVNLGKEMVAGLLEINSELICSSSLTKSTRKVSLLNTSGADISFKKSLFSMG
FT                   LEGTLVRGTDMLFVGDEFSSCHPIRSSLEAVNLVSKQLKRARQNVPLQSREMPVIFTPH
FT                   GVASTIIPALSAALNGKLVQEKASPLAGKLGEQMFDPAFNLVDDPTQSFSPNSRPFDDE
FT                   GTASQITPMVENGVIKNFIYDLRTAALAKAKSTGNAERHGGQPAPGFSALMIKPGTLSF
FT                   EEMVSDIKEGLVVEFMMGAEQGNVLGGDFSGNVLLGYKIENGQITGRVKDTMLSGNIYS
FT                   ALKTINAIGSDGRWLDGELFTPSMYFPNLSVAAK"
FT   gene            complement(487201..488577)
FT                   /locus_tag="DehaBAV1_0503"
FT   CDS_pept        complement(487201..488577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0503"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17088"
FT                   /protein_id="ABQ17088.1"
FT                   /translation="MTELRNIAHELSQQLYHYRADYLEIHLEESTSSYISYRGQNLDTA
FT                   GRGSDLGGNVRALVNGGWGFVSFNSLDDIRKRIDLAIHQASLAGSTQSQFASTPSVTYA
FT                   QTDELSQSSVERPLEDKKRILDEYKDLIWQTKGIKTSFIRFSDGYRRRFYVNSRGSVIE
FT                   QSRSDINFNATAIASGDGELQQSNISVGSRGNYNAITGLHSQIKDMTEHAVKLLSAPKV
FT                   KGGEYTVILDPILAGVFVHEAFGHLSEADHIYENPQMREVMVLGKKFGPKILNIIDNPT
FT                   MPDLRGSYKYDDEGVAATKNYLIREGKLTGRLHSRETAAKMNEPLSGNARAISYRYAPI
FT                   VRMSNTYIEPGVSTLEEMLDGVKEGIYVKNWYGGTTSMEMFTFSSGEAYMIRDGKIAEA
FT                   LRPVVLSGNVFDTLHNIDMIGNDLDMNQGGGCGKSGQSPLPVSNGSPHIRIQKCLVGGA
FT                   "
FT   gene            488715..490007
FT                   /locus_tag="DehaBAV1_0504"
FT   CDS_pept        488715..490007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0504"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17089"
FT                   /protein_id="ABQ17089.1"
FT                   /translation="MGLFGTSGIRRVVDDRLMEIALKVGFSVGKRYRRVVLAGDSRTST
FT                   PAIKRILSGALVAAGADVIDIGLVPTPTLAFIARDFDTGLMVTASHNPAEYNGIKFLNP
FT                   DGSAFSYLQQQEITKDVESSRSPSLKWDSFGQINAFPCTVEKHMEHILNYLPDKCRLKV
FT                   VVDCGGGAASVITPWLLQRMGSRVISLNDTTHGFFPHPPEPLAENLTGLIQTVRESDAD
FT                   LGIAHDGDADRMVAVDKHGNFISGDKMLVVFARAAKADKVVTTLDASMSVEEMGFKVIR
FT                   TAIGDNYVSEELKRQGNFGGEPCGAWVFPESSLCPDGIYAAARLLNLVSRQPLAELISD
FT                   IPEYSMKRGSVAGGGLNLSLVEESLQCLNPLSSSLLDGIKLNLKDGWLLIRPSGTEPKI
FT                   RLTAEAKTPEQCETIYQTGLKCLKSCLSREK"
FT   gene            490009..491211
FT                   /locus_tag="DehaBAV1_0505"
FT   CDS_pept        490009..491211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0505"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17090"
FT                   /protein_id="ABQ17090.1"
FT                   /translation="MKAVILAAGEGSRMRPLTFTRPKVMLPIAGKPILEHLLMEVSAAG
FT                   IKEFVLVVGYRDEQVRSYFADGAKWGVKISYCQQTRQLGTAHALKQLENQLEGNFLVMN
FT                   GDILAESADISALAAGSETTLSVLEVSDPSSLGVLETDGDRVRCIHEKSANPPTNLANA
FT                   GLYLFTPRIFKAISGTPLSPRGEYEITSSIQLLIDNGTEVGYRRLVYWQDVSYPWDLLD
FT                   VNASMLKNLAPCVYGTVEENVVIKGTVEIGEGSLVRSGAYIEGPVLIGKNCDIGPNCYI
FT                   RPSTSIGDNCRVGASVEIKNSIIMDNTKIPHLNYVGDSVIGQNCNLGAGTKLANLRFDG
FT                   ADIIAGGVNTRRRKLGAVLGDGVETGINVSLNPGVLIGSGSRIGPGAVVSGLVEPNSYI
FT                   G"
FT   gene            491229..492410
FT                   /locus_tag="DehaBAV1_0506"
FT   CDS_pept        491229..492410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0506"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17091"
FT                   /protein_id="ABQ17091.1"
FT                   /translation="MKQAVILAAGEGQRLRPFTASKSKVMLSIAGKPLLEYVIESLAQN
FT                   GIRDIILVVGYKRERIFDYFGQGGRFGVQISYVQQPNQLGTAHALRQVKDKIKGDFLVL
FT                   NGDQLIKPSTISGFVKQPPQAVMVKAINGEDPSRYGVVTSSGGLLTSIEEKPSIAKSNF
FT                   INTGIYSFSMAVFDYIGEHLDIPVVLQSMLKDGLDIHVAESQGAWLDIVYPWDMLKLNA
FT                   VVSAELKPGVAGTIESGVVMKGPVRIGKNTVIRSNSYIVGPVIIGEGCDIGPSVCIYPS
FT                   TSIADNVTVAPFSQIKNSLIYSGNSIGVASVIEDSVIDRGCVICGQFSAPSAEIETRIN
FT                   DGLHKIKVGTMMGEGCTVGNAVVLQSGTVVGNSTRIAPLRTLSGNIPDGSLVV"
FT   gene            492411..494192
FT                   /locus_tag="DehaBAV1_0507"
FT   CDS_pept        492411..494192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0507"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17092"
FT                   /protein_id="ABQ17092.1"
FT                   /translation="MCGIVGYTGKRQAQGVLYDCLCRLEYRGYDSCGIAVNTPEVQVFK
FT                   DAGKVHDILQNAPLFKGTAGLGHTRWATCGEPTQINAHPHTDCTGKICLVHNGVINNYS
FT                   QLLKRLEGNGHKIVSDTDTELIAHLIEEYDKGDLEEAVRLAVKEIEGSYALVVMRSGEN
FT                   TLVVVRQDSPLVIGVGDGEYLVASDVPAILGYTNRVIYLDEGDIGTISPDSLKIRRNGG
FT                   YIVPLVEKVNWTQDESQKAGYSHYMLKEIHEQPRVIQNTLINMPLPESFNKSEILEQSR
FT                   KTGILFLACGSSYHAALTARYLVEEHLNIPVRLEVASEFNYMHRLLPCKLAVVLTQSGE
FT                   TADVLRAMRRLKQAGCMVVAITNVAGSTAARLADHTIYTQAGPEIGVAATKSFIAQLIV
FT                   LYALCFAGASAANIRYQDYLSTMRLLPSVVQSILGSHQNIKDAAVEVAKSKSAFFIGRG
FT                   INYPIALEGALKLKEISYIHAEGYAAGELKHGPFALLSPETPVLALVSRDQTYEAMLTG
FT                   LREIKVRRAPLIVIGEAGDEQLGQLADRVISLPSFNRLFNPILFTVVLQLLAYYVALEL
FT                   GCSIDTPRNLAKSVTVE"
FT   gene            complement(494200..494652)
FT                   /locus_tag="DehaBAV1_0508"
FT   CDS_pept        complement(494200..494652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0508"
FT                   /product="phospholipid-binding protein, PBP family"
FT                   /note="PFAM: PEBP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17093"
FT                   /protein_id="ABQ17093.1"
FT                   /translation="MLLGSSAFACGEYIPRRFSGLGSNISPPVHWMQLPPDTKSLALVL
FT                   EDPDTSKAFTHWLIYNIPPNRVGLPEAVPTEPNLPDGVRQGLNSEGETGYTGPYPPPNR
FT                   VHHYHFRLFALDTELKLKASCHQADLLKAMEGHIIDQTDLTGLFVV"
FT   gene            complement(494664..495368)
FT                   /locus_tag="DehaBAV1_0509"
FT   CDS_pept        complement(494664..495368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0509"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17094"
FT                   /protein_id="ABQ17094.1"
FT                   /translation="MIKGVFFDLYNTLIGYQPSREEMTVKLLADMNYPINENDLYLPMN
FT                   KADEYFYLQNAQNPISLREKPEQFAVWSHYYRIILEEIGIEAKPELINTLISRWKNLKW
FT                   EMILYEDVIPCLKNLKSRNLKIGLISNADRDMSELFNKTGLNTYLETVVISQEVGVTKP
FT                   NPLIFQAALRKSGLTAKEVLYIGDQYQVDYIGAMNVGLNPVLLDRRNCYLDLNDCRRIT
FT                   GLGELEYCIDNT"
FT   gene            495507..496811
FT                   /locus_tag="DehaBAV1_0510"
FT   CDS_pept        495507..496811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0510"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17095"
FT                   /protein_id="ABQ17095.1"
FT                   /translation="MEPRIQVFPKNTEVKNNHLIIGGVDVAGLCAKYGTPLYIFDELTI
FT                   RQNCRDFKREFSRRYADSSVSYASKAFLHPALLKILAEEGMSLDVVSGGELSVANNAGF
FT                   PMDMVYLHGNNKSAEELRLALRLHVGRIVVDSFDEIKLLSKLADESGHIPDILLRITPG
FT                   VDAHTHHYITTGKLDSKFGFPLFQAAEAVGLAMAQASLNLVGFHFHIGSQIFETQPFLD
FT                   AIDLVLDFAAQVQERYGFDIEELDIGGGYGVQYEVDKPAPPISAYAEAIGAKVVSKCRS
FT                   LKLTPPSLNIEPGRAIIAQAGVALYTVGVIKDIPGIRLYASVDGGMGDNIRPALYEAKY
FT                   EAVVANNVQSAEKEKVTIAGKFCESGDILIRDIELPSLRTGDILAVPCCGAYCLPMSSN
FT                   YNGYHRPAVVMLKNGEDRLIRRRETVEDLSRLDSV"
FT   gene            496825..497856
FT                   /locus_tag="DehaBAV1_0511"
FT   CDS_pept        496825..497856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0511"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17096"
FT                   /protein_id="ABQ17096.1"
FT                   /translation="MWRIIGQDKVVSFLSNSLSQDKLSHAYVFHGPSGVGKKRMALTFA
FT                   QALNCQASPPPCQECSVCGRILSRNHPDIIHLELLSAEDASDGKAKAEIGVKQIEDIQH
FT                   AASLPPFEGKYKVFIIHQAEKLSLESSNRLLKTLEETGSQNIFILLTADKSLLLPTVIS
FT                   RCQILELRYVEINLIREALLKQGLDAEKAELLSHLSHGRVGWAMEVASSPEILEERKAN
FT                   IEKIIWILGQDEEERFDYASDLSNLFGQNRTAAEAILDMWLDVFRDMLLLKADANQNMT
FT                   NIDYKDILYMASDKLGLTDIRIAIDNILKTEDRLRANANPRLCLEVLMLSLPFVKEGTV
FT                   KNG"
FT   gene            497849..498682
FT                   /locus_tag="DehaBAV1_0512"
FT   CDS_pept        497849..498682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0512"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17097"
FT                   /protein_id="ABQ17097.1"
FT                   /translation="MVDIVKIRYKQAGKIYYFDPAGFELYPYDCVVLETSRGEELGWVV
FT                   ASPSQVEESSLEQPLKPVIRLATAEDMNRERQLEEKNQSAVAECIELVSKLNLPMKLIR
FT                   AEYSLDENHVTIYFSAEDRVDFRELVREISRKLRVRVELRQIGPRDEAKMVGGYGRCGR
FT                   ELCCCSFLSEFDPVSIKMAKEQNLPLNPQKISGVCGRLLCCLDYEYETYKAAKAKMPKD
FT                   GLKVSTPMGKGEVVGGNPLEEMVFVLLESGANAEVALKDIRPDKEGRRPDAPLHH"
FT   gene            complement(498671..499201)
FT                   /locus_tag="DehaBAV1_0513"
FT   CDS_pept        complement(498671..499201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0513"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17098"
FT                   /protein_id="ABQ17098.1"
FT                   /translation="MDNHQVLVLNQDYQPLNVCHIRRAVLLVYQSKAEMLEDGLGFWHS
FT                   EKDHFALPSVIRLSCLIKHPPLRPKLNRAEIFSRDKHTCQYCGRKDLELTIDHVNPKHQ
FT                   GGPHVWENVVAACLHCNRHKAGRTPEQAHMKLMCTPGVPQYRYGYSLPRANANIRHEWR
FT                   PYLGLRDEPKLVV"
FT   gene            complement(499273..500682)
FT                   /locus_tag="DehaBAV1_0514"
FT   CDS_pept        complement(499273..500682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0514"
FT                   /product="replicative DNA helicase loader DnaI"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   Chromosomal replication initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17099"
FT                   /protein_id="ABQ17099.1"
FT                   /translation="MEHIKEILGKQINTRANCTTTSSKDKAVKAAEENLCPLCKGAKFV
FT                   YPVSAEGVTDFSRVVPCQCTQSESGADREKRLLTYSCLGGLHKYTFEKLNSLGKTDEPH
FT                   SQDTFKQAYEAALDFASNPAGWLVFTGPSGAGKTHLAAAIANRRLSTGQPVLYKRASEL
FT                   IDDLKKSFEPDSDAGYSQSFDILKNAPLLVIDDLTVQSGSEWSKEKLDQLLTYRFSQEL
FT                   PTIITLSTPINELDPRIQSRLLDKSISKIYTVAPNPEDSLEYRWDNALALQKKMTFENY
FT                   DHKRSNLTPEQRQNIDAAYNLALDFSRNPESWLVFQGETGCGKTHLASAIVNERYRQGK
FT                   PAMFVVVPEFLDHLRSTFSPESKTSYDQMFDAVKNAKLLVLDDFGEQSSTPWAQEKLYQ
FT                   VINYRYNRRLATVITTRCQLSEIEVAISSRFVDPQISMVFNITAPNFRCDSTGPQKQRP
FT                   VSRMRTTRPQR"
FT   gene            complement(500606..501316)
FT                   /locus_tag="DehaBAV1_0515"
FT   CDS_pept        complement(500606..501316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0515"
FT                   /product="DNA replication protein DnaD"
FT                   /note="TIGRFAM: primosome, DnaD subunit; PFAM: DnaD and
FT                   phage-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17100"
FT                   /protein_id="ABQ17100.1"
FT                   /translation="MSNPPPVPVRQEFTPVSRYFIHRVAPLIADPAELKVSLAVFSLVQ
FT                   AKKGYPRYTTLAELGAEETLMNALGKTPNESLQSLEKALKMAVERRTLLGLELKSGKHN
FT                   HQLYFINTETDTAVVEKIKNGSLALPGLKEVTAEVITGKTGQPNIFKLYEQNIGLLTPM
FT                   LADNLKEAEKLYPEEWIAEAIKEAVSLNKHNWRYIERILENWSSQGKNSGTHKGNTGET
FT                   DKYKGQLYDHLVQR"
FT   gene            complement(501313..502689)
FT                   /locus_tag="DehaBAV1_0516"
FT   CDS_pept        complement(501313..502689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0516"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase, N-terminal domain protein; DnaB domain
FT                   protein helicase, C-terminal domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17101"
FT                   /protein_id="ABQ17101.1"
FT                   /translation="MLDSKLPPYDVDAEESVSGSLLIDGQAIFDIIPILKPQDFFTEPN
FT                   RLIFEACMSLYGRSDAINQVTVAQELERLGKLEKCGGSAYLSHVVSVVPTSLDIEHYAR
FT                   IVYRLSVMRQLIDAGQKISELGFKADPDVSDSLGKAEDLLFRLRHERSSLGFTHIKNIL
FT                   DKYFEPVPAPGSEGYQAIPHVLTGLTGMDTFLGGLQRSDLIIMAGRPSMGKTSLALNIA
FT                   RNAAVEQRACTAIFSLEMSRESLVQRLLSNEAAVNSRSIRLNESNPDEERKIMDAIGVL
FT                   SEAPIFIDDSPQIRVAEIRSKALRLRYEQNIDLIIVDYLQLIQGEGNTKENRVQEISYI
FT                   SRSLKGIARELNVPVIAISQLSRAPEFRSSHQPQLSDLRESGSIEQDADIVVFIYRDEF
FT                   YYKEEEWANLHPDQEYPREIADIIIAKHRNGPIGTVKCRFRHDLTRFENLGSSTEPSFL
FT                   "
FT   gene            complement(502690..503145)
FT                   /locus_tag="DehaBAV1_0517"
FT   CDS_pept        complement(502690..503145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0517"
FT                   /product="LSU ribosomal protein L9P"
FT                   /note="PFAM: ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17102"
FT                   /db_xref="GOA:A5FRT0"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRT0"
FT                   /protein_id="ABQ17102.1"
FT                   /translation="MKVVFLKDVPGRGKTGDIKEVNDGYARNYLIPNKLAMPASAAVKS
FT                   EIAAKQAAEERRKAKAEAEMVELAKNLDGAKVNLKAKTGAKDKLYGQITTTVIAAEIEK
FT                   QTGKTIDKRKLELAEPIRQLGNYEVVIRFNKDLSSKINLAVTAEENT"
FT   gene            complement(503215..504135)
FT                   /locus_tag="DehaBAV1_0518"
FT   CDS_pept        complement(503215..504135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0518"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; FAD
FT                   dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17103"
FT                   /protein_id="ABQ17103.1"
FT                   /translation="MSTLLYDVIIIGGGPAGLTAALYTGRSKLKTLVIERAFVGGQITR
FT                   SEKVDNYPGFPEGITGFDLTQQMQIQAEKYGVEITSAEVNAIHKTKDHFEVVTETGGLS
FT                   GRCIIICGGTERNKLEVPGEEEFSGRGVSYCATCDAPFYNDKVVAVVGGGNMAFYEALH
FT                   LSEFAKKVYLIHRRQGFRADAVLMDKAKNKSNIELVLDTVVTSINGQDSIQSLSLNNLK
FT                   TLKTSTLPIDGLFVAVGLQPNTTYLKGVVDMDKNGSILVNNQMETSVSGILSAGDIRSG
FT                   SIRQVISAAGDGAVAALSAKRYLDL"
FT   gene            complement(504116..505159)
FT                   /locus_tag="DehaBAV1_0519"
FT   CDS_pept        complement(504116..505159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0519"
FT                   /product="phosphate:acyl-[acyl carrier protein]
FT                   acyltransferase"
FT                   /note="TIGRFAM: fatty acid/phospholipid synthesis protein
FT                   PlsX; PFAM: fatty acid synthesis plsX protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17104"
FT                   /db_xref="GOA:A5FRR6"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRR6"
FT                   /protein_id="ABQ17104.1"
FT                   /translation="MIIAVDVDGGDYAPKEIIKGALKAAQEYKIGLILLGKKEVIHVHA
FT                   GHYLKKLPIEIVHCPQTVTFNEHAVEAIKGKPQSAIVIGTSLVKQGKADAFISAGNTGA
FT                   VLAAAFFILGKIDGVERPALGAIITTRPHIPSLLIDAGANAECRPNHLDEFAHLGNIYA
FT                   KQVLGLENPRIGLLNNGEEEAKGTKLTLETHQLLKKSKLNFIGNIEGHDISLNKADVIV
FT                   TDGFTGNIVLKTLEGLGDALLKVRKVGHAIDSAAHLRGRALLADVGLGSMVKGMDFEEC
FT                   GGACLLGVKGTIIVAHGRSHARAIKNAIGLAKRTAEKGVDKLIAEDIKSRTKAGTEGDP
FT                   KNVNTPV"
FT   gene            complement(505199..506050)
FT                   /locus_tag="DehaBAV1_0520"
FT   CDS_pept        complement(505199..506050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0520"
FT                   /product="putative CoA-substrate-specific enzyme activase"
FT                   /note="TIGRFAM: putative CoA-substrate-specific enzyme
FT                   activase; PFAM: ATPase, BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17105"
FT                   /protein_id="ABQ17105.1"
FT                   /translation="MNIFLGIDSGSVSTKVICLSQSAELTDWVYLPTAGEPLNTLRLAL
FT                   RQLQSRLPESTRVLGVAVTGSARELVAETVGADMLKNEISSQAKAAAHLIPEVKTVIEI
FT                   GGQDSKLILLENGFVVDFAMNTICAAGTGSFLEHQSRRLDLSLEDMGQLAQFSQNPIEL
FT                   KGRCTVFVESDMIHFQQTGSSRPDIVYGLCKALARNYLNDLGLHKEIRQPVVFQGGVAR
FT                   NPAMKKAFEEELGFSLIVPPRPEITGAWGVALLLRQDTNINTTAKPTNFRGFDTPFLRE
FT                   KV"
FT   gene            complement(506076..507269)
FT                   /locus_tag="DehaBAV1_0521"
FT   CDS_pept        complement(506076..507269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0521"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17106"
FT                   /protein_id="ABQ17106.1"
FT                   /translation="MSDNNLADIKSAIIKMINTEKGSLEELSLKLHANPELGYQEHKAV
FT                   EWICEYLSSQNFSIEKNIGGLNTAFKATFGHGTPVIGFLAEYDALPQLGHACGHNLIAT
FT                   SAAGAAVASCLAAKLCGGTVCLIGTPAEELSGGKIQMVEKGIFKELDAALIAHPGNEDI
FT                   ATTQALACVTLNVEYFGKEAHAAAHPDKGINALDAIVLAYTSLNSLRQHIEPSARIHGI
FT                   ITDGGKTANIVPGHSAGTFLIRSQTMPYLKELMDRVLDCFKSAAQATGARLEYRFDKSI
FT                   YAPMNNNMALANLYVKNMDLLGRKTLLENSDMNFGSTDMGNVSQILPSLHGYYAITRKE
FT                   VSGHTEEFASAACSVNGLKGALDAAKAMAMTAADLFSNSTNLDKVKTEFQKSTRPSA"
FT   gene            507483..510317
FT                   /locus_tag="DehaBAV1_0522"
FT   CDS_pept        507483..510317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0522"
FT                   /product="Excinuclease ABC subunit A"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17107"
FT                   /protein_id="ABQ17107.1"
FT                   /translation="MAQEYIKIKGAREHNLKNIDVQIPRDKLVVVTGLSGSGKSSLAFD
FT                   TVYAEGQRRYMESLSSYARQFLGRMEKPDVDHIEGLSPAIAIDQKGVSHNPRSTVGTVT
FT                   EIYDYLRLLFARTGHPHCPECGKEISAQSVEQITDAVQLLPEGAKILILGPLVRGRKGE
FT                   YTQMFKDLRKSGYARVRVDGQIKDLSEDIELDKNKKHDIEAVVDRLVVGQAGSQGRVAD
FT                   SVETALKLGGGLVVISVVDGQDMLFSEKFSCADCGVSLGEIEPRTFSFNTPHGACQTCM
FT                   GLGAKMELDPELIIPDKNQSLADGAISPYQNQNWYFGQVEDLARRAGFSLNKPVSTFTP
FT                   EQMQLLLYGEGGDIHKYRNRYGRVREYTSGFEGVIPRLDRLYRDSESQGVRESIEKYML
FT                   ASPCQACGGKRLRKEALSVKIGERNIADVAGMSVDEQFKWANELAGKNTLFSKREQLIA
FT                   AQILKEIRSRLGFLNNVGLEYLTIDRIAGTLSGGEAQRIRLASQIGSGLMGVLYVCDEP
FT                   TIGLHPADDTRLVETLQKLRDLGNTILVVEHDESVMRAADYIIDMGPGAGEHGGRVVAT
FT                   GNISEIMQNPASLTGQYLSGAKVIPVPEKRRDGNGQELLIQGARQNNLKNIDVHIPLGK
FT                   LVCVSGVSGSGKSTLVTDILFKHLAQVFYGAKDRAGGSDSITGTEHIDKIIEINQSPIG
FT                   RTPRSNPATYTGAFTNIRELFASVPESKVKGYGPGRFSFNIKGGRCETCGGEGYIQIEM
FT                   QFLPDVTVPCEVCHGARYNREVLEIKFKDKNIADVLDMTVDRALEFFENFPKISSKLQT
FT                   MQDVGLGYIRIGQPAPTLSGGEAQRIKLATELSKRATGRTLYILDEPTTGLSFEDVAAL
FT                   LRVLQRLVDSGNTVVVIEHQLDVIKNADWIIDLGPGAGIKGGQIVAEGIPEDVALNKAS
FT                   VTGKYLRRVLPKLK"
FT   gene            510391..510942
FT                   /locus_tag="DehaBAV1_0523"
FT   CDS_pept        510391..510942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0523"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase, HD sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17108"
FT                   /protein_id="ABQ17108.1"
FT                   /translation="MDRQLALVEVEKRVDNKNLVKHMLATEAVMKGLAGYFGENQDEWA
FT                   MAGLIHDIDLGEVKDDMSLHSKRSAEIAASLGAGKAVCQAILVHNSAHGIIPDSRMEKA
FT                   LFCADPITGLITAAALVRPDKKLACVEAKSVAKRFKEKSFAAGANREQIASCSSLGLEL
FT                   DEFIRLSLSAMQSVSSDLGL"
FT   gene            511051..511254
FT                   /locus_tag="DehaBAV1_0524"
FT   CDS_pept        511051..511254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0524"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17109"
FT                   /protein_id="ABQ17109.1"
FT                   /translation="MILRTRIKELRARYNLTQSELAETVGVSRQTMLYLEKGKYNPSLI
FT                   LAHKVAKALHADIEDVFILRDV"
FT   gene            complement(511251..513830)
FT                   /locus_tag="DehaBAV1_0525"
FT   CDS_pept        complement(511251..513830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0525"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17110"
FT                   /protein_id="ABQ17110.1"
FT                   /translation="MIPVKLKIKNFMCYRGEIPPFSFNGIHTACICGQNGAGKSALIDA
FT                   ITWALWGKSRAKSDDDVISLNEQEAEVSLDFEISGELYQVIRQRQRPKKAGTNGQSLLS
FT                   LFSLQDEKPRNITGDTLTQTEKKIISILHMDYDTFINSAFLRQGHANQFTQQPPGKRKE
FT                   VLANILGLEIYDQLEDLARQAVREAETKNLQIEQSIEDGKESLKSRPELEEALNHTRQD
FT                   LAEGEGKLKIQLAELEIMRHKKHSFDTKQNTCRQLDNDLKDISKDQSRWIQTLQEIKQR
FT                   ISTFETLSAQKEAIFKGFQEYSVCQSLYDKHNRILAKLRQLENTKKPLEDAVYKEENNL
FT                   KNTLGKYQERLKFRQDTAQTLVILEKEKTQSDQLKTRLETEEAELKIQQNKLLNLQSSL
FT                   ARLETEHAVAVKEVNALEEKLNLLAEAGENRCNCPLCETELGQDKLKLVFGKYKTEQDT
FT                   QKTLQADLQEKLSQMQSDIQALLKYIETETNRLSHSHKQYERQISLLDKGIAEAKEAEI
FT                   KAAEGRNLIAGIEKQLNERSYAAAEQASLAVVEKEIQGLNFDNAEYTRNQQNLADLTPF
FT                   EEKKRKLDEAINRLPLENDSLKKASSALAELTARRDNKLNEQQTLLKELAELPVLEKEL
FT                   GEAETEYKSLSQRQDALRQQLGSLSQKAEQINELEKKLKKQAQEKDQTTQEINYFGKLV
FT                   RAFGKKDGIQTMLIEDTLPELENGADLLLSRMTDGRMHLSIETQRSTKKGDQTETLDIN
FT                   ISDELGTRNYETFSGGEAFRIDFAIRIALSHLLANRLGAPLRTLIIDEGFGTQDTTGIE
FT                   RLKEAINSIQNEFDKILVITHIDDLKDSFPTRIEIDKTPSGSAIRLN"
FT   gene            complement(514001..515563)
FT                   /locus_tag="DehaBAV1_0526"
FT   CDS_pept        complement(514001..515563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0526"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD family"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor RpoD domain protein; PFAM:
FT                   Bacterio-opsin activator, HTH domain protein; sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 4 domain protein; sigma-70 region 1.2"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17111"
FT                   /protein_id="ABQ17111.1"
FT                   /translation="MPAEKDKKEFSPDDIDDDKDAEQGLANIHDEQDAEAEGDKLAEPD
FT                   LKDIADTDIPAELTEEELAAEADLIPDTDEEISPLNIDLDIPLEQIDTQGIVDDPVRMY
FT                   LHEIGRVPLLSAEDEKTLAKKMEEGKRIREIRQECLEKRGRYPSAAESFLCMLRELAQA
FT                   TEVLFQLGQELGMDTSASLKTIIHNPKLRTAIDHEIDQQLTKNISDNTGKSMAEIEQSF
FT                   INLAINSSLLPKVVLDAIPEKMTIPEISDHTYDTTFINHLERHEASLKYYLDNLEIDAK
FT                   RAERHLIQANLRLVVSVAKKHIGRGMPLLDLIQEGNIGLIRAVEKFDFHRGFKFSTYAT
FT                   WWIRQAITRAIADQARTIRIPVHMVETINKLLSISRQLSQKLGREPTPDEIALEMDLPP
FT                   EKVREIAKVSQLPVSLESPIGEEEDSHLGDFIEDQNALAPPDAASRQLLKEQIDTVLGS
FT                   LTPRERRVLQLRFGLEDGRSRTLEEVGKEFNVTRERIRQIEAKALRKLRHPSRSRKLKD
FT                   YLE"
FT   gene            complement(515564..517330)
FT                   /locus_tag="DehaBAV1_0527"
FT   CDS_pept        complement(515564..517330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0527"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="TIGRFAM: DNA primase; PFAM: zinc finger, CHC2-family
FT                   protein; TOPRIM domain protein; DNA primase catalytic core,
FT                   N-terminal domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17112"
FT                   /protein_id="ABQ17112.1"
FT                   /translation="MNDAVEEIKQKLDIVSFIGQYTKLTKAGRTMRGICPFHSEKHGSF
FT                   FVYPEAQNWHCFGACNTGGDIFAFVMKKEGLDFKAALELLAEKAGVSLPSQINPAIKDQ
FT                   RDRLYEINLSAAQYYHNLLLNSPQAENARIYLNSRGLNEQSLADFQLGYALADWQGLYD
FT                   YLKERSYSDEDLLKAGVIVRSDEGRIHDRFRNNIIYPIANYKGQIAGFGARVMDNSQPK
FT                   YRNSPQTDLFDKSSLLYGLHLASASIRENNRAIIVEGYMDAIMSHQGGFTNTVACMGTA
FT                   LTERQIALIKRQTKNLVLGLDSDSAGEEATLRAIDYENQMESEIRVAVPEGGKDPDELI
FT                   RHSPQSWQEILDNARPLLDYIFEHSQRGLDLNSAAGKSKLADHLLPIISKMEDGVRQSH
FT                   YLGKLAEIVSTSQNRILERLKKLKNETRNAKVTEKEAPSGQAPKNPALEEYALSLLFTS
FT                   AEVTRFAYNLHPEYLEIPQYRELLAIYNQSAEKDNLRPCLDENLREYYDNLMNKNPAND
FT                   NIEDKFYDLCLRLRERYLRNLAVKLNQALSEINQPETTEYQALNDQCVKVNEELRSVFS
FT                   LKDRRNQKQRRQ"
FT   gene            complement(517332..518369)
FT                   /locus_tag="DehaBAV1_0528"
FT   CDS_pept        complement(517332..518369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0528"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /note="TIGRFAM: putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase, HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17113"
FT                   /protein_id="ABQ17113.1"
FT                   /translation="MISELRIRERIEAREETLSPYAVKSRLSRGRQKPEDPDPVRTCFQ
FT                   RDRDRIIHSKAFRRLKHKTQVFIAPLGDHFVTRLTHTLEVTQIARTIARALNLNEDLTE
FT                   AICLGHDLGHTPFGHAGEEVLNELFPKGFHHNEQSLRVVDLLEKNGHGLNLSWEVRDGI
FT                   LNHSKSRSNILGETHNKAATFEGQICRIADAVAYINHDILDSVRAGIIKANDLPLGAVS
FT                   VLGNTHSHRINTMVCDIIKNSWSCTGLLPGQEPVLTMSNKVLDASNTLRDFLFEQVYQS
FT                   KDRKAEHEREIVRLLYKYLVGHQDLLPAEYIALSDKPERRVADYIAGMTDLFALRLAKE
FT                   LNLAD"
FT   gene            complement(518366..520642)
FT                   /locus_tag="DehaBAV1_0529"
FT   CDS_pept        complement(518366..520642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0529"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="TIGRFAM: phosphoenolpyruvate synthase; PFAM:
FT                   PEP-utilizing enzyme; pyruvate phosphate dikinase,
FT                   PEP/pyruvate-binding; PEP-utilising enzyme, mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17114"
FT                   /protein_id="ABQ17114.1"
FT                   /translation="MQKGHEAIVWFNEVTKNDIPLVGGKGANLGEMTNAGIPVPPGYIV
FT                   TANAYFDFINSSNLHPAISKALESLDINDSKQLSVVANIVKEMILSTPMPPGLATQIKT
FT                   AYKKMGQGLVAVRSSATAEDLPEASFAGQQSTYLNIEGGDEVVVAVQKCWASLFEARAI
FT                   YYRVQQNFDHLQVGIAVPVQKMVQSQASGVCFTIEPITSDPTKIVIEAIYGLGEGLVSG
FT                   EITPDLYILDKEGPAVLSRTISHQERRLVRKNGNSTSGAEDESGNNYWQPVPSTKQEQQ
FT                   KITEDDIITLAKLAMLIENHYKGPQDIEWAKEENEIYIVQSRPVTALKDASELEPEIDA
FT                   PIMLQGAAASPGLATGGVKILQDPSEIDLVLPGDILVAEMTTPDFVPAMKRAAAIVTNR
FT                   GGRTSHAAIVSRELGIPCVVGTGEATKVLKNDQMITVDGTHGKVYNGKVTRNVKTSNIA
FT                   SIVREAIRTKTRVYVNLAQPELADKVAARNVDGVGLLRAEFIFSQIGKHPRYMIEMGQQ
FT                   EEYIQQVYAGVLSFAKAFYPRPVVYRTNDFKTNEYRDLLGGDKYEGQEENPMLGYRGVS
FT                   RYIKDIEVFKMEIEAIKRVRKDYPNVYVMLPFVRTVDELVKVKRILEDEGLKRGPDFKL
FT                   WMMVEVPSNIFLIDKFIDAGIDGISIGSNDLTQLILGVDRDSEMLRETFDERNEAVLVA
FT                   LEKAVTTAARRGITASICGQAPSVYPELTEKLVSWGITSVSVSPDMIGTTREIIAKAEA
FT                   KLKIK"
FT   gene            520940..521509
FT                   /locus_tag="DehaBAV1_0530"
FT   CDS_pept        520940..521509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0530"
FT                   /product="protein of unknown function DUF151"
FT                   /note="PFAM: protein of unknown function DUF151"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17115"
FT                   /protein_id="ABQ17115.1"
FT                   /translation="MIEMTIDSIRVSLMNYQRVVLLKEKTADRYLPIWIGTAEAEAIAV
FT                   KLQGVAVPRPLTHDLLGTVIDVLGAKVRSIVVDDLKNDTFYAKVLLEVDGEQMEIDCRP
FT                   SDALALAVRVNVPIYAADSVLEKASIMLDREQDKRAMDEMDLPEPPSGGKGEKTRKASD
FT                   EEIKRLSAFRDFVDNLDLEDFDKRKS"
FT   gene            521567..521800
FT                   /locus_tag="DehaBAV1_0531"
FT   CDS_pept        521567..521800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17116"
FT                   /protein_id="ABQ17116.1"
FT                   /translation="MRFEAVMNKWGTGLQYLGLGWYMALVILLGTLGGRWLDQALGLDP
FT                   VFLLAGLLIGVFLAFYGVYRLLPKITNNGKGN"
FT   gene            521803..522747
FT                   /locus_tag="DehaBAV1_0532"
FT   CDS_pept        521803..522747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0532"
FT                   /product="ATP synthase F0 subcomplex A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17117"
FT                   /protein_id="ABQ17117.1"
FT                   /translation="MPKKKILGMPKQVFWPVMIVILAILVVGFLSGPIGIALFGDLGFP
FT                   DWMKITTPKPELPSAELFSIGPVAITNTILTAWITILVLVGLSVAATRKMKLIPGRLQG
FT                   ALEMVLSWIYNMCVDAAGEKFGRKFFPLVATIFLFIIVNAWMNLLPGYNTIFIELGNGH
FT                   EAHLLRGANTDINLPLALAAITFFMVEYWGIKTLGGFHYLSKFFNFKPLINAFRHKEGV
FT                   IGIFNGVISIFVGLLEFFLEFVRIISLTFRLFGNMIGGEILILMITFLAPFIIGIPFYG
FT                   LEMLVGFVQALVFCNLALVFSLIAVTPHGEETH"
FT   gene            522788..523018
FT                   /locus_tag="DehaBAV1_0533"
FT   CDS_pept        522788..523018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0533"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17118"
FT                   /db_xref="GOA:A5FRR4"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRR4"
FT                   /protein_id="ABQ17118.1"
FT                   /translation="MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKG
FT                   SIFTNMILLVAFAESIAIFALVISIVLIFVA"
FT   gene            523043..523552
FT                   /locus_tag="DehaBAV1_0534"
FT   CDS_pept        523043..523552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0534"
FT                   /product="ATP synthase F0 subcomplex B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17119"
FT                   /db_xref="GOA:A5FRQ1"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRQ1"
FT                   /protein_id="ABQ17119.1"
FT                   /translation="MEKLAELGINIPSFIAQIVNFGLLLGLLYLFAYKPILAKLDERST
FT                   RIKESMERTDQVKEQAQKAEEEFKKKIGEASQQGQLVIERAVKTGDEIRQKAIEEAKAE
FT                   AEAMLSRARTEIRQERDEVVDQLRKEFAELTILAAGKVIDQSLDKKAHQALIDSVLENS
FT                   TDLRKN"
FT   gene            523573..524115
FT                   /locus_tag="DehaBAV1_0535"
FT   CDS_pept        523573..524115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0535"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17120"
FT                   /db_xref="GOA:A5FRQ2"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRQ2"
FT                   /protein_id="ABQ17120.1"
FT                   /translation="MAKRVYAIAMRYAQALHELAKEQKSLDKWQEDLQNLSRLTEDASV
FT                   DEFLSNPKIVSARKHAVLAKLSDIDPLMLNLVDMLVATRRLGIMRAISGEYNRLLNEAR
FT                   GVEDAIVTTAKPASEADTEIIRQQLSKITGKKINILTATDPGLIAGLKARIGDKLIDGS
FT                   ISRRLVLLQNEISQGRI"
FT   gene            524138..525649
FT                   /locus_tag="DehaBAV1_0536"
FT   CDS_pept        524138..525649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0536"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17121"
FT                   /db_xref="GOA:A5FRQ3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRQ3"
FT                   /protein_id="ABQ17121.1"
FT                   /translation="MSARGQDIVSIIKEQIKEFGAPVSMTSVGSVIEVGDGIARIHGLS
FT                   NAKYNELLEFPGGVLGIALNLEEDSVAAVILGEDSNIKEGDEVKATGRISEITVGKGMI
FT                   GRVVDPLGRPLDGKGPIKAESTRPLERIAPNVVDRKSVNTPVQTGIKAIDAMIPIGRGQ
FT                   RELIIGDRSTGKTAIALDTIINQKGGDLVCIYVAIGQKASKVARIVALLEQYGAMEHTI
FT                   VVAANSSDAVALQYLAPYAGCAIGEEFMEQGKDALVVYDDLTKHAWAYRQLSLLLRRPP
FT                   GREAYPGDLFYLHSRLLERAARLNDKLGGGSLTALPIIETQAGDVSAYVPTNVISITDG
FT                   QIYLEPDMFNAGIRPAVNVGISVSRVGSSAQTKAMKKVAGKLKMDMGQYRELAAFAQFG
FT                   TSELDKSTRMQLERGQRVTEVLKQGQYQPVPAAKQVAILYATLNGYLDNIEVGKVRDYE
FT                   SGLYRFLEANFASVLTAIAKENVISADTEKTLKTALDEYKKGLVV"
FT   gene            525674..526531
FT                   /locus_tag="DehaBAV1_0537"
FT   CDS_pept        525674..526531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0537"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17122"
FT                   /db_xref="GOA:A5FRQ4"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRQ4"
FT                   /protein_id="ABQ17122.1"
FT                   /translation="MANLRIIKRRIRSVRNIAKITRAMEMIAASKMKKAQERGLAGRPY
FT                   SEKITEVIAALAALPQSGEILHPLLERRPVKKIAILHITPDRGQCGGLVANINRKTGTF
FT                   IMEQKVSVSAVVVGRKGVDFIRRIRQQMRAEFINLGDKPDYLDTLPISRVIMDDFMSGE
FT                   IDQVFIAYTQFVSTAIQNPVLEQLLPVVPVEFPPGQNLEYIYEPESAAVLNSLLPRFVE
FT                   MSVYHAILESIASEQSARMVAMRNATDNAKELIGELTLVYNKARQESITNELLDIVGGA
FT                   AALA"
FT   gene            526547..527941
FT                   /locus_tag="DehaBAV1_0538"
FT   CDS_pept        526547..527941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0538"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17123"
FT                   /db_xref="GOA:A5FRQ5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRQ5"
FT                   /protein_id="ABQ17123.1"
FT                   /translation="MANGKVIQVIGSVVDVEFSADSMPALFNALEIPRENGKMVLEVQS
FT                   HVGNNRVKCLSFTPTDGLERGAEVIDTTRPLSVPVGRGTLGRIFNVLGEALDNRGDVKS
FT                   EKTMPIHRLAPGMDELESSAQVLETGIKVIDLIAPFARGGKIGALGGAGVGKTVLIQEL
FT                   IRNIATEHEGFSVFAGVGERSREGNDLWHEMEDSGVLPKTTMVFGQMNELPAVRLRIAL
FT                   TGLTMAEYFRDEERQDVLLFIDNIYRYTLAGMEVSALLGRMPSAVGYQPTLATEMGALQ
FT                   ERIASTKQGSITSFQAVYVPADDYTDPGVVATFGHLDAMIALERSLAEQALYPAVDPLA
FT                   SNSRILDPQVVGEEHYKVARDVQKVLQRYKDLQDVIAILGMEELSEEDKLTVARARRIQ
FT                   RFLTQPMFVSEVFTGRPGQYVSLTETIRGFKEILEGKHDSLPEQAFYMVGTIDDAVAEA
FT                   KKLSAV"
FT   gene            527966..528388
FT                   /locus_tag="DehaBAV1_0539"
FT   CDS_pept        527966..528388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0539"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17124"
FT                   /db_xref="GOA:A5FRQ6"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRQ6"
FT                   /protein_id="ABQ17124.1"
FT                   /translation="MAKLKLDIVTAERSVFSEEVDVVVAPGIEGEMAILPHHAPLMTAL
FT                   QAGELKAKIGTEEYSLVVSGGFLEVRPDRVVVLADSAERAEEIDIARAIEAKKRAEASM
FT                   ADKYVPGMLAAETEASLRRAMVRLKVAEKRRKHPQV"
FT   gene            complement(528463..528963)
FT                   /locus_tag="DehaBAV1_0540"
FT   CDS_pept        complement(528463..528963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0540"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17125"
FT                   /db_xref="GOA:A5FRP5"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRP5"
FT                   /protein_id="ABQ17125.1"
FT                   /translation="MTQEEYILIGKVLGVWGISGGLKIGVLTDFPERFDAGNELLVGRK
FT                   LYTISQTNWQKAQVIVHLSGIDDIDTALELKDALVEIPASALKELPEGVYYDFQLIGLE
FT                   VVDLSGVKIGQIKEILHMPSNDIYVSSYGVKEALIPAIKDVVKEINLKTGKIIIDPIPG
FT                   LLD"
FT   gene            complement(529051..529278)
FT                   /locus_tag="DehaBAV1_0541"
FT   CDS_pept        complement(529051..529278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0541"
FT                   /product="RNA-binding protein (KH domain)"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17126"
FT                   /protein_id="ABQ17126.1"
FT                   /translation="MKELVEYIAKSLADEPNDVVVTEEPEEEGIKLTLKVADVDKGRII
FT                   GKQGRIAQAMRTLIRVKAAKAGKRARLEIL"
FT   gene            complement(529294..529542)
FT                   /locus_tag="DehaBAV1_0542"
FT   CDS_pept        complement(529294..529542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0542"
FT                   /product="SSU ribosomal protein S16P"
FT                   /note="PFAM: ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17127"
FT                   /db_xref="GOA:A5FRP7"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRP7"
FT                   /protein_id="ABQ17127.1"
FT                   /translation="MLKIRLTRIGAPKKPCYRIIVTEARSPRDATYTDLVGTYNPMTNP
FT                   ETVIINAEKVLYWIGKGAQPTDTVARLLKKAGIVNSN"
FT   gene            529687..530358
FT                   /locus_tag="DehaBAV1_0543"
FT   CDS_pept        529687..530358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0543"
FT                   /product="Endonuclease V"
FT                   /EC_number="3.1.21.-"
FT                   /note="PFAM: Endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17128"
FT                   /db_xref="GOA:A5FRP8"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRP8"
FT                   /protein_id="ABQ17128.1"
FT                   /translation="MNVKIKKLHNWDMTPTEAILLQRELAQKVSACGTLSSISLVAGAD
FT                   VWHSRTSGMGRAAVVVLSYPDMNLVEVSRSEGDCHIPYIPGLLSFREMPLLLSAFEGLE
FT                   SMPDLILMDGQGLAHPRRLGIASHLGLFLNKPVIGCAKSRLVGEYTPLADEAGSYSDLY
FT                   HNSQLVGRVLRTRRGVNPLFISVGHKICLEEACSRVADCCRGYRLPEPLRHAHLAAAEL
FT                   I"
FT   gene            530485..531555
FT                   /locus_tag="DehaBAV1_0544"
FT   CDS_pept        530485..531555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0544"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /note="TIGRFAM: peptide chain release factor 2; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17129"
FT                   /protein_id="ABQ17129.1"
FT                   /translation="MNLRAAFFLTWCDFDVSAKELEITELETASSNPDFWQDQQNAQKA
FT                   MKKLAANKRTSELWRGLERRINDLTELAVLSREDPSLSNEIEHEISGLTAELDSLEVGL
FT                   AFSGQYDNRNALLTVHAGAGGVESQDWAGMLLRMFMRWAEKKGFGMEILDQSPGEEAGI
FT                   KSATLQIEGEYAYGFLKSEHGVHRLIRLSPFDADHARHTSFALVEIMPEAEDSVDIDIK
FT                   PEDIKIDMFRSSGPGGQNVQKVSTAVRVTHIPSGIVVASQTERSQHQNREIAMRILASK
FT                   LLAVEIAKRAEERAKLKGERISAEWGSQIRSYVLHPYKMVKDHRTDYEVGNAEAVLEGE
FT                   LDGFISAYLRQNIGRE"
FT   gene            531555..532781
FT                   /locus_tag="DehaBAV1_0545"
FT   CDS_pept        531555..532781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17130"
FT                   /protein_id="ABQ17130.1"
FT                   /translation="MKKQLLALGLMLGILLGGLVPSTLTAQSPITIDKSSVNITFPSNI
FT                   GFSLTASSISNITDIRLYYTVDRKTFSEVYSEFVLNFTPDTTVNASYSWDMRYTGGMPP
FT                   GARVNYWYRITDEAGNILTSPSQTVVYEDARFDWQSISEGMLELYWYNGEQSFADELME
FT                   SAQAALLRLAADTGAELQDKVTLYIYANSADLQSAMVFPSEWTGGVAYPAFNVIAIGIA
FT                   PYDVDWGKRAITHELAHQVTSQMTSNPYCDLPVWLNEGISMYAEGNLEAVYVNYLVWAI
FT                   GQDKLISVKSLCSPFSANSADAYLSYAESFTLVNYLITYYGPEKFSALLETFHQSAGYD
FT                   EALLAVYGFDIQGLNTLWQATLKNGAIEIQPPRSIILTPGLAVLLTLVAGGSIITAFWL
FT                   WSNRVVSRT"
FT   sig_peptide     531555..531635
FT                   /locus_tag="DehaBAV1_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 27"
FT   gene            532765..533451
FT                   /locus_tag="DehaBAV1_0546"
FT   CDS_pept        532765..533451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0546"
FT                   /product="DNA replication and repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17131"
FT                   /protein_id="ABQ17131.1"
FT                   /translation="MSPVPSIRDLPLAERPRERLQSLGAGALSSVELLAVILGRGVAGE
FT                   PVLQSAQRLIAHFGGPSGIACASVEELSKLKGIGLAKACQLKAAFELAKRAGGIKGEYQ
FT                   PCIKTPEDVFQIIYPLVCDEKKEYFFCLMLDVKSRLIRVGHISVGSLEESVVHPREVFK
FT                   EALSASAASVILAHNHPSGDTEPSHDDIGLSARLREAGGIMGIEVLDHIIIGGQSFTSL
FT                   KRQGLL"
FT   gene            533451..535046
FT                   /locus_tag="DehaBAV1_0547"
FT   CDS_pept        533451..535046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0547"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17132"
FT                   /protein_id="ABQ17132.1"
FT                   /translation="MMKKILLIILSVCLSFSLLLSGCGYAPEDNTMPTGNNVLTLVGQE
FT                   PYTLDPAKVSDSGSVTYIYQIFSGLLKMGDDLTPVADIAQSWEVSPDGLTYTFYLKPNV
FT                   KFHNGRVLTAADFKYSWERAASPATASNTVLTFLGDIQGVTEMVQGQANSISGVTVVDD
FT                   LTLKVKLVSPCSFFLSKISYVTAFVVDKDNVSQGSDWWKKPVGTGPFMLPELTQGNYIM
FT                   LNSNPDYYDTPAKISSVIFRLQSGQPMDLYEVGGIDVAGVSADYLAKATDPDGFFSADL
FT                   QVVPQLSFYYFAYVTSKAPFDDPKIRQAFSMAVDKARIIELSYKGSVSVAEGILPPGMP
FT                   GYNPDLSGLEYNPERARELIAESSYGSVENLPTITLTASGWGGLLPVELEAVIDQWRQN
FT                   LGVEVVVRQIDMERFLYDLQTEKDNLYYSGWVADYPHPQDFLSVLFETTSSYNSGDYSN
FT                   PEVDALLVQAAATLDTEESMQLYAQAEQILINDAACLSFWFGKNYMLVKPYVKGYKLNA
FT                   MGIPILTEVSLEAH"
FT   sig_peptide     533451..533519
FT                   /locus_tag="DehaBAV1_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.899 at
FT                   residue 23"
FT   gene            complement(535171..535260)
FT                   /locus_tag="DehaBAV1_R0009"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(535171..535260)
FT                   /locus_tag="DehaBAV1_R0009"
FT                   /product="tRNA-Ser"
FT   gene            complement(535524..535883)
FT                   /locus_tag="DehaBAV1_0548"
FT   CDS_pept        complement(535524..535883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17133"
FT                   /protein_id="ABQ17133.1"
FT                   /translation="MPACPYRRYKNAVKQTPNLEGKTRNVKSRYPALQLVIKVIKILAV
FT                   LITLAGIIASTTIMAGDGLIHIDSATAFSVFAGMLGILASLIQGILIYATAELLQCFID
FT                   IERNTRKTTHLLNTR"
FT   sig_peptide     complement(535701..535883)
FT                   /locus_tag="DehaBAV1_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.723) with cleavage site probability 0.723 at
FT                   residue 61"
FT   gene            complement(536065..537207)
FT                   /locus_tag="DehaBAV1_0549"
FT   CDS_pept        complement(536065..537207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0549"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17134"
FT                   /protein_id="ABQ17134.1"
FT                   /translation="MEIKPFELERYFAKHEFSARYLMSSSDCESLGLEDLLLLADAECR
FT                   NLWQNLKLGYTYSDGHPLLRKEIAKLYEHITLSDILTTVPEEGIFIALNCLLEKGDHVI
FT                   CTFPGYQSLYQLAESLGCEVSYWKPEEENGWRFNPEFLSRNIRPNTRLIITNFPHNPTG
FT                   AMPDTRDYALITEIISQHNLWHFSDEMYRLLEYSPQNRLPAACDKSGMSVSLGGLSKSF
FT                   GLPGLRSGWLACRDKDVLSKMAGFKDYTTICGSATAEILSIIALRNKDTIVSAQLGRLN
FT                   QNLKLLEGFMGRHKQYFSWVKPKAGSVCFPRLNKITPCMDFCQQVLEKTGIVILPSEVY
FT                   NYGQNHFRIGFGRANFPEVLEIFENFITAYPARSKGLPEM"
FT   gene            complement(537223..538464)
FT                   /locus_tag="DehaBAV1_0550"
FT   CDS_pept        complement(537223..538464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0550"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); seryl-tRNA
FT                   synthetase, class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17135"
FT                   /db_xref="GOA:A5FRN4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRN4"
FT                   /protein_id="ABQ17135.1"
FT                   /translation="MLDLKFIRENPELVRKAVADRNTDAPIDEILELDNSRRNLTQELD
FT                   NLRAKRKIMAKQRDETAIEEGRVLRGQISTLESELSQVDEKLTDRLLRVPNIPDPSVPV
FT                   GKDESENVVLYYRGEKRNFSFTPKPHWELGEALDIIDFDRGIKLSGSRFYILKGAGARL
FT                   QRALIAFMLDLHTRKHDYTEIYPPYMIKRECLVASGNLPKFADNLYHDAEEDYWWVPTA
FT                   EAPLTNLHRDEILSAEQLPIHYVAYTACFRREKMSAGKDVRGIKRLHQFDKVELYKYCK
FT                   PEDSFAELEKMVADAEEIADALKIPYRLKQLVTADISFGSAKSYDIEMYSPGVDEWLEV
FT                   SSCSNCTDFQGRRANVRFRRTSEAKPEFVHTLNGSGLALPRVMISVIENYQQPDGSIVI
FT                   PEVLRPFMGVDVIR"
FT   gene            complement(538496..539992)
FT                   /locus_tag="DehaBAV1_0551"
FT   CDS_pept        complement(538496..539992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0551"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (D, K and N); nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17136"
FT                   /db_xref="GOA:A5FRN5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRN5"
FT                   /protein_id="ABQ17136.1"
FT                   /translation="MPEEYLNAQKMEKLERIKSRGINPYPSTFHPSHTSAQAVALLVEI
FT                   ETQENHLKEVLKLAGRIMTRRDMGKISFMDIRDGSGKMQIFFRQNDLDEASIELLKDLD
FT                   LGDFIGVEGSLMRTRTGEPSLAATKVSMLSKSLLPLPEKWHGLQDVEKRYRQRYLDLIS
FT                   NADARQTFLTRSRVISVIRAFMNAKGFLEVETPVLQPEAGGALARPFITHHQALNCDFY
FT                   MRIALELHLKRLIVGGFDRVYEIGRIFRNEGISTRHNPEFTMMESYQAYANYKDVMDFL
FT                   EEMVSSVVKEISGGYTLPFGDITLDFTPPWPRLTMRDAVKQYAGIDFFDFPTKETLAAE
FT                   MTRRKLKVDPAKDWGKLVDELVGEFVEPHLVQPTFLTDHPVAMSPLAKQKPEDPRLTER
FT                   FEAICANMEIANAFSELNDPVEQRARFKEQLEKRSQLRTDESESVDEDFLAALAYGMPP
FT                   TGGLGVGIDRLVMLFTNHDSIREVILFPALKDREDTKTQE"
FT   gene            540168..540401
FT                   /locus_tag="DehaBAV1_0552"
FT   CDS_pept        540168..540401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17137"
FT                   /protein_id="ABQ17137.1"
FT                   /translation="MLAFRKNVTNNTKWIEKRMDVSESIVPIIVGIVQVVLIVVLIALG
FT                   IYSLRNNKSGKQFEAKDIQAGESREEKFISRD"
FT   gene            complement(540415..541176)
FT                   /locus_tag="DehaBAV1_0553"
FT   CDS_pept        complement(540415..541176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0553"
FT                   /product="DNA replication and repair protein RecO"
FT                   /note="TIGRFAM: DNA repair protein RecO; PFAM:
FT                   Recombination protein O, RecO"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17138"
FT                   /db_xref="GOA:A5FRN7"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRN7"
FT                   /protein_id="ABQ17138.1"
FT                   /translation="MTKPHDFKTKAIIVRKTKCGEADRILSLLTPDLGLIQGFAKSVRK
FT                   TTSKLSGHLELLCYSEVSLARGKAIDTITGSQTIQSFLNIRNSLQLSAMAFYACELAYH
FT                   FSPEEAANPALFQLLLSTLEELDNGSQPELCLKYFEINLLASSGYKPELRECANCHKKL
FT                   QATINYYSPESGGVICPNCRNTQIGMPVSVNTVKVLRYIQENSFSSICRLKINREILSE
FT                   LELAIRANIRFVLEKEPKALFWLDSLRLADL"
FT   gene            complement(541177..541272)
FT                   /locus_tag="DehaBAV1_0554"
FT   CDS_pept        complement(541177..541272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17139"
FT                   /protein_id="ABQ17139.1"
FT                   /translation="MALPFLLKHIISFSESLEFIPILLEKPKRQI"
FT   gene            complement(541275..541997)
FT                   /locus_tag="DehaBAV1_0555"
FT   CDS_pept        complement(541275..541997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0555"
FT                   /product="DNA alkylation repair enzyme-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17140"
FT                   /protein_id="ABQ17140.1"
FT                   /translation="MANIEIQEEYTELITQLKALANADNAAGMSRFGISSANTLGVSGK
FT                   DIRRLIVQAGHNHPLAMLLWDSGIHEARIMASLVAESRKVSPQEMETWVKDIDSWDICD
FT                   LCCNNLWYKTPFAYEQALKWTYREEEYVKRAGFVLLTALAVHDKKAPDEKFVLFFPRLL
FT                   AEASDERNYVKKSVNWALRQIGKRNLSLNKAAITLGEEILAQNTRSARFIATDALRELK
FT                   SPQIQERLSGSRKKPTDA"
FT   gene            complement(541999..543063)
FT                   /locus_tag="DehaBAV1_0556"
FT   CDS_pept        complement(541999..543063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0556"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2+ transporter protein, CorA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17141"
FT                   /protein_id="ABQ17141.1"
FT                   /translation="MTRQSKKYSQKAGMLPGSVVFIGEGKTEKASLSLHSYTPDSYQPL
FT                   PVRNLADCITQIKQSKGIVWIKVNGLQDTAMVEELGKCFSLHPLTIEDVVNTEQRPKLE
FT                   DYGNYFFAVIKALYWDSELKKTRSEHISLVLGNNYLISFQEHQSDILNPIQERLKSDNG
FT                   RLRKLGSDYLLYSILDMVVDGYFSLLEGFGDYLDEIEEQLLSTPSSQTLKQISGAKKEM
FT                   LFIRKSIWPVRETIASIERTENPLIDKNSHVYFRDIYDHLIQLIDTGETYRDMLSNMID
FT                   IYLSSLSNRMNEVMKVLTIFASIFIPLTFIVGIYGMNFDIPELRLSWGYPGILIFMLAV
FT                   VLLLLSFFKRKKWL"
FT   gene            complement(543102..543716)
FT                   /locus_tag="DehaBAV1_0557"
FT   CDS_pept        complement(543102..543716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0557"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: RecR
FT                   protein; TOPRIM domain protein; SMART: Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17142"
FT                   /db_xref="GOA:A5FRM7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRM7"
FT                   /protein_id="ABQ17142.1"
FT                   /translation="MKDTSLPSTAGVVNKLIDSLGKLPGIGPKSAQRLAFYLMRAPEDQ
FT                   VISLSDTIRNIKNQISQCRICCNVADSELCPICQNTKRETNKICVVEQPQDILALEHVG
FT                   VYRGYYHVLHGAISPTEGITSQNIRINELMVRLDNGQVEEIILATNPTTEGEATAMYLS
FT                   RLITPLGIKVTRLARGLPFGTELEYADDVTLSRAMEGRQNF"
FT   gene            complement(543738..544031)
FT                   /locus_tag="DehaBAV1_0558"
FT   CDS_pept        complement(543738..544031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0558"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17143"
FT                   /protein_id="ABQ17143.1"
FT                   /translation="MIKQAMELKSKLDKAQKELAKIVVETESAKGAIKIKMNGQQKVLS
FT                   LSISPEIINPAKPKDLENALTKAFNDAYEETKKEGSKQMQGLIGDVKIPGLM"
FT   gene            complement(544047..545759)
FT                   /locus_tag="DehaBAV1_0559"
FT   CDS_pept        complement(544047..545759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0559"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17144"
FT                   /protein_id="ABQ17144.1"
FT                   /translation="MADMTCQVFYRKWRPQTLADLVGQEHVAHTLKNALSSGRIAQAYL
FT                   FCGPRGTGKTSTGRILAKAVNCTTNQGKGEPCNTCPMCLSITEGSSMDIIEIDAASNTG
FT                   VDDIRELKEKVQYSPSLANYKVYIIDEVHMLSNSASNALLKTLEEPPPRVIFILATTEI
FT                   HKVLPTIMSRCQRFDFHRVSLVDMTRKLGKISLAEGINVEPEALKLIARSAGGSFRDGE
FT                   NLLQQIATTYGAEISLSQVQAALGISGDERIKALAENILKKDIKNGLKTLNAVLADGLD
FT                   LKQFRRELLDYLRQIMLVNSGSESSLELTADEKKALQKVSGITNLENITKAIKAFSQLD
FT                   FSSDTASSLSFELALIDASLDKNTVPLPNKPKDEIPAVKADKPAPLEAPKTAASNNIPT
FT                   KEPKTETLTKPNTSAETAATPKPHTKESAPKLTRAAIPIEEKPKYTAPAPPKEEEKVLI
FT                   GAGDIIEQLKVSWKSILDQAPDNLKRSAAVAILRSAGVRPVSMDKNIVTLSFKYKYHKD
FT                   KIEELENRKVTAELISNFVGKTCTLVCISEAETNHLVKQAQKLGAQIISVEEK"
FT   gene            complement(545860..546111)
FT                   /locus_tag="DehaBAV1_0560"
FT   CDS_pept        complement(545860..546111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17145"
FT                   /protein_id="ABQ17145.1"
FT                   /translation="MFEIYYLYNCELNKEYRVQAEDYHRLHPARPASPRRPLMLRLGEY
FT                   MVNTGNRIIGHITTQPIPDTEDRSPVYRNKTVKTQTLL"
FT   gene            complement(546142..546564)
FT                   /locus_tag="DehaBAV1_0561"
FT   CDS_pept        complement(546142..546564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17146"
FT                   /protein_id="ABQ17146.1"
FT                   /translation="MSENTKKILQMLSEGKITVDEANKLLGALGNEGEKPGSIATATPK
FT                   GSPKYLRVIINGTDEDKNAKVNVRVPMALLRAGIKLASILPADATNEIDHNLKGKGVNF
FT                   DFKNLREEDIEPLIEAMTEMEVDVDSEGSKVKVFTE"
FT   gene            complement(546580..546864)
FT                   /locus_tag="DehaBAV1_0562"
FT   CDS_pept        complement(546580..546864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17147"
FT                   /protein_id="ABQ17147.1"
FT                   /translation="MYWPPMLLWVGIPFGKHGRSFPLILPLFLVYPIVLALMIVLAPFM
FT                   LLAILLAWASGRGRFLLLIGPYFYRVWCALRGINADIQDKNTHIKIQFI"
FT   gene            complement(546864..547238)
FT                   /locus_tag="DehaBAV1_0563"
FT   CDS_pept        complement(546864..547238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0563"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17148"
FT                   /protein_id="ABQ17148.1"
FT                   /translation="MVKDWQELTKLTQGAPVTVERVKLVSSGIAIEGSFDLPNLARLPA
FT                   EDQVFVMAFVKCHGSIKDMEKFFGISYPTVKNRLQRIGANFNFIENFPAPPKTNEDDNV
FT                   LTELEKGGISVEEALRRLQR"
FT   gene            complement(547445..548623)
FT                   /locus_tag="DehaBAV1_0564"
FT   CDS_pept        complement(547445..548623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0564"
FT                   /product="Tubulin/FtsZ, GTPase"
FT                   /note="PFAM: Tubulin/FtsZ, GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17149"
FT                   /protein_id="ABQ17149.1"
FT                   /translation="MKLIVIGLGQCGSRIADEFARMDKRARSQRNVSICPGVFAVNTDQ
FT                   ADLSGLVTIKPDHQHRILIGGRKTGGHGVGKINELGAEIARADADKVIDALRTTKRFYD
FT                   ADGFLVIAGAAGGTGSGAVSIIAQHIKERYMDKPVYALIAMPFEHEEKTEERTVYNTAV
FT                   CLKSISSVADAVILVENQRYVRKDFSLRYNLSKINSLIVEPFWDLLCAGEEKNAKYIGA
FT                   KTMDAGDIIQTISGWTVIGHGKARVRTLTLPFDKTDHFRMKSVSNYKGIRAMDEAVSEL
FT                   SLKIDPRDAGRALFLISAPAKEINMDIIKEQGDWLREMAPNAIIRNGDYPREKDTMTVT
FT                   VIFSELSDLERVRYYYNRSTSMMPIIKQRQSDLADRRRDIDELSRDIPSLLE"
FT   gene            complement(548711..549718)
FT                   /locus_tag="DehaBAV1_0565"
FT   CDS_pept        complement(548711..549718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0565"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /note="TIGRFAM: glyceraldehyde-3-phosphate dehydrogenase,
FT                   type I; PFAM: glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17150"
FT                   /protein_id="ABQ17150.1"
FT                   /translation="MVTRIGINGFGRIGRITLRTINQYHRGELEVVAVNDLADNKSNAH
FT                   LLKWDSTYGKYAGTVESDDCSIIVDGKPIRVFSERDPMQIPWETAGVDLVIESTGLFTD
FT                   ASKAAAHLRGSVKTVVISAPAKGEDITIVMGVNEDKYNCNTHRIISNASCTTNCVAPLI
FT                   KVLHDKFGVKKGFMTTCHAYTNDQKIQDMFHKDIRRARAAAVNVIPTTTGAAKAVALVL
FT                   PELKGKLDGISFRIPSASVSLVDFVGELARDVTVEEVNASFKEASQGKLSGILEYCEEE
FT                   LVSSDFKGNPASSIIDAPSTMVLGGNMVKVLSWYDNEWGYSTRLGDLIAYIAKK"
FT   gene            complement(549740..550759)
FT                   /locus_tag="DehaBAV1_0566"
FT   CDS_pept        complement(549740..550759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0566"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase, D-component"
FT                   /note="PFAM: 2-hydroxyglutaryl-CoA dehydratase,
FT                   D-component"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17151"
FT                   /protein_id="ABQ17151.1"
FT                   /translation="MKNNGQNKYIGITTTVPIEILLSAGYSPLDLNNIFVSDPKSDRLI
FT                   RLAEKDGFPLNCCAWIKGIYGVCLDKGISEVICVTSGDCSNTQMLREVLNLKGIRTIPF
FT                   DFPTEPDPAEVKASLAKLALRLSTTLEAADEWRKRLLPARELVHKLDYLCYADNKVSGF
FT                   ENHYWLVSSSDFNGDYVKYQAELQKLLDTVQTRTPYPATELRLAYLGVPSVFGEELYPY
FT                   LEQNGARVVFNEIQRQFSLPNGGADISQSYTAYTYPYPMEYRLRDIQTQLAERKIDGII
FT                   HYVQAFCHRAIGDIILRQKLPLPILTLEGNADFGLNQHQKTRLEAFLDMLKAKKQMNL"
FT   gene            complement(550756..551574)
FT                   /locus_tag="DehaBAV1_0567"
FT   CDS_pept        complement(550756..551574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17152"
FT                   /protein_id="ABQ17152.1"
FT                   /translation="MSLPGQTGTNFKQPDKWDCYKFECLSDFLGEYAKSVRQPTGYLEA
FT                   FAGSNQSVCAGINCPREACHILKGKESFFNQIVLLAQSETALAALRKPLLPARADVLSG
FT                   SLINEETLQKVLDSFPRSEAVFILLEPPGFHHLRFSSLKKLALRGIDKDGRKPDMLLVL
FT                   PLEMSLIRNLGRLDCQDSISRFFGHDKWIDIRQDWYTKRINTEEARKRLLRLYLAGFKD
FT                   MGYKHVVHKEPANAGSPARYQLAVVSDRINFKNILDTIWDKERFLSCELF"
FT   gene            complement(551590..552876)
FT                   /locus_tag="DehaBAV1_0568"
FT   CDS_pept        complement(551590..552876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0568"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17153"
FT                   /db_xref="GOA:A5FRM5"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRM5"
FT                   /protein_id="ABQ17153.1"
FT                   /translation="MSAVVKSIKAREILDSRGNPTVEADVVLSDGSFGRAAVPSGASTG
FT                   SHEAVELRDGDKSRYNGLGVHKAVANVNTTIASAISGFKASDQQRLDNLLIELDGTPNK
FT                   AKLGANAMLATSLAVAHAAAASRHMPLYRYLNNSEEYILPVPMFNILNGGKHASNSTDF
FT                   QEFMVMPVGAKSFAQALQMGTEVYHSLKKVLKGMNQNTTVGDEGGFAPSLPTNKDAVEV
FT                   ILKAIEKAGYRPGEDIFIALDPASSELYQDGKYTLATENKTLSSAEMVDYWCGWVEKYP
FT                   IISIEDGLFEDDWDGWKLLTRKIGNKVQLVGDDFYVTNIKRLDRGIKEKASNSILIKLN
FT                   QIGTLSETIAAIKMANNAGWTAVVSHRSGETEDTTIADLAVAMNAGQIKTGAPCRSERT
FT                   AKYNRLLRIEEELGGKAKYPGKDAFLNLK"
FT   gene            complement(552895..553383)
FT                   /locus_tag="DehaBAV1_0569"
FT   CDS_pept        complement(552895..553383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0569"
FT                   /product="Rossmann fold nucleotide-binding protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17154"
FT                   /protein_id="ABQ17154.1"
FT                   /translation="MPSMKNKHIFVAVIGASKANSEEARLAEEVGKELALRQVTLVCGG
FT                   MGGVMEAACRGASLNGGLTIGILPGNSREEANPYVQIPIVSSIGFARNIMVVKSAQAVI
FT                   AIGGAYGTLSEIAYALQIELPVIALNSWSMSQNGKSDSAVIKAENALEAVTKALDLIN"
FT   sig_peptide     complement(553318..553383)
FT                   /locus_tag="DehaBAV1_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.693) with cleavage site probability 0.689 at
FT                   residue 22"
FT   gene            complement(553422..553991)
FT                   /locus_tag="DehaBAV1_0570"
FT   CDS_pept        complement(553422..553991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0570"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17155"
FT                   /db_xref="GOA:A5FRL3"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRL3"
FT                   /protein_id="ABQ17155.1"
FT                   /translation="MKLIIGLGNPGKEYSGNRHNVGFQCLSRFAKENHISFDKKCCLSR
FT                   TGSGRINDEEIVLAKPQTYMNLSGKAVNQLLRRYNLKAADIIVVQDDLDLPAGKLRLRL
FT                   GGSAGGHNGVSSIITDIGTKEFIRLKIGIGKPDARNNGAEVVDHVLGNFGGEEREIIET
FT                   AIARAAEALACLITSGLDTASNRFNC"
FT   gene            complement(553991..556033)
FT                   /locus_tag="DehaBAV1_0571"
FT   CDS_pept        complement(553991..556033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0571"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="TIGRFAM: DNA ligase, NAD-dependent; PFAM: BRCT
FT                   domain protein; zinc-finger, NAD-dependent DNA ligase
FT                   C4-type; NAD-dependent DNA ligase, OB-fold; NAD-dependent
FT                   DNA ligase, adenylation; SMART: Helix-hairpin-helix
FT                   DNA-binding, class 1; NAD-dependent DNA ligase-like"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17156"
FT                   /db_xref="GOA:A5FRL4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRL4"
FT                   /protein_id="ABQ17156.1"
FT                   /translation="MEDMFSPLIEVENLRREINRHNQLYYVQDNPEISDAQYDTLIRRL
FT                   KELEEAHPELVTPDSPTQRVGAEPLKAFGIVNHPYPLLSLANAFSDTELEAWYQRVKKL
FT                   LGNIPFQIDCEPKMDGLAVALTYRNGKFATGATRGDGFQGENITRNLRTIHSIPLNAEP
FT                   NAPPVFEVRGEVYLSKNGFAKLNRERADKGLPLFANPRNAAAGSLRQLDPSVTAERPLD
FT                   IFIYALGYSEDSLLPDSHWQILDYFSKIGFRINPLNRLVNTLEEAKEYYRQMAANRASL
FT                   PYEADGVVFKVDSVSLQHRLGDVGREPRWAIAYKFPAEQVMTRLKKIGISVGRTGTLNP
FT                   FAVLEPVNVGGVVVKQAALHNEDDILRKDIREGDTVIIQRAGEVIPEVVAPVLSKRNPE
FT                   SKPFRMEESLFNPNLNRTACPVCGGEIYRPAGEAMHYCANVSCPAQFERQLEHFVSRGA
FT                   MDIRGIGESLSVILAQQGLVKNVSDLYYLTTADLLQLPRMGEKSADNIIDAIADSKTRP
FT                   LDRVIFGLGVRHVGNETATLLSRHYGNIWALAKTGLGELQTIPDIGDKIASSIVAYFSE
FT                   EKNVAVIRRLEEAGVRLTSDQKPVNKNMPFSGMEFVVTGKLESFSREEAQEKIRSLGGT
FT                   AKDNVTKATNYLVVGADAGSKLTKARSMGVKELSEREFINMLEQS"
FT   gene            556169..557497
FT                   /locus_tag="DehaBAV1_0572"
FT   CDS_pept        556169..557497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0572"
FT                   /product="uncharacterized conserved protein UCP033563"
FT                   /note="PFAM: uncharacterised conserved protein UCP033563"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17157"
FT                   /protein_id="ABQ17157.1"
FT                   /translation="MAEVRAFHGLRYNPMFVDDMADVICPPYDIISPEQEKALKERSPY
FT                   NYIRLEYSQPTPQDNIVDNRYTRAAAILEKWIGERVMTAEKKAAIYIHDHYFSVFGKQY
FT                   KRRGIIARVRLEEWDRMVIRPHEGTLAEPKRDRINLISAVRANTSPVYGLYQDTEKDIN
FT                   RVLEIQTGGKPTVSMNIEGERHELWVVTDESAISKVTALFDKKPVYIADGHHRYESALT
FT                   YRRERLAGNPQLPSDDPVNFVMMTLVDFADPGLVVLPAHRLLGGMDARTLSNLQTKLAS
FT                   FFDVTTIPAKLPAAWDTLDKAFKEEGKIRLVMYGLGGTENFTILTLRDLETASKLMPYF
FT                   HSDIYKKLDVSILDHIILEELMGLKTVEDPRIAFNFDRNDVVSRIKSGEFQLAFILKPM
FT                   KAEVIKAISDVSDRMPRKSTYFFPKLPSGLVVYRFESEAIAKK"
FT   gene            complement(557568..558155)
FT                   /locus_tag="DehaBAV1_0573"
FT   CDS_pept        complement(557568..558155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0573"
FT                   /product="pyridoxal phosphate synthase yaaE subunit"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17158"
FT                   /db_xref="GOA:A5FRL6"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRL6"
FT                   /protein_id="ABQ17158.1"
FT                   /translation="MKIGVLALQGAFREHLNMLGTLGAEAVEVRKAEELPELSGLIIPG
FT                   GESTTITKLLDIFGMAEPIKALAKKGMPIWGTCAGMICLAKELPGDISGVKPLGLMDIT
FT                   VRRNAFGRQVNSFEAMLKVKGLDKADFPAVFIRAPLVEKTGKGVEILSKLPDGTIVAVR
FT                   ENNLLAISFHPELSGDNRFHRYFVQMAKTYKA"
FT   gene            complement(558230..559810)
FT                   /locus_tag="DehaBAV1_0574"
FT   CDS_pept        complement(558230..559810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0574"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="TIGRFAM: D-3-phosphoglycerate dehydrogenase; PFAM:
FT                   amino acid-binding ACT domain protein; D-isomer specific
FT                   2-hydroxyacid dehydrogenase, catalytic region; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17159"
FT                   /protein_id="ABQ17159.1"
FT                   /translation="MKKVLVSDALSATGLAPLKEIAQVDVKTGLKPEELISIIGEYDAL
FT                   LVRSQTQVTADIINAGKKLQVIGRAGVGVDNIDLKAATGNGIIVVNAPTGNTISATEHT
FT                   LALMLAMARHIPRANASLKSGQWKRNEFVGSELKGKTLGIVGLGNIGSEIAKRALALEM
FT                   RVIGYDPFISMERAKKLQVELLPFEDLLKQADFITLHVPMTGQTKGLIGPKELEMMKPT
FT                   VRLINTSRGGIIDEEALAKAVKEKRIGGAAIDVFSKEPCTESCLFECDNIIVTPHLGAS
FT                   TAEAQELATSDVVKQVIDVFEGRPARYAVNAPYISAESLPVVGPFMPVARTVGSLVSQL
FT                   TDGHMKNVTIKYCGELAAYDTTALKALVLGGILEHISEERVNVVNADIVASQRGLGVTE
FT                   QKESTCQNFSSLITVTIDTDNGKSNTVAGSLVRGDVHIVKLNDYWIDIVPTGGYFLFAD
FT                   HIDRPGLIGSAGKITGDADINISYMHLSRQKARGQALMILALDEPLPEKQRQQLLSLPD
FT                   VQMVQVVKI"
FT   gene            complement(559812..560900)
FT                   /locus_tag="DehaBAV1_0575"
FT   CDS_pept        complement(559812..560900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0575"
FT                   /product="phosphoserine aminotransferase apoenzyme /
FT                   L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.52"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17160"
FT                   /protein_id="ABQ17160.1"
FT                   /translation="MQNLRIPGPTPCPEEVLKAMGQQMINHRGPEMAAIMKEVAEKLKY
FT                   FFQTKNDVLVLTGSGTGGLEAAAVNFLSPGDTVLSVSIGVFGERFAKIASIFGAKIIAL
FT                   NFEQGKAADPALVKKALTEHPEIKAVLVTHNETSTGITNDLKPLASVIKGAGKLLLVDA
FT                   ISSLSSINLPVDEWGCDVVVSGSQKGWMVPPGLAFISVSPEAWKANAESKMPRFYWDLA
FT                   KHKASIEKGQTPWTPCVSVIVALHTALIMMEKEGMQNIFKRHQKIADFTRKGVKELGLT
FT                   LLAEEKYASNTVTAIVATEGLDVKKLLKIMREEYNTVLAGGQGPLEGKIFRIGHLGWVT
FT                   ENDIKVTLDNLKLALPKAGFRS"
FT   gene            complement(560960..562150)
FT                   /locus_tag="DehaBAV1_0576"
FT   CDS_pept        complement(560960..562150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0576"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib; RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17161"
FT                   /protein_id="ABQ17161.1"
FT                   /translation="MNQSENQIDQILKRGVAEVIVEEDFKKLLLSGRKLRLKEGFDPSS
FT                   PDIHLGHMVALRKLRQLQDLGHQVVLIVGDWTAQIGDPSGASVTRPMLSAEQVKANAKT
FT                   YLEQFFKIVDKDKTEVRWQSEWYGNFKLEDVVRLSSKFTVAQMLARDDFAKRYAAGKPI
FT                   SVTELLYPMLQAYDSVMVKSDVEFGGTDQKFNLLVGRELQEMVGQKPQQVLMVPILVGT
FT                   DGVHKMSKSLGNYIGVAEDPSEIFGKCMSIPDELILQYFELVTDIPDQEIADFKAQMEN
FT                   GQVNPMILKKRLASELLTQLYNATAAQEADARFTRVVQRGEIPEDMPECRLENGQNTGV
FT                   IDFIILSGLAKSKSEARRLLEQGAVEINSEKISDQNTPVKCGDIIKAGKRRYSKAI"
FT   gene            complement(562157..563074)
FT                   /locus_tag="DehaBAV1_0577"
FT   CDS_pept        complement(562157..563074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0577"
FT                   /product="riboflavin kinase / FMN adenylyltransferase"
FT                   /EC_number="2.7.1.26"
FT                   /EC_number="2.7.7.2"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   Riboflavin kinase / FAD synthetase; cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17162"
FT                   /protein_id="ABQ17162.1"
FT                   /translation="MTLLEEELILHASDQDTLITIGVFDGVHLGHQHLINELKKQAKER
FT                   NLQSCLITFKDHPSKVLGQDDIKLILSLEERNLALEQMGLDRIIMLSFTPEIAEICATD
FT                   FVGYLLDHLHMQGIVVGSDFALGRNRAGDATALRRLSHIMDFSVSVVSPVVIENQIVSS
FT                   TAIRQALRTGNVTKARLMLGRNYHLRGTVQSGANRGTKLGFPTANLTLPGYLALPADGV
FT                   YAAKAFLAEKEYKAVANIGSCPTFGQEEHRLEVHLLDFKGDIKGQTLKVEFVEFLRSEV
FT                   CFANAEALKAQISVDILKARDILR"
FT   gene            563580..567302
FT                   /locus_tag="DehaBAV1_0578"
FT   CDS_pept        563580..567302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0578"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase Rpb2,
FT                   domain 7; RNA polymerase Rpb2, domain 2; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2, domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17163"
FT                   /db_xref="GOA:A5FRK5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRK5"
FT                   /protein_id="ABQ17163.1"
FT                   /translation="MQLQSFVWFQEEGLRELIEEISPIKDFVGNRLELEFIGYEFREPR
FT                   LSEYECTQRDQTYSVPLYVKARLIVKTTGEIKEPFDLFFGDIPLMTALGTFITSGTERV
FT                   VVSQLLRSPGVYFTISDDPATGRPLCHTNLIPSRGAWLEFETSNRDVISVKIDGRRKIP
FT                   VSTLLRAIGYSDDLDILNLFEVIDNDPERHYIQSSIDRDPLIKDEISALIDIYSRLRPG
FT                   DPPNADNARKLINEMFFDPQHYDLGKVGRYKVNRRLELPSREVGENRALTREDIVAIIQ
FT                   RIIMVNNGQDTPDDIDHLGNRRIRTVGELVQNQFRIGLVRLERVARERMSIVNLEMVTP
FT                   SALVNIRPVVSAVKEFFGGSQLSQFMDQTNPLAEITNKRRLSAMGPGGLSRERAGFDVR
FT                   DVHYSHYGRICPIETPEGPNIGLIGSLATYSRINRYGFVETPYRKVYSKLKNNDKKLVG
FT                   LKLKTEISEKGKVLAAAGSTISEDSFKIISKLPECDISVMPFVSAEVKYMPADEEDRYI
FT                   IAQANTRLDEKGYFLDDRIEARSAERYVVEPPDKIDYMDVSPKQIFSVAASLIPFLEHD
FT                   DANRALMGANMQRQAVPLLRAEAPMVATGMEREAARYSGQVIFAKHAGVASSVTSEKII
FT                   IRTAEGGHDEYLLKKFVRTNQGTCINQHAIINKGQKIAAGQVLADSSATENGELALGQN
FT                   CVVAFMSWQGFNYEDAIILSERLVREDAFTSIHITKHELEARDTKLGVEEITRDIPNVG
FT                   EESLRELDEDGIIRIGAEVGPDDILVGKITPKGETELSAEEKLLRAIFGEKAREVKDTS
FT                   LRMPHGEWGKVINVRIFSRDSGDDLPARVNKWVQVWVAQKRKVSVGDKLAGRHGNKGVI
FT                   SIIAPVEDMPYLPDGTPVDVVLNPIGVPSRMNLGQILETHLGWAGHLLGFRVATPVFDG
FT                   ADDTVIEDALARSWLSAKAGAIDMSPENKRPSADAHKAIEWIKQQGFDGKKIFDEKHPG
FT                   LAKEVSLKLWLKDMGVDASALSGAELEKKAYDVSSQSRLPSPIVGKSVLRDGRTGETFD
FT                   QPVTVGNMYILKLIHLVEDKVHARATGPYSLISQQPLGGKAQFGGQRFGEMEVWAMYAY
FT                   GTAHNLQEMLTIKSDDIAGRAKAYESIVKGEDVLQPGVPESFKVLVKELQSLGLAVEVI
FT                   NEEVKIAPSEKVSSLNEGNLPASDEISAEILPETLYANTEDISEDSMMSVIDADDQDLV
FT                   VSSNDEEVSENDERS"
FT   gene            567403..571176
FT                   /locus_tag="DehaBAV1_0579"
FT   CDS_pept        567403..571176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0579"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase, alpha subunit; RNA polymerase Rpb1,
FT                   domain 3; RNA polymerase Rpb1, domain 1; RNA polymerase
FT                   Rpb1, domain 5; RNA polymerase Rpb1, domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17164"
FT                   /db_xref="GOA:A5FRK6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRK6"
FT                   /protein_id="ABQ17164.1"
FT                   /translation="MKPERDGLFCERIFGPIKDFECACGKYKRIRYKGIICDKCGVEIA
FT                   RAKVRRERMGHIELACPVGHIWFTRGIPSRVGLLLNLSTRSLERIIYYSHFIITAVNDE
FT                   ARAKAIKDLEVISSQRVADKGSEVDTRVAQMEAEDATVEAINQIRRDFSTEREQMEEDI
FT                   QLLIDQLKDLQKGNLLTENQYYELKQRFSNVFEASMGAEALLKLLSYIDMDKERSKLIQ
FT                   ETRSTSGQRRKKAGKQLQLVEAFRRSSNKPEWMIMTVLPVLPPDLRPMVQLDGGRFATS
FT                   DLNDLYRRVINRNNRLQHLMEIGAPEIIIRNEKRMLQEAVDSLIDNGRRGKSVAVNGDH
FT                   KAKSLSDLLRGKQGRFRQNLLGKRVDYSGRSVIVVGPSLKLSQCGLPRRMALELFKPFV
FT                   MHRLVRDGLAPNIKSARRLVERARPEVYDILEEVVKDRPVLLNRAPTLHRLSIQAFEPV
FT                   LIDGSALRLHPLVCSAFNADFDGDQMAVHVPLSKAAVKEARETMLSIHNMMLPSSGEPV
FT                   VSPSLDMVFGCYYLTTTRPGAKGEGKIFGDFEEAKRYYEMGIIDLRAIIKVRDGKGNML
FT                   ETTTGRIIFNDVLPKAVEFQNMDIPKSAIKKIIGRCYKILSSQDMAVMLDKIKELGFKF
FT                   ATSSGISIAMSDISVPREKTKLVAAADERTAIAEGQFARGLITEDERYNSIIETWMETT
FT                   DRITDAIQAGFDKQGSVYMMANSGAKGNISQIRQMAGLRGLMTNPSGRIIDFPIKSSLR
FT                   EGLTALEYFISTHGARKGLADTALRTSGSGYLTRRLIDVTQDVIILQEDCGTANGTWII
FT                   EPKEKGMLPPLVDRILGRWTAHNVVHPQTGEIIVDNNEEIDEIKAKAIGEAGITEVFVR
FT                   SPLTCESTHGMCRRCYGRDLGRVRLVDMNTAVGIIAAQSIGEPGTQLTLRTFHTGGVVG
FT                   VDITTGLPRVEELFEARPPKVQSIISEIDGVVEVIENENGRHIRIASDEVYQDEYELPS
FT                   GWKTQVQSRQWVDSGMVLASPELEGKSKAVVQSDQNVVARVAGEVTIEGNLITIKYSES
FT                   EEREYTIPAAMQIKVKTGDTIRAGQQLTDGSINPQDILSILGRDAVQKYLVEEVQKVYY
FT                   SQGVHINDKHIEVIARQMLIKVRIDSSGDTDLVPGELVDKFRYEDINAKVLAEGGEPAT
FT                   AHTVLMGITRASLSTESWLAAASFQETTRVLTDAAIYGRVDKLSGLKENVIIGKLIPAQ
FT                   CKSCKEATIERAERIAAAASAPAMSGLPENCL"
FT   gene            571383..572432
FT                   /locus_tag="DehaBAV1_0580"
FT   CDS_pept        571383..572432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0580"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase, central domain protein; Holliday junction DNA
FT                   helicase RuvB, C-terminal domain; Holliday junction DNA
FT                   helicase RuvB, N-terminal domain; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17165"
FT                   /db_xref="GOA:A5FRK7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRK7"
FT                   /protein_id="ABQ17165.1"
FT                   /translation="MSQEKERLISGKLVTDDAKLDTSLRPRCLPDFIGQKRLKDNLGVA
FT                   IQAAKQRGEALDHVLLYGPPGLGKTTLSHIIALEMGVNIRITSGPAIERQGDLAAILTN
FT                   LKPFDILFIDEIHRLSRNVEEVLYPAMEDYALDIMVGKGPGARSLRLKLPHFTLIGATT
FT                   RYAMLSAPLRDRFGSIFRLDFYDEEAIHDIVRRSARILGVEADENGLHQIACRSRGTPR
FT                   VANRLLRRVRDYAQVKGNGLITADIAAESLACLEVDKLGLDEIDHKVLKTIIHKFGGGP
FT                   VGLETIAAAISEEADTIMDVYEPYLLQLGFLERTPRGRQATRLAYQHLSIPYQNDKNNQ
FT                   QGLWTENGS"
FT   gene            572422..572970
FT                   /locus_tag="DehaBAV1_0581"
FT   CDS_pept        572422..572970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0581"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17166"
FT                   /protein_id="ABQ17166.1"
FT                   /translation="MAAKLLLHGCCAHCTAYSFKYWQEQGFEVSVYWYNPNIHPFTEHQ
FT                   NRLEAMVKLSQELSFELVTEPLYQMAEYFKKVAEKPDERCRTCFDMRLGQTAVYAARYG
FT                   YEYFSSSLFISPHQKHQEAVFSAEAFAKETGVKFAYADLRKRYSDSRHITKPLDLYRQQ
FT                   YCGCIYSEYERFGKTDPPA"
FT   gene            573047..573688
FT                   /locus_tag="DehaBAV1_0582"
FT   CDS_pept        573047..573688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0582"
FT                   /product="[SSU ribosomal protein S18P]-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17167"
FT                   /protein_id="ABQ17167.1"
FT                   /translation="MVYFIRPIKDEDIPELNQIDREAFPTMWPATNFKREMENIMAHYM
FT                   VLVDGDSSNQAGPKTNINIWKWLWNCIYHDSTILQPVADHPKVIGYGAIWVMAGSAHLV
FT                   SVAVREAYRRKGFGELLLISSLKEAIKHKCFEMTLEVRVSNIVAQNLYLKYGFAIKGIR
FT                   KKYYLDNHEDALIMTLDSIDSPDFPAKLEGYKNSHTRKWKTTPGMAELAS"
FT   gene            complement(573705..573932)
FT                   /locus_tag="DehaBAV1_0583"
FT   CDS_pept        complement(573705..573932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17168"
FT                   /protein_id="ABQ17168.1"
FT                   /translation="MMAKIPCPDCGVIGSFSLADEVYEGPYKCWKCRKLYKILIERGAV
FT                   KLCEPIDEMEFERLKSLGDLKRKSRGGDEE"
FT   gene            complement(573997..574536)
FT                   /locus_tag="DehaBAV1_0584"
FT   CDS_pept        complement(573997..574536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17169"
FT                   /protein_id="ABQ17169.1"
FT                   /translation="MASNSCERGSRPSMIIPTLILAVIAVVVSIIAYNKNGAHVEGFKA
FT                   AWDIFIQVLPMMVLAFVIAGMLRVIIPEETVSQWLGQESGFKGVLIGTAVGGLMPGGPY
FT                   SCMPIAAGLLGGGAGAGTMVAFMTGWSLLAVNRLPLEIGMLGWKFALIRLAVTALMPLA
FT                   AGMLANALFSKVNLLE"
FT   gene            complement(574565..575239)
FT                   /locus_tag="DehaBAV1_0585"
FT   CDS_pept        complement(574565..575239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0585"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17170"
FT                   /protein_id="ABQ17170.1"
FT                   /translation="MNEQNFTSQSQVFDRIAAGWYSFRHRSIFSRELSALAAKWQTGKL
FT                   LNAGCGCGADFIPFKDSFELYGIDFSAEMINQAGKYARKHGFKPNLAVADMQNLPFEDA
FT                   EFDWLIAVASFHHLKGQDSQLKALQEFGRVLEDDGQIFLTVWNRLQPRFWFKGRETLVS
FT                   WKSQDQILKRYYRLYTCWEIEALVKKAGFRVVSSSGEKSHRGPKYFARNICLLLEKQTL
FT                   KK"
FT   gene            575283..576662
FT                   /locus_tag="DehaBAV1_0586"
FT   CDS_pept        575283..576662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0586"
FT                   /product="histone acetyltransferase, ELP3 family"
FT                   /EC_number="2.3.1.48"
FT                   /note="TIGRFAM: histone acetyltransferase, ELP3 family;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17171"
FT                   /protein_id="ABQ17171.1"
FT                   /translation="MKKLSRTISGVTPVAVMTKPLPCPGKCIYCPTFAATPQSYTPESP
FT                   AVLRAKSCEYQAYKQVALRLRIIQDMGHPTDKVELIIMGGTFLSADITYQYGFIKDCYD
FT                   ALNGVVAGSLEEAKTINETAQHRCVGLCIETRPDICGKAEIQRMIDFGTTRVELGVQML
FT                   DDDIYKLVERGHTVADVAEATCLLREYGLKVHYHWMPGLPGSSPEKDLALSRMVFEDPR
FT                   FCPDGLKLYPTMVVEGTILEQWWKEGRYTPYPNGTMTGLIADIKALVPPYVRISRVLRD
FT                   IPAVFISAGLKDSLRDGVRQILESRHQKCRCIRCREYGHRQRKGQTSGEPTLRRLDYPD
FT                   SGGKEIFLSFEDASDTLYGLLRLRIPCASLPVLGQKYGAKTGLVRELHVYGTELSLGEQ
FT                   GDQSAQHRGLGRKLLAEAECLARDEFGLDSLAILSGVGAREYYRSLGYELVAGYMCKHL
FT                   D"
FT   gene            576878..577816
FT                   /locus_tag="DehaBAV1_0587"
FT   CDS_pept        576878..577816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0587"
FT                   /product="F420-non-reducing hydrogenase subunit G"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase, 20 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17172"
FT                   /protein_id="ABQ17172.1"
FT                   /translation="MVRVAEEWFAVCGGCELSLLDIGEPLLDVLPHLEIVHMPVLMDHK
FT                   LLGQCGDGKKLEIPEADLGIITGGIRNEENRELALEMRKKCKIIVALGTCACFGGIPAL
FT                   ANLSTTEEMMEQIYSKEKGTEKSDSPSDKSLPKMLDRVYAVDEMIKVDIHLPGCPPTPT
FT                   HIAELLGAVLEGKSFALPERSVCDTCPTIREKQSTGGPIKRSLQNAQFTPGRYDNMRCL
FT                   NEQGLFCLGPVTKAGCNRILGADPSEEIPRCIKAYMPCRGCFGPIRQGSNPTADMMGSL
FT                   SYIGRDPKEIVDRVATINRFIGSGRLRPQDK"
FT   gene            577848..579287
FT                   /locus_tag="DehaBAV1_0588"
FT   CDS_pept        577848..579287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0588"
FT                   /product="F420-non-reducing hydrogenase subunit A"
FT                   /note="PFAM: nickel-dependent hydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17173"
FT                   /protein_id="ABQ17173.1"
FT                   /translation="MKQITIQPVTRIEGAAKVVISLDDSGNVSDARMHIIELRGFEKFC
FT                   IGRPVEEMPRITPRICGVCPLSHHLCSAKACDSVFGVTPPSAGRKLRELANATAYLEEH
FT                   ILHFFFLAGADLVMGPGENYSMRNVFGIAQKMPELGQKVIRSRHLASKMLDYLLGKDIH
FT                   PVAAVAGGFSKPLTETEREKMMEMAKELLEFSKFSIAYAKENLFSKYEGLIKEIGVIKT
FT                   GFLGTVDKNGALNQYDGNLRLMRPDGKFTEFAPKDYLDHITERVEDWSYAKFPYAKELG
FT                   EFNMDLDNPSGIFRVNTLARINACDRIATPLAQKELEEFRAKFGRPAQQSLLFNWARLI
FT                   ELLYNAERVIELLSDPEITSTNTRVPVTPKAGRGVGCVEAPRGTLIHDYTTDENGLVTD
FT                   ANLVVATVMNNAAINMSVKQAAQTLIKGGKYNETILDEIEMVIRAYDPCLSCSTHELNG
FT                   KVAVRLDIVDANGQLVQTYSN"
FT   gene            579290..579793
FT                   /locus_tag="DehaBAV1_0589"
FT   CDS_pept        579290..579793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0589"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   peptidase M52, hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17174"
FT                   /protein_id="ABQ17174.1"
FT                   /translation="MDYLPEYCSRPVVVFGCGNILYGDDGFGPAVADYLNTHSRVPSFA
FT                   CVMDVGTAIRELLFNIIISDTKPKVIVLVDAMETGLGVGEMGLLTVDQVSPEKINDFSL
FT                   HLMPTLNMLKELHADGGVRIDVLAVKPEYIPPEMEQGLTGKVQKAVAETARYIVDTYFS
FT                   QPLL"
FT   gene            complement(579790..580095)
FT                   /locus_tag="DehaBAV1_0590"
FT   CDS_pept        complement(579790..580095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17175"
FT                   /protein_id="ABQ17175.1"
FT                   /translation="MTDILNEASNIAQCKECPWYRACTTPMRYTSEDIRRQVQNGGPGM
FT                   NAPQDEAAMQQMLSMASAAQNSMLEACPIFIERLRNNPKLGQKLKEMMQNWSQEIN"
FT   gene            complement(580113..580652)
FT                   /locus_tag="DehaBAV1_0591"
FT   CDS_pept        complement(580113..580652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0591"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17176"
FT                   /protein_id="ABQ17176.1"
FT                   /translation="MKSKFIALSFLLLSSLCLSACSQTTPVPADNGEQPVAGIKINNLA
FT                   PDFSLKNLTGQEIRLSNLQGSGVILNFWKISCSYCKQEMPFFEAAYLKNKTLPSGIKIL
FT                   MVNITENKSLIEQFLKDNRFTFPVLLDTTGATGQTYNANYIPITYFINAEGIIKAIKFG
FT                   AFSSQTDFDNQLNKIN"
FT   sig_peptide     complement(580584..580652)
FT                   /locus_tag="DehaBAV1_0591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.816 at
FT                   residue 23"
FT   gene            complement(580654..581376)
FT                   /locus_tag="DehaBAV1_0592"
FT   CDS_pept        complement(580654..581376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0592"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17177"
FT                   /protein_id="ABQ17177.1"
FT                   /translation="MGRCKIGLEDVSYLLALAGGLAAFFSPCVLPMMPIYLASLAGADI
FT                   LDAQPNSITSFKALRHSIAFVAGFSLVFTSLGALSGLGGVIINPSDLWVRILSGGMLVI
FT                   FGTYMLLSLRFPSLSFEKHLASQQNLRTGGYIRSFLSGAVFTLAWTPCISPMLGSILSI
FT                   TFGGESPLYGSALLAVFSLGMGIPFVLLGLLIQKTLPLVHKISRYSAAIYGASGVILIF
FT                   IGILILGNRIGFFSTLQI"
FT   gene            581439..582578
FT                   /locus_tag="DehaBAV1_0593"
FT   CDS_pept        581439..582578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0593"
FT                   /product="RecB family exonuclease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17178"
FT                   /protein_id="ABQ17178.1"
FT                   /translation="MRPLSYSQIDQYQSCPLKYRFLYIDGLKPLEKGYFSFGTTLHDCA
FT                   EHFFRVKVPPPLSLEKLMEYYQSHWRSGGYESVEIEENYRQLGREILAEFHRIHRADFH
FT                   MPLAVEHQYTVNLDGVKLTGKIDRVDKLPSGELCIVDYKSNKDLFSAEYVQDNLQLSLY
FT                   QLAVEQIWYLPVGELCLYHLRSNTAMRCPARSKEVIADARRLVLEVAEKIEKAIFPACE
FT                   NNFCPCDFAHLCPLYRHKYAPPPQLPEASPIDIPLAVEEYVMLQFRKNEIEARIESLKE
FT                   AIIEYCRASSLGRVFGSEHALSYKEVSRSGYNNQAVHDLLEPLGLWDKVSELDKTLLEK
FT                   YLETDACGKELKDRILALKEVVSTSPRLYVKQVSKDKDS"
FT   gene            582599..583087
FT                   /locus_tag="DehaBAV1_0594"
FT   CDS_pept        582599..583087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17179"
FT                   /protein_id="ABQ17179.1"
FT                   /translation="MFFQIIGVFLLALVEIWLAIPIGLIWGLDPWLVILLVIGGTLVGV
FT                   GIIILLAERVRSGSNRWLDKNRTGDATLSLSSLFAQIISALQERLHSGRLYKVWLKYGI
FT                   IGLGILSPVLTSAPIAAFLGVMLSADRLKLFIWISVGVAVWTTGLTLAMHFGLILLGI"
FT   gene            583285..584034
FT                   /locus_tag="DehaBAV1_0595"
FT   CDS_pept        583285..584034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0595"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17180"
FT                   /protein_id="ABQ17180.1"
FT                   /translation="MKVYHLAYEPSYHSMDFHFWTECNLKCRGCYTNYEVYDFGLLDDP
FT                   VAEIITRERQSPPTEFLSFDQVMEKIDGYTIKYAVFLGTEAVLDPELPKLAKAVHEKYG
FT                   SFNILLTNGIRMPDLTDIDQIIFSLKAYSEDIYRDYTSRSNKSALENLKKIHAGLGDRK
FT                   LHVEVVYIPDYIAKDEIEKVAQFLASIDKDMSFRIDAYFPIPGCPWRAANKEEVEEAAV
FT                   VARKYLNNVVVLTLDMKRIGDKAVKVF"
FT   gene            584035..585834
FT                   /locus_tag="DehaBAV1_0596"
FT   CDS_pept        584035..585834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0596"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit, N
FT                   terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17181"
FT                   /protein_id="ABQ17181.1"
FT                   /translation="MTVGFGRQSIPANVRLSTTAKRVLEKRYLKKDDSGRVIETPEDMF
FT                   HRVAKVMASAEHKYAPGTDTSRIEEEFYQAMSRLEFLPNSPTLLNAGRQAGQLSACFVL
FT                   PVEDSIESIFDAVKQTALIHKSGGGTGFSFSDLRPAGDKVGELTEVAGGPVSVINIFAA
FT                   AADYVRQGGVRRGCNTAILDVTHPDILNFISCKGDPNALTNFYISVVVTRDFMTKVRSG
FT                   EDYDIINPHTGEVVRRLNAACVFDCIVDQAWKTGDPGLVFIDRINDDNPTPSIAPIRHV
FT                   SGCGEQTLLPYESCNLGSISLPRMLKRDGERVVVDYEKLGRTVKMAIRFLDNVIDVNKF
FT                   PTPEIEKATLRNRKIGLGVMGFADMLVLMGIPYNSEEAIFQADQIMDFIKETSHRASSK
FT                   LAEVRGSFPAYEGSMYDVPGGRPMRNATCTSIAPTGTLSIIAGVSSGIEPSFAMVFVRN
FT                   ILDGENLLEINPYFEEMARREGFHSRELFEKLVSSNHLHDMECIPDWLKRLLVTAHCIR
FT                   PEWHIRIQAAFQKYTDNAVSKTVNFPHEATRADMANVFNMAYDQGLKGITVYRDGSRAA
FT                   QPLCTSESGVKLVDQYLDNCACH"
FT   gene            complement(585831..586835)
FT                   /locus_tag="DehaBAV1_0597"
FT   CDS_pept        complement(585831..586835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0597"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   response regulator receiver; metal-dependent
FT                   phosphohydrolase, HD sub domain; HDOD; SMART:
FT                   metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17182"
FT                   /protein_id="ABQ17182.1"
FT                   /translation="MITKSETVLTVDDEDTIRRLLYQKITSEGYKCLTASNATEAMEIV
FT                   KNHDIALAILDIKMPGLSGMDILPEIRIVSPDTAVIMATAISDTDTAINCMKLGAYDYV
FT                   TKPFKLDAVIMGMERALEKRRLILENRDYQEHLELKIKDQAEKIRGSFFNAITSLAYAL
FT                   EAKDSYTIGHSQRVAETSVAIAGAMELPFATVEQIRLAGLVHDIGKIGIRSACLNKAGN
FT                   LTEDEYNHIKTHPSVGERILSPITEDHEILKIVRHHHEHFNGRGYPDGLKGEEIPLGAR
FT                   IMALADAYDAMTSLRPYRKAMTDIEAWEELKRCSGIQFDPEIVAVFARMNNHT"
FT   gene            complement(586865..589423)
FT                   /locus_tag="DehaBAV1_0598"
FT   CDS_pept        complement(586865..589423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0598"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17183"
FT                   /protein_id="ABQ17183.1"
FT                   /translation="MQDQYRSCHTSARQNVLPESADLTEILSMIESTRNLVLIFKTSPE
FT                   PQLIYVSSNSASISGYSPEDYLANPTLSQDILKPIGLELNTHTLDRFRIPLGPIPCYIP
FT                   CKKGLPVSAEILCKLSSGRLIFYIQCQHQVRHNANHPDFSDKNLPATPLVMGFQPDGKL
FT                   IFANHIFEEVTGYLVSEVTGEDWKSCGLFSRETTDLIIKMFQDRKPDTGQPFELQLIHK
FT                   NGQTCWFSGHSRIINRDNKSSYLQLSASDITICKKSEKMLRLTRFALEQTTDAIFWTDS
FT                   EGNFVDVNQSACNSLGYRREDLLKLKVTDIDALITNQTDWEAHWKNLKNSAYLSFESIH
FT                   RNISGEEIPVEITANYMQCDKMEYNVAIARNIHLRKEAEKQLKFTSFSVEHTADSVLWV
FT                   NQSGSIIAANMSACQSLGYTRTELCSLNVININPVCVAERWKTLWVRLKQDINFSLESD
FT                   MFTKNGQQIPIEVMCNFLEFEGIDYCCAVLRDITERKKVDARLLRAAEEWRITFDNISD
FT                   IVFLLDNDFNIQRANRAFTKTLNCQPQDVLNKKCYQVLHHADCPKVNCPKLIASDTKKS
FT                   QRIAYFEKNIDKHFEETIDPILDTNGLSMGTVHTIKDVTEQHKITAQLMITDRLASLGE
FT                   LSAGLAHELNNPLTSVIGFSELIQEKILPEDLRQDIQIISQEAQRAAEIIRNLLTFARR
FT                   HEPSKDWVDMNQIIHKVLAICNYGQKVHNIQLITNLDPNLPEIKADYFQMQQVLLNIVI
FT                   NAEYFMTQSHGEGTIVISSRKFNDSIQISIRDDGPGMSENVLNHIFDPFFTTKEVGKGT
FT                   GLGLSIGHGIITQHGGKLYAESSEGKGATFFIEIPINQPD"
FT   gene            complement(589599..589940)
FT                   /locus_tag="DehaBAV1_0599"
FT   CDS_pept        complement(589599..589940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0599"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17184"
FT                   /protein_id="ABQ17184.1"
FT                   /translation="MKYMNDIENTDIFECRRCGNCCLHFQPHLEMAEAQNIADHLSLSL
FT                   DEFKAKYADKRWPGHRTMLIRHNQNGCIFMGHGVDNLSLCTIHDFKPQACRDYQPSFKH
FT                   RECREGLLP"
FT   gene            590013..591278
FT                   /locus_tag="DehaBAV1_0600"
FT   CDS_pept        590013..591278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17185"
FT                   /protein_id="ABQ17185.1"
FT                   /translation="MKMKKDYIIRLIATLVISGVLFFGSATVNKAALEGQLYFSDVIIK
FT                   VGTKLTVYGQNFLRQSNVKLFYDDQEVALGATNQLGEFTLSFIIPPSGRGLHAVKAIDA
FT                   DYNMGSGLVLMESWIELSKNEAAIGETVNIRGTGFTPLTSVSFYYSDTPLIVTPSIVKA
FT                   DLTGSFSVNFAVPERFAGVYLVEVRQGDYINSQSLKANVWLDINPEIGLGKALDVGTEL
FT                   NIHGKGFKPNGQVDLRYDGVSLLVVNIDDKGIFSAQIVIPAGAGISHSLTLDDGQNRIV
FT                   REVWLENTSPSAPVITLPASGEALSYPFTFGWEGVNDASGVEYVFQIASDSGFGSILLE
FT                   IKGIKVSQYILTDNEDINNSPAASFYWRVKAVDGAGNESGWSETGVFDKASLVQNLGLV
FT                   VGVGAGLVAIILFMWWAIRNRR"
FT   sig_peptide     590013..590105
FT                   /locus_tag="DehaBAV1_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.643 at
FT                   residue 31"
FT   gene            591420..592739
FT                   /locus_tag="DehaBAV1_0601"
FT   CDS_pept        591420..592739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0601"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17186"
FT                   /protein_id="ABQ17186.1"
FT                   /translation="MTNTEKIKNKQSDDPLGAGTIENCGKVDDEPPSRPDQTKRFRLKY
FT                   FPKVSDQDWNDWHWQFKNRVTSVAEIARFFHLSAEEYRDMDTVSAVFPLSATPYYLSLV
FT                   DFDNVNDPVKLQLIPDTAELCFDAHCCSDPLEEAHSSVVPGLVHRYPDRVVMVLTDICP
FT                   VLCRHCTRKREWKNGGWVHTQAEIDAMLAYIRQNQAIRDVIISGGDPLTLSTSRLESVL
FT                   SALRSIPHVEIIRIGTRYPVVLPQRIDDELCSMLSKYGPIWLNTHYNHPNEITDESRQA
FT                   CDRLVRAGVPVNNQSVLLKGINDSLPVQKALCHKLLMSKVRPYYLFQCDNVQGTEHFHT
FT                   PIETGVGIIEGLRGYTSGLAVPNYVIDLPGGGGKITIQPDYVLDKQADEYIIRNYKGEI
FT                   IRFKNPGGHKVFSNTGSTGTVKTAAKINGETDANRVVIRS"
FT   gene            592711..593727
FT                   /locus_tag="DehaBAV1_0602"
FT   CDS_pept        592711..593727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0602"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase; protein
FT                   of unknown function DUF201; D-alanine--D-alanine ligase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17187"
FT                   /protein_id="ABQ17187.1"
FT                   /translation="MRIGLSYDLKLALTPVTGGPDDALEEYDSPETVEAITNALTAAGH
FT                   AVYRLGGGKEFLRKVQEQKLDLVFNISEGLGNYRSREAQIPGVLEMLDIPYTGSDPQTL
FT                   AICLDKPLTKKLVAGAGVKTAKWQLVSNCEELSTIDWSDFPLPAFLKPACEGSSKGVRF
FT                   ASRAESTDEIMRMATELLTTYNQPVLVEEFINGDEITVGVIGNDKPKVLGIMRIVPKTK
FT                   ADYFVYSIEIKRNWRQMVEYEVPAALPAKTLARIEKATLDAYRVLECHDLCRMDFRVSP
FT                   DGTPYFLEVNPLPGLNPVSGDLPIMASKLGISHADLALEILNTAIARHNLVAADCLA"
FT   gene            593858..594289
FT                   /locus_tag="DehaBAV1_0603"
FT   CDS_pept        593858..594289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0603"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17188"
FT                   /protein_id="ABQ17188.1"
FT                   /translation="MTTIQSRIRQNKYKITPQRQAVLKVLSAAIQPLSPAEVHKLVQAD
FT                   KPATGMATVYRSLQLLAELGLICELHTAGNCHRYLLKRIDSHHHHLICSGCGQVVHVEG
FT                   CGLKEITENLSRQTGFAIDTHLLEFIGRCRNCQKGIGKV"
FT   gene            594286..595158
FT                   /locus_tag="DehaBAV1_0604"
FT   CDS_pept        594286..595158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0604"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17189"
FT                   /protein_id="ABQ17189.1"
FT                   /translation="MKFRTLFLSLILGVTLLSSLLLAGCQEETPSTAKLKIAVSIVPLK
FT                   EFTQQIAGDKAEVVLMVPPGAEPHTYQPLPSQMVDVSQADMYVKLGSDFGFEQNWLSKI
FT                   LSLNHSMLVVDSSVNITLESGSEGDGADPHIWLSPRNAIQMVKNITLGLMSLDPENQSY
FT                   YAANRDAYLAKLEQLDNEITLAFSNLYNRTFLVFHPAWVYFARDYNLKELSIEIEGKEP
FT                   TPQQMIEIINMAIQNNISIVFASPQFSSRSAEAIASEIDGRVVMIDPLAEDYITNMEFV
FT                   YKQMQEVMS"
FT   sig_peptide     594286..594357
FT                   /locus_tag="DehaBAV1_0604"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.780 at
FT                   residue 24"
FT   gene            595161..595925
FT                   /locus_tag="DehaBAV1_0605"
FT   CDS_pept        595161..595925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0605"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17190"
FT                   /protein_id="ABQ17190.1"
FT                   /translation="MPVVPALVFKGVTASFDGLAVLEDITFSQPTGRMLGIIGPNGGGK
FT                   TTLLKLILGLIQPDCGTIKVLGKSPEDARPEIGYVSQYHLFDRDFPISVLEVVLMGRYS
FT                   KRGLAHSYRKEDVALAEEYLDKVGMLPFINRQIGQLSGGQQKRVFIARALVNQPKLLIL
FT                   DEPTAGVDVAMQTGLYELLESLKKDMTIIMVTHDISAVAVCIDDIACLNKHLSYHHAEE
FT                   GLTAEDLAETYNCPIQLIAHGQVPHRVLKEHE"
FT   gene            595922..596767
FT                   /locus_tag="DehaBAV1_0606"
FT   CDS_pept        595922..596767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0606"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17191"
FT                   /protein_id="ABQ17191.1"
FT                   /translation="MIEALGYGFIQNAIWAGLLAAIGCGIIGSYVVVKKLASISGGIAH
FT                   ASFGGIGLGYLLGINPVLGALAFSLLAAASMGTLTRRSRISEDTIIGMLWAFGMALGII
FT                   FIGLTPGYAPDLFSYLFGNILTVPSSDLVLMLVLDALIIGVVWFFYKEFLGVSFDEEFC
FT                   RVSGMPTGLLYVIMLGLIALTVVMLIRVVGIILVIALLTIPAAVARRFTDSLLKMMGLS
FT                   IGFGVVFCLGGLWLSYILDFASGATIILFSVAVFLAVLAFKGKKKQEPASDKTGCINHE
FT                   "
FT   gene            complement(596791..597141)
FT                   /locus_tag="DehaBAV1_0607"
FT   CDS_pept        complement(596791..597141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17192"
FT                   /protein_id="ABQ17192.1"
FT                   /translation="MELDEFLKQSAVDYTSRQIILLFSKHPFARFDRSAIASTIEDGSD
FT                   ILPTLQSLVSSGIIKLCQKGGAELYCLTSEPALRDMVTRLGNMEWKQQQNFSRRKLIGL
FT                   NVFPQTRPLGTH"
FT   gene            complement(597257..598387)
FT                   /locus_tag="DehaBAV1_0608"
FT   CDS_pept        complement(597257..598387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0608"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17193"
FT                   /protein_id="ABQ17193.1"
FT                   /translation="MSKKVYVPSGAKIKVIGCGGAGSNAVTRMVRDNIQGVEFIAVNTD
FT                   AQHLAITEAATRIQIGERCTRGLGAGGNHTMGKAAAEESLSELKENIIGADMVFVTAGM
FT                   GGGTGTGSAPVVAKIAKESGALTIAVCTKPFCFEGAHRMQTAEEGINNIVDSVDTLIII
FT                   PNDRLLDMVDQKTGVDGAFKLADEVLCNGVKAIAEVITVPGIINLDFADVKAVMKDAGP
FT                   AWMSIGKGAGQNRAADAARAALASPLLDIAVDGAMGVIYNVCGGDDLSLMEVNSAADVI
FT                   RQAVDPQANIIFGVSTDPRMGKEVQITLIATGFATKESMLSNNHEKEMTRMMKGLRSKT
FT                   QEELEVPSFMRYRSAQPSIRKPAPAAHQAPPRFLSR"
FT   gene            complement(598420..599622)
FT                   /locus_tag="DehaBAV1_0609"
FT   CDS_pept        complement(598420..599622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0609"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17194"
FT                   /protein_id="ABQ17194.1"
FT                   /translation="MKRRQIAAIDVGTSKICTVMADTENGDLRILGVGVVPSRGLQKGM
FT                   VVNLNEAKEAIRESVSMAERTAGYKLKSALIGVTGKHINSKNNRGVISITRNDHLVRQS
FT                   DLQRAIDIASSITMPQDRKVLHIIPRNYSVDGQEGVSNPVGMHGFRLDVETHIITAASN
FT                   SIENLTKCIRAAGVEIDDLVFNPLASAEAALTDEEREKGVILADIGGGTTDIAAFKGNS
FT                   IYHTSVLPIAGSQVTHDVSVGLGIPFEMAEDIKQRYSSVIPGECNDANFVESGHTFSYP
FT                   DLCEIVRMRVEELLRLIILELPSDDYSKMVPSGLVITGGTANLPGIAELGSEVLRLPVR
FT                   VGTPPNLFGVSDILNDPACTNVVGMLLWSINNRDASKSHPTTEESAKGGFISRMFGNPK
FT                   N"
FT   gene            complement(599680..599889)
FT                   /locus_tag="DehaBAV1_0610"
FT   CDS_pept        complement(599680..599889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17195"
FT                   /protein_id="ABQ17195.1"
FT                   /translation="MGTAIEYQKLMTEIVHINLPGPAEPMPGMSGGELLHGFLAELYRA
FT                   PSTDSKAFIESLSGKWNVHFRHVK"
FT   gene            600128..600817
FT                   /locus_tag="DehaBAV1_0611"
FT   CDS_pept        600128..600817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17196"
FT                   /protein_id="ABQ17196.1"
FT                   /translation="MANLKGSKPLPPYVSYRTFLNFLLGLQEAIPSRLDRSFWGDKWSG
FT                   STGTQLMSALRFLGLADAEGMPREKLRRLVDARGEDRTLILRQITLEGYQFVFNSSADP
FT                   ESLTYAQLEELFHNSFKVADDVVRKCIKFFLGLAEDADISISPFVTKKSRAGRSGTGTK
FT                   KIQRKIIPRTASHVLIPDNTMKVPDNSDMDRVLLGKFPTFDPAWTDEVKVKWFEAFDVL
FT                   LKKVSKA"
FT   gene            600974..601837
FT                   /locus_tag="DehaBAV1_0612"
FT   CDS_pept        600974..601837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0612"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17197"
FT                   /protein_id="ABQ17197.1"
FT                   /translation="MYFKRILITLDGTKTAEKTLPVAELMASYPETELLLVSICDPKPK
FT                   ITDERQKYLDAKSAELRTKGIQANGKMFCGELLPLILKCINENGIDLLCMASHGYTGIK
FT                   KMVLGSVSEKLIKATNLPVLLVKEGHDPDKAVFANILLPLDGSLFSEACLKQVSDLARD
FT                   FKSKLTLLVVIQPPCIPSDRSPSIQPSWDEYYQALLEELKQQAHAYLERLTGELQANGI
FT                   ETEFRMEVSDKIPETILSTAEDINASLISFTTHNRSGIEKWYYGSVAAGLIENSSHPML
FT                   LWRNSI"
FT   gene            601891..602520
FT                   /locus_tag="DehaBAV1_0613"
FT   CDS_pept        601891..602520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0613"
FT                   /product="Kynurenine formamidase"
FT                   /EC_number="3.5.1.9"
FT                   /note="PFAM: cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17198"
FT                   /protein_id="ABQ17198.1"
FT                   /translation="MKKIYDLSPEIRPDMISWPGDSCPEITLLHSIKYGSHSNLSRLTM
FT                   TLHNGSHIDAPYHFFEAGIGASEIPLEILVGDVRVLRFGGVKTITRKMLEHADLKGVTR
FT                   LILATDNESLWKKPDFDENYTYIDIGAAQYLTEIGIRLLGIDYLSVEDFQGLDGVHKHL
FT                   LSQGVVILETLQLAGVPEGDYELYCLPLKLGKVDGAPARVILIERD"
FT   gene            602521..603183
FT                   /locus_tag="DehaBAV1_0614"
FT   CDS_pept        602521..603183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0614"
FT                   /product="Ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17199"
FT                   /protein_id="ABQ17199.1"
FT                   /translation="MKDVKVVPAILTDDPAAFESMIKQSEGFAPVAQIDIMDGQFVPSL
FT                   SIPPEVLGRYKPCFASEIHLMTLNPEEYLTYCKQHGARRVIFHFEATPRPEYVISRIKE
FT                   MGFKVGLAVNPETSVAEFAYLVPQVDMVLFMSVIPGFYGAPFIPEVLLKVKEFKRRFPE
FT                   TEIGLDGGAKQANIPEIVAAGVNDICVGSAIFRQSDPQSSYLYLDKLAKNSAKEAGL"
FT   gene            complement(603180..603638)
FT                   /locus_tag="DehaBAV1_0615"
FT   CDS_pept        complement(603180..603638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0615"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17200"
FT                   /protein_id="ABQ17200.1"
FT                   /translation="MSNISIAIGADHGGYDLKTDILPFLNHLGLKVLDLGACTYNSSDD
FT                   YPDFAQTVARNVACGKTDRGIIICGSGVGACITANKIKGIRAGLCHDVYSAHQGVEHDD
FT                   MNVLCLGARVIGIEVAKEIISAFLNARFTGEERHKRRLEKLLKVEKEG"
FT   gene            complement(603631..605631)
FT                   /locus_tag="DehaBAV1_0616"
FT   CDS_pept        complement(603631..605631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0616"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase domain
FT                   protein; Transketolase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17201"
FT                   /protein_id="ABQ17201.1"
FT                   /translation="MSNTKLDSLCINALRFLSVDAVQKANSGHPGAPMGMAAMAYALWQ
FT                   NFLKHNPQDPAWPNRDRFILSAGHASALLYSLLHLTGYDLPLDELKNFRQWGSKTPGHP
FT                   EYGLTPGVEMTTGPLGQGFASGVGMAMAEAHLAAVFNQPDCKIIDHYTYGIVSDGDLME
FT                   GVASEAASLAGHLALGKLIYLYDDNDISIEGSTELAFTENAALRFESYGWQVIDHVDGL
FT                   DPEAVSQAIKQAQSDTTRPSLIICKTIIGFGSPNKAGKASAHGEPLGTDEVSKSRKSLG
FT                   WDYEPFVIPVEALTEFREALGKGKTAQQVWLSKLDYYLSHYPEKASLLQDMLSGNLPED
FT                   WDKDLDRLFDKAMASREASGLLINALASRLPSLMGGSADLSPSNKTVIKDGGEYEPHYY
FT                   EGRNIHFGVREHAMGAIANGLALHGGIIPYVATFLIFYDYMRPAVRLASLMGQRVIYIF
FT                   THDSIGLGEDGPTHQPIEQLAGLRSVPGLVTIRPADSYETAQAWKTAILRKNGPTAIAL
FT                   SRQKLPLLDNSQTKSLNLPKGAYILQETDSHPQVALVASGSEVTIAVEAAEILKGKGIS
FT                   SRVVSFPSWQLFDNQPQTYRQSVLPSSLPRVIMEAGNSQGWCKYLGTNGTVISIDHFGA
FT                   SAPAPLLYKKFGLTPENMAEKALKLLENEHE"
FT   gene            complement(605683..606192)
FT                   /locus_tag="DehaBAV1_0617"
FT   CDS_pept        complement(605683..606192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0617"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17202"
FT                   /protein_id="ABQ17202.1"
FT                   /translation="MDALEAIFSRRSIRHYQHGDISASELDTLLRAGMAAPSAGNQQVW
FT                   HFVVIDDRRILDKIPDIHPYSKMLKEAPMAIMVCADQSAETKTGYWIQDCAAATQNILL
FT                   AAEALGLGACWLGLHPREERKEAISRLLNLPVSISPLSLIAIGKKGETKPPAKRYLESH
FT                   IHKNGW"
FT   gene            606318..607160
FT                   /locus_tag="DehaBAV1_0618"
FT   CDS_pept        606318..607160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0618"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17203"
FT                   /protein_id="ABQ17203.1"
FT                   /translation="MFKKLADINTKPELYQQYSAPVLWNDPHISSRMLEFHLNPDIEPA
FT                   SRKAVFIEKSAGWIKDYFGLGDGKQVCDFGCGPGLYTSRLAATGADVTGIDFSSRSISY
FT                   ARDFAASHYLDIHYIEQNYLEFATPKQFDLITLIYCDYCALSPSQRCQLLSVWNKCLKD
FT                   DGNILLDVFSLSAYEGRAETAGYEYRLMDGFWSGNDYFGFINTFKYPLEKVVLDKYTLI
FT                   EADREWQVFNWLKYFCVAELKHELAEKGFEVADIFSDVAGAVYWAGSPEIAVVARKIK"
FT   gene            607302..607931
FT                   /locus_tag="DehaBAV1_0619"
FT   CDS_pept        607302..607931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17204"
FT                   /protein_id="ABQ17204.1"
FT                   /translation="MTKSTRVIPPFPQMTIGVMGSAGGTMTDETKKSLRCLGACIAKRK
FT                   HVLITGACPGMPHETVLGSKEEGGVVVGISPALNLEEHVEKYHSPTRGYDAIIYTGSGL
FT                   MGREIENIRSCDVVIFAGGRSGTLGEFAIAYDEGKVIGVLRGSGGIADHLDKIIAMVDK
FT                   ETGARVYYESDPYKLLDMLEAVYRERILPKHKRLLENNDPDGVSDG"
FT   gene            608537..609550
FT                   /locus_tag="DehaBAV1_0620"
FT   CDS_pept        608537..609550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0620"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17205"
FT                   /protein_id="ABQ17205.1"
FT                   /translation="MLDDINMKLNSKSARLGTTVAGVFLSLVLLLGLVGGCKTADDTNP
FT                   DDENPVVTEVTYPLTVTDQLGRIVTILSEPQTIVSLSPSNTETIYAMGLEDKLVGVTTY
FT                   CNYPEAAKDKPKVGGFSNVDAEAVTAIGPDIILASNIHASTVIPQLEQLGLTVIAISPD
FT                   NLEDVLASIELIGKCLNQVKKANSLMDSMQTRIDAVTSKVKNLSESQKPRVLYIVWHEP
FT                   LMSVGSTAFITGLITAVGGVSITADSAESYPTIGLETVLGANPQVVVVGTGMGSGADAP
FT                   LLFIQDEPRLANIDARINGNIYSINTDLIGRTGPRIVEALEQLAKMLHPEIFGAIS"
FT   gene            609606..610697
FT                   /locus_tag="DehaBAV1_0621"
FT   CDS_pept        609606..610697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0621"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17206"
FT                   /protein_id="ABQ17206.1"
FT                   /translation="MGVNTNLNKENCPAVPGGLHPHWRGRIFAMAGLFGLLLVAAVFAI
FT                   SFGSVEVPFFTTIAILISKIPFVHISPDWTVNTQAIIWDIRLPRVLLAGVVGMALAVAG
FT                   ATYQGLFRNPLADPYLIGVAQGAAVGAVLGLILGIGFDVLGIFTTPLFAFAGAFGAVGV
FT                   VYMLARVGNRLTVTTLILAGVALGSFLTAIVSYLITVSGDKIHSVMFWLMGSFSMAGWE
FT                   SVKIVIPIVIIGTLVILLFARSLNLIQLGEEQAQELGVDVERMKIILLTAATLITAAAV
FT                   SFVGIIGFVGIIVPHAIRLIWGADYRFLLPLSALVGAVFMILADIASRTLVAPSEIPVG
FT                   AITALVGAPFFLYLLRKRTRMLF"
FT   gene            610709..611536
FT                   /locus_tag="DehaBAV1_0622"
FT   CDS_pept        610709..611536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0622"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17207"
FT                   /protein_id="ABQ17207.1"
FT                   /translation="MFELEVRDVTLAYGPVDVLKNVSFKTMPGEMIGLVGPNGSGKSTL
FT                   IKSLARVIDPRLGSIYINGRNSRSIPRLELAKMVGVVPQIPVLPSAFTAFEIVLMGRNP
FT                   HMGTFQYESHKDIAIAWEALARAGVLHLADRQIGELSGGEIQSVVIARSLCQKTEAILL
FT                   DEPTSNLDIGRQIEILDLIKSECRERNITVIAALHDLNLAAHYCERLILIDNNGIHADG
FT                   SPVEVITTNNISRVYGPGSYVHTHPLSGLPAVLPRLGNIRCNANGEKGGTDAH"
FT   gene            611526..612296
FT                   /locus_tag="DehaBAV1_0623"
FT   CDS_pept        611526..612296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0623"
FT                   /product="protein of unknown function DUF105"
FT                   /note="PFAM: protein of unknown function DUF105"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17208"
FT                   /protein_id="ABQ17208.1"
FT                   /translation="MLTEKVNIRTVAEFHGIKAEVIEHEVWGVPANALVVTFPEERRAL
FT                   SGRQGYRKIKAVCNIYLPDAIWPRLHDDKLSWNGYYRQVFSKALSAIGIPLSKVLVLST
FT                   GVTMDHLAIHEEKRGDLWVVALATAGVESNALRIGQDKSSGIDRNGRFKPFGTINTIIL
FT                   TSENLSQATLASCFITATEAKTIALDELGVMSAYTPSLKASGTGTDQIVAVSGMGDKAT
FT                   YVGGHTLLGELMGRSVTLAIKEALTKRIASRKGH"
FT   gene            612299..613225
FT                   /locus_tag="DehaBAV1_0624"
FT   CDS_pept        612299..613225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0624"
FT                   /product="adenosylcobinamide-phosphate synthase"
FT                   /EC_number="6.3.1.10"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17209"
FT                   /protein_id="ABQ17209.1"
FT                   /translation="MEILLIFLLALVIDMVFGDPPNAFHPVAYMGKVISLFERAGFKGG
FT                   KGYQFVYGIVMVIFTMALFFVPVYFLLDWLQGINSIVYIIVSAILFKMCFTVTGLRKAA
FT                   LLIKRLLEKDDIAQARFELRSLVSRDTSKLPQPKLVAAAVESVAESIGDGFVAPLFFFL
FT                   IFGVPGVMAYRVVSTFDSMVGYRGKYEYLGKFAARFDDVLNFIPARLSALCILVASFFG
FT                   RYSPAGAWRIMWRDHGKTQSPNAGWPMATAAGALEVCLEKVGHYSLGDDIRPLLPQTIS
FT                   RSLVLINNAGCIWVLISVGVIYFARIA"
FT   gene            613209..614315
FT                   /locus_tag="DehaBAV1_0625"
FT   CDS_pept        613209..614315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0625"
FT                   /product="L-threonine O-3-phosphate decarboxylase"
FT                   /EC_number="4.1.1.81"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17210"
FT                   /protein_id="ABQ17210.1"
FT                   /translation="MPVLPKPQLEKLKPCYHGGPNYAELKKLGISPDAVMDFSVSSNPY
FT                   PAPVELKEALSSLVIDRYPDSESAELKEYLAGRLSLKPENLIIGSGSMEVIRLVAGAYF
FT                   GVGDTVLILKPTFGEYELAVEVAGADIIEQWADEESGFKFDLDLTCRIIKKHQPKAVFI
FT                   CNPNNPTGVYLSKADIEKVLNVCTDTLLVLDEAYIAFAEDCWKSADLLDSDNLIVIRSM
FT                   TKDCALAGLRLGYGMASAEIIANLKKICPPWNVNAAAQKAGLVCLRHPSYLAESEKKIK
FT                   ASKEYLMQGFIRLGFSVFPSETNFFLLKVRSAADFRSAFLKYGLMVRDCTSFGLPQYVR
FT                   IAPRTQSECEHLLEVSVELKSKSEIYPA"
FT   misc_binding    614337..614530
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 72.76"
FT   gene            614688..615746
FT                   /locus_tag="DehaBAV1_0626"
FT   CDS_pept        614688..615746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0626"
FT                   /product="Nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="PFAM: Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17211"
FT                   /db_xref="GOA:A5FRG9"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRG9"
FT                   /protein_id="ABQ17211.1"
FT                   /translation="MELLNATLAKIYGLDKEAMVKAQAHQDILIKPQGSLGKLEAIVVQ
FT                   LAGIQGDAKPKTAKKAIITMAGDHGIIDEKFHNWPKEVTVQMLQNFAHGGAAINVLSRQ
FT                   VGARNVVVALGVATPMAADPNIINRNIAPGTNNMVHGPAMTREQAVKAIEVGIEIVNAE
FT                   VKKGLDLVGTGDMGIGNTSPSAAICSVITGRSLEDVTGRGTGASDEQMKLKRNAIAKAI
FT                   SLNNPDAKDAIDVLSKVGGYEIGGLAGVILGAAANRVAVVVDGFISGAAALIAYTICPQ
FT                   VKDFMFAAHQSVEPGHRILLEHMGLDAILKMDMRLGEGTGAALAMNIIEAANRIQHEMA
FT                   SFADAGVSEKQS"
FT   gene            615786..616550
FT                   /locus_tag="DehaBAV1_0627"
FT   CDS_pept        615786..616550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0627"
FT                   /product="cobalamin-5'-phosphate synthase"
FT                   /EC_number="2.7.8.26"
FT                   /note="TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17212"
FT                   /protein_id="ABQ17212.1"
FT                   /translation="MGSFLAAFRFLTNIPVPWLKEDWQGEKPRLDFARSLGFYPLVGLI
FT                   IGLILVGLGWVFSLFLPDVLTAALLTISLVIITGGLHLDGLTDTFDGIAAGHKSFERAQ
FT                   EVMHLPGVGAIGVLAAICLLLLKFSAVLSLPSESFITGLILFPLISRWAMVYAVVKYPY
FT                   VRSQGLGKELKGETAKASLWFATIFCLTVCVVLGGWAGFLAMFGSWLMVMYLASFFKRR
FT                   LGGLNGDTYGSINEFTEVAALVFIVALSGYFS"
FT   gene            616569..617171
FT                   /locus_tag="DehaBAV1_0628"
FT   CDS_pept        616569..617171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0628"
FT                   /product="phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17213"
FT                   /protein_id="ABQ17213.1"
FT                   /translation="MKLIMVRHGETETDNCRRYWGHSDIGLSDCGHAQANSLREYLASV
FT                   KIDAIYSSSLKRCMETAETIAYGRPLLVNKNNDLKEIDFGRVEGLTYDDVVERYPDIAQ
FT                   KWAEGSFDVHFPDGESMAHFAQRVIKFAKMLSKHKSDDTLLVVGHGGVFRILICHFLGI
FT                   EYKHWWQFILGVGSVTVLDIYPEGSILEKLNDNSHLD"
FT   gene            617224..617790
FT                   /locus_tag="DehaBAV1_0629"
FT   CDS_pept        617224..617790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0629"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /note="PFAM: cobalbumin biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17214"
FT                   /protein_id="ABQ17214.1"
FT                   /translation="MNYLLIGGARSGKSSYAEELAKSIGGKVVFVATAEAGDEEMKTRI
FT                   LRHQQARPAEWGLIEASLQVGEKISAHGSSAGVIILDCITLLVNNIMCKYMLEHGDELT
FT                   GEAADYLDAEVKKEINGIINAMKKTGASFIVVTNDVGAGLIPPNAMARIYRDLLGRANQ
FT                   MLGAYVEYVYLMVAGLPVQVKPLLR"
FT   gene            complement(617866..618189)
FT                   /locus_tag="DehaBAV1_0630"
FT   CDS_pept        complement(617866..618189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0630"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17215"
FT                   /protein_id="ABQ17215.1"
FT                   /translation="MVMELTDQSFAAEVLKSDKPVLVDFWAPWCGPCRMVAPIIDKLST
FT                   KYAGKFKFCKLNVDENKTTATQYRVMSIPTLLFFKGGQVADMVVGAVPESALSQKIDQL
FT                   IQK"
FT   gene            complement(618359..619504)
FT                   /locus_tag="DehaBAV1_0631"
FT   CDS_pept        complement(618359..619504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0631"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, dimerisation and phosphoacceptor region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17216"
FT                   /protein_id="ABQ17216.1"
FT                   /translation="MKKVFSFLYSQIRRLPRLLANVHIWILVLLFTGGFFLHYPQLLPF
FT                   IGQIDPDSFLYLTRHSVGRLIMLLPVTYTALVFGLRPGLVSLLLAIAIIIPNIFVTDTV
FT                   TADDIIEIIGIIIIGLVVNLWLESYETDKKHRQQAYLKMETAQRELQRMQQNLRFYLKQ
FT                   ITIAQEDERRRIAQELHDDTAQDLIVISRAIDRFVTKNPNLGEDNLAELEEMQNHINRT
FT                   LSEVRRFAQDLRPSVLDDLGLIPALEWLIPDLSKHFGINIDIDVNGEIRRFAPETELVL
FT                   FRIVQESLRNVGKHAQATKAWVYIDFGKYKATLTVKDNGKGFLLPERVGDLAALGKLGL
FT                   TGMQERAQLIGGRLSIQSKPDVGTMVTVAVPNSGNLEDDDV"
FT   gene            complement(619521..620195)
FT                   /locus_tag="DehaBAV1_0632"
FT   CDS_pept        complement(619521..620195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0632"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Bacterio-opsin activator, HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17217"
FT                   /protein_id="ABQ17217.1"
FT                   /translation="MQTTQMIKVLLADDHVIVREGTRELIQRESGMMVVGEASDGVEAV
FT                   EMSMKVHPDVVVMDIAMPRLNGIEATKQIKQLLPTTAILILTAYESEQYILAILEAGAA
FT                   GFLLKNVKGTQLLEAIRSVYAGESVLQPSTTRRVIDQLINKAAKTEELSAVNPLTEREI
FT                   EVLKMAARGVSNKDIADQLYLSNRTIQTHLSNIFKKLSVGSRTEAILYGLKRGWFIMED
FT                   LP"
FT   gene            complement(620265..620909)
FT                   /locus_tag="DehaBAV1_0633"
FT   CDS_pept        complement(620265..620909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17218"
FT                   /protein_id="ABQ17218.1"
FT                   /translation="MTNPKEVFNLPAQRNFELATKRTLELNRSHFLAVQDFDKISRQAG
FT                   AVLQPPFIHLKYFRFRVEIDTRNAAVTSPDTSLSPREEALILHYLLKADGTPVSREQIS
FT                   FKELPEGANYQPVFYNRVLKSLIALYIANPAKLDLSAISLGGKKAEQADVSFLFQALPR
FT                   LPLWLVFWQGDDEFPPEGNIIFDRSISRYLDTEAITEICQNLNRRLTEKTF"
FT   gene            complement(620941..622287)
FT                   /locus_tag="DehaBAV1_0634"
FT   CDS_pept        complement(620941..622287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0634"
FT                   /product="acetyl-CoA decarbonylase/synthase gamma subunit"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: CO dehydrogenase/acetyl-CoA synthase delta
FT                   subunit; Fe-S cluster domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17219"
FT                   /protein_id="ABQ17219.1"
FT                   /translation="MSPTGIEIYKFLPRTNCGECGVPTCLAFAMSLASGRAELSSCPYV
FT                   SEETKLKLEEASAPPVRTVSIGTGIYSFKIGGETVMHRHEKRFEHQSGIALLLSDNLTE
FT                   TEQNAKLTAFNSFQYKRVGAILKPDMLALRADSGSSEKYLKLVKLAAEKCQASLMLICA
FT                   NTTVLDESLKICAERKPLLYAATAENSNEMAELAKKYNCPLVAKAKNLTDLAELTIKLQ
FT                   SLGIKDIVLDSSPASFKQTLADNIAIRRAAILKKFRPLGFPVINFPCLITSDHMKESLF
FT                   ASILTAKYAGILVLSDFRGETLFPLLVARMNLYTDPQRPLATTEGIYEINNPDANSPVM
FT                   LTCNFSLTYFIVSGEMETSRVPCYLLIKDTEGLSVMTAWAAGKFGADTIGKFVKNSGIA
FT                   GKVNHRKLIIPGYASMESGGLEEELSGWEIMVGPREAAHIPAYLKQFKP"
FT   gene            complement(622308..624509)
FT                   /locus_tag="DehaBAV1_0635"
FT   CDS_pept        complement(622308..624509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0635"
FT                   /product="acetyl-CoA decarbonylase/synthase alpha subunit"
FT                   /EC_number="1.2.7.4"
FT                   /note="TIGRFAM: CO dehydrogenase/acetyl-CoA synthase
FT                   complex, beta subunit; PFAM: CO dehydrogenase/acetyl-CoA
FT                   synthase complex beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17220"
FT                   /protein_id="ABQ17220.1"
FT                   /translation="MSKTVAEAAIKGARNIVNASYEVYKQTLVTNCPDTAVGFPNTAYF
FT                   LPVIYGILGIQVEKLSDMGMVFDKCFKMLPPPEVNAEDVTELGAVLEAGLSTLFAEEML
FT                   EALRYLSQPEYYTNTEDPTPDNIWLGAADDIILRKRGVEFVDGTAPGFAAIIGAAPDNA
FT                   AAESIAAELQQKNLYTFMCGESQGKRFAKQLADADVELGWTPRLVSFGDEATAAIFAFG
FT                   FAVRVALSFGNIEPGNRAKLFEYSQERIKAFIMPLGDISDEWYANAAGALNFGFPIIAD
FT                   KSVLPILPGVESVDSVLAGIPYSRIVSKAMDARGIKVNVTKVPVPVAYGPAYEGERVRG
FT                   EQIYLECGGGRTQMVELVTTAKMDDVTDGKIELFGQDVSDMPEGSRLPLAIVVEAAGHK
FT                   MNEDYEPILERQIHHLLNYAQGVMHIGQRDIAWLRIGKSAAAKGFSLKHIGAILHAKLH
FT                   QDFGGIVDKIQIKLYTTPEKVAEISRQSKKIYTKRDERIEGMTDENTETFYSCTLCQSF
FT                   APSHVCIVSPERTGLCGAYNWMDCRASNEINNIGPNQPVNKGAVIDAKLGQWSGINQFV
FT                   EKTSGGVVSHYNLYSIIYDPMTTCGCCECISAILPLCNGVMTVNREHTGMTPCGMKFTT
FT                   LAGTIGGGITTPGFLGHSKYNITQRKFISAEDGLLRLVWMPKSLKEEIRERFNARAAEL
FT                   GVPDLLERIADESVGTTEEEILPFLEEKQHPALTLEPLI"
FT   gene            complement(624569..625510)
FT                   /locus_tag="DehaBAV1_0636"
FT   CDS_pept        complement(624569..625510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0636"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase delta
FT                   subunit"
FT                   /note="PFAM: CO dehydrogenase/acetyl-CoA synthase delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17221"
FT                   /protein_id="ABQ17221.1"
FT                   /translation="MAFETPKINYSGSIREITLGDGPKSVTVGGETALPFYLFEGDMPR
FT                   KPKIAMEIQDTPPLDWPADALKPFGDAVNNPVSWAKKCVDTYEAKIICLQLESTDPNGL
FT                   DRSAEEAAKIVREVANAVDVPLIVWGTANHEKDTEVLRKISEICPDKKLILGPVEEGDY
FT                   KKIAAQAMAYKHTIIASSPIDINLAKQLNILLGNLGVPANEIIMDPTVSSIGYGIEYAY
FT                   SVIERIRLAALTQQDERLQYPIICNIGREAWKTKEAKIPETESPELGNTEKRAIMIEAM
FT                   SAAILLIAGADILVMRHPESMRLVGELMAELG"
FT   gene            complement(625546..626436)
FT                   /locus_tag="DehaBAV1_0637"
FT   CDS_pept        complement(625546..626436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0637"
FT                   /product="5,10-methylenetetrahydrofolate dehydrogenase
FT                   (NADP+) / methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="3.5.4.9"
FT                   /EC_number="1.5.1.5"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17222"
FT                   /db_xref="GOA:A5FRF1"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRF1"
FT                   /protein_id="ABQ17222.1"
FT                   /translation="MSAHIINGTEIAAAIREEIRSEVIALKAKAGIVPGLATVLVGDDP
FT                   ASHSYVDSKIKMCQNLGIYSEHHPLPQNATIEDLLTLIAKLNADPKISGILVQVPLPAQ
FT                   ISESLVLNAINPDKDVDGFHPVNVGRMCLGEPCFLPCTPHGVQELLIRSGIKIEGTHVV
FT                   IVGRSNLVGKPLANILLQKAPGANATVTICHSGTKNLPEITRQADILVAAMGKPKFITS
FT                   DMVREGAVVIDVGTTCIGYTPEGKRILSGDVDFEEVKEKAFAITPVPKGVGPMTIIMLM
FT                   LNTLTAAKRAAGLIK"
FT   gene            complement(626436..627218)
FT                   /locus_tag="DehaBAV1_0638"
FT   CDS_pept        complement(626436..627218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0638"
FT                   /product="CO dehydrogenase maturation factor-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17223"
FT                   /protein_id="ABQ17223.1"
FT                   /translation="MTYTIALAGKGGVGKTSVSSLIIRQLLKNSLTPILAVDADANANL
FT                   GESLGLCVPQTVGGLIASFNKAKLNLPSGITKEAYLEYQLNTTLAESHGLDMISMGRGE
FT                   GDGCYCYPNTILRSYIDKLSRNYRYVVMDNEAGMEHLSRRTTQNVDHLFIISDHSVKGV
FT                   RTLGRIRQLIDEMKLNVSRISVIINMVSGTLDPRLGQEIDKLGIAYTDTVPADEMIREF
FT                   DLKQTPLLKLPDNSPAVQAVAKILSSRLGIKNLTEVSE"
FT   gene            complement(627215..629137)
FT                   /locus_tag="DehaBAV1_0639"
FT   CDS_pept        complement(627215..629137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0639"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17224"
FT                   /protein_id="ABQ17224.1"
FT                   /translation="MTEKKFSVCFEPGHRVINGQKGDSLLDLAIIAGTGLCASCGGEGV
FT                   CGRCRIKLIEGELECEDHLQISAEEFAQGIRLACQSRLVSNVTVEILAESRFDTAISGD
FT                   AISCTLQSRPESVKNKPVLPLRKVFLKLVPPSGADNSSDLGRLKRFLKPFCPTEPDIDY
FT                   HLLSSLSETLREKNWEITVSLLETPNGVKIINIQPGDQTLTTYAFAFDIGTTGVRGQLL
FT                   EVTKSQVLAQATEYNGQIPFGEDVISRINYAAREGGLNQLQQAVVNTLNNLGQAMLSEC
FT                   GLEASDIAFATIAANTTITQLLYGLDPKHLRLAPYVPLASELPLISARHINLSICPQAY
FT                   IYTLPCVASYVGGDIVAGVISTNIPHREGLVLYIDIGTNGEIVVGNKDFMLTASCSAGP
FT                   AFEGGGIKNGMLAKPGAIEDIELGPQSFEPKLSVMGSGNPKGICGAGLINTVSALLNCG
FT                   LLGQNGKYNTHIKTGRLRKGADGYEYVLAFGREFGQGQDITLSEVDIDNLIRAKAAMYA
FT                   GYQTLLENAGANFKNLEKVIIAGTFGAKLNIKKAINIGLLPELPEEHFIFVGNGSLAGA
FT                   RLCAFDKNAQTEASAAAKMMTNVELSESVSFMDNYMASMFLPHTKSTDFPEVYAALGKF
FT                   NGGRI"
FT   gene            complement(629175..630992)
FT                   /locus_tag="DehaBAV1_0640"
FT   CDS_pept        complement(629175..630992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0640"
FT                   /product="Formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase, FTHFS"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17225"
FT                   /protein_id="ABQ17225.1"
FT                   /translation="MKVLRGNILAVNDREFHLKELDPVLMKDWEIAEKAEDFLKPVKVL
FT                   AMELGLTEDEIIPHGKYIAKVDFAGVLARLKDRPNGKYIDVTAITPTPLGEGKSTTTMG
FT                   LVQGLGKLGKKVTGAIRQPSSGPTFNIKGSAAGGGLSQCLPLSPFSLGLTGDIDAVTNS
FT                   HNLAMVALQARLQHEANNTDEFLSSRHLTRLDIDPSRVEMKWAMDFCAQSLREIIMGIG
FT                   SKTDGYRMPSGFGISVSSEVMAILSVFTSLSDLRERMGKIIVAYRKNDEPVTTADLEVD
FT                   GAMTALLLRAVNPNLLQTIEGQPVFVHAGPFANIAIGQSSIVADRLALKLADYHVTESG
FT                   FGADIGFEKFWNIKCRLSGLKPDCAVIVVTARALKMHGGGPKVTPGTPLDPAYTTPNTK
FT                   LVEKGCQNMLAHIQTVKTAGINPVVCINHFAADTHEEIDIIRRTAEQAEARVAVSHHWA
FT                   KGGDGATELAEAVTDACNEPNNFHFLYPENMPLKKRIETIARKVYGANGVSYTPIAMEK
FT                   LARIESMGDTQFMPTCMVKTHLSLSHDPALKGRPSGFTLPIRDILTYMGAGLVVPVAGD
FT                   IKLMPGTSSDPNFRRIDIDTQTGKVKGLF"
FT   gene            631099..631680
FT                   /locus_tag="DehaBAV1_0641"
FT   CDS_pept        631099..631680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17226"
FT                   /protein_id="ABQ17226.1"
FT                   /translation="MHELLPFYGKRQKSFLKNYMRLASLGRWPLIGALVKKYANHYARK
FT                   QHGGYLLNLAEAKDILDMSENIYLGPCSCREVFKNCDAPIMAEIIIGAGRHVYRDTLEN
FT                   FKPISRVEAMAVITTCQQAGLMTTLVHCKEHFYSICNCCRCCCVPYRLKHQYGIEFALV
FT                   RDKNIVTRFAEFLKEEGLHGVPQDIQPDKT"
FT   gene            631799..631978
FT                   /locus_tag="DehaBAV1_0642"
FT   CDS_pept        631799..631978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17227"
FT                   /protein_id="ABQ17227.1"
FT                   /translation="MAFSQSKNGSPACASVYVMGSERKDSRVILDIEAGAFGESAIKCL
FT                   LDEVNFLLGEYEKI"
FT   gene            632055..633851
FT                   /locus_tag="DehaBAV1_0643"
FT   CDS_pept        632055..633851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0643"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); GAD domain protein;
FT                   tRNA synthetase, class II (D, K and N); nucleic acid
FT                   binding, OB-fold, tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17228"
FT                   /db_xref="GOA:A5FRE3"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRE3"
FT                   /protein_id="ABQ17228.1"
FT                   /translation="MLKTHSCALTQENVGTEVTLAGWVHRRRDHGGVIFIDLRDREGIV
FT                   QVVFNPEQSAACLDIGKELRSEYVLQVKGVVSHRPAGTENNRMPSGMVEVVAVHAKILN
FT                   AAKTPPFYINEEVEVDESLRLKYRYLDIRRQGMKNNLIIRHKAVRFMREFLNDQGFIEI
FT                   ETPILIKSTPEGARDYLVPSRLFPGKFFALPQSPQQLKQLLMVAGMEKYYQVARCFRDE
FT                   DLRADRQPEFTQLDMEMSFVDEEDMMKLMEDLFTGLVANVRPDMKYNKKFPRISFADAT
FT                   EKYGCDKPDLRFGMELADITDIGASSAFGVFKNVAAQGGAIKAISAPGCGGYNKSQQEE
FT                   LINLAKKYGAAGLVPISLGVENGELKDLTMEMVKSVAAKYLALEEIKTIAERSGAKPGD
FT                   LILIVAGARKMVNTVLGEMRNQLAVKLNLCDKNELSFAFVVDFPLFQWDEEGKRWDSVH
FT                   HPFTAPLESDMPLMDTDPGRVGSRAYDVVCNGYEIAGGSIRIHQADLQRKVFHLLGYND
FT                   EQIDERFGHLLEAFEFGAPPHGGVAPGIDRFVMLLAGETSIREVISFPKNQAAQDLLFG
FT                   APSVVDDKQIRDLHIRIQAEKE"
FT   gene            633871..635214
FT                   /locus_tag="DehaBAV1_0644"
FT   CDS_pept        633871..635214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0644"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase, FKBP-type; trigger factor, C-terminal domain
FT                   protein; trigger factor, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17229"
FT                   /db_xref="GOA:A5FRE4"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRE4"
FT                   /protein_id="ABQ17229.1"
FT                   /translation="MKVTDKKIEGCQASITVEMDSTEVEEGLSKTYRRLVKKVEIPGFR
FT                   KGKAPRDVFEKYVSREKMLDELVDDIVPEACQKAIQDEEIKPFATPKVAMVTTDPFVFS
FT                   ARIPLPPVVELGDYKTIRATKETVEIAEENIDTVVDQVLHQRATWETAERPVKMGDMLL
FT                   MQVESTLNGEPYLNREDMQYSVREEAIYPAPGFGGYLVDMVAGEPKEFSIVFPEDHARA
FT                   ELAGKTAAFKVTVREIKEEKLPELNDAFAHELNPEFNTLSELRQRIRENMQDRQDDKAQ
FT                   AKFEDQIVEALIKMSKIDYPEVMVEAELDQIIEQQLQRLQSNVKSPEEFRAMLSQMTPE
FT                   DMQQRYRPLAEQRVASSLALGKLATTENLVPNDEEVDAEIEKLITDAGDKKEEEKALYN
FT                   QPETRGRLIQLLTARKTMAFIDEIALQPALEAVESKADEDEKTEEADK"
FT   gene            635211..635813
FT                   /locus_tag="DehaBAV1_0645"
FT   CDS_pept        635211..635813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0645"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14, ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17230"
FT                   /db_xref="GOA:A5FRE5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRE5"
FT                   /protein_id="ABQ17230.1"
FT                   /translation="MISPENVVPMVIESSARGERAFDIYSLLLKERIIFLGSQINDQVA
FT                   NLVIAQLLFLDREDPDKDISLYIHSPGGVISAGLAMYDTMQLIRPKVSTICVGVAASMA
FT                   TVLLCAGAKGKRYALPNATIHMHQAMGGAQGQASDIEIAAREIMRQQDILRNILVKHTG
FT                   QTMEKIVHDSDRDYYLSAQQAVEYGLIDEILQKPENK"
FT   gene            complement(635894..636880)
FT                   /locus_tag="DehaBAV1_0646"
FT   CDS_pept        complement(635894..636880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0646"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17231"
FT                   /protein_id="ABQ17231.1"
FT                   /translation="MTTCSLEAIGLGAVHVDHIYTVEQILHDGECVVTESASFPGGSGA
FT                   NTIHGLSRLGLKCGFIGAVGNDSDGNLLIKDFENAGIDNQYLMVTDEAQTGSVVSLSES
FT                   SGRRSTYVNPGANNYLNLSDINLEYLSQAKLVHMSTFFSQNEFALCHEIAERLAPDVLF
FT                   SFSPGALFAAQGLKRLAPILSRTNALFTNQLDIEKMTQKNYQRATDMCIRSGCEHVVVT
FT                   LGESRRFQRKGKITLQTYIRDKDHECHMESTVSLRKDIRTVVDTIGAADAFTTGFLFGL
FT                   MGDKPIEECGLLGDISARFCISKLGARSGLPNLEGLKERFGMHYFTN"
FT   gene            complement(636882..637703)
FT                   /locus_tag="DehaBAV1_0647"
FT   CDS_pept        complement(636882..637703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0647"
FT                   /product="Folate-dependent phosphoribosylglycinamide
FT                   formyltransferase PurN-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17232"
FT                   /protein_id="ABQ17232.1"
FT                   /translation="MFELGWFSTARGKGSRNLLTAVLDSIQKGELKARISFVFCSREPG
FT                   ESAETDAFFELVKNHKIPLVTFSYQKYKTRVNGNDEIPGSILPQWRLDYDREVINRLKE
FT                   YNPQLCVLAGYMLIMGPEMCSRYNIINLHPATPWGPKGTWKEVIWELMQQKAAETGAMI
FT                   HLVTPELDRGPVVSYCRFPIQTDSFKPLWDSIAGRTVNDIKTAEGEDNSLFKAIRHQGT
FT                   IRELPLIVRSIKAISEGRVNIRKGQVTDNCGQTIPGYDLSAEIDHLIQGRE"
FT   gene            complement(637706..638365)
FT                   /locus_tag="DehaBAV1_0648"
FT   CDS_pept        complement(637706..638365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0648"
FT                   /product="PHP C-terminal domain protein"
FT                   /note="PFAM: PHP C-terminal domain protein; SMART:
FT                   phosphoesterase PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17233"
FT                   /protein_id="ABQ17233.1"
FT                   /translation="MLKADLHVHTNYSMDSNTQPKDLISKCVEKGINCISLCDHGTAEG
FT                   ALMLAKESPIKIIISEEVLTPHGEIMGMFLKESIPSGISVDECVSRIKAQGALVCIPHP
FT                   YDGLRGSALIDTELERLASEGKIDVLEVFNSRTLLNGSLKKARKLAKQYDLPMSAGTDS
FT                   HTLPEIGTTYVTMPDFNTPKEFIAALRQGRITGRQNRMVRIRALIRKLSKYIKPEK"
FT   gene            complement(638368..638928)
FT                   /locus_tag="DehaBAV1_0649"
FT   CDS_pept        complement(638368..638928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0649"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P/YeiP protein; Elongation factor, KOW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17234"
FT                   /protein_id="ABQ17234.1"
FT                   /translation="MATGNELKKSCIIQQENGLFQVMDIQHVKMKHTALLRLKLKDIRD
FT                   GHTMEQTFQSDEKFNLVNLEYRHMQFLYNDENVYHFMDEKTFEQIALNKAILGDAVNYL
FT                   LENGSVRVMTFQEDAIGVELPASVNLRIAHTEPGFKGDTAATTTKPATLETGLVVQVPL
FT                   FINTEDLIRVDTRSGQYLGKATT"
FT   gene            complement(638944..640035)
FT                   /locus_tag="DehaBAV1_0650"
FT   CDS_pept        complement(638944..640035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0650"
FT                   /product="peptidase M24"
FT                   /note="PFAM: creatinase; peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17235"
FT                   /protein_id="ABQ17235.1"
FT                   /translation="MSQSNGQRLALLRKLMAENELDGLLVSKPENQYYLSGFSGGEGHL
FT                   FITPTQSFIAVDFRYYEQAENESPDYTLCKIINGRSLWLPELLSSESIRRLGFESSFIT
FT                   FEQYSKLKNTLSKSGLNVLLVETADLAGNLRKIKSENEIDCIKQASAIGDAAFSALPSL
FT                   LTPGMTERELAWELEKFMKSHGSQSMPFEVIAATGANSALPHAQTRPEAVADGQPLLMD
FT                   YGAKVSWYASDMTRTVLPGKPNSQFKRIYDIVLAAQQKAIDQIHSGMTGQEADAIAREV
FT                   IEKAGYGANFGHSLGHGVGLEVHEEPHLSPRSTDILENGMVFSIEPGIYLPGWGGIRIE
FT                   DTCMLKNGKIELLSKSDKQNPYI"
FT   gene            complement(640032..640955)
FT                   /locus_tag="DehaBAV1_0651"
FT   CDS_pept        complement(640032..640955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0651"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: phage
FT                   integrase family protein; phage integrase domain protein
FT                   SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17236"
FT                   /protein_id="ABQ17236.1"
FT                   /translation="MQENFNKYLEYLSVEKNVSPYTLRNYRTDLIGFVNYLIEKKVSSF
FT                   DRVDRYILRDYMSSLIAKGIVKGSIARKLSAVRSFYRYLMREGLIQKNPTLNASSPRLD
FT                   KRLPEFLTVTEVNKLLRVPDSSTPQGLRDKAFMELLYASGLRVSELVKLDIENMDLHSH
FT                   QIRVWGKGSKERVVLAGLPAIQSIQNYLNLGRPLLKGKRNTPALFLNPTGGRLSARSFQ
FT                   ERLDKLAKQAGIEKHVHPHMLRHTFATHLLDGGADLRVVQELLGHSNLSTTQIYTHVTK
FT                   SQARKVYMSSHPLARPQNNIAGREDE"
FT   gene            complement(640956..643067)
FT                   /locus_tag="DehaBAV1_0652"
FT   CDS_pept        complement(640956..643067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0652"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="TIGRFAM: DNA topoisomerase I; PFAM: TOPRIM domain
FT                   protein; DNA topoisomerase, type IA, central domain
FT                   protein; DNA topoisomerase, type IA, zn finger domain
FT                   protein; SMART: DNA topoisomerase I, ATP-binding; DNA
FT                   topoisomerase I, DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17237"
FT                   /protein_id="ABQ17237.1"
FT                   /translation="MKEKLVIVESPAKARTISKMLGKDFNIMATMGHIRDLPKSTLGVD
FT                   VENNFTPKYVSLKAKAKVIKELKEAVKHSKAIYLATDPDREGEAIAWHISEVTKANLSN
FT                   PKRVVFHEITKEAIDKAFKNTRELDMDLVNAQQARRVLDRLVGYKLSPLLWRKVQRGLS
FT                   AGRVQSVSLKIIVDREREIEKFVSTEYWNIEALLSKKVKSAAFKATLAGYVTKGKLEIH
FT                   NESEADQIKKELEVSDYQVLKIKRKSNLRQSPAPFITSTLQQEAWRKLRFSAKQTMVIA
FT                   QQLYEGLNVEGEGEVGLITYMRTDSTNVARTAVAETRDYITEKYGPAYLPKQARVFSSK
FT                   VKGAQEAHEAIRPTRINRTPDFIKKSLSADQFKLYQLIWQRMMASQMSPAVFDNTTIDI
FT                   EAKHQPSKTRYLLRTTSSVNTFPGFTIVYIEGKDEDEEKEQSSLPPMEEGEELKLKSLD
FT                   ATQHFTQPPPRYTEATLIKALEQNGIGRPSTYAPTISTIQEREYITKLKGSLKPSELGM
FT                   LVNDLLVEHFPDIIGIDFTAAMEAELDKIATEKLDWVPIIRRFYEPFIKEIEAASEKIE
FT                   KIKPPEEELDELCPECNAKLVIKRGRFGKFIACSRYSKEDDGCRYTRSYQIKTGAKCPD
FT                   CNSDIVEKYSKKGKIFYGCAGYPNCKFVSFYKPLTKPCPECGALMTKSGQNWAKCTKCG
FT                   KRKKLEDES"
FT   gene            complement(643074..644195)
FT                   /locus_tag="DehaBAV1_0653"
FT   CDS_pept        complement(643074..644195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0653"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17238"
FT                   /protein_id="ABQ17238.1"
FT                   /translation="MQNQDNNYAIGFSYINGVGRVRLNLLDNYFGNLENAWHAGKEALI
FT                   SAGLDNTLAENIVAHRPKIDLSKTLETLKRHDIQTYAHTDKDYPASLRQIHDYPPLIFV
FT                   KGQLLPADELCLGIVGTRQPTVYGKLVTEELAESLARAGLTIVSGLARGIDTVAHTAAL
FT                   KAGGRSIAVFGCGLDIIYPSENHSLARQIAEDGALISEHPPGIRPRPEFFPRRNRILSG
FT                   LCRGILVTEAGENSGAVITANYALEQNREIFAVPGSILSPSSLGTNRLIQEGAKLVSSA
FT                   KDVLEELNISLFSEENTTVEIIPENQTESLILGKLGYEPVHIDQICRECALGVALVSGT
FT                   LAIMELKGQVRSTGGMNYVRTREKKEIYQLEMN"
FT   gene            complement(644324..644413)
FT                   /locus_tag="DehaBAV1_R0010"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(644324..644413)
FT                   /locus_tag="DehaBAV1_R0010"
FT                   /product="tRNA-Ser"
FT   gene            complement(644450..644539)
FT                   /locus_tag="DehaBAV1_R0011"
FT                   /note="tRNA-Ser2"
FT   tRNA            complement(644450..644539)
FT                   /locus_tag="DehaBAV1_R0011"
FT                   /product="tRNA-Ser"
FT   gene            644691..644885
FT                   /locus_tag="DehaBAV1_0654"
FT   CDS_pept        644691..644885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0654"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17239"
FT                   /protein_id="ABQ17239.1"
FT                   /translation="MALSSLNIGKYLHVCGGLFLKIQIGLHNYAYFRQGKGFIPAGQKQ
FT                   SFWTYIQDNLLFQNIFSRG"
FT   gene            644964..646238
FT                   /locus_tag="DehaBAV1_0655"
FT   CDS_pept        644964..646238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0655"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17240"
FT                   /protein_id="ABQ17240.1"
FT                   /translation="METEIYFKFILSFGLILLVARLGGAIAERFLKQPAVIGELLAGII
FT                   ISPFLLGQFLFANDPVIMNFALIDGVFSQNGEHLSGFAPMEIISQIAVVVLLFVAGLET
FT                   NVTSFIKNSFTGAMVAIGGVVVPFALGVFSAMYFFPDLHMAGWLFIGAILTATSIGITV
FT                   RILMDMGKLSSREGTIILVAAVVDDIIGLVILSVVISMAQSGSVNALSAVTTGVIGFAV
FT                   WLGILLLGVYGHKYISKYILTPFKSSGTMPVMALIVGLIVSYLVTLVDLHPVVGAYVAG
FT                   LMFASTMEKEEILHQTRPIMLFIAPFFFAYLGMQVDLREVWAVIVPALVIVVLAIIGKI
FT                   VGCYFPARFVGKTSHNGAMIVGVGMVPRGEVGLIVAGAGLIAGAITRDLFGIAVAVSIL
FT                   TTLVMPVMIKPFFKPKAEANAKRLP"
FT   gene            646274..646345
FT                   /locus_tag="DehaBAV1_R0012"
FT                   /note="tRNA-Arg1"
FT   tRNA            646274..646345
FT                   /locus_tag="DehaBAV1_R0012"
FT                   /product="tRNA-Arg"
FT   gene            646380..646952
FT                   /locus_tag="DehaBAV1_0656"
FT   CDS_pept        646380..646952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0656"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="TIGRFAM: pyruvate/ketoisovalerate oxidoreductase,
FT                   gamma subunit; PFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17241"
FT                   /protein_id="ABQ17241.1"
FT                   /translation="MKHFIEIRWHGRGGQGAVTSAELIAQAAIGKGKYAQAFPSFGPER
FT                   RGAPVQSFNRISDNNPIRERSGINQPDIVVVLDPSLVIIGNVISGLKDGGTLIINTTKP
FT                   LEHFASQYGDRWKVATVDATAIAKEVLGVNIVNTTMLGALIKATGLADMEAFEEPLKHR
FT                   FGKLAAKNMAAMKKAFEETVVKELKVG"
FT   gene            646945..647241
FT                   /locus_tag="DehaBAV1_0657"
FT   CDS_pept        646945..647241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0657"
FT                   /product="pyruvate ferredoxin oxidoreductase, delta
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17242"
FT                   /protein_id="ABQ17242.1"
FT                   /translation="MAKQENQITWQEVTPGCIVSEPGNASQYKTGDWRSQLPIHNFKKC
FT                   IKCGVCYIFCPEGCINETKEGFFEADLFYCKGCGICAHECPTGAIVMKDEEEK"
FT   gene            647241..648413
FT                   /locus_tag="DehaBAV1_0658"
FT   CDS_pept        647241..648413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0658"
FT                   /product="pyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17243"
FT                   /protein_id="ABQ17243.1"
FT                   /translation="MPRVGLEVSIALSEAVGLCNADVIAAYPITPQTHIVEHLAEMVAE
FT                   GELDAEYIPVESEHSALSACLGSAAAGARTFTATAGQGLELMHEVLYVASSMRLPIMMA
FT                   VANRALSGPLSVWGDHSDVMSCRDIGWIQIFTENGQEVVDNTICSFKIGEDKRVLLPVM
FT                   VHLDGFHLSHVIEPIEMPERKQVDAFLSVNDYPYALNPDNPRAMGDFAPPVIFTEAKWA
FT                   QEQDFQKSKAVILEVWKDFEKQFGRSYKPVETYRTEGAENLLFTMGSFSETAMSAIDKM
FT                   RDDGMSVGLVRLRLWRPFPFEELRTAVKDAKNLIVLDRALSIGGPGGPVCSEIKAALYP
FT                   LEKKPKIVSIIGGLGGRDITVANFEDIMKKGLAIAEKGSPSEYEIYGVRA"
FT   gene            648413..649354
FT                   /locus_tag="DehaBAV1_0659"
FT   CDS_pept        648413..649354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0659"
FT                   /product="pyruvate ferredoxin oxidoreductase, beta subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17244"
FT                   /protein_id="ABQ17244.1"
FT                   /translation="MQNYSVFVPKLLPKRELFAPGHRGCIGCGEALAVRLATKAMDENT
FT                   IIVNATGCMEIIASQYPYTSWRLPWIHTLFENTAAVASGVESALKVLKRKKRIEDKDIK
FT                   IVAIGGDGATVDIGLQALSGAMERGHNFTYICFDNEAYMNTGIQRSSATPFGAATTTSP
FT                   AGKVGKGQFSWKKDMPAIAVAHNIPYVATCCPSYPFDMIEKVSKALAADGPAYIHCLSV
FT                   CPTGWRCATEDTIKIGRLAVETGVFPLYEVVNGEYKMSMETPALKPLKEYTSLQRRFRH
FT                   LTEESLDLIQERVQLEYNKIAERAACALKLEK"
FT   gene            649330..649803
FT                   /locus_tag="DehaBAV1_0660"
FT   CDS_pept        649330..649803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0660"
FT                   /product="NADH dehydrogenase (ubiquinone), 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 24 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17245"
FT                   /protein_id="ABQ17245.1"
FT                   /translation="MCTETREIVAPKVKDILNKYAKDKGMLVAILQDIQTEFNYLPRPA
FT                   LEAVSQGLGVPMSQVYSVATFFKAFSLKPKGKHSVHVCMGTACHVRGASKILDKLVEKL
FT                   GCCAGENTEDMKFSLDAVNCVGACALGPVVVVDGQYVGNMTTEKVKPLIEGCQ"
FT   gene            649803..651674
FT                   /locus_tag="DehaBAV1_0661"
FT   CDS_pept        649803..651674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0661"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.11"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; Respiratory-chain NADH dehydrogenase domain, 51
FT                   kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17246"
FT                   /protein_id="ABQ17246.1"
FT                   /translation="MSNIAIKKFSSATELEAKRQEILKSRNSGQAVIAICCGTGCQAYG
FT                   AKKVADAFEEELAKAGLGDKVEVRTTGCHGFCERGPLVVIRPQNIFYQRLKISDIPEII
FT                   EKTIKNNEVIERLLYVDPMTKEKKVHEHDVPFYKKQMRLVFGNNGNIDPTSIEDYLAVG
FT                   GYKSLAKAISSLKPDEIVEEIIKSGLRGRGGGGFPTGWKWKSCREAHDPVKYVICNCDE
FT                   GDPGAFMDRSLMEGNPHSVIEGMIIGAYAIGSHEAYIYIRDEYPMAVKHALLAIKQAED
FT                   YGLLGENILGSGFSLKIHINRGGGAFVCGESTALMASLEGKVGEPRAKYVHTSEKGLYD
FT                   KPTTLNNVETWANIPLIIEKGADWFNKIGTAGSKGTKIFSLVGKVNNTGLIEVPMGITL
FT                   REIVYDIGGGIPKGKKFKAIQTGGPSGGCLPESMLDLPVDFDELTKAGSMMGSGAMIVM
FT                   DEDNCMVEIARYFLSFLEGESCGKCVPCREGVKRMRQILEKITKGEGEEGDIEHLEQLS
FT                   QAIQDASLCALGGSAPNPVMSTIKYFREEYEAHIRQKTCPAKECKALITYNIIDANCPG
FT                   CGLCYKACATGAIISQGKKMSVILDQSKCTKCGACFDACKLHAVEIR"
FT   gene            651681..652410
FT                   /pseudo
FT                   /locus_tag="DehaBAV1_0662"
FT   gene            652466..652543
FT                   /locus_tag="DehaBAV1_R0013"
FT                   /note="tRNA-Pro1"
FT   tRNA            652466..652543
FT                   /locus_tag="DehaBAV1_R0013"
FT                   /product="tRNA-Pro"
FT   gene            652634..653323
FT                   /locus_tag="DehaBAV1_0663"
FT   CDS_pept        652634..653323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0663"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17247"
FT                   /protein_id="ABQ17247.1"
FT                   /translation="MDLKRGFGVLVVLLLAVSMFLNSQNISFGDIFSNDTPVTLDGVQI
FT                   LEYEGKDLTSILNLRDNSIFGPPEIDTVSYTLNINGLVGQELSFTYDELRTRFNPYTKV
FT                   VTLHCVEGWDATILWEGILFKDIAGMAGIKGEADTVIFHALDGYTTALSLDYLISNNIM
FT                   LAYKLNGVTLPAKYGFPLQLVAESKWGYKWIKWVSQIEFSDDENYLGTWERQGYSNDAD
FT                   LNKGFFD"
FT   sig_peptide     652634..652705
FT                   /locus_tag="DehaBAV1_0663"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.939 at
FT                   residue 24"
FT   gene            653485..654954
FT                   /locus_tag="DehaBAV1_0664"
FT   CDS_pept        653485..654954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0664"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A;
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17248"
FT                   /protein_id="ABQ17248.1"
FT                   /translation="MKFQYDLVVIGSGLAGFTSTVFANGLGKKVAMVEKGKLGGACTWN
FT                   ACVPSKTLLQIGRRVGQIKKYNQNGLKLVSVNLQTENIMPYLHSVLEDISGVDDFDNLE
FT                   KTGINILKGEAVFTDRHHISLNGQVVSAKHFIIATGSSPAIPPVEGLADIPYYTNETVF
FT                   DIKSIPSSMIVLGGGPAGIELGLAFAWLGCKVDIIEMAERILPKDDTELSGLLLDYLNA
FT                   EENLQIHVSTKAIRFQEQDNGQLKLEMQTREGKINEITAETVLVAVGRRANVAGLALEK
FT                   AGVKYTARGISVNSKLQTSSLNIFAAGDVAGPIQLGMMAEKQAILAASNACLPFKQSIR
FT                   YDDVAWVTYSEPQMAHIGLTEDEARRKYGNNIRIIRYPLTKVRRAVMDHDIRGMCKFVL
FT                   DKHDRLIGAHLLCSQAENLIHELQIVKCLHKPLSRLHTIPHIYPTYEEGIIKRAADISY
FT                   TMKMRRNPFVRLVLRYWHGYKDKLDTVINRL"
FT   sig_peptide     653485..653556
FT                   /locus_tag="DehaBAV1_0664"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            complement(654991..655065)
FT                   /locus_tag="DehaBAV1_R0014"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(654991..655065)
FT                   /locus_tag="DehaBAV1_R0014"
FT                   /product="tRNA-Gly"
FT   gene            655214..655600
FT                   /locus_tag="DehaBAV1_0665"
FT   CDS_pept        655214..655600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0665"
FT                   /product="putative regulatory protein, FmdB family"
FT                   /note="TIGRFAM: putative regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17249"
FT                   /protein_id="ABQ17249.1"
FT                   /translation="MPIYEYSCSKCNKVFEIMRPRSESSLSATCPVCSAESTRIISDFT
FT                   HGVAFSKDAPEMRKDSANEKMWISEQKVAENKIKDPDPLKKWREEREKSCGKGPEAWVE
FT                   YAKQEEAKEQKVKDYGTGFTGREV"
FT   gene            655617..655691
FT                   /locus_tag="DehaBAV1_R0015"
FT                   /note="tRNA-Met1"
FT   tRNA            655617..655691
FT                   /locus_tag="DehaBAV1_R0015"
FT                   /product="tRNA-Met"
FT   gene            complement(655779..656576)
FT                   /locus_tag="DehaBAV1_0666"
FT   CDS_pept        complement(655779..656576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0666"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17250"
FT                   /protein_id="ABQ17250.1"
FT                   /translation="MMTIAELFDLRGKVAIVTGGAMGIGKGISMRLAEAGASIMIPDLN
FT                   LEVAQKTVAEIKALGGKATAIQADVSNINDTQKVIDATLKAFGDLDIMVNNAGIYRFMP
FT                   AIDMTEAMWDKTLGINLKGLMFFSQAAAKAMMAAKHGGKIINIASIDGFRPTGNLAHYD
FT                   ASKGGVIMLTKAMAQEWAPHGILVNAVAPGGINTPGASALMPSGSMSAEQLMELSKSFV
FT                   AKLPLKRMGEPDDIGKVVLFLTSAAADYIVGSVIVADGGALLV"
FT   gene            656721..657932
FT                   /locus_tag="DehaBAV1_0667"
FT   CDS_pept        656721..657932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0667"
FT                   /product="GTP-binding protein HflX"
FT                   /EC_number="3.1.5.-"
FT                   /note="PFAM: GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17251"
FT                   /protein_id="ABQ17251.1"
FT                   /translation="MEDTINKTVGNNVVIQPERAVLAAVDTNRNSNWAIEDSLDELCQL
FT                   VATAGATVVGRIIQKLHAPARNSYLGKGKLDELIEMKKELDYNLVIFDDELSPIQQRSL
FT                   EEALGVKVIDRVALILDIFAKHANTREGQLQVELAQMQYLLPRLAGQWSHLERLGGGIG
FT                   TRGPGESQLETDKRIVRTKIRNLKEHLDEVTIQRELYRERRRMRGVPVVSLVGYTNSGK
FT                   SSLLNAVARTDVLAENKLFATLDPTTRRLYINGLGNVLLTDTVGFIRKLPPAIVKAFRA
FT                   TLEEINQADLLVHVVDITAKNAFEQCQTVEKILTDMGVADKPRLTAMNKIDLKLDTNRN
FT                   WTEEEALNLLKTECPVAENTVLISAVKRWGLIELNLMLKEKLISMGFNPGYAVYDEIGE
FT                   KKEQ"
FT   gene            657936..658148
FT                   /locus_tag="DehaBAV1_0668"
FT   CDS_pept        657936..658148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0668"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17252"
FT                   /protein_id="ABQ17252.1"
FT                   /translation="MENELAGNIMSCFDELALGLSRRRELLARKGACENYYFYYDLAAI
FT                   DEEESKALNRLNNLVKQDIERNTAI"
FT   gene            complement(658776..659942)
FT                   /locus_tag="DehaBAV1_0669"
FT   CDS_pept        complement(658776..659942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0669"
FT                   /product="LL-diaminopimelate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.83"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17253"
FT                   /db_xref="GOA:A5FRC5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019881"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRC5"
FT                   /protein_id="ABQ17253.1"
FT                   /translation="MKLSKRIENLPPYLFVQISKKIAEKRAKGEDVISFAIGDPDLPTP
FT                   KHILAELCKAAEDPSNHRYPETEGLPVLRKAMAEWYQKRFGVKLNPDTEVLPLIGSKEG
FT                   IGHAAWCFLDPGDIALVPNPAYPVYAISSQLAGAEVFNLPLNKGNNFLPNLEAIPQNIL
FT                   SKAKVLWINYPNNPTGAVAGLSFFQEVANFAAKHNLAVCHDGPYSEIAFDGYKPVSFLE
FT                   ADGAKDVGIEFHSLSKSYNMTGWRIGMAVGNAKMIDALRRFKSNLDSGIPQAIQLMAIA
FT                   ALNGSQEIINQNCAIYQRRRDRLVEALRNIGMEVTAPKASLYIWAPVPESYTSASFATE
FT                   LLDKTGVVVTPGTGYGTAGEGYIRLSLTVPDEQIEKGIAKLAGYKKSS"
FT   gene            complement(659929..660783)
FT                   /locus_tag="DehaBAV1_0670"
FT   CDS_pept        complement(659929..660783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0670"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17254"
FT                   /protein_id="ABQ17254.1"
FT                   /translation="MKFTKLQSVGNDFVLLDPQGEEQDWPKLALHMCHRHFGAGADGLM
FT                   LILPSEKADFRMRIFNADGSEAEICGNGLRCLIHYIAVNKLLGNLDELSIETLAGMRHA
FT                   QIFKDGRIRTTMGKPMFEAHQIPVAAEPDPKHYNGQLISDFPLNINNRRVLVSLVSMGN
FT                   PHAIHFCTKPVEEFPLGEVGSQVEIHKAFPKRTNFEVANILDTEHIKVRVWERGVGETL
FT                   GCGSGASAVAVAAQILGYVGKFVYIKLPGGTLGVEWDGHDDVYLTGKAEIIYTGEWLKD
FT                   EII"
FT   gene            complement(660770..661756)
FT                   /locus_tag="DehaBAV1_0671"
FT   CDS_pept        complement(660770..661756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0671"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="TIGRFAM: tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; PFAM: tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17255"
FT                   /db_xref="GOA:A5FRB5"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRB5"
FT                   /protein_id="ABQ17255.1"
FT                   /translation="MSIIDSTTGANASNLPLSPLLVILGNTGSGKSALAINLAKVIPAG
FT                   IINADSRQIYSRMDIATAKPTLSEMLEIPHYLYSFIQPDQPFSLAEYQTLAYQAIDSLH
FT                   TQNRLPVLVGGSGQYLKAVLEGWSIPPVAPDETFRAALFEKAEKEGGDVIFTELEKKDP
FT                   QAATQIDPRNIRRVVRALEVIHKTGGKFSGLLIKNPPPYRVFKIGIHIPREELYRTVDL
FT                   RVEKMLEQGLEAEVRSLLEKGYKASLPSMSGIGYRQIAKYIEGGISLTEAVEQMKFETH
FT                   RLIRQQNTYFRLTDTNIHWITLEESRSNGIIQLVCDFLAAENKNEIH"
FT   gene            complement(661818..662579)
FT                   /locus_tag="DehaBAV1_0672"
FT   CDS_pept        complement(661818..662579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0672"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17256"
FT                   /db_xref="GOA:A5FRB6"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRB6"
FT                   /protein_id="ABQ17256.1"
FT                   /translation="MRQIIIAGNWKMNTTLSEACTLVQSMKCELERIEGIEKIICPPFI
FT                   SLYPIKTMLENSSIKLGAQNLFYQEKGAYTGEISPLMLKELCQYVIIGHSERRAYFGET
FT                   GQVVNQKIKAALQAGLLPIVCVGEKPEENENGQTRQVLETQLKEALDGLNLSCIIIAYE
FT                   PIWAIGTGKAATASEANSAIGYIRRVLGDTLGNAAAQTSPILYGGSVNEKNITEILSQT
FT                   NIDGALVGGASLKAESFVSICRQAAVIQNKH"
FT   gene            complement(662591..663796)
FT                   /locus_tag="DehaBAV1_0673"
FT   CDS_pept        complement(662591..663796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0673"
FT                   /product="phosphoglycerate mutase"
FT                   /note="TIGRFAM: phosphonopyruvate decarboxylase-related
FT                   protein; PFAM: metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17257"
FT                   /protein_id="ABQ17257.1"
FT                   /translation="MNKLNLVSQLSQTTPSKIVLLVIDGLGGLPHPESGQTELETARTP
FT                   NLDELARKSICGMASPVAAGITPGSAPGHLGLFGYDPVDCLIGRGVLEALGIDFDLKPG
FT                   DVATRGNFCTVDKQGLICDRRAGRVSSLVSAKLCTLLDGQEFDGIRVIVKPVKDHRLVV
FT                   IFRGSGLSEKVTDSDPQKLGAVPEEVKPLAENARLMAKVANRFLQFAAKTLKDHAPANM
FT                   ILLRGFSEKPCFATMNEIYKLKTAAIASYPMYRGLSKVVGMDVLPTGSMLSDEIATYKA
FT                   NFEKYDFFFLHVKATDAAGEDGDFERKVKALEELDQILPEILSLKPDVVAISGDHSTPA
FT                   VIQGHSWHEVPVLIYSKYCRPDKVCRFSETDCLQGGLGHIPASDIMPLAMANALKLGKF
FT                   GA"
FT   gene            complement(663789..664982)
FT                   /locus_tag="DehaBAV1_0674"
FT   CDS_pept        complement(663789..664982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0674"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17258"
FT                   /protein_id="ABQ17258.1"
FT                   /translation="MENLTIRDLNFSGKKALVRVDFNVPINEETGTINDSSRIRAAIPT
FT                   IDYLLDHQAKVILCSHLGRPDGMIVESMRLAPVAKRLSEILRQEVFTASDCIGDEVAAK
FT                   VDALEDSQVLLLENLRFHPEEEANDPIFAKKLADLADIYVDDAFGTAHRKHASIVGVAK
FT                   YLPAVAGLLLEKELNALGKVLEHPPRPFMILLGGAKVSDKVGMLENVMDKVDTILIGGG
FT                   MAATFLKAQGLEIGDSLIDDSLDTAKMLMDKAKSKNVKIILPDDVLVTFDKIGPEARAE
FT                   NVSVENIPHTAKIVDIGLLTITHFTKHLEKCKTVFWNGPMGIYEIPQFSEGTRAMVNTM
FT                   TRLHATTIIGGGSTAEIVTELNIASKMSFVSTGGGASLKFLSGEKLPGVEVLAKKNE"
FT   gene            complement(665082..666983)
FT                   /locus_tag="DehaBAV1_0675"
FT   CDS_pept        complement(665082..666983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0675"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase, central region; Transketolase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17259"
FT                   /db_xref="GOA:A5FRB9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRB9"
FT                   /protein_id="ABQ17259.1"
FT                   /translation="MSKLLDTINSPSDLKKLSLDELRELAVQIREELVNRVTLNGGHLA
FT                   SSLGVVELTIALHRVFESPKDKIIWDVGHQSYAHKLLTGRREQFATLRQHGGLSGFTCR
FT                   DESPHDPFGAGHASTSISAGLGMAVARDLAKEDYSVISVIGDGAISGGMSFEAINNAGH
FT                   LHTKFIVILNDNGMAISPSTGALSKFLNNVRFDPRFEFAKRNAKQTITNMPFGKAVWAF
FT                   TKSIKRKFEKSMLPGSLWEELGFIYLGPVDGHNIRELEAALKRAKDFESKPVLIHMITK
FT                   KGKGYDDAEADAVKYHGISPKSGGLKSSHGLSYSQVFGQTLHKIMSQNPQVVAITAAMT
FT                   DGCGLGEIAAAFPDRVFDVGICEQHAVTFAAGMATQGYIPVVVIYSTFLQRGFDQIIHD
FT                   VCLQKLPVVFAIDRGGIVGDDGKTHQGIFDLSFMSLIPDMVVSAPSDENDLQHLLYTAV
FT                   NSGKPFALRYPRGFGEGVEIESSLHNIPIGQNEILVNGSDVAILATGKSVAFAREALEI
FT                   LTESGIKPTLVNNRYISPLDSELVLKIAQSHKYLVTVEENVISGGLGSRINTLLAEAGL
FT                   VNKIKIANIGIPDKFVEHGNQSLLRAKYGLDGKGIAQRVLSLVGNPNEMKHPQIICP"
FT   gene            667147..667698
FT                   /locus_tag="DehaBAV1_0676"
FT   CDS_pept        667147..667698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0676"
FT                   /product="putative small multi-drug export"
FT                   /note="PFAM: putative small multi-drug export"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17260"
FT                   /protein_id="ABQ17260.1"
FT                   /translation="MSSEFWLGLGLPPELLVFLAAVLPVSELRGALPLAINVFGIPWYW
FT                   AYLIALAGNLLPIPVVLVLLEKVLNLLERFSFMRGFTRWIYALGQRRSTPVEKYKRIGL
FT                   MMLVAVPLPVTGAWTGSLVAVVLGLNYKEALIYISLGVAIAGVIVTSLCLLGWFGAILA
FT                   GGVLGGIGVYRIIHSKNRPL"
FT   gene            667738..667814
FT                   /locus_tag="DehaBAV1_R0016"
FT                   /note="tRNA-Arg2"
FT   tRNA            667738..667814
FT                   /locus_tag="DehaBAV1_R0016"
FT                   /product="tRNA-Arg"
FT   gene            complement(668208..669608)
FT                   /locus_tag="DehaBAV1_0677"
FT   CDS_pept        complement(668208..669608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0677"
FT                   /product="putative GAF sensor protein"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17261"
FT                   /protein_id="ABQ17261.1"
FT                   /translation="MNKERAFYKAVSRSIQSLNTPAELKAKLEGIIRLAARASHCAVSL
FT                   LLIDAAGQKLSHNISFGLPQFYIHKGVLSAADSIGETVNIQTTAITDVQNDHRIQFPQM
FT                   ALKAGFSSILGSPIIYREKVIGSIRFYCKDFYEFSQQDITFAENMARIISLAFCTLPTT
FT                   TAPVDNTASMPASNLKTAQNITFAHQSETEFARLLDFYNIEWIYEPRSFPLDWEGELVT
FT                   EMFTPDFYLPGLDMYIELTTLKQSLVTTKNHKLKMLRELYPDIKISLLYKNDYARLLSK
FT                   YGCGPLAQTRAHGIDRVLYTAGDIAERVASLARQISDDYPDNRPILIGVQRGFICFMAD
FT                   LIRQIAIPLDIDFMTISYYSGSNASMVRITKDMDLEVAGRDVLLVEDIVDTGITLNYLL
FT                   NHLRSKNPASLKVCTLLDRKVRRLIDINIDYVGFELPDEFVVGYGLDYHEEYRNLPFIG
FT                   IPGIKQNP"
FT   gene            complement(669721..670080)
FT                   /locus_tag="DehaBAV1_0678"
FT   CDS_pept        complement(669721..670080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0678"
FT                   /product="LSU ribosomal protein L20P"
FT                   /note="TIGRFAM: ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17262"
FT                   /db_xref="GOA:A5FRB0"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRB0"
FT                   /protein_id="ABQ17262.1"
FT                   /translation="MARIKGGLATHKRHKKVLALTKGHASTRHSLFKRAHESMVHAMSY
FT                   AFAHRRARKGDMRRLWITRINAAARAEGLTYGELISGLKVAGIDINRKVLADMAISDTV
FT                   AFAAVAAKAAAAKAN"
FT   gene            complement(670099..670302)
FT                   /locus_tag="DehaBAV1_0679"
FT   CDS_pept        complement(670099..670302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0679"
FT                   /product="LSU ribosomal protein L35P"
FT                   /note="PFAM: ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17263"
FT                   /db_xref="GOA:A5FRB1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRB1"
FT                   /protein_id="ABQ17263.1"
FT                   /translation="MPKMKTRKTAAKRFHVTGTGKIMRSKGMKSHLRRNKSARVLRQFD
FT                   EMSQVAGVDRARIQKLIPYGVS"
FT   gene            complement(670295..670768)
FT                   /locus_tag="DehaBAV1_0680"
FT   CDS_pept        complement(670295..670768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0680"
FT                   /product="bacterial translation initiation factor 3
FT                   (bIF-3)"
FT                   /note="PFAM: initiation factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17264"
FT                   /protein_id="ABQ17264.1"
FT                   /translation="MPILQAREQARKINLDLVEVAPTAVPPVCRLMDYGKYRFEQTKKD
FT                   REAKRTQKVSLLKEIRVRPKIGEHDFDAKARSARKQLESGDKVKLTVMFRGREITHAEL
FT                   GLRLLKKMADSLTDIATIEGQPSLLGSRMHLTLLPKAAIKVSKVKEGQETANA"
FT   gene            complement(670919..672667)
FT                   /locus_tag="DehaBAV1_0681"
FT   CDS_pept        complement(670919..672667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0681"
FT                   /product="Ser-tRNA(Thr) hydrolase / threonyl-tRNA
FT                   synthetase"
FT                   /EC_number="3.1.1.-"
FT                   /EC_number="6.1.1.3"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein; Threonyl/alanyl tRNA synthetase, SAD"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17265"
FT                   /db_xref="GOA:A5FRB3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRB3"
FT                   /protein_id="ABQ17265.1"
FT                   /translation="MANQIDESKPISDLEIMRHSAAHIMAEAVLSMFPEAKLGIGPAID
FT                   TGFYYDFDLPRTLTPEDLPEIETRMNQLVKSNLPFRREEMSKDEARKLFANQPYKLELL
FT                   NDITDETVSIYRQGNFCDLCRGPHVNYTSKVKAFKLLSIAGAYWRGDEKRPMLQRIYGA
FT                   AFLDKASLAEYLNMLEEAAKRDHRKLGKELELFSLHQEIGGGLVNWLPNGAIVRHLIEE
FT                   FWKKEHLKRGYDLVYTPHIAKVDLWKTSGHWGFYRENMYSPMDIDGEEYVLKPMNCVYH
FT                   ILMFKNRTRSYKELPIRMAELGTVYRYERSGVLHGLSRVRGFTQDDAHIFCLYDQLEKE
FT                   VVKVLDLAKFMIDTFGFTKYKVMLSTRPEKYVGELDKWEYATDILAKALEANQIPYQVD
FT                   PGEGVFYGPKIDIKFEDALGRAWQGPTIQVDFQLPERFDVSVVGEDGKDQPVAMVHRTV
FT                   LGSMERFMSCLTEQYGGAFPAWLSPKQAMVIPIADRHTEFAEKLACELREEEVRVEVDS
FT                   RSETMNQKIRQAQLAKIPYMLVVGDKEIETQSVAVRTRTGSQQVMPFAEFKSMLLAKIK
FT                   TKSTEI"
FT   gene            complement(672793..675324)
FT                   /locus_tag="DehaBAV1_0682"
FT   CDS_pept        complement(672793..675324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17266"
FT                   /protein_id="ABQ17266.1"
FT                   /translation="MEGKKNISSNNEPVAQPKILTKPLPQILDEMDANIRAAAEAARRA
FT                   QEAAVTAGKAAESATHAANLAEKRAEDARLAGEKAAETATRAAAEAAAAAEKTAKLATN
FT                   AANEALKAAELASRKAEDAERGAAKAADDFKRVAEEAARRAEAASQAARDAADNAILVA
FT                   ESAAQRAEDAGENARQAAEKAIREAQDATIAAIQASELATNAAEDAAHRAEQASALARK
FT                   TAEDATNASREAVLKAEEAARKAEAASLAATNAAENATKSASEAAKRAEAASLAAKEAA
FT                   AMATAAAMAAAKKAEEASAIAKSAAEQAIKAANEAALRAEAAAKAATLKAEEALLASKK
FT                   AAAEAIASASEAAMSAAMKSEAAVAAAKSSAEKAILVAEDAARKAEAAAAEASKKAENA
FT                   SLLSTQKAEEAIKAADLAAKRAEAAALAATQKADEAVKIAGEAAKLAAANATNAANEAA
FT                   KRAEAAAAAATKKAEEAIAAAKLAVDEAVKAATKAAEDAAKKAQLAAEEATRRAEQASA
FT                   AAAAAAAAAASRAEEAAYKAEDTAKAAKLAAEEATNRADEVALTAKETALANKKAAEAS
FT                   AIRASQIALTAKAELDKTILAANKAGNNATEATAAANTATTEANTRKDANSARKADEAG
FT                   RKAKMAATAALQLAEETARKASLAEMAGDEALEAATRVSGDIAKRAEDAGYAAKESAKS
FT                   GFKVAEETRKKATLADEAGDAAIHASMSIIQDLINRAEQVGIDAKRSAEDFAKISRSQA
FT                   EAMMRDAQMKAAAEVEKARRAAEDAGAKAESIANAAKLAAEEAMSKAQEALVKAVIKRL
FT                   TSWEWISILVIINLSIVFAAVLLATAFGALI"
FT   gene            complement(675466..676872)
FT                   /locus_tag="DehaBAV1_0683"
FT   CDS_pept        complement(675466..676872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17267"
FT                   /protein_id="ABQ17267.1"
FT                   /translation="MENKSPALGQHVDQPGPKIMTKPLPIILDEMEANIRAAAEAARRA
FT                   EEAAKQASASAGTSMRAAEVAEKRAEDARLAGENAAAVAKKAAAEAVAKAAEATAKAQE
FT                   AILRSVEADRAAVKAAETFKKAAEEASEKARASAAEAAAQASLSAEEAARRAEEAAMRA
FT                   EETARAAIYAAEEATAKADEVARSSKEAALAAQRAAEQAAIRAEEIAKAAKEALERLIK
FT                   QAEKNSVEVAAAITAAKSAGKDATIKLTTEAGKTADDAGRKAKEMAISALHLSEQLSHK
FT                   AEMADVAGDEAIEAATKVSGKLATAVDEAGRMAKESAANGFKIAENMAQQAVSADKAGD
FT                   DAIRTAMSILQELASRAESTAKSAAERATGAEATAKAAAERATGAETTARAAADRAVAE
FT                   VSRVRQTAEEVAQSARRAAEEALAKAEEALVKAVIKRLTSWEWIVILVVINLSIVFAAV
FT                   LIATALGALI"
FT   gene            complement(677376..677460)
FT                   /locus_tag="DehaBAV1_R0017"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(677376..677460)
FT                   /locus_tag="DehaBAV1_R0017"
FT                   /product="tRNA-Leu"
FT   gene            677558..677926
FT                   /locus_tag="DehaBAV1_0684"
FT   CDS_pept        677558..677926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17268"
FT                   /protein_id="ABQ17268.1"
FT                   /translation="MIVLFGNKSYFDILGYMVTTCPGCKTTSVMTVEQQRKKLTVYFIP
FT                   TFDFSRKQYMYCGHCHERFEIDKSLQSTVKARLLSKKQMEKLMVELEMEKPRYECANCE
FT                   SRIEAGMKFCPQCGNNLG"
FT   gene            677937..678599
FT                   /locus_tag="DehaBAV1_0685"
FT   CDS_pept        677937..678599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0685"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17269"
FT                   /protein_id="ABQ17269.1"
FT                   /translation="MYENIAQNVRDILAELPPDVVLVAAVKKRQPAEILAAIAAGVKII
FT                   GHNYLSEAEETYPFIGDKAEWHFIGKLQSNKCKKIVRLFSVVETVDSFEIASELNRRAA
FT                   EIDKVMSVFIEINSGREKQKSGVLPEETVELAKRISGLSNLKLAGLMTMGPALEDPEEL
FT                   RTIFRLTKIKFDEIAVMGLPNTELKFLSMGMSVSYKVAVQEGTNLVRLGTRIFGNRP"
FT   gene            complement(678596..679255)
FT                   /locus_tag="DehaBAV1_0686"
FT   CDS_pept        complement(678596..679255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0686"
FT                   /product="2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17270"
FT                   /protein_id="ABQ17270.1"
FT                   /translation="MPFSHNPKLMFQSDFDGTLTEGDVSFLILEKYAQGDWCAILREYQ
FT                   QGKISVGDFNYRAFALVKEDRETLVEFIRKNAVPKKGIYELINYCRQENIRFSVVSNGL
FT                   DFYIHTMLEELGFKDIEINAARTLFTSNGLDARYYGPDGKMVENGFKESYTNHFISQNY
FT                   QVIYAGNGPSDFPPAKLCEYTFATDMLLDRFKQSNLPCYPFQDLHDVVSRLKTIPR"
FT   gene            complement(679279..679782)
FT                   /locus_tag="DehaBAV1_0687"
FT   CDS_pept        complement(679279..679782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0687"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17271"
FT                   /db_xref="GOA:A5FRA7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FRA7"
FT                   /protein_id="ABQ17271.1"
FT                   /translation="MAIRRICELPEPVLRKKAKKVPSIDGSIQTLIDDMIETMNSADGA
FT                   GLAAPQVGVSLRLVVFREPDTKEATVLINPEIIKKEGQRQVTEGCLSIPGYFGELTRAE
FT                   TVTAKGLDRHGKACRIKGTGIVAQLLEHETEHLDGILYIDHLESEDQLHEIGPDDEMPE
FT                   EIRE"
FT   gene            679908..679984
FT                   /locus_tag="DehaBAV1_R0018"
FT                   /note="tRNA-Pro2"
FT   tRNA            679908..679984
FT                   /locus_tag="DehaBAV1_R0018"
FT                   /product="tRNA-Pro"
FT   gene            complement(680068..680871)
FT                   /locus_tag="DehaBAV1_0688"
FT   CDS_pept        complement(680068..680871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17272"
FT                   /protein_id="ABQ17272.1"
FT                   /translation="MANKKVKQSESNQLQTFKKLRVYNLVMGSFHLAQSILILFLSNNF
FT                   SLPVTTNFIGGGPGGITFKPPEMLFDLPIGPMVAIFLLLSAIAHFLLSSPGVFEWYKTN
FT                   LSKGINYARWYEYALSSSVMIVLIAMLSGIYDVATLIAIFGANAAMNLFGLMMELHNQT
FT                   TPKTNWLSYTFGCFAGFMPWVAISIYFFGAISQASDNIPTFVYFILPTLFIFFFSFALN
FT                   MWLQYKKVGKWRDYLFGERVYILLSLTAKTALAWQVFGGALAGGS"
FT   gene            complement(680929..681330)
FT                   /locus_tag="DehaBAV1_0689"
FT   CDS_pept        complement(680929..681330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17273"
FT                   /protein_id="ABQ17273.1"
FT                   /translation="MSGLLVYLIVLVLIFVLDLIWIGLIAKKFYVTELSPIARWSGGGM
FT                   SPDWPSAILVYLLISLGIVAMALPLAEDNIFAALAYGGLFGFITYGIHDLTNYSTLNSF
FT                   SLKMALVDIGWGTFLGAAAGLTGGILYSL"
FT   gene            complement(681340..681999)
FT                   /locus_tag="DehaBAV1_0690"
FT   CDS_pept        complement(681340..681999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0690"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17274"
FT                   /protein_id="ABQ17274.1"
FT                   /translation="MQIYEKTINVVIGTTNLPGDLAIPPEPIGLVIFVHGSGSNHQSPR
FT                   NRQVAHQLNSYGLATFLFDLLTPKEDMVDILIANTRYNFRFLADRVIKVTEMLKAREET
FT                   QDLPLGYFGASTGAAVALYASALLPRQIKAVVSRGGRPDLARELLPMVESPTLFIVGEN
FT                   DSQVLKLNTQSQKQMRAPNHLCILPGAGHLFEEPGALEKVAELAGGWFIEYMEKQV"
FT   gene            682212..682376
FT                   /locus_tag="DehaBAV1_0691"
FT   CDS_pept        682212..682376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17275"
FT                   /protein_id="ABQ17275.1"
FT                   /translation="MKVTINACPKCKKERVIRIEDENNLYEYREKYVHQDCTKCVAKEM
FT                   ESKAVGASA"
FT   gene            complement(682448..684574)
FT                   /locus_tag="DehaBAV1_0692"
FT   CDS_pept        complement(682448..684574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0692"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="TIGRFAM: V-type H(+)-translocating pyrophosphatase;
FT                   PFAM: Inorganic H+ pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17276"
FT                   /protein_id="ABQ17276.1"
FT                   /translation="MDLSWLVWTAGLIAVLFALYLIRDVMRRDSGTPAMQDIAGRILEG
FT                   AVAFLRRQYRTIAILAVVAAVAVGAVVGLLGGERGLEAYGITGIGIAWRTALAFLAGAL
FT                   CSGISGVIGMYISVKSNLRCAAAAAKGGLSEAVTVAIRGGAVSGFLIVALSLLGVAGIY
FT                   YMYGGNPEVTPHLIIGFGFGASFVALFAQLGGGIYTKAADMGADLVGKVEAGIPEDDPR
FT                   NAAVIADLVGDNVGDCAGRGADLFESTAAENIGAMILGITLYLATGNAAWVLFPLVVRA
FT                   FGILASIVGIMFVRGKDNESPMNALNRGYFTAVGLSIIGIFIANQTIGGDLWLFGAGVI
FT                   GILTSVAMVFITQYYTEFRYKPVQEIANASRTGAATNIVSGTAVGLETAMPTAITIGAA
FT                   LLLSYWMGGQTGIAGGAVFGTAAATMGMLMTCPFILAMDTFGPITDNANGVIEMAGVGG
FT                   KVRKITDRLDAVGNTTKALTKGYALASAGLAAFLLFEAYLERVAFLRGETEMMAVDLSR
FT                   IEVFVGGLLAVALVFFFSAVAIKAVGRTASKIIEEVRRQFKADPGILAGTSRPDYARAV
FT                   DITAAAGLREMIFPGLLPVLSPIVLGVFLKLTGYDSAMAIAGFLMVGTIGGIMMAAYLN
FT                   NSGGAWDNAKKYIETGEMLEKDGSPVLKHTVTHAATVVGDTVGDPFKDTAGPSIHVLIK
FT                   LLSTITLVLAPLFI"
FT   gene            684764..684994
FT                   /locus_tag="DehaBAV1_0693"
FT   CDS_pept        684764..684994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17277"
FT                   /protein_id="ABQ17277.1"
FT                   /translation="MGIASFVIGLFSLVSMVVGLIPLLGTINFFNFFFALIGLGLGVGG
FT                   MLHSPRHRLSLAGIVLCGLSLVLGFVKYILG"
FT   gene            complement(685062..685391)
FT                   /locus_tag="DehaBAV1_0694"
FT   CDS_pept        complement(685062..685391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0694"
FT                   /product="protein of unknown function UPF0132"
FT                   /note="PFAM: protein of unknown function UPF0132"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17278"
FT                   /protein_id="ABQ17278.1"
FT                   /translation="MIKTSTGLQENIAGLLCYVLAWISAIIFLILEKDNKFVRFHAYQS
FT                   LVVFGSLQIIGLVLTIIPLLGVFISWAISVLSFILWIVLIVKASQGLKYKLPIAGDIAE
FT                   RWANK"
FT   gene            complement(685463..686602)
FT                   /locus_tag="DehaBAV1_0695"
FT   CDS_pept        complement(685463..686602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0695"
FT                   /product="peptidase M50"
FT                   /note="PFAM: CBS domain containing protein; peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17279"
FT                   /protein_id="ABQ17279.1"
FT                   /translation="MKSSFKLGRILGIEIGIHASWFIIFALLSWSLAVAYYPSIDENIS
FT                   PFTGWTLGILSSLLLFSSVLAHELGHSFIAIRQGIPVKSIDLFIFGGVSNLTKEPDNPA
FT                   AEFRMAISGPAVSIVLALVFWVFQIVFSSQNATLAGVFLYLAQINAMLAIFNLIPGFPL
FT                   DGGRVLRAIIWNASNDIRRATRISAGVGLGFAYLLIFGGIAAAFLGIGISGLWLALIGW
FT                   FLASAAQGSFQQTVISEILREVNVSRVMKREFKTIEPDNTLHQALHEYILPLNQRALPV
FT                   FENGKLAGLISLSDIKKIPTNQLNQTSVRQAMTPFEKLRTVGPEEHLGNVLNLLQSEDI
FT                   NQLPVLSEGKLIGLISRTNLIEYLQMRQEMETGQLNSKH"
FT   gene            complement(686629..687429)
FT                   /locus_tag="DehaBAV1_0696"
FT   CDS_pept        complement(686629..687429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0696"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17280"
FT                   /protein_id="ABQ17280.1"
FT                   /translation="MQNSGINLDEALNQYLNDNSNKKIHQNSLVHFTRWCGKDKLVCRM
FT                   TAIEVSRYPECISSSDKEVSVKLQSIRAFLTYLNEQGWVDYNLSSHIKIKKLASRKSAT
FT                   RTSQNAVEKIPMTASGYKKLEDELCILKVKRIAVIEEMRLAALDKDMRENAPYHAAKEQ
FT                   RGQIEGRIKEIEHELKHAEVSEYTDNNTSKVNMGNTVKLRDLKNGEQCIYTLVSPKEIE
FT                   PLKGRISASSPIGKALFNRSKGDNIEIEVPSGTLQYVIEDISFK"
FT   gene            complement(687460..688641)
FT                   /locus_tag="DehaBAV1_0697"
FT   CDS_pept        complement(687460..688641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0697"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17281"
FT                   /protein_id="ABQ17281.1"
FT                   /translation="MPIVFFAKKPDNVTMNTDVLVIGAGPVGLHTAKCLAECGYEVRLL
FT                   EKKPEAAKQVCCTGIISTECASKYGFDGKYIQNYFSEASVYSPVGQKLLLKRDTPQAIM
FT                   LDRASFQAKLLQQAINCGVRTSFGFQANSIEYIENGLRITTKEGQSFTAKAVVLAAGYN
FT                   TALSRATGLGEINNFAYGLQAEVDTSIPANLSLFTGKAISQGYFGWLSPINDCTAKMGL
FT                   LTRKNPFECWSALHNTLYKQGLITAKHINYVCRPVPIGNLSASFGDRVLAVGDFAGQLK
FT                   PTTGGGIYFGLLCADLAVSCLDKNIKTNKISKANLAEYEKNWKSLIGSELYIGRLLSRA
FT                   YTGIDDRLLEQIFKKCATSGMIEKMAAKSHLGFDWHGKAFGHLLKNPFDLVRS"
FT   gene            688740..688976
FT                   /locus_tag="DehaBAV1_0698"
FT   CDS_pept        688740..688976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17282"
FT                   /protein_id="ABQ17282.1"
FT                   /translation="MIVTVTSVTTATAAGLASVIGGVSLAALIVFLIAREMALARKSDF
FT                   SMRIARYLHISILPLFLVMGVIVITRVMETLAQ"
FT   sig_peptide     688740..688820
FT                   /locus_tag="DehaBAV1_0698"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.977 at
FT                   residue 27"
FT   gene            complement(688965..689705)
FT                   /locus_tag="DehaBAV1_0699"
FT   CDS_pept        complement(688965..689705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0699"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17283"
FT                   /protein_id="ABQ17283.1"
FT                   /translation="MPSALFYLLIITTAEIVTVAFHPLLGLGIYTVLLFSIIIQVAKTN
FT                   RFHPDRLILALSLVALIRIISLAMPLSDIPQIWWYPIIYLPLLIATIMVAKMLEYTFKD
FT                   IGLIWGKIPVQILIGLTGIGLGFAEYAILKPDAIAETLNWSNLILPGIILLLTTGFVEE
FT                   LIFRGVLQKAALDSFGSRGIIYISLIFAVLHIGFFSILDIFFVFGVALVFGYLVKKTGS
FT                   ILGVTIAHGLTNIILFAIAPLLLG"
FT   gene            complement(689698..690810)
FT                   /locus_tag="DehaBAV1_0700"
FT   CDS_pept        complement(689698..690810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0700"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17284"
FT                   /protein_id="ABQ17284.1"
FT                   /translation="MEQGINIGKLFGIQFRLHYGWFIIFGLVSVFLATQVFPDTLDNAT
FT                   NLQLWIMGICTSLLFFASVIVHELAHSLVGKANGMKVKSITLFIFGGAANMSEEAETAG
FT                   SEFKMALAGPAASLGLSGIFYVLYINLNGQSPELAIMNYWLAQINLILAVFNLIPGFPL
FT                   DGGRILRAVFWQTTKDLAKSTRISTIAGQIFGYLFILAGVFILIRTQDWLSGIWLGLLG
FT                   WYLSDTARNSLRQYTLQQILKRVTPVEVVASDIPRAKSTQIFADYLTQTPNGDYILVED
FT                   ENGLAGIINQHSLKNKDNLKSTLAELYTPINEIPVIPSDTNALDIARRMNEDKIEIVRL
FT                   ASEDTRVSFITLDSLIAYMNKASEKGFTDA"
FT   gene            complement(690846..692141)
FT                   /locus_tag="DehaBAV1_0701"
FT   CDS_pept        complement(690846..692141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0701"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17285"
FT                   /db_xref="GOA:A5FR94"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR94"
FT                   /protein_id="ABQ17285.1"
FT                   /translation="MTQLKQARKGIVTPEMEAVAKTEGLQPEFILKGIADGNIVIPVNK
FT                   LRKNLKLCGIGKGLSTKVNANIGTSTDFGSVASEVEKLKMAEMVGADTIMDLSTGPKIN
FT                   TIRKAILENTCLPLGTVPVYQAAVEAKDRYGAMVKMTADDLFGAIESQAREGVDFVTVH
FT                   CGVTRQVIDTFKGQGRLTDIVSRGGTFTAGWMVFHGAENPLYEHFDRLLDICREYDVTL
FT                   SLGDGLRPGCIADATDRAQVAELLVLGELVKRAREAEVQVMVEGPGHVPLNQIEANVRL
FT                   QKSICEDAPFYVLGPLVTDIAPGYDHITGAIGGAIAAAAGADFLCYVTPAEHLSLPDVT
FT                   DVRNGVIASRIAAHAADIVKGVNGAAERDRQMAIARKKLDWETQLKLSLDPEHARVTRD
FT                   RFKTRGKACSMCGDFCAMELAEKHLGVSVSRC"
FT   misc_binding    complement(692193..692288)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 56.54"
FT   gene            692306..693076
FT                   /locus_tag="DehaBAV1_0702"
FT   CDS_pept        692306..693076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0702"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17286"
FT                   /db_xref="GOA:A5FR82"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR82"
FT                   /protein_id="ABQ17286.1"
FT                   /translation="MINLLNAKIEPEIWLCDILLCMNELVYGLSALGISLNSVQLGQFE
FT                   TYYQELVDYNSRINLTAITEYKDVQIKHFLDSVSLVLAGIKGDEKLLDVGSGAGFPGLP
FT                   LKILFPAIQLGLLEATQKKARFLSEITVKLGLSGVEIISQRAEDTAQNPLYRQKYSLVT
FT                   SRAVADMATLAELTLPFCAIGGRVIAPKKGDIEEEMDRAATAVKKMGGRVFKVIKVELP
FT                   GLEDGRKLVLLEKISNTPALYPRRAGIPAKTPLI"
FT   gene            693295..694824
FT                   /locus_tag="DehaBAV1_0703"
FT   CDS_pept        693295..694824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0703"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17287"
FT                   /protein_id="ABQ17287.1"
FT                   /translation="MPELLTDDLNALLEVLPPHIRQPLTDPANRENLIEIVMDLGRTPE
FT                   ARFPDREIILSERDVTQEDIDYVSSRTGDFGDDNRAGIERTLHRISAIRNRKGKIVGLT
FT                   LRVGRAVFGTIKIIQDLIKSDQSVLMLGRPGVGKTTMLREVARVLAGDLKKRVVIVDTS
FT                   NEIAGDGDIPHPAIGHARRMQVRTPDMQHAVMIEAVENHMPQVIVIDEIGTELEALAAR
FT                   TIAERGVQLVGTAHGNVLDNLMLNPTLSDLIGGIQSVTLGDEEARRRGTQKTILERRAP
FT                   PTFQVIVEIQDRNKVAVHPDVGAAVDSILRGVSPSAEIRYLDGNGEVVISKQQPSEEKV
FT                   KSAPESLPVFRGKELPIMYLFGVNRSRMEEIAREMHLDIRISERLEQAQLMVTSRNYYR
FT                   SKPQRVRDAENMNIPIYVLKSHTPGQFQQLLATLSGRDVAYAVEKPPEIDVAIHEAEEA
FT                   VAQVKTSHIPVELSPQGAYIRRFQHIIAEKEHLSSHSLGREPHRRVRISRG"
FT   gene            694827..695453
FT                   /locus_tag="DehaBAV1_0704"
FT   CDS_pept        694827..695453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0704"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17288"
FT                   /db_xref="GOA:A5FR84"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR84"
FT                   /protein_id="ABQ17288.1"
FT                   /translation="MSLFITFEGGEGCGKSTQSKALYRYLKKKGLGCVLTHEPGGSKSG
FT                   DKITRLLKWSKEEHISPLTELLLFNASRSILIDNVIKPALQDGKIVICDRYTDSTLAYQ
FT                   GYGRGLDLDTVKCVNSLASGGLVPDLTIWLDMDDKAALLRKGELPPDRFESENNGFHQR
FT                   VRNGFGAIYATEPDRFLKLDASLPQSEIFSRIKQRVTILLGCRNE"
FT   gene            695434..696519
FT                   /locus_tag="DehaBAV1_0705"
FT   CDS_pept        695434..696519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0705"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="PFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17289"
FT                   /db_xref="GOA:A5FR85"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR85"
FT                   /protein_id="ABQ17289.1"
FT                   /translation="MVAEMSDSSELVMVAMSGGVDSSVTAMLLLEQGYNVAGVSLQLKS
FT                   NNEPYGNGYNLKLINRAREVAAALNIPHYVVDLSDIFSQRVIADFCQQYSQGRTPNPCI
FT                   RCNYYVKIGALLNKIQDFKADYLATGHYARIVSDENGTHLLRGADGKKDQSYFLYTLPP
FT                   ESLSRLMFPLGQKYKKDIVRLATNMKLPVSQKESQDVCFIPDGDYKSFLATRMGFTPGK
FT                   ILDTTGKILGEHQGLPLYTVGQRQGLGLASNEKLFVSDMNADANTITVAGHDQLYTSRI
FT                   LLSNFIWRESGIPLDTSGMIVKVRYKAAPAEVKKISQSGDFYILELASPVWAATPGQAA
FT                   VIYLDDMVLGGGIIESGGDTI"
FT   gene            696521..697159
FT                   /locus_tag="DehaBAV1_0706"
FT   CDS_pept        696521..697159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0706"
FT                   /product="Ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease HII/HIII"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17290"
FT                   /db_xref="GOA:A5FR86"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR86"
FT                   /protein_id="ABQ17290.1"
FT                   /translation="MPATVICPSRAEEKLLRKQGFILIAGLDEAGRGCLAGPVVAGAVI
FT                   MPPRLKGDWVEMVRDSKVLSPAKREYLYCHIVSMAVTFGVGAVDNEQIDSMGIAPATRL
FT                   AMKQAVEDLTCQPDFLLVDYLKLPDIPLPQKGIVDGDALCFSIACASIVAKVSRDRLMS
FT                   KLDMEYPGYYLAKHKGYGTALHVECICQKGISPIHRRTFAPLKGMIDGL"
FT   gene            697149..697514
FT                   /locus_tag="DehaBAV1_0707"
FT   CDS_pept        697149..697514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0707"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17291"
FT                   /db_xref="GOA:A5FR87"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR87"
FT                   /protein_id="ABQ17291.1"
FT                   /translation="MAYNRKETGEFGEKLAAEYLKGMGYSIIQTNCRLPEGEIDIVGQD
FT                   GEYLVFIEVRTKRRLGYGLPAESVTPRKKAHLMASAESYIQKHRLEHFPCRIDFVSVDL
FT                   SQPEPRLELIKNALGEE"
FT   gene            697550..698608
FT                   /locus_tag="DehaBAV1_0708"
FT   CDS_pept        697550..698608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0708"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="TIGRFAM: thiamine-phosphate pyrophosphorylase; PFAM:
FT                   thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17292"
FT                   /protein_id="ABQ17292.1"
FT                   /translation="MDNLEKLWRIVDVNQNRLSEGLRILEEIARLYLENETLTLRLKNL
FT                   RHALTLQDTASNCHLLFSRQADTDIGAHLKTVDQSKPETLFSLISANAKRAEQSLRVLE
FT                   EFAGLLELGFDTSIYSRGRFELYTLEKDLAAILLRKNRRDMIKGLYVAIDVDYLAGRDI
FT                   PRVTKEVLEGGCRLVQLRAKTASARQFLSLALSLKELCIEYGAVFIVNDRLDIALACGA
FT                   DGLHLGQTDLPLSQARCLMPAGSIIGISADSPEDAASAQAGDADYVAAGAVFPTQTKLD
FT                   VLYGGLSGLKAIRQVVNIPLVAIGGINKSNYNEALQAGADSLCLISAVLGAPDIKKATS
FT                   EFMTLVEAEKND"
FT   gene            698601..699254
FT                   /locus_tag="DehaBAV1_0709"
FT   CDS_pept        698601..699254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0709"
FT                   /product="Translin"
FT                   /note="PFAM: Translin"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17293"
FT                   /protein_id="ABQ17293.1"
FT                   /translation="MTNISVKMEQISDSIRENFKTRDAAREKSLPISREAIQYCSLAIR
FT                   AVHRQELAQAREMLVSARALIKEAGQAIDDCGELSNTTFFLDAQKEYAEANTVLALVNG
FT                   KDMPSPEELEVDNAAYLNGIGEAAGELRRYILDGLRKGEDTRGEELLQAMDDIYEVLVT
FT                   MDFPDAITGGLRRTTDMVRGVLERTRSDLTLYIQQKGLEQKLEVFQSKLTRKGE"
FT   gene            699259..701298
FT                   /locus_tag="DehaBAV1_0710"
FT   CDS_pept        699259..701298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0710"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="TIGRFAM: V-type H(+)-translocating pyrophosphatase;
FT                   PFAM: Inorganic H+ pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17294"
FT                   /protein_id="ABQ17294.1"
FT                   /translation="MSIWIALVVGLVGLAVAGLLAKFVLKQDEGTPKVREIAAAIKEGA
FT                   MAFITREYTVMAIFVAAVTIILAFLPSLGWPVSVSFLFGALCSGLAGFIGMSIAVRANS
FT                   RTTTAASHSLNQGLKLSFRAGSVMGMCVVGIGIIGLSIMYFAFGSDVDFIKILPGYGFG
FT                   ASSVAIFARVGGGIFTKAADTGADIVGKVEKGIPEDDPRNAAVVADFVGDNVGDVAGMG
FT                   ADLFESYVDSIIATMALATIGAFSMKLGYALVPSQEAAFFLPMLVAAGGILASVIGIFL
FT                   VRTGEKLQMKALLAALRKGTLAAAFLSAVFSFLAVWYLQADFGLFFAILAGLVAGVLIG
FT                   ESTNYFTSYVYKPTLGIAASCQTGAATNIISGFSVGLMSVVPPIVLVVIAIVISYAFGD
FT                   VYGVALAGVGMLATLGIQDATDAYGPVADNAGGIAEMSGLPKEVRERTDALDSLGNTTA
FT                   AIGKGFAIGSAGLTSLALLLSYTQAVGISASQVSLLDVKVLAGLLLGVMMPAVFCSLTL
FT                   KAVGVTSFSIVNEVRRQFKEIAGIMEGTAKPEYGKCVDICTRDSIKQMILPGVITVVSP
FT                   VIVGWLLGPVAVVGFLTGTILCGFILAVTFANAGGAWDNAKKWVETGAYGGKGSDAHKA
FT                   AVVGDTVGDPMKDTAGPSLNIMIKLVAIIALVMAPILANFSGII"
FT   sig_peptide     699259..699324
FT                   /locus_tag="DehaBAV1_0710"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.433 at
FT                   residue 22"
FT   gene            complement(701311..701964)
FT                   /locus_tag="DehaBAV1_0711"
FT   CDS_pept        complement(701311..701964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0711"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17295"
FT                   /protein_id="ABQ17295.1"
FT                   /translation="MCQNIILEAYTNMLNRKLRLGLLGTNCYILGDEESRHGLIIDPAA
FT                   ISDSIPETVTEYHLDVKYILLTHGHLDHLAGLEYARKLYPEAKLCFHPADASLSENVEL
FT                   ISYLGMSALPTLAPDIPLSEGSTLELGKIKFSVISIPGHTPGGICLYTRGYLFSGDTLF
FT                   NSGIGRSDFEESDTEALRQNIINRLLSLPPETLVFPGHGRETTIGKEKTGNPFI"
FT   gene            702035..702580
FT                   /locus_tag="DehaBAV1_0712"
FT   CDS_pept        702035..702580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17296"
FT                   /protein_id="ABQ17296.1"
FT                   /translation="MSIDNQPNLPAASFRFRPVYFMAPLMVLVISLLLTAVYYGRLPSD
FT                   VAYRFSIDGAPVTYIDAGLITGVLLGVQFLLVLFAFGLAVFLPRLGFFKNNQTDFWVKP
FT                   GTLLGFMGNIMAVPQLILAYALLDVFVYNVHQIHLLPLWLFAIILIVIAAIVIGIFAIP
FT                   VFVRAYKTFNGPSASKKE"
FT   gene            702587..703918
FT                   /locus_tag="DehaBAV1_0713"
FT   CDS_pept        702587..703918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0713"
FT                   /product="glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); Anticodon-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17297"
FT                   /protein_id="ABQ17297.1"
FT                   /translation="MSENISQPVAMDKIVSLARRRGFIFPSSEIYGGLNSCWDYGPLGV
FT                   ELKRNVKEAWWRYMVRDRDDVVGLDASIIMHPRVWEASGHVAGFSDPMVDCKKCKMRWR
FT                   PTDLAEPKCPACGGELTESRQFNLMFKTFMGPIEEAASIVYLRPETAQGIFVNFENVLN
FT                   TTRKKLPFGIAQIGKSFRNEITTGNFIFRSREFEQMELEYFVKPGADDSCLEEWTQYRL
FT                   NWYKNLGMNPENLRLRAHRSDELAHYAKGCYDVEYNFPMGWSELEGIANRRDFDLTQHA
FT                   KYSGKSLEYFDEETKEHFVPYVIEPSAGVERSTLAFLIDAYAEEPDKDEIRTVLHLHPA
FT                   LAPYKIAVLPLSKKEILSDYARKIYADLRKCWMVAYDDSQSIGRRYRRQDEIGTPYCVT
FT                   VDFQSLEDGMVTVRDRDSMAQIRVKVSELSYILAAKLSGEPFNS"
FT   gene            703932..705179
FT                   /locus_tag="DehaBAV1_0714"
FT   CDS_pept        703932..705179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0714"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17298"
FT                   /protein_id="ABQ17298.1"
FT                   /translation="MKILHFADLHIGVENYGRFDSATGLSSRLADFLTAFDRLVAYAID
FT                   KKVDLVVFSGDAYKSRDPSQTQQREFARRVSTLASSGIQVFLLVGNHDQPNAAGRATTT
FT                   EIFDTLDIANVHVSGKAEVRLINTRNGPIQIASLPWLRRSSVLSVSNQKEEKNLSIEEL
FT                   NQRVESYLAGIIENLAGQLDKNIPSILSAHLSVNTAKVGSERNISIGHEPTVMLSNIAN
FT                   PAFDYVALGHIHKQQVLSSAPPVIYPGSLERLDFGEEKDDKGFYLVEIDPLSHKTDFVF
FT                   IKLEGRRFLTIELNLNADSLDPTLEVINILQARQQDIKDAIVRLKLELPAEIGGQLRDS
FT                   DIREALREAHNFTISKNVIRLTRQRADGFKVEGLDPIQALEHYLEIKQTSAQEKKTLLE
FT                   YGRRLYSTLDSKQTKI"
FT   gene            705203..705952
FT                   /locus_tag="DehaBAV1_0715"
FT   CDS_pept        705203..705952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0715"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="5.4.99.-"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17299"
FT                   /protein_id="ABQ17299.1"
FT                   /translation="MAYNSSSDTSLVKVLVEARLGSRRKMAEAIKQGLVTLNGQKAESY
FT                   SQPVNTQKDKVTFEGKLVVLSRVRRIYLMLNKPPEIVSTTSDELGRKTVMDLLHRRYEG
FT                   AGLFPVGRLDEATTGLILLTNDGEMTNRLTHPSYEIEKEYLISIDAALTQADKESLEKG
FT                   ILLDDGLTSPARLSRVTDEPPYNYKLIIHEGKKRIVRRMFARLGHPIKALKRSRIATLR
FT                   LGKLEEGKTRELTPGEIAALRRITRLK"
FT   gene            complement(705945..706679)
FT                   /locus_tag="DehaBAV1_0716"
FT   CDS_pept        complement(705945..706679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0716"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17300"
FT                   /protein_id="ABQ17300.1"
FT                   /translation="MHRPLVSPIFENRFDAGRQLAEKLSHYKDKSAIVLAIPNGGIPIA
FT                   TQVALALDADMDMIISRKLPIPLRPEGGFGAVADDGAVMLNHEVVNYLHMTEQQINYTV
FT                   NKVRAEVQQRSLLYRGHRSLSILNGRIAIIIDDGLASGYTMLAAIESVRRKKPARIVAA
FT                   VPAASATARKLVEKVADEVITVADGFMPKFYVSDYYRYWNVLDDEQSLKVFKDWQMRRQ
FT                   NLNLRPENLPPPSMTMRRKPLI"
FT   gene            complement(706679..708394)
FT                   /locus_tag="DehaBAV1_0717"
FT   CDS_pept        complement(706679..708394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0717"
FT                   /product="Adenine deaminase"
FT                   /EC_number="3.5.4.2"
FT                   /note="TIGRFAM: adenine deaminase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17301"
FT                   /db_xref="GOA:A5FR71"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR71"
FT                   /protein_id="ABQ17301.1"
FT                   /translation="MQTNLSQLIKVARGETEADLVLLNARVINVFNAEIEQTNVAVFDG
FT                   KIAGVGDYRHGKEVIDLKGAYLLPGLINGHTHVESSMLDIAQYARAVVSNGTLALITDL
FT                   HEISNVCGKEGIDYVLDASADLPLSIFLQVPSCVPATHLETAGAEINSQDVADLLRLPN
FT                   VTGLGEMMNFPGVLFGVPSVLDKIIAATGKVMDGHAPGLSGKDLNAYISAGIHSDHECI
FT                   HLAEAKEKLARGMYIMIREGSSEKNLAELLPLVTDKTYKRCLFVVDDRSCADLKSDGDI
FT                   DAVVRKAIRLGLDPVRAIQLASINTAEYFHLQGHGAIAPGYLANMIVCQNLEQLDIDMV
FT                   FHKGKLVAEKGQALFKPQSRIPKSLLNSIHIKPFNTEDLVLKTIQPQIPVIEVIPGQIV
FT                   TRRLDLKITAENGVIKANTELDLLKIVVLERHHQSGNIGHGLIRGFGLKKGAIASSVAH
FT                   DSHNVVAVGTNDADLYTAIKELERINGGIALAVDGQVTASVSLPVAGLLSTKPLEEVVT
FT                   ELEEINNQVAKLGCKLSAPFATLSFMALPVIPELRLTDLGLVDVKTFKLIPQET"
FT   gene            complement(708378..708914)
FT                   /locus_tag="DehaBAV1_0718"
FT   CDS_pept        complement(708378..708914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0718"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17302"
FT                   /protein_id="ABQ17302.1"
FT                   /translation="MKLSLFIPKTEIEVYLERLAYEINRDFKDRPLVVIGVLKGSFVFM
FT                   ADLIRRLNMPVELDFVGLASYGKNTQSCGKVHLTRPLNRDIAEKDILVIEDIVDSGLTV
FT                   SYLLKYLKKRRTNSVKLCALLSKPSRRVCPVEIDYLGCEVEDKFLVGYGLDWAECYRQL
FT                   PEIFALEGKPDADKP"
FT   gene            709211..709876
FT                   /locus_tag="DehaBAV1_0719"
FT   CDS_pept        709211..709876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17303"
FT                   /protein_id="ABQ17303.1"
FT                   /translation="MKCLNCSRDFEDNLVESGLLFCPFCGVGQPRGSQNPDINNMTFCS
FT                   CGQGIVGKVNYCPGCGQMLNPDAPPLERTGRLYKNTTRRETADKTPPVVQEIPEDTEYE
FT                   NDEQSESARRPQVYRDNEETPPSARPARQAYPYYDQHEERSRSRTSRRYAADDDYYEDE
FT                   EPIRYRNSRRPAKAYREERSYRPNRRNDVMPLLVVLLIAGVGVLGYGIYLLIQNFIGS"
FT   gene            709971..710888
FT                   /locus_tag="DehaBAV1_0720"
FT   CDS_pept        709971..710888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0720"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17304"
FT                   /protein_id="ABQ17304.1"
FT                   /translation="MVIQVQNLVKVYGSIRAVDGISFEVKKGEVFGMLGPNGAGKTTTA
FT                   EIIEGLRDADSGSVSVMGLDVRKQRDQIKQLIGIQLQAPALLPLLNVEEILKLFTSFYR
FT                   NSVPVEKLLDMVSLTESRKVLSKNLSGGQQQRLSVAMAMVNNPEITFLDEPTTGLDPQA
FT                   RRGLWSVIEELRSQGKTVFLTTHYMDEAERLCDRIAVVDHGKIIALDTPKKLISGNFKE
FT                   SAIEFEMEPVPSGELLGSFPCVTSASVEGFEVILYSNNVPKTMGAILDYADKNRGNTEL
FT                   RNLHVRQATLEDVFLKLTGRKIRE"
FT   gene            710885..711967
FT                   /locus_tag="DehaBAV1_0721"
FT   CDS_pept        710885..711967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0721"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17305"
FT                   /protein_id="ABQ17305.1"
FT                   /translation="MNSFISMLNANFKQFLRDKTALFFTLAFPVLFIIMFGLVFSGTDK
FT                   ISYDVALVNEDNSQISQGITEAFSQVTIFSVKDSPRDESLQLLKDGKLKAVIIIPEGLG
FT                   IAALSGQTTDIQVYYDGSQTNVNQILLPVIKEILQTINREITQTPVLFQISEETIQTKD
FT                   MSMMSFFIPGVLAMSIMFLGLYSAMPLIQQREKKILKRLGASPISRSTIIFSQVVLRLG
FT                   LAVLQTIIIIVIGQLMFGVEILGNWWLLLGLVMLGTLSFISLGFLVASLAKTEEGAMPI
FT                   VQLIQFPMMFLSGIFFPLEFMPDFMRPVVNALPLTYLGDAFRQVMVDGAPAFPLGVDLL
FT                   VVTGWLVVCMAVSIRFFRWE"
FT   sig_peptide     710885..711010
FT                   /locus_tag="DehaBAV1_0721"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.978 at
FT                   residue 42"
FT   gene            complement(712050..713081)
FT                   /locus_tag="DehaBAV1_0722"
FT   CDS_pept        complement(712050..713081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0722"
FT                   /product="S-adenosylmethionine--tRNA
FT                   ribosyltransferase-isomerase"
FT                   /note="PFAM: Queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17306"
FT                   /db_xref="GOA:A5FR63"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR63"
FT                   /protein_id="ABQ17306.1"
FT                   /translation="MKTSDFDYNLPQEYIAQKPAEPRDSSRLLVLNRQSEELTNRIFGE
FT                   ITDYFKPGDVLVMNDSRVLPARIKGIKQDTSAKIEILLLKRDGEGCWEALLKPSKRTKP
FT                   GTIIDIHQPNGGISTQAKVLADKDDSIKLLRFSDETHLMKLGEVPLPPYIHTPVADPER
FT                   YQTVYALTNGSVAAPTAGLHFTPELLKRLTEMGVICTYVTLHIGLDTFRPVKEEDPKDH
FT                   KIHREYGILSKETASAICCAKETGKRVFCVGTSATRLVEQASHLSQTSLITSYSGWADL
FT                   FILPGYKFRVADCFITNFHLPRSTPLMLTSAFAGWPFLRKAYEKAISEHYRFYSFGDAM
FT                   LIL"
FT   gene            713244..714041
FT                   /locus_tag="DehaBAV1_0723"
FT   CDS_pept        713244..714041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0723"
FT                   /product="exopolyphosphatase / 5'-nucleotidase /
FT                   3'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /EC_number="3.6.1.11"
FT                   /EC_number="3.1.3.6"
FT                   /note="TIGRFAM: stationary-phase survival protein SurE;
FT                   PFAM: Survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17307"
FT                   /db_xref="GOA:A5FR64"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR64"
FT                   /protein_id="ABQ17307.1"
FT                   /translation="MRILVSNDDGIYSPGLWALVKRLKEVGEVIVVAPDREQSATGTQV
FT                   TLRQPLRVQKTHPLIPGIEAYAVEGSPCDCVILGLAKLITEPVDLVVSGINHGLNLGDD
FT                   VLISGTVGAALQGYLRNIPSIAVSIPVTMEEPENLDSAACITAEVSRRIQNGDITKNSF
FT                   LNINIPDLPLSQIEELRVTPLAHKTHIETVEEGHDGRKRYFWLRRRQLSSADNKKTDIW
FT                   AIENGYITISALHERLFQQPVFTLKDAETAGILAAARSCQDKI"
FT   gene            714175..714729
FT                   /locus_tag="DehaBAV1_0724"
FT   CDS_pept        714175..714729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17308"
FT                   /protein_id="ABQ17308.1"
FT                   /translation="MNKISNGKFLRSLALSSPVLIIAAVSIVFSFSTAFEGKVASSPTG
FT                   NTDDNTQVTAPIDDTSTDGSVDLTITAETLYSHYVYPGETNPDLYYKSKNIKITGKVAG
FT                   FVYGTVANSCWISFKTDQSNGANVICYFGNYVIKPGAAITIGMDIEITGTCMGLTNGHV
FT                   TLINSFTDDIQLIPYDHNLEA"
FT   sig_peptide     714175..714279
FT                   /locus_tag="DehaBAV1_0724"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.660 at
FT                   residue 35"
FT   gene            714897..715754
FT                   /locus_tag="DehaBAV1_0725"
FT   CDS_pept        714897..715754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0725"
FT                   /product="NADP oxidoreductase, coenzyme F420-dependent"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17309"
FT                   /protein_id="ABQ17309.1"
FT                   /translation="MQSIGFIGAGTVGSALALGLSEKGYPISGIASRTRLSAEKLCRKI
FT                   PSAKFCNSPQAVVDTADIVFITAPDDTIAEICRSLHWHSNQYVIHCSGAYSLELLQTAQ
FT                   CSGAYTGVLHPLQSFSLQADPVRNLGGITYALEGDDQTLSLLKDMVKVLGGEWIVLKPS
FT                   DKVAYHVAAVLASNYLVTLIKMATGLWQSFGIPEDKAVKALMPLVRGTLSNIEKAGATN
FT                   ALSGPIARGDCGTVSKHLAALENIAPELIPAYKELGRQTVKIALEKEKPNITGIEKLSR
FT                   ILAN"
FT   gene            715768..716151
FT                   /locus_tag="DehaBAV1_0726"
FT   CDS_pept        715768..716151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0726"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17310"
FT                   /protein_id="ABQ17310.1"
FT                   /translation="MRIMLKSKIHRATITDACIDYEGSITIDKNLMQAANLLPYEQVHV
FT                   VNVNNGTRLETYVIEGSAGSGQICLNGAAARMGMKGDKVIILGYSLITEEDTLIHQPNL
FT                   VYVDALNRITKVKNGVANQGLEV"
FT   gene            716154..716993
FT                   /locus_tag="DehaBAV1_0727"
FT   CDS_pept        716154..716993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0727"
FT                   /product="ketopantoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; PFAM: Ketopantoate
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17311"
FT                   /db_xref="GOA:A5FR68"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR68"
FT                   /protein_id="ABQ17311.1"
FT                   /translation="MRTTISQLKEMKQNKQKIAILTAYDYPTAQILDKAGIPAILVGDS
FT                   LGMVVLGYDSTVSVTMEDMLHHLKAVVRGSQKALIIADMPFMTYHLSPEQALLNAGRFI
FT                   QEGGAQAVKLEGGVNVADKVKRIVDCGIPVMGHIGLTPQSVNQLSGFKVQGKTLATALS
FT                   LIEDAKALEKAGAFAIVLETMPAELAAIITAGISIPTIGIGAGEECDGQVQVISDMLGM
FT                   FTDFIPKHTKRYADLNGIITKAVSEYAAEVTKGAFPTLKESFTLDKKVLEELKKCVL"
FT   gene            716981..717814
FT                   /locus_tag="DehaBAV1_0728"
FT   CDS_pept        716981..717814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0728"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="TIGRFAM: pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17312"
FT                   /db_xref="GOA:A5FR69"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR69"
FT                   /protein_id="ABQ17312.1"
FT                   /translation="MRIIRTVDEMKKLHREICGPVGLVPTMGYLHEGHLSLVRASKKQD
FT                   INTVASIFVNPTQFGPHEDFKKYPRDEKRDMAMLENAGVDYVFAPSVEDMYPAGFDSWV
FT                   EPGILQQCLEGAIRPGHFRGVCTVVAKLFTIIRPDRAYFGQKDYQQYLIIKRMASDLNL
FT                   DVSVEMLPIIRENDGLALSSRNTYLSPAERQAALVLYRSLLTARSLFDEKEHRAEVIRK
FT                   KMTDVIQHESMAEIDYVSLSHQDTLCESDEVSAKTIALVAARFGKTRLIDNMFLA"
FT   gene            complement(717811..719073)
FT                   /locus_tag="DehaBAV1_0729"
FT   CDS_pept        complement(717811..719073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0729"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17313"
FT                   /protein_id="ABQ17313.1"
FT                   /translation="MEQEIKPAASEKRILGFAPNVFFLGLVSFLTDISSEIIFTLVPLF
FT                   LANVLGATTTVIGFVGGLSDSTEAVFKIFSGYLSDKINRCKSLALFGYGFSALAKPFML
FT                   LANSWGIVTGVRFADRVGKGVRSSPRDALIANSVEPHERGRSFGLHKAMDSLGATLGLG
FT                   IAAAVIYFTQSGSLTLELETYKTLVWWGIIPAFLAVLVLAVFVKEKHRPQTTSLKGEKV
FT                   RFNFRNLFLGMDSRFKLFLLVMFLFTLGNSSDYFVILRAQGMGVSVLAISLMLVVFNIT
FT                   YTLVSLPAGMLSDKMGRRKVIAMGWLFYALVYLGFAVTQNQIGIWILFGCYGLYYGIVE
FT                   GVAKAFVADMIPSDKRGAAYGLYQGVVGLTLLPASLIAGILWDRVGSAAPFYFGAVLAL
FT                   LAVIGLLVFIKEPPKKTPTVS"
FT   gene            complement(719073..719372)
FT                   /locus_tag="DehaBAV1_0730"
FT   CDS_pept        complement(719073..719372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0730"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17314"
FT                   /protein_id="ABQ17314.1"
FT                   /translation="MVDREFFLGFIRIHILYHAQNEPIFGAEIARELGRHCYTITAGTL
FT                   YPLLHRLQAEGYLESFPRVEQGKQRKYYRTTLKGSEMLNECRKQIRELVDEVLE"
FT   gene            719505..719580
FT                   /locus_tag="DehaBAV1_R0019"
FT                   /note="tRNA-Phe1"
FT   tRNA            719505..719580
FT                   /locus_tag="DehaBAV1_R0019"
FT                   /product="tRNA-Phe"
FT   gene            719655..719741
FT                   /locus_tag="DehaBAV1_R0020"
FT                   /note="tRNA-Leu1"
FT   tRNA            719655..719741
FT                   /locus_tag="DehaBAV1_R0020"
FT                   /product="tRNA-Leu"
FT   gene            719772..719845
FT                   /locus_tag="DehaBAV1_R0021"
FT                   /note="tRNA-Gln1"
FT   tRNA            719772..719845
FT                   /locus_tag="DehaBAV1_R0021"
FT                   /product="tRNA-Gln"
FT   gene            719856..719930
FT                   /locus_tag="DehaBAV1_R0022"
FT                   /note="tRNA-Asn1"
FT   tRNA            719856..719930
FT                   /locus_tag="DehaBAV1_R0022"
FT                   /product="tRNA-Asn"
FT   gene            720035..721537
FT                   /locus_tag="DehaBAV1_0731"
FT   CDS_pept        720035..721537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0731"
FT                   /product="Phytoene dehydrogenase and related protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17315"
FT                   /protein_id="ABQ17315.1"
FT                   /translation="MSSKKVIIIGAGLAGLSAGCYSRMNGYATRIYEHHSKPGGVAACW
FT                   RRGEYLIDGGIHFMMGSQNGTDLYNIYRQLGVADPANFVPMKSYGSFIDIEGSRQLDIP
FT                   LNISELALDLKMLSPADAPLIEDLATAVTAFSGKDLAIYGQMNPPELTSGLDKLTDMWK
FT                   MRKLFKYMSGKYAKSMQDYTAGMQNRWLAERLNNLFTPQCPVWFVIMLLAIAADGQMSY
FT                   LAKGCKDFVRQIEKRYKDLNGEVTYSSTVEKILVRDDCAFGVKLADGTEDYADYVISAG
FT                   DIHNTVFHLLDGKYIGKKLQNKFDTCELSRPYFVASFGVKRTFENESVFNTLILKQPLQ
FT                   IGNREIRQIFVRIFNYSNHFAPKDKSVIQAEFETEWDYWDNLRQKDPNKYAAEKERLVS
FT                   EILANLEILYPGISPLVEIADVATPCTLNRYTLNHQGAPEGWGLTSQNFKEETRRSLEG
FT                   LSNLYLAGHWVSGGVPGVILSGRQAIQLVCAKEKKPFFTRTT"
FT   sig_peptide     720035..720103
FT                   /locus_tag="DehaBAV1_0731"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.676 at
FT                   residue 23"
FT   gene            complement(721534..722124)
FT                   /locus_tag="DehaBAV1_0732"
FT   CDS_pept        complement(721534..722124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17316"
FT                   /protein_id="ABQ17316.1"
FT                   /translation="MKTKLANYISDIFNPLTLSILFVFLLAKDSTENLWEAVKWSLIFI
FT                   TLCMLPIFLVILSMVKRGKLQSVFSNPREQRHVLYVLGSVMVGAGLMVLIFIGAPDKLI
FT                   AALFAGFVSSVLFMIVNFFWKISVHTAFASAFSSIALMLYGYSALGFMLLVPMMAWARV
FT                   YLKEHTVGQVTAGALLAGTVIVTVFNIFNMVNI"
FT   gene            722341..723087
FT                   /locus_tag="DehaBAV1_0733"
FT   CDS_pept        722341..723087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0733"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17317"
FT                   /protein_id="ABQ17317.1"
FT                   /translation="MTGNAISLRDISFNYKHIKALDDLSLEIPGGISFGIMGPNGAGKT
FT                   TLIRIMVGLLRQKSGYLAILGKEFSRQLEYQLGYMPQAHSLYTELSISQNIDFFARVYG
FT                   LRDKTLRKARIEEVIRLVDLWERRNDAVMNLSGGMKQRVSLACAIVHNPPVIFLDEPTV
FT                   GLDPELRCRFWEYFKSLNQKGVTIIISSHTLDDAAHCDRLAFLREGKVIAEGTPADLKA
FT                   ATGKADASLEDAFLHSIRIGGIPCHE"
FT   gene            723080..723805
FT                   /locus_tag="DehaBAV1_0734"
FT   CDS_pept        723080..723805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0734"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17318"
FT                   /protein_id="ABQ17318.1"
FT                   /translation="MNNMLAIAQRLIRQLLHDRRTMALIIVVPVVVMGLIGVSFPDATV
FT                   LDYIAPAMLATLALFFSFLLTGISFLRETSQGTMERLMAAPVSRLDIVAGYLLGFFVFA
FT                   LLQTLIIVLFTIYVLGVNFQSELWQILLFQVLIITGAVTLGIFTSSFAKNEFQMVQFIP
FT                   LIIVPQIFLCGVIWPVSQMPEWLQYLSNILPLTYGVDGMREIMLEGKNLAEVGFQCGVL
FT                   MLFAVITTLLASLTVPKRR"
FT   gene            723905..724660
FT                   /locus_tag="DehaBAV1_0735"
FT   CDS_pept        723905..724660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0735"
FT                   /product="Iron-regulated ABC transporter ATPase subunit
FT                   SufC"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17319"
FT                   /protein_id="ABQ17319.1"
FT                   /translation="MDSEILLEVKDLHVEVDGREILHGVDLVLPAGETHVIFGPNGSGK
FT                   TTLLMTLMGFPRYKITKGQLIFNGKDITHVPLDERARLGIGISFQRPPVVRGVKLREMV
FT                   RSSLRAKDDKGLINELAKKANMTDFLERDVNHGFSGGEIKRSELLQLLAQGPDMVLLDE
FT                   PESGVDLENIALIGSLINELLEKKHPIRERKRGGLVITHTGHILDYVNARTGYVLCHGR
FT                   INCTGDPRDMLETIKHNGYQECVECPRKI"
FT   gene            724642..725877
FT                   /locus_tag="DehaBAV1_0736"
FT   CDS_pept        724642..725877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0736"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17320"
FT                   /protein_id="ABQ17320.1"
FT                   /translation="MSPKDLRPNLADTAGAAINKKPAVGDDILLEKYTDNTEAHKYVNK
FT                   PSELASEDKARMLESGVILDDLKERSGTYIQMDNHPVHFSAQQDGIEIMSTSEAAKKYD
FT                   WLKDYWWKAVSVDADKYTAHVELNQADGYFIRALPGVKTEFPVQSCMYMAKNQSIQNVH
FT                   NIIIAEEGSELHIITGCTSAHRTETGLHLGVTEFYIKKGAKVTFTMIHTWSPDIAVRPR
FT                   TGAIVEENGVFLSNYVIMKTVKNLQSYPVAYLNGENAVARFNSVMVCPPGSKMDVGSRV
FT                   FLNAKHTRTELITRALTTGGEIISRGYIEGKVPDCKGHLECRGLILGDKGIIYAIPELM
FT                   GRVSGVDLSHEAAVGKIAEEEVEYLMARGLNKDEATAAIVRGFLNVDIEGLPPLLKEEM
FT                   DKAIKLGDQEGM"
FT   gene            complement(725946..726737)
FT                   /locus_tag="DehaBAV1_0737"
FT   CDS_pept        complement(725946..726737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0737"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17321"
FT                   /protein_id="ABQ17321.1"
FT                   /translation="MTNRDLPPLIEFKNISLMRGERLCLKNINLVINQGQSLAILGPNG
FT                   AGKSSLIKTITRELYPIFDPLGSSLRILGRENWDVFELRSQLGIVSAEVLRQDISQTCQ
FT                   EAVLSGYFGSPYLRDAGLISLQMKTYAQDMMNLLEIDHLAERLTDEISSGEARRVVIAR
FT                   ALVNNPQSLLLDEPTTNLDMKSAHQLRQLLSKISNLGTQIILVTHNLTDIIPEINRVVM
FT                   LKDGSIFRDGAKTEIMTETNFSELFGFEVNLLNKAGFYYLY"
FT   gene            complement(726826..726898)
FT                   /locus_tag="DehaBAV1_R0023"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(726826..726898)
FT                   /locus_tag="DehaBAV1_R0023"
FT                   /product="tRNA-Lys"
FT   gene            complement(727013..727666)
FT                   /locus_tag="DehaBAV1_0738"
FT   CDS_pept        complement(727013..727666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0738"
FT                   /product="Thymidylate synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17322"
FT                   /protein_id="ABQ17322.1"
FT                   /translation="MKITSVEARDLSEAWFLCLRQVLTNGYEYTIERGSYSGQKRKELD
FT                   MITVHIKNPGNRPLIPDVPPGVPAPSTMEYIDNYLPYLMTAHRAEGEQYTYGQYLEAQI
FT                   AKVIKMYRETGFNTNQAFMTVGNPETLDLEDPPCLRSIDTRVRYGKLHFIIYFRSWDLW
FT                   AGFPSNLAAIQLLKEYMAAEIGVEDGEIIAMSKGMHIYDYAWDIAKTAAGMNGV"
FT   gene            complement(727678..728385)
FT                   /locus_tag="DehaBAV1_0739"
FT   CDS_pept        complement(727678..728385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0739"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17323"
FT                   /protein_id="ABQ17323.1"
FT                   /translation="MVDDSLIFKAVANTRILRPPKQRLATFGITNIDYYLLTTPSYPVE
FT                   EGDMPLQAETVVREGKVIVQQPRIVTPYYLTRLEGFSDEAKRYFSLLVDQYGSQAPGLM
FT                   YAYKNESKGLNIVPGELHTVAQNISQQLDKDKAKLTTIIQGEDTLWDVSLLKFIYDLTR
FT                   HSLQGNLSDLGSRGRLGVGTDGVPSDARFYIEELFSKTLRDEADPSELKDELERWELFN
FT                   EYQDRFFALFKKK"
FT   gene            complement(728394..728984)
FT                   /locus_tag="DehaBAV1_0740"
FT   CDS_pept        complement(728394..728984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17324"
FT                   /protein_id="ABQ17324.1"
FT                   /translation="MGDIKSAFEIAMEKLKDIEEVTEDEKARWKYLPAGEKLATAYLKE
FT                   TVNLKTELEQYQGKAREYVGKGIENLLLSLIALPENEAATRIGSKAMEGIKSIKEDQAA
FT                   AETMISQMVQIIAHYTDQGEKQRRSAYDQLKQQYSQYLQKAIQQGMEMPPGLSSDIEKH
FT                   PRFQEEWRKRKNEFEARYIESLAQMKQELSQIK"
FT   gene            729087..729503
FT                   /locus_tag="DehaBAV1_0741"
FT   CDS_pept        729087..729503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0741"
FT                   /product="archease family protein"
FT                   /note="PFAM: protein of unknown function DUF101"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17325"
FT                   /protein_id="ABQ17325.1"
FT                   /translation="MFLGYKLIQHTADVGIVAQGASMGDAFGFAASGLFSLITDTSTLK
FT                   QDKIISLEFISDSYENLLVKWLNELIYIFDTQILVFGRFEVAVNSAFKLTAICFGQKVN
FT                   ADTPLHHYVKAATYHLLKVKKITGGYKLQVLLDI"
FT   gene            729513..730973
FT                   /locus_tag="DehaBAV1_0742"
FT   CDS_pept        729513..730973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0742"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17326"
FT                   /protein_id="ABQ17326.1"
FT                   /translation="MTSPWHGILKKIDDYRWEIPQSYKVGMRVPGLVYASERMLNQIWE
FT                   EHAIEQIANVAFLPGIVGRSMAMPDIHWGYGFPIGGVAATRISDGVISPGGVGFDINCG
FT                   TRLLRTNLSVEEVQPKIDELLNELFSKISSGVGSSGNIKLSGTDIDNVMTRGGSWALEK
FT                   GMGEAEDIKLTEESGSLSGANPDKVSNKAKTRGASQLGTLGSGNHFLEVQVVDEIFDPE
FT                   VAAVFGVQALGQVLFLIHTGSRGLGHQVCTDYVQLLNEAVKKYGINLPDRQLACAPLKS
FT                   DDGQNYLAAMACAANYAWANRQCITHWARDAFMKVFEKGRRDLGMDQIYDVAHNIAKIE
FT                   EHMVDGKVQNVCVHRKGATRSFPAGHPEIPAVYRKVGQPVIIPGDMGRYSYVAVGTETA
FT                   MRETFGSTCHGAGRILSRGAAKKTTSGTQLLDTLRSQGISIRVGDIGSLAEEASEAYKD
FT                   VADVVEVTHKAGIARNIFKTRPLGVIKG"
FT   gene            731019..731588
FT                   /locus_tag="DehaBAV1_0743"
FT   CDS_pept        731019..731588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0743"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17327"
FT                   /protein_id="ABQ17327.1"
FT                   /translation="MTVEEAISKRRSVRSFSNRQINRETLSQLLWASDGITDTVDKLRS
FT                   APSAGAIYPLDLYIIAGNKGVEGLEAGVYRYNPERNGLYLQVSGDFRKQLAEGCFKQDF
FT                   VADAPFSLVICYRPEDLIKRYGNNAEKYAYFEVGHVAQNFSLACVALGLGSVVIGAFTE
FT                   ETICKSMNLNGHPKPLYIIAAGFPAA"
FT   gene            complement(731593..733194)
FT                   /locus_tag="DehaBAV1_0744"
FT   CDS_pept        complement(731593..733194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0744"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase/homocitrate
FT                   synthase family protein; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17328"
FT                   /protein_id="ABQ17328.1"
FT                   /translation="MQVKLYDTTLRDGSQREGISFTVADKLKIAQKLDDLGIHYIEGGW
FT                   PGANPKDSEFFTQAKSLKLKNAKMVAFGSTRRPKVKADADTTLKQLIDSGTEYVTLVGK
FT                   SSARQVTQVLETTLEENLAMITESIEYLRSKCIKVFLDAEHFFDGYKDNPEYSIQVLQA
FT                   AEKAGAEGVVLCDTNGGTLPEEITQAVKTVKEALNICVGIHAHNDTEMAVANSIAALKA
FT                   GASQVQGTINGFGERCGNANLCSIIPILKLKMDIDCISDNQLKLLTETSHYISELANLV
FT                   SEPFLPYVGSSAFSHKAGLHVSGLSKWSGSYQHIEPELVGNHQRLLVSELAGRSNIVQR
FT                   AKAIGINLAPDSKEVKDLLQQVKKMESLGFQYENAEASFDLLVNRTQTGYIAPFELIDF
FT                   MVVVEKQRRPSTMRNQDEMMAEGIVKVRVDGDIMHTVAEGNGPINALDAALRKGLCQFY
FT                   PELSAVHLSDYKVRILEQTSGTDALVRVLIESSDGENTWHTVGASPNIIEASWLALSDS
FT                   FEYWLITKKCKNCKKQ"
FT   gene            complement(733201..734298)
FT                   /locus_tag="DehaBAV1_0745"
FT   CDS_pept        complement(733201..734298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0745"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17329"
FT                   /protein_id="ABQ17329.1"
FT                   /translation="MDFKLTVLPGDGIGPEVMDEGLKVLNAVAKKYKHTFKYQYGLIGG
FT                   CCIDKEGVALSPAALAMCKKSDAVLLAAVGDPRFDDPKLPVHPEDGLLALRKGLGLFAN
FT                   IRPVKVAPSLVNSTPIKAEIVKGTDFIFIRELTGGVYFAKPKKRWTTPAGIRKATDSMT
FT                   YSENEIERIVRVGFELAKNRKKKLVSVDKANVLLSSRLWRQIVIEVAKDYPEVKVEHVL
FT                   VDACAMKLILAPTYFDVIVTENLFGDILTDEASMLAGSMGMLPSASLAGIPAKGTKTFG
FT                   LYEPIHGSAPTIAKQNIANPIATILSIAMMLRYSCGLETEAVEIESAVDKVLAAGYATI
FT                   DIFKEGNTKLGTAEMGNQITKMIGG"
FT   gene            complement(734299..734799)
FT                   /locus_tag="DehaBAV1_0746"
FT   CDS_pept        complement(734299..734799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0746"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17330"
FT                   /protein_id="ABQ17330.1"
FT                   /translation="MLKGFVHKYGENVDTDAIIPARYLNVSEPKALAEHCMEDIDLNFV
FT                   KKVKPGDFIVTTTNFGCGSSREHAPISIKASGVSAVIAASFARIFFRNAINIGLPLLES
FT                   AEAAEKINSGDELEIDLETGIIKDLTTGEKFSAKPYPEFMSRLIKAGGLIEYTREKLCG
FT                   RGV"
FT   gene            complement(734871..736121)
FT                   /locus_tag="DehaBAV1_0747"
FT   CDS_pept        complement(734871..736121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0747"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase, large subunit;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17331"
FT                   /protein_id="ABQ17331.1"
FT                   /translation="MNLVEKILAAHCGKTQVSPGDFINAKVDLVLANDITAPIAIKEFK
FT                   KVGVSKVFDSKKIVFVPDHFVPNKDIASAEQVKMVREFAREQGILFFECGKMGVEHVIL
FT                   HEQGLVLPGDIVVGADSHTCTYGALGAFTTGMGSTDIAAAMATGEVWMKVPQTIKFNYS
FT                   GKLPKWIGGKDLILYTIGQTGVDGALYSAMFFCGEAIEALSMENRFTMSNMAIEAGGKA
FT                   GLFRVDEKTLEYVTPRAKRQYTVYDNDADASYAKTYNFDISKLEPQVSLPHSPANARPV
FT                   SQIGKIKVDQVIIGSCTNGRLEDLAVSAKLLKGNVVHPDLRTIVIPGSQQVYLDALKAG
FT                   YIETFINAGVAVSTPTCGPCLGGHMGILAAGERCLATTNRNFVGRMGSPKSEVYLAGPA
FT                   VAAATAIKGYIAHPDEI"
FT   gene            complement(736142..736543)
FT                   /locus_tag="DehaBAV1_0748"
FT   CDS_pept        complement(736142..736543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0748"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17332"
FT                   /protein_id="ABQ17332.1"
FT                   /translation="MPIEVEMLFRILLAMVLGGIVGYEREHSGKAAGLRTNTLICVGSC
FT                   LITLVSIYGFSETDISRIAAGIVTGVGFLGAGAILRQSEGHVEGLTTAATIWAVAGIGL
FT                   AVGAGMYFLSAVGTGVILLILLIDRVKFR"
FT   gene            complement(736559..738076)
FT                   /locus_tag="DehaBAV1_0749"
FT   CDS_pept        complement(736559..738076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0749"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17333"
FT                   /protein_id="ABQ17333.1"
FT                   /translation="MDRIKIFDTTLRDGEQAAGASLNAQEKLEIARQLEKLGVDIIEAG
FT                   FPITSPGDFEAVKLIAQEVRTPVICGLARAIPADIDRAWEALKEAAHPRIHVFISSSEI
FT                   HMVHQIKKSRDEVLELARTMVAKAKGYTDDIEFSPMDASRSDPEFLYKLLEAVIDAGAT
FT                   TLNIPDTVGYAIPSEFGELIKGIRQNVPNIGKAVISVHCHDDLGMGTANSLAAVKNGAR
FT                   QVECTLNGIGERAGNAALEEVVMALRTRSDFFNFETGINTQEIYRTSRLVSALTGFAIQ
FT                   PNKAVVGENAFRHQSGIHQDGVIKMAKTFEIMDPKEVGIQASSLVLGKLSGRHAFKQHL
FT                   TELGFDLNEEDFDRAFKAFKDLADKKKDVTDRDIEALVAEELRTTVELYHLDRIQVTSG
FT                   DRGIPTAAVRLTTPNGGAVEDASLGSGPVDAVYKAINRIVNVPNKLTEFSVKSVTAGID
FT                   ALGEVLIRIESDGVTYTGRGSDTDIIVASAKAYMNALNRLLRVKNAS"
FT   gene            complement(738252..739250)
FT                   /locus_tag="DehaBAV1_0750"
FT   CDS_pept        complement(738252..739250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0750"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; PFAM:
FT                   acetohydroxy acid isomeroreductase; Acetohydroxy acid
FT                   isomeroreductase, catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17334"
FT                   /db_xref="GOA:A5FR44"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5FR44"
FT                   /protein_id="ABQ17334.1"
FT                   /translation="MAVIYYDKDCDLSLIEKKLIGIVGYGAQGHAHAQNLRDSGLKVIV
FT                   ACVEGGRGWKKATADGFEVMCVAEMAKKADIIMMLAPDTSQAKIYKDSVEQGLKPGKML
FT                   MFAHGFNIHYGQIVPPSFVDVTMIAPKCPGYMLRQVFTEGAGAPSLIAVEQDASGKAKE
FT                   LALAYAKGIGSNRAGILETTFAEETETDLFGEQAVLCGGTTSLVKAGFETLVEAGYQPE
FT                   VAYFECLHELKLIVDLMYQGGIAYMRDSISDTAKYGDFTRGPRVINEDTYETMGEILGE
FT                   IQDGSFAKEWILENQAGRPVYNSLRRMESEHLIEEVGAELRSMMSWLKKKK"
FT   gene            complement(739269..739805)
FT                   /locus_tag="DehaBAV1_0751"
FT   CDS_pept        complement(739269..739805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0751"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17335"
FT                   /protein_id="ABQ17335.1"
FT                   /translation="MSPTKHTIVALVEDRPGVLNRMASLFRRRGFNIDSIAVGRSETPG
FT                   FSRMTIVVDGANTMVEQVRKQLDKVIDVVKVSDITGQDIICRELALIKVKSTPANRSEI
FT                   MQIVDIFRAKIVDVASDSLTVEVTGDEEKVNSLYNLLRAFGIKEITRTGRIAMTRGGLA
FT                   TATELQSSKELKTKE"
FT   gene            complement(739781..741490)
FT                   /locus_tag="DehaBAV1_0752"
FT   CDS_pept        complement(739781..741490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0752"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate enzyme
FT                   domain protein TPP-binding; thiamine pyrophosphate enzyme,
FT                   central region; thiamine pyrophosphate enzyme TPP binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:DehaBAV1_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ17336"
FT                   /protein_id="ABQ17336.1"
FT                   /translation="MKLTGAQIVCESLLKEGADIIFGYPGGVLLPLYDTFTQYPALRHI
FT                   LTRHEQGAAHAADGFARVTGKVGVCLATSGPGATNLITGIANAYMDSIPMVAITGQVTR
FT                   NLIGKDAFQEIDITGITLPITKQNYLVTKASSLADTIKEAFYLARTGRPGPVLIDIPKD
FT                   VFIEQAEFEYPDEPDLPGYKPVIKGNLMQIQKAARLIETAEKPVIIAGHGVNISGANEE
FT                   LKTLAENCQLPVITTLLGVSSFPEDHVLSYGMLGMHGMAYANMAVAATDLIIAIGMRFD
FT                   DRVTGKLSSFAPHASVIHIDIDPAEIGKNVRVDVPIVGDVKNVLKSLNKQVECVQHPDW
FT                   LRQLENWRREHPPLSIRHTDLILPQYIVQQISEATRGNAIVVTGVGQHQMWAAQHYTYI
FT                   RPNSLVTSGGLGTMGFDLPAALGAKVGCPDETVWCIAGDGGFQMNMQELGTVVQEKAAV
FT                   KIAVFNNGYLGMVRQWQDLFYNKNYVATPLGCPDFIKIAEAYGIPALNVKRKEDVRPAI
FT                   EQAMSTEGPFLLNFVIEPEENVYPMVPPGAALHEVLEEPKKEVSACPRRSIP"
FT   gene            complement(741512..743179)
FT                   /locus_tag="DehaBAV1_0753"
FT   CDS_pept        complement(741512..743179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="DehaBAV1_0753"
FT                   /product="dihydroxyac