(data stored in ACNUC7421 zone)

EMBL: CP000699

ID   CP000699; SV 1; circular; genomic DNA; STD; PRO; 5382261 BP.
XX
AC   CP000699; AAVK01000000-AAVK01000029;
XX
PR   Project:PRJNA17343;
XX
DT   01-JUN-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Sphingomonas wittichii RW1, complete genome.
XX
KW   .
XX
OS   Sphingomonas wittichii RW1
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales;
OC   Sphingomonadaceae; Sphingomonas.
XX
RN   [1]
RP   1-5382261
RX   DOI; 10.1128/JB.01030-10.
RX   PUBMED; 20833805.
RA   Miller T.R., Delcher A.L., Salzberg S.L., Saunders E., Detter J.C.,
RA   Halden R.U.;
RT   "Genome sequence of the dioxin-mineralizing bacterium Sphingomonas
RT   wittichii RW1";
RL   J. Bacteriol. 192(22):6101-6102(2010).
XX
RN   [2]
RP   1-5382261
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Saunders E., Brettin T., Bruce D., Detter J.C.,
RA   Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Halden R.U., Miller T.R., Salzberg S.L., Eisen J.A.,
RA   Richardson P.;
RT   "Complete sequence of chromosome of Sphingomonas wittichii RW1";
RL   Unpublished.
XX
RN   [3]
RP   1-5382261
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Glavina del Rio T., Dalin E.,
RA   Tice H., Pitluck S., Saunders E., Brettin T., Bruce D., Detter J.C.,
RA   Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Kim E., Halden R.U., Miller T.R., Salzberg S.L., Eisen J.A.,
RA   Richardson P.;
RT   ;
RL   Submitted (08-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; af517527f347fe93d61750ea3aa089d2.
DR   BioSample; SAMN02598383.
DR   EnsemblGenomes-Gn; EBG00001247109.
DR   EnsemblGenomes-Gn; EBG00001247110.
DR   EnsemblGenomes-Gn; EBG00001247111.
DR   EnsemblGenomes-Gn; EBG00001247112.
DR   EnsemblGenomes-Gn; EBG00001247113.
DR   EnsemblGenomes-Gn; EBG00001247114.
DR   EnsemblGenomes-Gn; EBG00001247115.
DR   EnsemblGenomes-Gn; EBG00001247116.
DR   EnsemblGenomes-Gn; EBG00001247117.
DR   EnsemblGenomes-Gn; EBG00001247118.
DR   EnsemblGenomes-Gn; EBG00001247119.
DR   EnsemblGenomes-Gn; EBG00001247120.
DR   EnsemblGenomes-Gn; EBG00001247121.
DR   EnsemblGenomes-Gn; EBG00001247122.
DR   EnsemblGenomes-Gn; EBG00001247123.
DR   EnsemblGenomes-Gn; EBG00001247124.
DR   EnsemblGenomes-Gn; EBG00001247125.
DR   EnsemblGenomes-Gn; EBG00001247126.
DR   EnsemblGenomes-Gn; EBG00001247127.
DR   EnsemblGenomes-Gn; EBG00001247128.
DR   EnsemblGenomes-Gn; EBG00001247129.
DR   EnsemblGenomes-Gn; EBG00001247130.
DR   EnsemblGenomes-Gn; EBG00001247131.
DR   EnsemblGenomes-Gn; EBG00001247132.
DR   EnsemblGenomes-Gn; EBG00001247133.
DR   EnsemblGenomes-Gn; EBG00001247134.
DR   EnsemblGenomes-Gn; EBG00001247135.
DR   EnsemblGenomes-Gn; EBG00001247136.
DR   EnsemblGenomes-Gn; EBG00001247137.
DR   EnsemblGenomes-Gn; EBG00001247138.
DR   EnsemblGenomes-Gn; EBG00001247139.
DR   EnsemblGenomes-Gn; EBG00001247140.
DR   EnsemblGenomes-Gn; EBG00001247141.
DR   EnsemblGenomes-Gn; EBG00001247142.
DR   EnsemblGenomes-Gn; EBG00001247143.
DR   EnsemblGenomes-Gn; EBG00001247144.
DR   EnsemblGenomes-Gn; EBG00001247145.
DR   EnsemblGenomes-Gn; EBG00001247146.
DR   EnsemblGenomes-Gn; EBG00001247147.
DR   EnsemblGenomes-Gn; EBG00001247148.
DR   EnsemblGenomes-Gn; EBG00001247149.
DR   EnsemblGenomes-Gn; EBG00001247150.
DR   EnsemblGenomes-Gn; EBG00001247151.
DR   EnsemblGenomes-Gn; EBG00001247152.
DR   EnsemblGenomes-Gn; EBG00001247153.
DR   EnsemblGenomes-Gn; EBG00001247154.
DR   EnsemblGenomes-Gn; EBG00001247155.
DR   EnsemblGenomes-Gn; EBG00001247156.
DR   EnsemblGenomes-Gn; EBG00001247157.
DR   EnsemblGenomes-Gn; EBG00001247158.
DR   EnsemblGenomes-Gn; EBG00001247159.
DR   EnsemblGenomes-Gn; EBG00001247160.
DR   EnsemblGenomes-Gn; EBG00001247161.
DR   EnsemblGenomes-Gn; EBG00001247162.
DR   EnsemblGenomes-Gn; EBG00001247163.
DR   EnsemblGenomes-Gn; EBG00001247164.
DR   EnsemblGenomes-Gn; EBG00001247165.
DR   EnsemblGenomes-Gn; EBG00001247166.
DR   EnsemblGenomes-Gn; EBG00001247167.
DR   EnsemblGenomes-Gn; EBG00001247168.
DR   EnsemblGenomes-Gn; EBG00001247169.
DR   EnsemblGenomes-Gn; EBG00001247170.
DR   EnsemblGenomes-Gn; EBG00001247171.
DR   EnsemblGenomes-Gn; EBG00001247172.
DR   EnsemblGenomes-Gn; EBG00001247173.
DR   EnsemblGenomes-Gn; EBG00001247174.
DR   EnsemblGenomes-Gn; EBG00001247175.
DR   EnsemblGenomes-Gn; EBG00001247176.
DR   EnsemblGenomes-Gn; EBG00001247177.
DR   EnsemblGenomes-Gn; EBG00001247178.
DR   EnsemblGenomes-Gn; EBG00001247179.
DR   EnsemblGenomes-Gn; EBG00001247180.
DR   EnsemblGenomes-Gn; EBG00001247181.
DR   EnsemblGenomes-Gn; EBG00001247182.
DR   EnsemblGenomes-Gn; EBG00001247183.
DR   EnsemblGenomes-Gn; EBG00001247184.
DR   EnsemblGenomes-Gn; EBG00001247185.
DR   EnsemblGenomes-Gn; EBG00001247186.
DR   EnsemblGenomes-Gn; EBG00001247187.
DR   EnsemblGenomes-Gn; EBG00001247188.
DR   EnsemblGenomes-Gn; EBG00001247189.
DR   EnsemblGenomes-Gn; EBG00001247190.
DR   EnsemblGenomes-Gn; EBG00001247191.
DR   EnsemblGenomes-Gn; EBG00001247192.
DR   EnsemblGenomes-Gn; EBG00001247193.
DR   EnsemblGenomes-Gn; EBG00001247194.
DR   EnsemblGenomes-Gn; EBG00001247195.
DR   EnsemblGenomes-Gn; EBG00001247196.
DR   EnsemblGenomes-Gn; EBG00001247197.
DR   EnsemblGenomes-Gn; EBG00001247198.
DR   EnsemblGenomes-Gn; Swit_R0001.
DR   EnsemblGenomes-Gn; Swit_R0004.
DR   EnsemblGenomes-Gn; Swit_R0005.
DR   EnsemblGenomes-Gn; Swit_R0006.
DR   EnsemblGenomes-Gn; Swit_R0007.
DR   EnsemblGenomes-Gn; Swit_R0008.
DR   EnsemblGenomes-Gn; Swit_R0009.
DR   EnsemblGenomes-Gn; Swit_R0010.
DR   EnsemblGenomes-Gn; Swit_R0011.
DR   EnsemblGenomes-Gn; Swit_R0012.
DR   EnsemblGenomes-Gn; Swit_R0013.
DR   EnsemblGenomes-Gn; Swit_R0014.
DR   EnsemblGenomes-Gn; Swit_R0015.
DR   EnsemblGenomes-Gn; Swit_R0016.
DR   EnsemblGenomes-Gn; Swit_R0017.
DR   EnsemblGenomes-Gn; Swit_R0018.
DR   EnsemblGenomes-Gn; Swit_R0019.
DR   EnsemblGenomes-Gn; Swit_R0020.
DR   EnsemblGenomes-Gn; Swit_R0021.
DR   EnsemblGenomes-Gn; Swit_R0022.
DR   EnsemblGenomes-Gn; Swit_R0023.
DR   EnsemblGenomes-Gn; Swit_R0024.
DR   EnsemblGenomes-Gn; Swit_R0025.
DR   EnsemblGenomes-Gn; Swit_R0026.
DR   EnsemblGenomes-Gn; Swit_R0027.
DR   EnsemblGenomes-Gn; Swit_R0028.
DR   EnsemblGenomes-Gn; Swit_R0029.
DR   EnsemblGenomes-Gn; Swit_R0030.
DR   EnsemblGenomes-Gn; Swit_R0031.
DR   EnsemblGenomes-Gn; Swit_R0032.
DR   EnsemblGenomes-Gn; Swit_R0033.
DR   EnsemblGenomes-Gn; Swit_R0034.
DR   EnsemblGenomes-Gn; Swit_R0035.
DR   EnsemblGenomes-Gn; Swit_R0036.
DR   EnsemblGenomes-Gn; Swit_R0037.
DR   EnsemblGenomes-Gn; Swit_R0038.
DR   EnsemblGenomes-Gn; Swit_R0039.
DR   EnsemblGenomes-Gn; Swit_R0040.
DR   EnsemblGenomes-Gn; Swit_R0041.
DR   EnsemblGenomes-Gn; Swit_R0042.
DR   EnsemblGenomes-Gn; Swit_R0043.
DR   EnsemblGenomes-Gn; Swit_R0044.
DR   EnsemblGenomes-Gn; Swit_R0045.
DR   EnsemblGenomes-Gn; Swit_R0046.
DR   EnsemblGenomes-Gn; Swit_R0047.
DR   EnsemblGenomes-Gn; Swit_R0048.
DR   EnsemblGenomes-Gn; Swit_R0049.
DR   EnsemblGenomes-Gn; Swit_R0050.
DR   EnsemblGenomes-Gn; Swit_R0051.
DR   EnsemblGenomes-Gn; Swit_R0052.
DR   EnsemblGenomes-Gn; Swit_R0053.
DR   EnsemblGenomes-Gn; Swit_R0054.
DR   EnsemblGenomes-Gn; Swit_R0055.
DR   EnsemblGenomes-Gn; Swit_R0056.
DR   EnsemblGenomes-Tr; EBT00001592652.
DR   EnsemblGenomes-Tr; EBT00001592653.
DR   EnsemblGenomes-Tr; EBT00001592654.
DR   EnsemblGenomes-Tr; EBT00001592655.
DR   EnsemblGenomes-Tr; EBT00001592656.
DR   EnsemblGenomes-Tr; EBT00001592657.
DR   EnsemblGenomes-Tr; EBT00001592658.
DR   EnsemblGenomes-Tr; EBT00001592659.
DR   EnsemblGenomes-Tr; EBT00001592660.
DR   EnsemblGenomes-Tr; EBT00001592661.
DR   EnsemblGenomes-Tr; EBT00001592662.
DR   EnsemblGenomes-Tr; EBT00001592663.
DR   EnsemblGenomes-Tr; EBT00001592664.
DR   EnsemblGenomes-Tr; EBT00001592665.
DR   EnsemblGenomes-Tr; EBT00001592666.
DR   EnsemblGenomes-Tr; EBT00001592667.
DR   EnsemblGenomes-Tr; EBT00001592668.
DR   EnsemblGenomes-Tr; EBT00001592669.
DR   EnsemblGenomes-Tr; EBT00001592670.
DR   EnsemblGenomes-Tr; EBT00001592671.
DR   EnsemblGenomes-Tr; EBT00001592672.
DR   EnsemblGenomes-Tr; EBT00001592673.
DR   EnsemblGenomes-Tr; EBT00001592674.
DR   EnsemblGenomes-Tr; EBT00001592675.
DR   EnsemblGenomes-Tr; EBT00001592676.
DR   EnsemblGenomes-Tr; EBT00001592677.
DR   EnsemblGenomes-Tr; EBT00001592678.
DR   EnsemblGenomes-Tr; EBT00001592679.
DR   EnsemblGenomes-Tr; EBT00001592680.
DR   EnsemblGenomes-Tr; EBT00001592681.
DR   EnsemblGenomes-Tr; EBT00001592682.
DR   EnsemblGenomes-Tr; EBT00001592683.
DR   EnsemblGenomes-Tr; EBT00001592684.
DR   EnsemblGenomes-Tr; EBT00001592685.
DR   EnsemblGenomes-Tr; EBT00001592686.
DR   EnsemblGenomes-Tr; EBT00001592687.
DR   EnsemblGenomes-Tr; EBT00001592688.
DR   EnsemblGenomes-Tr; EBT00001592689.
DR   EnsemblGenomes-Tr; EBT00001592690.
DR   EnsemblGenomes-Tr; EBT00001592691.
DR   EnsemblGenomes-Tr; EBT00001592692.
DR   EnsemblGenomes-Tr; EBT00001592693.
DR   EnsemblGenomes-Tr; EBT00001592694.
DR   EnsemblGenomes-Tr; EBT00001592695.
DR   EnsemblGenomes-Tr; EBT00001592696.
DR   EnsemblGenomes-Tr; EBT00001592697.
DR   EnsemblGenomes-Tr; EBT00001592698.
DR   EnsemblGenomes-Tr; EBT00001592699.
DR   EnsemblGenomes-Tr; EBT00001592700.
DR   EnsemblGenomes-Tr; EBT00001592701.
DR   EnsemblGenomes-Tr; EBT00001592702.
DR   EnsemblGenomes-Tr; EBT00001592703.
DR   EnsemblGenomes-Tr; EBT00001592704.
DR   EnsemblGenomes-Tr; EBT00001592705.
DR   EnsemblGenomes-Tr; EBT00001592706.
DR   EnsemblGenomes-Tr; EBT00001592707.
DR   EnsemblGenomes-Tr; EBT00001592708.
DR   EnsemblGenomes-Tr; EBT00001592709.
DR   EnsemblGenomes-Tr; EBT00001592710.
DR   EnsemblGenomes-Tr; EBT00001592711.
DR   EnsemblGenomes-Tr; EBT00001592712.
DR   EnsemblGenomes-Tr; EBT00001592713.
DR   EnsemblGenomes-Tr; EBT00001592714.
DR   EnsemblGenomes-Tr; EBT00001592715.
DR   EnsemblGenomes-Tr; EBT00001592716.
DR   EnsemblGenomes-Tr; EBT00001592717.
DR   EnsemblGenomes-Tr; EBT00001592718.
DR   EnsemblGenomes-Tr; EBT00001592719.
DR   EnsemblGenomes-Tr; EBT00001592720.
DR   EnsemblGenomes-Tr; EBT00001592721.
DR   EnsemblGenomes-Tr; EBT00001592722.
DR   EnsemblGenomes-Tr; EBT00001592723.
DR   EnsemblGenomes-Tr; EBT00001592724.
DR   EnsemblGenomes-Tr; EBT00001592725.
DR   EnsemblGenomes-Tr; EBT00001592726.
DR   EnsemblGenomes-Tr; EBT00001592727.
DR   EnsemblGenomes-Tr; EBT00001592728.
DR   EnsemblGenomes-Tr; EBT00001592729.
DR   EnsemblGenomes-Tr; EBT00001592730.
DR   EnsemblGenomes-Tr; EBT00001592731.
DR   EnsemblGenomes-Tr; EBT00001592732.
DR   EnsemblGenomes-Tr; EBT00001592733.
DR   EnsemblGenomes-Tr; EBT00001592734.
DR   EnsemblGenomes-Tr; EBT00001592735.
DR   EnsemblGenomes-Tr; EBT00001592736.
DR   EnsemblGenomes-Tr; EBT00001592737.
DR   EnsemblGenomes-Tr; EBT00001592738.
DR   EnsemblGenomes-Tr; EBT00001592739.
DR   EnsemblGenomes-Tr; EBT00001592740.
DR   EnsemblGenomes-Tr; EBT00001592741.
DR   EnsemblGenomes-Tr; Swit_R0001-1.
DR   EnsemblGenomes-Tr; Swit_R0004-1.
DR   EnsemblGenomes-Tr; Swit_R0005-1.
DR   EnsemblGenomes-Tr; Swit_R0006-1.
DR   EnsemblGenomes-Tr; Swit_R0007-1.
DR   EnsemblGenomes-Tr; Swit_R0008-1.
DR   EnsemblGenomes-Tr; Swit_R0009-1.
DR   EnsemblGenomes-Tr; Swit_R0010-1.
DR   EnsemblGenomes-Tr; Swit_R0011-1.
DR   EnsemblGenomes-Tr; Swit_R0012-1.
DR   EnsemblGenomes-Tr; Swit_R0013-1.
DR   EnsemblGenomes-Tr; Swit_R0014-1.
DR   EnsemblGenomes-Tr; Swit_R0015-1.
DR   EnsemblGenomes-Tr; Swit_R0016-1.
DR   EnsemblGenomes-Tr; Swit_R0017-1.
DR   EnsemblGenomes-Tr; Swit_R0018-1.
DR   EnsemblGenomes-Tr; Swit_R0019-1.
DR   EnsemblGenomes-Tr; Swit_R0020-1.
DR   EnsemblGenomes-Tr; Swit_R0021-1.
DR   EnsemblGenomes-Tr; Swit_R0022-1.
DR   EnsemblGenomes-Tr; Swit_R0023-1.
DR   EnsemblGenomes-Tr; Swit_R0024-1.
DR   EnsemblGenomes-Tr; Swit_R0025-1.
DR   EnsemblGenomes-Tr; Swit_R0026-1.
DR   EnsemblGenomes-Tr; Swit_R0027-1.
DR   EnsemblGenomes-Tr; Swit_R0028-1.
DR   EnsemblGenomes-Tr; Swit_R0029-1.
DR   EnsemblGenomes-Tr; Swit_R0030-1.
DR   EnsemblGenomes-Tr; Swit_R0031-1.
DR   EnsemblGenomes-Tr; Swit_R0032-1.
DR   EnsemblGenomes-Tr; Swit_R0033-1.
DR   EnsemblGenomes-Tr; Swit_R0034-1.
DR   EnsemblGenomes-Tr; Swit_R0035-1.
DR   EnsemblGenomes-Tr; Swit_R0036-1.
DR   EnsemblGenomes-Tr; Swit_R0037-1.
DR   EnsemblGenomes-Tr; Swit_R0038-1.
DR   EnsemblGenomes-Tr; Swit_R0039-1.
DR   EnsemblGenomes-Tr; Swit_R0040-1.
DR   EnsemblGenomes-Tr; Swit_R0041-1.
DR   EnsemblGenomes-Tr; Swit_R0042-1.
DR   EnsemblGenomes-Tr; Swit_R0043-1.
DR   EnsemblGenomes-Tr; Swit_R0044-1.
DR   EnsemblGenomes-Tr; Swit_R0045-1.
DR   EnsemblGenomes-Tr; Swit_R0046-1.
DR   EnsemblGenomes-Tr; Swit_R0047-1.
DR   EnsemblGenomes-Tr; Swit_R0048-1.
DR   EnsemblGenomes-Tr; Swit_R0049-1.
DR   EnsemblGenomes-Tr; Swit_R0050-1.
DR   EnsemblGenomes-Tr; Swit_R0051-1.
DR   EnsemblGenomes-Tr; Swit_R0052-1.
DR   EnsemblGenomes-Tr; Swit_R0053-1.
DR   EnsemblGenomes-Tr; Swit_R0054-1.
DR   EnsemblGenomes-Tr; Swit_R0055-1.
DR   EnsemblGenomes-Tr; Swit_R0056-1.
DR   EuropePMC; PMC2632904; 19056824.
DR   EuropePMC; PMC2668395; 19201802.
DR   EuropePMC; PMC2798625; 19880651.
DR   EuropePMC; PMC2976435; 20833805.
DR   EuropePMC; PMC3463246; 23066504.
DR   EuropePMC; PMC4123721; 25147547.
DR   EuropePMC; PMC5989583; 29620507.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000699.
DR   SILVA-SSU; CP000699.
DR   StrainInfo; 144023; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002524
CC   Source DNA and bacteria available from Rolf Halden
CC   (rhalden@jhsph.edu)
CC   Contacts: Rolf Halden (rhalden@jhsph.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5382261
FT                   /organism="Sphingomonas wittichii RW1"
FT                   /strain="RW1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:392499"
FT   gene            245..1678
FT                   /locus_tag="Swit_0001"
FT   CDS_pept        245..1678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66374"
FT                   /db_xref="GOA:A5V258"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A5V258"
FT                   /protein_id="ABQ66374.1"
FT                   /translation="MSDKVGGVGMNEGPAANAGIDAALAQAWETIRASLRRSIGVRTFD
FT                   GWLKPLTLGDCDLASGTLKLIAPSEFMANWATTHFVDHLLQGWRALLPQVRHVSIVPAS
FT                   ASERPALFSAPTAPVAAPAVEEAMPAPSDDVRCGTPLEARYTFDSYVVGKANEVAYNAA
FT                   RTLAEGGKLVFNPLFLHGGTGLGKTHLMHAIGHEYLARQPGAKVVYMSAEKFMFEFVSA
FT                   MRAKDTFSFKQRLRAADVLMIDDVQFIAGKESTQEEFFHTMNELISAGRRLVISADRSP
FT                   QDLDGIESRILSRLSWGLVADVNPADFELRLNILMRKLQGMPQAQVPQDVVMFLARRIS
FT                   ANVRELEGALNRVVAYAALSGKPVDIDFTQATLADILRANQRRVTIDEIQRKVSDHYRI
FT                   RQAEMSSARRAREVARPRQVAMYLAKQLTPRSLPEIGRRFGGRDHTTVIHAVKQIEKLR
FT                   QTDAELDADVRLLIRQLEG"
FT   gene            1789..2307
FT                   /locus_tag="Swit_0002"
FT   CDS_pept        1789..2307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0002"
FT                   /product="NifU-like involved in Fe-S cluster formation"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66375"
FT                   /db_xref="GOA:A5V259"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A5V259"
FT                   /protein_id="ABQ66375.1"
FT                   /translation="MGLAYRSCAAVPHRGLTPRNDPPYMGRMSASLYNARILRLATSIP
FT                   HQARLADAQATVSRRSPVCGSRVTVDVVMDGEGRVAALGQEVRACALGQASAALMGAHA
FT                   IGRTPAELAAARDALTAFLAGERDDPGDWPDLDIFLPARPHAARHPSIRLAFEAVAEAA
FT                   AQALAEPVR"
FT   gene            2304..4091
FT                   /locus_tag="Swit_0003"
FT   CDS_pept        2304..4091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0003"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; sodium/hydrogen
FT                   exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66376"
FT                   /db_xref="GOA:A5V260"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A5V260"
FT                   /protein_id="ABQ66376.1"
FT                   /translation="MSDAADALLLRDGVLLLGAAIVCVLIFRRLGLGATLGYLVAGALI
FT                   GPQGFGLIGDAESKLGIAELGIVLLLFLVGLELHPNRLWRLRRDIFGLGFVQVVACGVA
FT                   LSAVIYFGTAFTAAAAIALGLPLALSSTAQVLPMLRSAGRLNTPAGERAFSVLLFQDLS
FT                   LIPLITIIATLSRTPPAADAPPGWLLGVHTVVAVVGLVLAGRFIINPLFRLVGRLGERE
FT                   LFVAAGLFTVLASAAVMEALHLSTALGAFVAGVMLADSPYRHELEADVEPFRTILLGLF
FT                   FIAVGMLLDLHVIAERPLFVAAMALAVVATKTLVMFGVAKLFGVSNRGALGFGLLLSQG
FT                   GEFAFVLFAQASEALLIRPEAASLFGAIVTLSMATTPFLMMVSSRFLTPPPSQEERPGP
FT                   DGGMSPAAIVVGYGRFGQTVAQMLMAAGTRVSLIDNEIEQIDVAEKFGSKVFYGDGTRV
FT                   ELLRHAGADQACAIIFCVDGDGLGKAQLQPVLNAFPNAAVLVRAFDRRHMMVLGRLDIA
FT                   GAVRELFESAVVLGREALEAVGVSEANIDKIEAEYRRRDGLRLEAQIAADDLTVRRDMM
FT                   FNPDRKLDLEPEEDEDGAG"
FT   gene            4078..4431
FT                   /locus_tag="Swit_0004"
FT   CDS_pept        4078..4431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0004"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66377"
FT                   /db_xref="GOA:A5V261"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A5V261"
FT                   /protein_id="ABQ66377.1"
FT                   /translation="MARARTLGDPLAALFALSGAVAVVAGAYGAHGASGKAAEWLATGA
FT                   EYQMIHAVAGLVVLAKGRGAAALLLLGALLFSGTLYAMALGGPRWLGAVTPLGGLAMIL
FT                   GWIWIAILYLRGR"
FT   sig_peptide     4078..4155
FT                   /locus_tag="Swit_0004"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.413 at
FT                   residue 26"
FT   gene            complement(4444..6153)
FT                   /locus_tag="Swit_0005"
FT   CDS_pept        complement(4444..6153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0005"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66378"
FT                   /db_xref="GOA:A5V262"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A5V262"
FT                   /protein_id="ABQ66378.1"
FT                   /translation="MSNLPATTSSGFLDSASSIYVVAPGIAVVALVILGLIIARLYRRA
FT                   SKEIAFVRTGFGGEKVVMNGGALVLPVFHETMPVNMNTVRLAVERKNADALITLDRLRI
FT                   DVKAEFYVRVRPDREAIAMAAQTLGMRTMHSENLKELVEGKFVDALRSVAAGMTMNQLH
FT                   EQRSDFVQKVQQVSSADLAMNGLELESVSLTGLDQTSIEHFNANNAFDAEGLTKLTEQI
FT                   ELRKKARNDIEQDTRVQIEAKNLEAQRQSFLISRDSEFARLEQEREIEMRRAEQSSEVA
FT                   RQQSERQREAEQARIEAKQLTDAAQIEADRAVQEAKIAQAQALEIARQEQQIAVQNKSR
FT                   EESQAKAEADKARAAAVAAEEQVVTARETEVAERAKRIELIQAAKEAERQALGVKVEAE
FT                   AEKQAAADRAEALRAAAKGEAEAEKLRADAARVRFEVEAAGKRAVNEAANLLSSENISL
FT                   QAKLELLRVLPDIIREAAKPMEAIDSIKIVQVDGLTGAGAGGAEIVSAGGEQNLAQSAV
FT                   AAALRYRAQAPVVDGLMKELGLDGSTLDSLVKGGAAEMPVVAPKAKAAELPE"
FT   gene            complement(6150..6767)
FT                   /locus_tag="Swit_0006"
FT   CDS_pept        complement(6150..6767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0006"
FT                   /product="protein of unknown function DUF1449"
FT                   /note="PFAM: protein of unknown function DUF1449"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66379"
FT                   /db_xref="GOA:A5V263"
FT                   /db_xref="InterPro:IPR010840"
FT                   /db_xref="UniProtKB/TrEMBL:A5V263"
FT                   /protein_id="ABQ66379.1"
FT                   /translation="MLGFLAAGENLAFVIALGTMVLIGLVEAVGLGSSALGHDLDLDAD
FT                   GDWLGWLGFGRLPLLMLLVVFLACFSVIGLVGQQIALSSFGALLPGWIAIPAAGVAALP
FT                   ATGGMARIVGAIMPRDETTAIGIDQLVGLHAQIVVGTATQGSPAKARVRDFHGQVHHVM
FT                   VEPDIAGARFAEGTEVLLVRREDHLFRAISSDRPPFSEWIER"
FT   gene            complement(6840..7949)
FT                   /locus_tag="Swit_0007"
FT   CDS_pept        complement(6840..7949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0007"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66380"
FT                   /db_xref="GOA:A5V264"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:A5V264"
FT                   /protein_id="ABQ66380.1"
FT                   /translation="MTVRVSLGDRSYDITIENGALDRAGELLAPYAARGRFIVVTDRNI
FT                   VPNQLYRLETALTAAGIASAVEVLPPGESTKSWVMLEKLTDALLSYGVERGDTIVALGG
FT                   GVIGDLVGFAAAILKRGCRFVQVPTTLLAQVDSSVGGKTAINSKAGKNLIGAFYQPAHV
FT                   LIDPTTLDTLPPRETRAGYAEVVKYGLIDDAAFFDWCEANGPKLLAGDPEARAVAIAKS
FT                   VGAKARIVGEDERETSGRRALLNLGHTFGHALEAETGFSDRLLHGEAVAAGMALAFRFS
FT                   AAQGLCPPEDARRVTAHIAATGLPATLQAAGVDAGGATLVGHMQHDKKMEGGRLPFLLA
FT                   RGIGETFLDKQVDLAAVEAFLDAERTATA"
FT   gene            complement(7946..8509)
FT                   /locus_tag="Swit_0008"
FT   CDS_pept        complement(7946..8509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0008"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66381"
FT                   /db_xref="GOA:A5V265"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A5V265"
FT                   /protein_id="ABQ66381.1"
FT                   /translation="MCIALDDMPQSLPPNLPHFDRPLVLIGLMGAGKSTIGKRLAARVH
FT                   LPFVDADQEIERAAGLTISEIFARFGEKEFRDGERRVIARLIDGRPKVIATGGGAFMQE
FT                   ETRALILDRATAVWLDADIEVLADRVGRREGTRPLLKDRDAREVLAELAAVRNPVYALA
FT                   PIHIRSQPLPHDATVDAILKALTQ"
FT   gene            8622..8759
FT                   /locus_tag="Swit_0009"
FT   CDS_pept        8622..8759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66382"
FT                   /db_xref="GOA:A5V266"
FT                   /db_xref="UniProtKB/TrEMBL:A5V266"
FT                   /protein_id="ABQ66382.1"
FT                   /translation="MSRFSFILSSVVIIIVVALVALSFVNTEKPPVTVEKAMLNEAQAK
FT                   "
FT   sig_peptide     8622..8693
FT                   /locus_tag="Swit_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.706 at
FT                   residue 24"
FT   gene            8740..10554
FT                   /locus_tag="Swit_0010"
FT   CDS_pept        8740..10554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66383"
FT                   /db_xref="UniProtKB/TrEMBL:A5V267"
FT                   /protein_id="ABQ66383.1"
FT                   /translation="MKPRPSKKAFLALTAGAASLAAVAAFAQESLLPPGFGNQPPPANR
FT                   PQPAAPAPAQPAAGPTQAAPAAPGASVAPTLTLDPAIFASAEPDAPVVPVEELPPSARR
FT                   SIDAVGPLAGFGPNAWGMADGRFLSALMRRLDVPIASRWASITLRRALLTRVGTPDNVS
FT                   APDWIAERAWLLLRMGEADGARMLIEGVDVDRFNAKLYTVAGQSALAGADAAGLCALAD
FT                   GGAIRSREAVWPMARAICAALSGDTAIADVLMDQARRRTSNPQGIDVQLAERMMGVNGA
FT                   GRRSISVEWTGVNQLTAWRFGMASALGLTIPADLYRTVGPQVVAWSARAPMIPPAERLD
FT                   AAMTAARLGVFSNSALVDLYAQAADESGDFSSDTPAGRLRLCYAGDDAGARLSAMRGFW
FT                   SGEGQGDGKQVDRYAGLILTARAAARIAPDSDHVSDAAGLIGSMMSAGLDRKAAAWAPI
FT                   VSGMSAGKGDDAWAILAVGTPRAVVDVSADRLSAVADRWSAENPQKLRLLLAALAGLDR
FT                   LQTEEQMRLLQEYQVGFDNRSNWGRLLLQAADRKEPATVALLVAVGMQKTGWSGLSSAM
FT                   FATMIRALHDVGLDGEARMIAAEAMTRL"
FT   sig_peptide     8740..8823
FT                   /locus_tag="Swit_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 28"
FT   gene            10709..11614
FT                   /locus_tag="Swit_0011"
FT   CDS_pept        10709..11614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0011"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66384"
FT                   /db_xref="GOA:A5V268"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A5V268"
FT                   /protein_id="ABQ66384.1"
FT                   /translation="MKDSEAIAQFLEMLAAEGGAARNTLLAYGSDLRGASELLGGGLVG
FT                   ADTAGLQTLGGEWMALSRTSVARKASVLRRFFAFLEEEGIRRDDPSDALPRPAVQRALP
FT                   RTLSHGDIERLFDTLEERRRDRHADPLTLRLIALVELLYGSGLRATELVSLPRHALRGD
FT                   RPFLILRGKGGRERLVPISDRARMAVAEWGAHVPTDQPWLFPSGHGHLSRVRLFQLVRE
FT                   LAAEAGIPPQRISPHVLRHAFATHLLEGGADLRALQTMLGHADIATTQIYTHVNSAHLV
FT                   ELVNARHPLMDAARRRPQDG"
FT   gene            11706..13289
FT                   /locus_tag="Swit_0012"
FT   CDS_pept        11706..13289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0012"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66385"
FT                   /db_xref="GOA:A5V269"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5V269"
FT                   /protein_id="ABQ66385.1"
FT                   /translation="MAADGGIDVRRDRLVIFASTLGTAFEWYDFFVYGTLATIVAGHFF
FT                   PSDNPAVSFLIFLGSFGVGFGMRPLGAILFGVLGDRLGRKYTFLVTITLMGVATAAVGL
FT                   LPTYATIGVAAPILLVFCRILQGLALGGEYGGAAVYVAEHAPRNRRGFYTSFIQSGVSA
FT                   GFMLSLSVVLLSNQFVDKEAFAAWGWRIPFLFSLVLLGISLWVRLKLSESPVFTAMKEK
FT                   GEVARNPLRESFDSWAKVRRILLALFGLSAGLTVIWYVGQFQSLYFLQNSLRVDDMVAR
FT                   VLVGAAAFGAVFGFILFGWLSDRIGRRRLILTGYVLTLVFLFPLFHWIAAAANPGLAAA
FT                   MERAPVVVTGSDCRYDPFASRQETACGKVLDALSKKGVAYTKVDGVPGTPPAVTIGGAP
FT                   VDASDAESLEAGLAAAGYDLAKVTPSLGDSAKIFVYLLILGFFSGMTYGPSAAVMVELF
FT                   PARVRYTSLSVPYHIGTGYFGGFLPFISQYIVARTGDPFAGFWYTFIVAGVAFLIALVW
FT                   LPETAGKELE"
FT   gene            13318..14364
FT                   /locus_tag="Swit_0013"
FT   CDS_pept        13318..14364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0013"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; PFAM: alanine racemase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66386"
FT                   /db_xref="GOA:A5V270"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A5V270"
FT                   /protein_id="ABQ66386.1"
FT                   /translation="MTQEFLPLRLDLDPQALVANWRWLGERAAAPAGAAIKADAYGLGA
FT                   VEVSRRLADAGCRDFFVATWAETEALGSLPFGAGLSVLHGLREEDLAAALASRARPVLN
FT                   SPAMVARWKAAAPGRPCDVMIDTGMNRLGLTVEEACSGLLDGLEIDLLLSHLACADEPD
FT                   SPMNERQRARFVDLRGRVAAKRHSLANSAGACLGPAYGFDLIRPGIALYGGIPRPEARG
FT                   HIVRVVRIEAQVLQVRDVPAGDTIGYGATFTAERPMRVAILNLGYADGYLRAFAGNGAA
FT                   LVNGRRCPLAGRVSMDLIAVDLTGADAAEGDWLEIDYALESAADRTGLSQYELLTGLGS
FT                   RYQRRWKE"
FT   gene            14366..15160
FT                   /locus_tag="Swit_0014"
FT   CDS_pept        14366..15160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0014"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66387"
FT                   /db_xref="GOA:A5V271"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A5V271"
FT                   /protein_id="ABQ66387.1"
FT                   /translation="MSATLQPVIGFFGSIGRLFIAALAAIGRVTVFAATTISRAVRPPY
FT                   YPSRLFEQLMQIGWFSLPVVGMTAIFSGAALAQQTFTAGSRFNATSTVPAIVVLGIVRE
FT                   LGPVLVGLMVAGRVSSAMAAELGTMRVTEQLDALTTLRTDPYRYLIAPRLFAALIAIPL
FT                   MVLVANAIGIFGGYFVAVYKLGFNAVGYLDTTRQFLTATDLQMALVKSAFFGFFIALMG
FT                   CYHGFRAQGGAAGVGRATTDAVVSAFILILLSNMIITLMAFG"
FT   sig_peptide     14366..14467
FT                   /locus_tag="Swit_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.951 at
FT                   residue 34"
FT   gene            15160..15918
FT                   /locus_tag="Swit_0015"
FT   CDS_pept        15160..15918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0015"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66388"
FT                   /db_xref="GOA:A5V272"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V272"
FT                   /protein_id="ABQ66388.1"
FT                   /translation="MADNHKIVLEGVRKAFGGNAVLDGVDLAIERGESLVIIGQSGSGK
FT                   SVMLKCILGLIRPDRGAIRVDGEDLMAMSARELETARAKFGMLFQGSALFDSLPIWRNV
FT                   TFALTQGRMRDAAKMRKIAAENLERVGLGSQVLDLRPSELSGGMQKRVALARAIAPRPE
FT                   IIFFDEPTTGLDPIRADVINDLIVELVEELGVTALTITHDMASARKIAHRVAMLYQGRI
FT                   VWSGPRDRLYDSGNPYVDQFVQGRAEGPIQ"
FT   gene            16023..16577
FT                   /locus_tag="Swit_0016"
FT   CDS_pept        16023..16577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0016"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66389"
FT                   /db_xref="GOA:A5V273"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A5V273"
FT                   /protein_id="ABQ66389.1"
FT                   /translation="MIGRTVPNVTLKTRVRDESVGGPNPFRWQDVHTGELFAGRRVVVF
FT                   ALPGAFTPTCSTEQCPAYERSYDELRARGADEVYCLSVNDAFVMYQWAKQLGVEKTRML
FT                   PDGSGDFTRRMGMLINKDHLGFGDRSWRYAMVVDDGRITGWFEEPGINDVGADDDPYGE
FT                   SAPDKVLAWLHENPVREPAEA"
FT   gene            complement(16635..17213)
FT                   /locus_tag="Swit_0017"
FT   CDS_pept        complement(16635..17213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0017"
FT                   /product="Glutathione S-transferase, C-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66390"
FT                   /db_xref="GOA:A5V274"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A5V274"
FT                   /protein_id="ABQ66390.1"
FT                   /translation="MRVYGDSISGNCLKVKWTADLLGIRHEWIETSVLDGATRTPDFLA
FT                   MNPAGQVPLVRYDDGRTLAQSNAIILSLAEGSALIPADAHQRAKMLEWLFWEQYSHEPY
FT                   VAVARFQVHYLGKAVADLEPRVVERGKGALKLLDEQLTGRTFLVGDALSLADIALVAYT
FT                   RVADEGGFELGDYPAVRRWIGRVEEALGI"
FT   gene            17449..18300
FT                   /locus_tag="Swit_0018"
FT   CDS_pept        17449..18300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0018"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66391"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A5V275"
FT                   /protein_id="ABQ66391.1"
FT                   /translation="MNAITRIAAAQGSRPATPEARRQRRRYRTIWVSDIHLGTRGCNAQ
FT                   MLIDFLDSTDSETMYLVGDIIDGWRLKRSWYWPSAHNDIVWRVMKRAKRGTRVVFIPGN
FT                   HDEMFRQYSGMTFGGIEIRRSAIHETADGRRLMVTHGDEFDTVVMCHRWLAFAGDFAYE
FT                   TLMRLNVVINTVRQWFDLPYWSLSKHAKHKVKNAVEFISRFEEAVAHEAGERGVDGVVC
FT                   GHIHTAEIRRFGDIVYYNDGDWVEGCTALVEHFDGRMEVLHWADEIAARRQGATAAAAM
FT                   AA"
FT   gene            18302..19330
FT                   /locus_tag="Swit_0019"
FT   CDS_pept        18302..19330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0019"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66392"
FT                   /db_xref="GOA:A5V276"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5V276"
FT                   /protein_id="ABQ66392.1"
FT                   /translation="MRIAIATDAWAPQVNGVVRTLQAVTAELGAMGHEVCVIAPDQFLT
FT                   VPCPSYPEIRLALTTQAGVGRRIAEFGAEAIHIATEGPIGLAARRHCLGRRLAFTTAYH
FT                   TQFPDYVAERTGMPADWFWHYIRWFHAPSAAVLASTPSVEAILDQRGVGPVQRWGRGVD
FT                   LALFRPDRAPHPAFAALPRPIQLYVGRVAVEKNIEAFLACDTPGTKVVVGDGPARAALS
FT                   RDYPEVRFLGALHGEELASAYAGADVFVFPSRTDTFGLVMIEALACGAPVAAYPVTGPI
FT                   DILAPSSAAMDDDLATAIGRALRCDRGAAAAYGATFGWRRSAEQFLGALVPQGEGRRRL
FT                   AA"
FT   gene            19473..20150
FT                   /locus_tag="Swit_0020"
FT   CDS_pept        19473..20150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0020"
FT                   /product="protein of unknown function DUF1013"
FT                   /note="PFAM: protein of unknown function DUF1013"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66393"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:A5V277"
FT                   /protein_id="ABQ66393.1"
FT                   /translation="MAQPLMPHATASWLVDNTALSFQQIAEFCGLHILEVQAIADDMAA
FT                   TKLTGRDPVRAGELTMAEIEKGQQDPNYRLVMQKGPDQLRRTKGPRYTPVSKRQDKPDG
FT                   IAWIIRNHPEVSDGQISKLIGTTRTTIAAIRDRTHWNIANIVPKDPVTLGLSSQRELDA
FT                   VVAKAAKAAGLEAPTDTRLEGDREALIEQLRAEREAAVRNADAVHVEESTYGGATFHDP
FT                   FKK"
FT   gene            20286..20603
FT                   /locus_tag="Swit_0021"
FT   CDS_pept        20286..20603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0021"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66394"
FT                   /db_xref="GOA:A5V278"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A5V278"
FT                   /protein_id="ABQ66394.1"
FT                   /translation="MRPEGPAHPNPSLTLPPPEPKSLAMTDSAALADLSFEDALKQLET
FT                   IVRQLESGEVPLDESISLYAKGDALKRLCEERLNAAKARIEKISLGADGAPRGTEPFTA
FT                   S"
FT   gene            20611..21504
FT                   /locus_tag="Swit_0022"
FT   CDS_pept        20611..21504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0022"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66395"
FT                   /db_xref="GOA:A5V279"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A5V279"
FT                   /protein_id="ABQ66395.1"
FT                   /translation="MSALLASELARIAQEIDARFDTLLTPPDDSRERLYAAMRHAAIGG
FT                   GKRLRPLLACASARLFAVDPECALRAGLAIEAIHVYSLIHDDLPAMDDDDLRRGRPTVH
FT                   RAYDEATAILAGDGFQALAFEIAASEATHPDPFVRSELVAALAAAAGPAGMVGGQAMDM
FT                   AAEAGGEHDLDAISRLQQLKTGALIGFSIEAGAILGRVPPEGRTKLRAYAHDLGLAFQI
FT                   ADDLLDAEGDPAAMGKAAGKDHAAGKATFVGLLGVDRARAQARLLSQQAIDHLGNFGRE
FT                   ADLLRDIAAYVVDRDR"
FT   gene            21529..22026
FT                   /locus_tag="Swit_0023"
FT   CDS_pept        21529..22026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0023"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="TIGRFAM: pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66396"
FT                   /db_xref="GOA:A5V280"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V280"
FT                   /protein_id="ABQ66396.1"
FT                   /translation="MRTGVYPGTFDPITLGHMDIIRRGAKLVDKLVIGVTTNASKSPMF
FT                   TVEERLAMVRRETADLPGVEVVAFDSLLMDFAESMGAAIIVRGLRAVADFEYEYQMAGM
FT                   NQQLNNRVETVFLMADVALQPIASRLVKEIALYGGAIDRFVPKRVVQEVVARVEKIGKK
FT                   GS"
FT   gene            22115..23023
FT                   /locus_tag="Swit_0024"
FT   CDS_pept        22115..23023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0024"
FT                   /product="peptidyl-prolyl cis-trans isomerase, cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66397"
FT                   /db_xref="GOA:A5V281"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A5V281"
FT                   /protein_id="ABQ66397.1"
FT                   /translation="MRSKFVVAAFAGLFMAGVALAQPAPAPAPVDAPAQDPQNILNLDL
FT                   STGGRVKILLRPDKAPYSVDRIKTLVRRHFYDGLTFHRVIEGFMAQGGDPKGTGEGGSD
FT                   LPDLKAEFNDMPHVRGVMSMARAQDPNSANSQFFIMLQPNLTLDGNYTPIGRVFSGMEY
FT                   VDAIEKGEPPANPSKIVHASIESDDQGQPPVAFVPPAAPEAAAPAAASKQDRKAREKAA
FT                   KEEKEAAEKAAKEAKKLRKQQSQPGDLANPADAVGGGEAAVSPSVAPQGTDAAVEAVAD
FT                   AQPTEDAVRAVAGEEAAASPQ"
FT   sig_peptide     22115..22180
FT                   /locus_tag="Swit_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            23033..24067
FT                   /locus_tag="Swit_0025"
FT   CDS_pept        23033..24067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0025"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66398"
FT                   /db_xref="GOA:A5V282"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V282"
FT                   /protein_id="ABQ66398.1"
FT                   /translation="MRVDLFDFDLPPENIALRPASPRDSARMLLVEGSEGALADRHVSD
FT                   LPGLLRVGDCLVFNDTRVIPAQLEGRRGEARIGATLHKREGLRQWRAFVRNAKRVRTGD
FT                   RIDFGAGVSAIAAERGEDGSILLDFEGDEPVELLLERAGTMPLPPYIAGKRPTDDRDRD
FT                   DYQTMFAREKGAVAAPTAALHFTPRLMEALAAAGIASETLTLHVGAGTFLPVKADDTDD
FT                   HRMHAEWGRIDAATADHLNAIRAAGGRVIAVGTTSLRLLESATGEDGVIRPFDGDTAIF
FT                   ITPGYRFRAIDGLMTNFHLPKSTLFMLVSALMGRDRMQAAYAHAIAEGYRFYSYGDSSL
FT                   LLPG"
FT   gene            complement(24171..25175)
FT                   /locus_tag="Swit_0026"
FT   CDS_pept        complement(24171..25175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66399"
FT                   /db_xref="InterPro:IPR018736"
FT                   /db_xref="UniProtKB/TrEMBL:A5V283"
FT                   /protein_id="ABQ66399.1"
FT                   /translation="MTITDGLARPVIRSLATIAFATSAAPILADAIDENAPAIDFDLSE
FT                   PHKDWLALAEQPVPAAEPGYGPSLPATPAAEEPNGQRLSFGRQVGAIKWELGAALVWVT
FT                   GTNIAKVNREGGRRFHFQDEGWFGKDTINLGMDKLTHAWNTYWITDMIEARIRRKTGAT
FT                   NAGLTAASLSMGVMLYAELWDAHKKSSGFSFQDIAMNASGAGFSLLRNAVPGLDRKLDF
FT                   RLLLIPNKDIYTPSGTRHYRQMRYLFALKLAGFEGLEDSPLRFVELHAGYRATGFTAKE
FT                   EARGDPRRRRPFIGIGLNLNELFFPSRPSGWAGRAASEALQYVQVPYTAYHAD"
FT   sig_peptide     complement(25086..25175)
FT                   /locus_tag="Swit_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.788 at
FT                   residue 30"
FT   gene            25334..27262
FT                   /locus_tag="Swit_0027"
FT   CDS_pept        25334..27262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0027"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S15; peptidase S9, prolyl
FT                   oligopeptidase active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66400"
FT                   /db_xref="GOA:A5V284"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5V284"
FT                   /protein_id="ABQ66400.1"
FT                   /translation="MLVASTALAALVAPLSAQTVETRHVGSATLQNVPAIPAEVRDAVQ
FT                   RYQNSRAALFEDWLPDGSMLIATRFGATQQIHHVAVPGGARTQISFGSEPIAEAHVIPG
FT                   SDRFATVGDTGGDEWFQLDLRGLAGTATRLTEPTTRNQSPVFSKDGSLLVWARATRGSA
FT                   AYSLIGVDPKAGGAPKPLYRADGAIDPADIAADKNRLIFVRSLSNREDQLFELDLATGK
FT                   AARIAPKTAPAIYQKPRYLPGGRSLIAISDSGSDTRQLVEIDLATGRQTVLTPGLGWDV
FT                   EDYDLSDDGRVLAYAINEDGFSRVVVQDRVTRRALPQPALPRGVLTALKFTPDGRRLAI
FT                   GLTSATSAGDVWSWDVDGAALTRWTTSELGELDPARLAEPELIRFTSFDGLSVPAFVYR
FT                   PKGVPADRPTPVIIDIHGGPEAQTRPVWNYGAQYFADVLQATVILPNVRGSDGYGKRYL
FT                   NLDNAEKREDSVRDIGALLDWIARQPGLDAKRVAVYGQSYGGYMSLAVMTHYSDRLVGG
FT                   VERYGISNWTTFLENTEAYRRDNRRAEYGDERDPKMRKVFEAISPTNNVGRITRPMLVM
FT                   QGANDPRVPQSESDQVVAKLRAAGNEAWYVLFADEGHGFLKKPNNDLRREVETVFLRRL
FT                   FDPAATK"
FT   sig_peptide     25334..25393
FT                   /locus_tag="Swit_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.835 at
FT                   residue 20"
FT   gene            complement(27309..28004)
FT                   /locus_tag="Swit_0028"
FT   CDS_pept        complement(27309..28004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0028"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66401"
FT                   /db_xref="GOA:A5V285"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:A5V285"
FT                   /protein_id="ABQ66401.1"
FT                   /translation="MTRKLAAELFGTFWLVFGGCGSAVLAAAFPELGIGFAGVALAFGL
FT                   TVLTMAYAVGGISGGHFNPAVSLGAAAAGRLPWKDLVPYWVAQVVGAIAAAAVLYAIAS
FT                   GKPGFEAGGFASNGYDALSPGGYSLHAALLIEIVLTAGFIIVILGSTSSLVPAGFAPIP
FT                   IGLALTLIHLISIPVTNTSVNPARSTGVALFATTDALGQLWLFWAAPLVGAVIGALIWR
FT                   FLLASPDEA"
FT   sig_peptide     complement(27924..28004)
FT                   /locus_tag="Swit_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.912 at
FT                   residue 27"
FT   gene            complement(28114..29760)
FT                   /locus_tag="Swit_0029"
FT   CDS_pept        complement(28114..29760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0029"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M28"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66402"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A5V286"
FT                   /protein_id="ABQ66402.1"
FT                   /translation="MRKIAALLAAPLLLAPALCLAAPTPAFDVQRFSQDVKTLSDDSFE
FT                   GRAPATEGEKKTIAYIIQQMKAAGLQPGMPDGGWTQSVPLLKSDIVGAPKLSLRLGDGA
FT                   ARALTQGEEIAVRAALTGQDKVDIAAAPLVFVGYGVKAPERNWDDFKGADLKGKILVVL
FT                   VNDPDFEGGEGDFGGKTMTYYGRWTYKYEEGARQGAAGVLVIHEYAPASYGWPTVKNSN
FT                   TNTMFDIVRADPTAEHVPMEGWIQRDLAVDLFKAAGLDFEAMKKAAQRKDFKPVALNAT
FT                   LDAAYAVKAETITSYNVLGRLAGAKHPNETVIYSGHWDHLGIGQPDAKGDRIYNGARDN
FT                   ASGIAALLELGRAFAKAPRTDRSVLFLAVTAEEKGLLGSEYYAANPVYPLATTTGVINM
FT                   DSIVGEGAARDFTISGVARLGLLDMLVDQGRKLGRVYVPDPKTETGGFYRSDHFPMAKA
FT                   GVPAFSFKGGIDLVKGGVARGKELGAIYTRDRYHQPADEWSADMDLSNIGPDLTLLYNT
FT                   GRALADSRAWPDWAPDAEFKAKRDETAAERK"
FT   sig_peptide     complement(29695..29760)
FT                   /locus_tag="Swit_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            29952..30374
FT                   /locus_tag="Swit_0030"
FT   CDS_pept        29952..30374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0030"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66403"
FT                   /db_xref="GOA:A5V287"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V287"
FT                   /protein_id="ABQ66403.1"
FT                   /translation="MATERTFSIIKPDATRRNLTGAITAKLEEAGLRVVASKRIHMTKE
FT                   QAEGFYGVHRERPFFGDLVSFMISGPVVVQVLEGENAVARNREVMGATNPANADEGTIR
FT                   KTFAESIEANSVHGSDSAENAKIEIDFFFKPEEIVG"
FT   gene            complement(30629..31009)
FT                   /locus_tag="Swit_0031"
FT   CDS_pept        complement(30629..31009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66404"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A5V288"
FT                   /protein_id="ABQ66404.1"
FT                   /translation="MASDDPRAVHARVGALAKALPQVEEKVSHGSPCWRVADKRMFAYF
FT                   WHNHHGDDRTALLVKTSGIEEQEMLIDLDPDIYFKPPYLGPSGWIGVRLDQPDTDWEQV
FT                   DHRLRESWRLAAPPKLAAVMEF"
FT   gene            complement(31009..31635)
FT                   /locus_tag="Swit_0032"
FT   CDS_pept        complement(31009..31635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66405"
FT                   /db_xref="GOA:A5V289"
FT                   /db_xref="UniProtKB/TrEMBL:A5V289"
FT                   /protein_id="ABQ66405.1"
FT                   /translation="MADDSAEAAAARRRRLRWLTLAEVLGVSALVISALTLWNSYSERR
FT                   HSEETRTAESRAASSKARILVLRAEVQRDGDRLELHAAGDQVIQGQTIAFPKALGVDPV
FT                   DSTDPRIEASWFASGLKKARREAGEPERPRGDARLPVAITTRFTVDGDLAEDVTLYDIG
FT                   YVTDGSFLGGTSIRLRGLSLIGRSSAKAAQARLDALWKARHKGAK"
FT   gene            complement(31628..32206)
FT                   /locus_tag="Swit_0033"
FT   CDS_pept        complement(31628..32206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0033"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66406"
FT                   /db_xref="GOA:A5V290"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A5V290"
FT                   /protein_id="ABQ66406.1"
FT                   /translation="MSGRTPIAILISGRGSNMRVLVEASRAPDCPYEVVLVASNDPDAP
FT                   GLAIARDAGIATFAHSHKGLTRDAFDAIIDKALRDAGVSYVALAGYMRILSGGFVAGWA
FT                   GRMLNIHPSLLPRYKGLDTHARAIAAGDAEGGCSVHIVTATLDDGEVVGQARVPILPGD
FT                   TPETLADRVLIEEHRLYPAALADYIRAHG"
FT   gene            complement(32247..33347)
FT                   /locus_tag="Swit_0034"
FT   CDS_pept        complement(32247..33347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0034"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66407"
FT                   /db_xref="GOA:A5V291"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A5V291"
FT                   /protein_id="ABQ66407.1"
FT                   /translation="MSSNDQESYTYAKAGVSIAAGNALVKAIGPLAKATRRPGADADLG
FT                   GFGGFFDLKAAGYSDPLLVAANDGVGTKLKLAIDSGKHDGVGIDLVAMCANDLIVQGAE
FT                   PLFFLDYFATGRLDNGVAEAVIAGIAEGCKLAGCALIGGETAEMPGMYADGDYDLAGFC
FT                   VGAVEREQALTGNRVAAGQAILGLASSGVHSNGFSLVRRLAADKGWKLDRPALFDQDVL
FT                   LIDALLAPTRIYVKALLPLVRSGAVKAMAHITGGGLLENIPRVLPEGLHAHVDADLWPQ
FT                   PRLMAFLQAQGHIEPEEMARTFNCGIGMAVIVDEADVAAVTAALEAAGETVLRIGHIAA
FT                   GDKGCTVRGGDETWSARTAWSATHLG"
FT   gene            33408..34622
FT                   /locus_tag="Swit_0035"
FT   CDS_pept        33408..34622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66408"
FT                   /db_xref="UniProtKB/TrEMBL:A5V292"
FT                   /protein_id="ABQ66408.1"
FT                   /translation="MTFADRLFRPLPLSILCVALFAAALAFAQLERADERGVPPIDGSG
FT                   SFEVDGIKVDMAARNADQARTAGWREAQRKGWKMLWARANGKPVENAPGLPDSTLDSIS
FT                   GGIVVEEEHIGPNRYIATLGVLFDRARAGELLGVKGAIRRSAPMLVIPVEWSGATPISF
FT                   ERRSEWQKAWARFRAGNSPIDYVRVSGTGADPVLLNAAQTRRPGRGWWRMLLDQYGAAD
FT                   IVVPEVTLFRQWPGGPVIGRFVARHGPDAAVIDSFTLTAENGDALPAMLDRGIERIDRA
FT                   YTRALQEGALRADKSLVVETPAAEVPIDDVLAEMASAATSNITIQVDTPDAGALRGSET
FT                   ALRGMTGVTGVQTSSLALGGISIFRVSFSGPAAAFREALVARGWQVEDVGGGYRIRRGG
FT                   SPPAP"
FT   sig_peptide     33408..33494
FT                   /locus_tag="Swit_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.905 at
FT                   residue 29"
FT   gene            34619..35242
FT                   /locus_tag="Swit_0036"
FT   CDS_pept        34619..35242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0036"
FT                   /product="ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66409"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V293"
FT                   /protein_id="ABQ66409.1"
FT                   /translation="MTDQIALPFVWPAEEDERDFIVSEANSTAVRHLEHWSLWPVMATV
FT                   LTGPRKSGRSLLGRIFAAKTGGRFVDNADAQDEEKLFHAWNAAQADRKPLLLAADLPSA
FT                   RWRIKLPDLRSRLLASPHVAIEEPDFPLMLGLVEKLLHVRGLAVRPEVVRYVASRIERS
FT                   YVGIGRIVDALDEAALARRRPITMAVAREALATIGVTEDTYRLL"
FT   gene            35252..37417
FT                   /locus_tag="Swit_0037"
FT   CDS_pept        35252..37417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0037"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="PFAM: Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66410"
FT                   /db_xref="GOA:A5V294"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:A5V294"
FT                   /protein_id="ABQ66410.1"
FT                   /translation="MDSIDQPEHEEELIGALSPIEPIALRDRYFNRELSWLAFNERVLE
FT                   EASNPAHPLLERLRFLSISGNNLDEFFMVRFAGLRAQQIEEVDTLSPDGLTVAQQIEGA
FT                   SDRADQLMAEQQLVWDRLRDELAASGIVVLEEIEGQDAVWLEAYFRDHIFSVLTPQALD
FT                   PAHPFPFIPNKGFSLLFDLTRLSDGEQVFELLMVPATLPRFIRLPGDGARYVAIETMVR
FT                   RFTSVLFPGYEVRGHGALRIIRDSDIEVEEEAEDLVLYFRTAIKRRRRGRVIRIELEGG
FT                   MSTSLEPLWKDQIGGADSFVTESGSFLGIADLARLVEEDRPDLKFTPFSPRFPERIREH
FT                   GGDCFAAIRAKDIVVHHPYETFDVVLAFLRQAAQDPDVVAIKQTLYRAGKQSAVIRALV
FT                   DAAEAGKSVTAVVELKARFDEEQNLLWASQLERAGVQVVYGFIDWKTHAKVSMVVRREG
FT                   DGHRTYCHFGTGNYHPITARIYTDLSFFTADPRLGRDVAQIFNYITGYVEPTDLNLVTI
FT                   SPHGMRDELARLIDAEIDHAREGRDAAIWAKMNSLVDPAIIEKLYRASAAGVQIDLVIR
FT                   GMCCLRPGVPGLSENIRVKSVVGRFLEHSRIICFGNGAALPNRKAKVLISSADWMPRNF
FT                   DRRVEYLLPIENPTVHAQILDQVMVANLIDDEQSWRLLPDGDYERIVPGKRPFNLHRYF
FT                   MTNPSLSGRGAALRQSGQVPKLTLRRG"
FT   gene            complement(37404..38015)
FT                   /locus_tag="Swit_0038"
FT   CDS_pept        complement(37404..38015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0038"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66411"
FT                   /db_xref="GOA:A5V295"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A5V295"
FT                   /protein_id="ABQ66411.1"
FT                   /translation="MPHGFRSSPLMLSGLILMIAGFALWRLAPELDLTLLMAFRLDPAS
FT                   PAVPAIRGLTMLGGLALLAPFALVAAAGLALRGDRWRALWLVLTVASGRLAVEAAKLIC
FT                   ARGRPPLAGRLDDVSSPSFPSAHAAGTLLVWLALTMLFDRQRRVLLPATVAMAAAIGWT
FT                   RLALGVHWPGDVLAGFGLALLWAGLAERWLPPARAPINRA"
FT   gene            38110..39609
FT                   /locus_tag="Swit_0039"
FT   CDS_pept        38110..39609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0039"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66412"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A5V296"
FT                   /protein_id="ABQ66412.1"
FT                   /translation="MSSISMFRRARTPAPGHARVGIIDIGSNSIRLVIYDGPARIPAAL
FT                   FNEKVMAGLGKGVSRDGMLDAEAVERALSTLARFRRLAEQMGVPQPRTVATAAVREASN
FT                   GQQFIDRVLDLGLPVEILSGHDEARMAGMGVIASIPQANGIVGDLGGGSLELARVVDGE
FT                   VRETSSFPLGVLRIDAVKAKGPRALRNLVARTLEENGWTGKGAGLPFYMVGGSWRSLAR
FT                   LDMHLTGYPLPIVHHYWMPPENAQHLVRVLAHLDRKRLRDVVGLSGARIPTLSHAALLL
FT                   SHVARRLGSSELIVSAYGLREGLLFDDLSEYQRAQDPLIASTREEGARQGRFPEHGDLL
FT                   DRWLAPLFASESPADTRIRHATCLLADVGWRAHPEFRAERGIETALHGNWVGIDSRGRG
FT                   MMAHALWTSFGGQGVVPVISGICSPSEIVAAERWGLALRLGQRFSGGVADALAGSRLSI
FT                   GGGALELHAERDNAILYGEAVERRHKALAVAFGLPARLILG"
FT   gene            39831..41738
FT                   /locus_tag="Swit_0040"
FT   CDS_pept        39831..41738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0040"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66413"
FT                   /db_xref="GOA:A5V297"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A5V297"
FT                   /protein_id="ABQ66413.1"
FT                   /translation="MGKAHMSAHRFRPDIQGLRALAVLPVVAFHAFPDLLPGGFVGVDI
FT                   FFVISGYLITRILHQELREGRFSIAGFYVRRVRRLFPALYLMLFATMLLGLVLLPPHEL
FT                   RELAKTVAATVGFVANFLFYDLSGYFGGEAELKPLLHTWSLAVEEQFYLVFPLALAAVW
FT                   RLRPRWLPAILWAAAALSLAWSVRELGQDASRAFYYPWPRAFELLIGAIVAVGAIPQAR
FT                   HQAVRDGLSLLGIALIAASLLLLSEERPFPGLAALPPCIGAALVLAAGEEGESLGGRML
FT                   GAAPLVLVGSLSYSLYLWHWPALVFGRYLALRPLTAPEAIAAVAVAFALAWASWRYVES
FT                   PVLKWRLPRRRVLAGGGAMMAATAVLAAAVVLGRGLPQRLDPMGRTLIAAAGDSSDFRA
FT                   TCHSGEHGAIPYRKLCAFGDPRAAPSMAVWGDSFGAELVVALGEKMARERRSVLQVTAS
FT                   GCPPALGYNPRRRPGCAAYNAERLAELAADPRIREVVLVVNYLGFMADTPAQQAALLDG
FT                   VERTARALHADGKTLSLVYSIPRMPFVAPTALAMERLRGGDPSDFGQRRADFDRRDAIV
FT                   SARLDRIVRETGADRIVPAQRLCGDRLCPAYMPGAGVLYFDHAHLSIAGARYMLAGVRV
FT                   "
FT   gene            41890..42510
FT                   /locus_tag="Swit_0041"
FT   CDS_pept        41890..42510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0041"
FT                   /product="Domain of unknown function DUF1801"
FT                   /note="PFAM: Domain of unknown function DUF1801"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66414"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="InterPro:IPR016786"
FT                   /db_xref="UniProtKB/TrEMBL:A5V298"
FT                   /protein_id="ABQ66414.1"
FT                   /translation="MITEIEDFFTRGCGRCDRFDTPDCSARHWEQGLARLREICRSAGL
FT                   EETVKWGHPCYMHAGRNIAIMGALRGDFRLSFMNAALLKDSEAVLERQGPNTRHPDMIR
FT                   FTASGDVDRLEPVIRAYLGEAMDYAAKGVKPPRDDSEPDAPPELSEALDADPELAEAFH
FT                   ALTPGRRKSYVINLNSAKQSETRVKRIAGFRDKIMAGKGAMER"
FT   gene            complement(42513..43700)
FT                   /locus_tag="Swit_0042"
FT   CDS_pept        complement(42513..43700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0042"
FT                   /product="ribonuclease D"
FT                   /note="TIGRFAM: ribonuclease D; PFAM: HRDC domain protein;
FT                   3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66415"
FT                   /db_xref="GOA:A5V299"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR006292"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5V299"
FT                   /protein_id="ABQ66415.1"
FT                   /translation="MHESMHIHPLITDSATLANLCTRLAASPYVVVDTEFMRESTYWPD
FT                   LCLIQIANSEEAAAIDPKAKDIDLTPLLDLLVENEEVLKVFHAGGQDLEIVHNLTGKTP
FT                   YPLFDTQVAAMAMGLGEQIGYSNLVETMLGIKLDKGARFTDWARRPLDKRQIDYAIGDV
FT                   THLSAIFPRMLERLRKSGRGGWLDNEMERLGDPASYANLPELAWTRIRLPSRKPEVLGR
FT                   LKAIAAWREREARSKNLPRGRIAKDETLADLASHPPKVQADLSRVRGLSPSWAQNDIGA
FT                   RLMSSIADAEPLPDAEMPPREDRKPGLGKEGALIADLLKLLLKVRSRDADVAPRLIARA
FT                   DDLELLAAGVRDLPMLDGWRFDIFGKDALALVEGRLAFSVRNGRMVMSALDGDQG"
FT   gene            43785..45566
FT                   /locus_tag="Swit_0043"
FT   CDS_pept        43785..45566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0043"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: GAD domain
FT                   protein; tRNA synthetase, class II (D, K and N); nucleic
FT                   acid binding, OB-fold, tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66416"
FT                   /db_xref="GOA:A5V2A0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2A0"
FT                   /protein_id="ABQ66416.1"
FT                   /translation="MMHAYRTHNCGQLRAQDVGSQVRLSGWVHRKRDHGNLLFVDLRDH
FT                   YGLTQIVTDIESEAFRQLERLRVESVVTITGDVVARAGEAVNPNLATGEIEIRAREVSV
FT                   QSTAQELPLPVAGEADYPEDIRLRYRFLDLRRDRIHANIVLRSNVIASIRRRMIDQGFT
FT                   EYQTPILTASSPEGARDFLVPSRIHPGKFYALPQAPQMFKQLLMVAGFDRYFQIAPCFR
FT                   DEDARADRSPGEFYQLDFEMSFVTQEDVFAAIEPVLHGVFEEFANGRAVTPAPFPRIAY
FT                   RDAMLRYGSDKPDLRNPLEITDVTEHFQGSGFGLFARIVEGGGVVRAIPAPGAGAKSRK
FT                   FFDDMNDWARAQGHAGLGYINIKGGEAGGPIAKNHGEEATAKLIAALGLGPDDGVFFAA
FT                   GKELATAKLAGAARTRVGEELGLIEQGVFKFCWVVDFPMFEYDEDAKKIDFSHNPFSMP
FT                   QGEMEALETMDPLDILAYQYDIVCNGVELSSGAIRNHRPEIMYKAFEIAGYSQEQVEEN
FT                   FSGMLNAFKFGAPPHGGSAPGIDRIVMLLADEPNIREVVLFPMNQKAEDLMMGAPSQVS
FT                   LKQLRELNIRVVEQSKQ"
FT   gene            45783..46568
FT                   /locus_tag="Swit_0044"
FT   CDS_pept        45783..46568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0044"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66417"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2A1"
FT                   /protein_id="ABQ66417.1"
FT                   /translation="MAIDLADYEKGAPFDGDYDAALAEVQKRLSRLQVAHVVCNLRSMI
FT                   LFEGWDAAGKGGAIQRLTMGWDPRHFHVWPIAAPTEEERGRHFLWRFWQKLPGRGRIAI
FT                   FDRTWYGRVLVERVEAYASEREWRRAYDEINEFEAQQQADGVTIVKLFLHVTQEEQDKR
FT                   LADRLDHPWKRWKVTPEDFRNRARRDDYLAAMKDMFRETDTRWAPWTVIDGNDKKAARI
FT                   AALTHVADSLERIVPLEPPALDPDFERYARVQLGLPEKR"
FT   gene            46707..46979
FT                   /locus_tag="Swit_0045"
FT   CDS_pept        46707..46979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0045"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66418"
FT                   /db_xref="GOA:A5V2A2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2A2"
FT                   /protein_id="ABQ66418.1"
FT                   /translation="MNKQELIGTVAEATGMTKNDASKAVEAVFDSITTQLKKGDEVRLV
FT                   GFGTFSVTKRKASTGRNPRTGEPMKISASSQPKFKPGKGLKDAVN"
FT   gene            47180..47254
FT                   /locus_tag="Swit_R0001"
FT                   /note="tRNA-Val1"
FT   tRNA            47180..47254
FT                   /locus_tag="Swit_R0001"
FT                   /product="tRNA-Val"
FT   gene            complement(47310..47702)
FT                   /locus_tag="Swit_0046"
FT   CDS_pept        complement(47310..47702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0046"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66419"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2A3"
FT                   /protein_id="ABQ66419.1"
FT                   /translation="MKYFYAVVHKDEDSAYGVHFPDLPGCFSAADDLEDVVPNAIEAME
FT                   LWLEDQAEPAASSVTAIREQAAEDLAEGAFLIAVPRMTTSGKLTRVNLSLDMGTLAAID
FT                   TAARDRKLTRSAFLAEAARNEIQGRH"
FT   gene            complement(47725..47925)
FT                   /locus_tag="Swit_0047"
FT   CDS_pept        complement(47725..47925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0047"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66420"
FT                   /db_xref="GOA:A5V2A4"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2A4"
FT                   /protein_id="ABQ66420.1"
FT                   /translation="MCKYLHMERDSRKIIKRLLSEGWEQVSARGSHHKFRRDEVSLIVP
FT                   HPKRDLPIGTARSIARAAGWL"
FT   gene            complement(47976..48782)
FT                   /locus_tag="Swit_0048"
FT   CDS_pept        complement(47976..48782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0048"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66421"
FT                   /db_xref="GOA:A5V2A5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2A5"
FT                   /protein_id="ABQ66421.1"
FT                   /translation="MIRLKLQALIGSGGSADVFRLAGGRVLKLYREGLDPGVIAREHDG
FT                   VRHAVDQGLHVARAFGTRDHGDRSGIVFEELVGKPLLRLPVLRPFRTRALLRRFADYQA
FT                   RIHLCGAAGLPHHQHDIIHVRIEQAEVSEALRAAALEQLHAIPRGDRFCHGDYHPGNVI
FT                   LTRAGIAAIDWSNASAGDPAGDVARSELLFRYAGYGPSLRNVPALRRIRTMTADFYLRQ
FT                   YRESTGLSDAAIDAWRLPMAVASLVPGSRVHRPTLIAALERQGFSV"
FT   gene            48911..49090
FT                   /locus_tag="Swit_0049"
FT   CDS_pept        48911..49090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66422"
FT                   /db_xref="GOA:A5V2A6"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2A6"
FT                   /protein_id="ABQ66422.1"
FT                   /translation="MMNGPAALTLSLLMLGGLVLGIGGLWMIVRRGDPKRGWLMIAAAV
FT                   VMFANVAIWTMPLR"
FT   sig_peptide     48911..48976
FT                   /locus_tag="Swit_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.763) with cleavage site probability 0.721 at
FT                   residue 22"
FT   gene            complement(49131..49778)
FT                   /locus_tag="Swit_0050"
FT   CDS_pept        complement(49131..49778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0050"
FT                   /product="hydrolase of the alpha/beta superfamily-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66423"
FT                   /db_xref="GOA:A5V2A7"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2A7"
FT                   /protein_id="ABQ66423.1"
FT                   /translation="MPEVIFPGPEGRLEGRFNPGPRPRAPVAMILHPHPQGGGTMNNRI
FT                   VQSLYQTFVRRGFATLRFNFRGVGKSQGTFDNGIGELSDAASALDWVQSIHPEAQTTWI
FT                   AGFSFGAWIGMQLLMRRPEIKGFISIAPPANMYDFTFLAPCPSSGIIIQGDSDEVVTPG
FT                   AVQKLVDKLRTQRHITIHHDTIPGANHFFADEMPELMKSVDDYLDMRLSGDR"
FT   gene            49891..50949
FT                   /locus_tag="Swit_0051"
FT   CDS_pept        49891..50949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0051"
FT                   /product="Cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="PFAM: aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66424"
FT                   /db_xref="GOA:A5V2A8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2A8"
FT                   /protein_id="ABQ66424.1"
FT                   /translation="MATPRLYLDHAATTPLHPAARAAMAQALDRWANPSSPHAEGRAAR
FT                   AALEEARARIGRALGHDGAILFTSGATEAIEIALRRAKAAGRFVSAVEHDAVRRAAPDA
FT                   VVLPVDGDGLVGPLPAAARGALVAVQAVNNETGVIQPLERIGADVRAGGGLLLADCAQS
FT                   GAKLALPDADFIALSAHKLGGPPGIGALLVRDLATLAPSGGQEQGYRGGTENLPAVLGF
FT                   AAAIEAGFDWIGRAAALRARLDAAIVATGGIVVAGGCERLPTIASYRMPGVAATAQLIR
FT                   FDMAGIAVSAGSACSSGSLKPSHVLAAMGWDEASAREVVRISFGRDTSEADIDRVAAEW
FT                   RTIATAARARAA"
FT   gene            50946..52040
FT                   /locus_tag="Swit_0052"
FT   CDS_pept        50946..52040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0052"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66425"
FT                   /db_xref="GOA:A5V2A9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2A9"
FT                   /protein_id="ABQ66425.1"
FT                   /translation="MIYLDYQATTPLAPEARAAMLPFLDDKFGNPHSPHRMGREAAAAV
FT                   EVARGQVASLLPGGGRVAFTGGATEALNWAIKGTRGPIVTVATEHAAVLDSVRAVGQAG
FT                   RGVRILPVDAEGLVDPEQARAAIAPGTGLVAVMLVNNEIGVIQPVEALAALAHQAGALF
FT                   LCDAVQGYGRVPIPESCDLVAISAHKVHGPKGIGALWVRDGVALEPLLHGGGQEAPGRS
FT                   GTLAPMLCAGFGAAAALMAARREADAAHVERLWLIATRRLGPEWRINGSVERRWRGNLN
FT                   LRRDGVDSARLISDLRELAFSAGSACASGSGRPSHVLKALGLSDAQARSSIRLGFGRYT
FT                   SEEEIDRAATMILDAAARQRMWAA"
FT   gene            52037..52372
FT                   /locus_tag="Swit_0053"
FT   CDS_pept        52037..52372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0053"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66426"
FT                   /db_xref="GOA:A5V2B0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2B0"
FT                   /protein_id="ABQ66426.1"
FT                   /translation="MTRVVFISADGEHRSEVEASPGQHLLDVAQADGQPLEGTCEGQMA
FT                   CSTCHVIVDAADFARLPRASEMEEDLLDLASHVTRTSRLACQIVLTDALDGLTVRMPVG
FT                   ARNMQGR"
FT   gene            52456..53235
FT                   /locus_tag="Swit_0054"
FT   CDS_pept        52456..53235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0054"
FT                   /product="protein of unknown function DUF347"
FT                   /note="PFAM: protein of unknown function DUF347"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66427"
FT                   /db_xref="GOA:A5V2B1"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2B1"
FT                   /protein_id="ABQ66427.1"
FT                   /translation="MRDQDFPADSKLPAVTLGFWIIKILATTLGETGGDTVSMTMNLGY
FT                   LAGTGIFLTLLLVLVGVQMAARRFVPSLYWLTIIASTMAGTTMADFATRSMGIGYAGGS
FT                   ALLLVCVLGSLLTWYRSLGSVAVDQVRDSGTELFYWITITFSQTLGTALGDWLADTGGL
FT                   GYVGAGTIFGALLAGLALLYLFTPASRVMLFWAAFILTRPLGATVGDFLDKPIDHGGLD
FT                   FSRPLASAVLAGAIVLLILTVPQRAGSSAPAAGRLGR"
FT   gene            53279..53379
FT                   /gene="ffs"
FT                   /locus_tag="Swit_R0002"
FT   misc_RNA        53279..53379
FT                   /gene="ffs"
FT                   /locus_tag="Swit_R0002"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            53421..55169
FT                   /locus_tag="Swit_0055"
FT   CDS_pept        53421..55169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0055"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66428"
FT                   /db_xref="GOA:A5V2B2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2B2"
FT                   /protein_id="ABQ66428.1"
FT                   /translation="MSESSTPYRVLARKYRPQNFNELIGQDAMVTTLANAIRRGRLAHA
FT                   FLLTGVRGVGKTSTARLIAKALNCIGPDGQGGPTIDPCGVCEPCVAIAEGRHIDVVEMD
FT                   AASHTSIDDVREIIEAVRYASVSARYKIYIIDEVHMLSKSAFNGLLKTLEEPPAHVKFL
FT                   FATTEVNKVPITVLSRCQRFDLRRITADKLAAHFTNVVAAEGVEADPEALALIARAAEG
FT                   SARDGLSILDQAIAHGSGRVEAQQVRDMLGLSDRGAVRRLFGEMLKGDAAAVLASIRGQ
FT                   YDLGVEPVAMLHGLLETCHAITRAKVAGTDDPALSAEEREAYGDWAGKLGFATLHRLWQ
FT                   LLLKGHGEVQTAAMPIEAAEMALLRVVHASQLPDPGELARRLASGDLNLPVQPAPAQPP
FT                   AAEPQGALMAAPAPIAAPAPAPAPIETPPPLAAVPAPAPVVAPVPVAIPEPEPEPAPPS
FT                   LPATGEAIHALLLPENALLAQLFHDYAAIVRLEGEELLIARHQRLPQNFAGDVANILKR
FT                   STGRTWSVAMVDEAGAPSLLARIRAEEDAARDAILESPLVKAALEAFPDAELIDYSAPE
FT                   KRSLAS"
FT   gene            55166..55504
FT                   /locus_tag="Swit_0056"
FT   CDS_pept        55166..55504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0056"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66429"
FT                   /db_xref="GOA:A5V2B3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2B3"
FT                   /protein_id="ABQ66429.1"
FT                   /translation="MKSLEEMIAAAQSAAQTIQTQMEQAQTVLDTIEVEGAAGGGLVKI
FT                   RATAKGRILGVAIDDSLMELSEKQMLEDLITAAINDCRTKADAASNAEMAKLTQGLPIP
FT                   PGFKMPFS"
FT   gene            complement(55679..56374)
FT                   /locus_tag="Swit_0057"
FT   CDS_pept        complement(55679..56374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0057"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase, family 51"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66430"
FT                   /db_xref="GOA:A5V2B4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2B4"
FT                   /protein_id="ABQ66430.1"
FT                   /translation="MARESFARRALRWIVRALIIFVIGSVIWVGIYRFVPPPVTTTMIV
FT                   NAFDGRGIAKDWMSIDTMSPNMPLAAIAAEDGNFCSHHGFDFKAIQKAMESNFQGDRRI
FT                   RGGSTISQQTAKNAFLWQNGGYVRKAFEAWFTVLIELLWPKKRIMEVYLNIAETGIGTY
FT                   GANAGAMRYFHHDASRLSRAEAARIAAVLPLPKKREAISPTGFTRRYGDRIARRMGQVQ
FT                   RYGQDGCLK"
FT   gene            complement(56388..57884)
FT                   /locus_tag="Swit_0058"
FT   CDS_pept        complement(56388..57884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66431"
FT                   /db_xref="GOA:A5V2B5"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2B5"
FT                   /protein_id="ABQ66431.1"
FT                   /translation="MMGDMKAGGGRRAGDAAVAVALAIIVTALAAAALLGGPTLDDHWT
FT                   IYLSDSTRGLAKLVEERWILDIRPPVFDAWATLLHMVGIDSIPLARLISSLPAVVLLVL
FT                   AVRAFSRRLPDEAPFFAIFLLLVLSTPAAVRAFGVYRGDFWQLAAFAIQILLVRHVLFV
FT                   QKDYRRKTDAVLALFALPATFAAITIDYGGALFGGIVAMATILAAIARGLRRWARSLLI
FT                   TVALAVATVIAMISWQAGAWAANFDLYQNWIEMSYGSAGAILAALLFGTILHNPIALAG
FT                   GYLGREQWTRGDTGFAIIIGAALVAALVAIMQIDAQRRLITFSNSSDVAVLVTALMATA
FT                   GAKIADRRMWMNALAGVAILSVTVSATVNGSGSGWQSGAKHISRIVAACPQTQVFAVSG
FT                   WRLDDGSASRAARREEPVFTIGYKRLARSYGFTAIVIPRDRPATAAPGRCPVLLWIERV
FT                   PSKKRVKPAQVLKAAGLGGLEKARLSLIRGENGLIVRADR"
FT   gene            57948..58745
FT                   /locus_tag="Swit_0059"
FT   CDS_pept        57948..58745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66432"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2B6"
FT                   /protein_id="ABQ66432.1"
FT                   /translation="MFARFLGWLAMALPAAGAAAEMRDYCPDRPGLGTPACTIDRGHVS
FT                   VEVGLADWTLDRQAGERDDRLLLGDLLVRYGIGDRTEVQFGWTSFGREHDRDRSAGLRL
FT                   RESGVGDVTVALRHNLLHPDGSALSVALMPFATLPVGREPIGAGDWGAGFRLPVSYEID
FT                   ETFALEWVPEVDAAVDSDGKGRHLAYGTVAGVAAKLGPTLSATLEYQFTRDRDPSGHES
FT                   QQLGGLSLAWQPRDDLQFDIGANGGLDRHAPDVELYVGVSRRF"
FT   sig_peptide     57948..58010
FT                   /locus_tag="Swit_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.588 at
FT                   residue 21"
FT   gene            complement(58880..59785)
FT                   /locus_tag="Swit_0060"
FT   CDS_pept        complement(58880..59785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0060"
FT                   /product="RNA polymerase sigma factor RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma-70; PFAM: sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; sigma-70 region
FT                   1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66433"
FT                   /db_xref="GOA:A5V2B7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2B7"
FT                   /protein_id="ABQ66433.1"
FT                   /translation="MASGKNVPATIPALGGEQSLNRYLAEIRKFPLLTAEEEYMLAKRF
FT                   QEHGDPEAATRLVTSHLRLVAKIAMGYRGYGLPASELISEGNIGLMQGVKKFEPDRGFR
FT                   LATYAMWWIKASIQEYILRSWSLVKMGTTAAQKKLFFNLRRMKSQLEAFEDGDLKPEDL
FT                   KKIATDLGVSEEEVTSMNRRMSMGGDASLNVSMNEDGEGEWQDMLVDQGPLQDERLAEV
FT                   EEKSVRHNMLNEALAALNDREKHILVERRLVDEPKTLEELSQVYGVSRERVRQIEVRAF
FT                   DKLQKAMMRIAGEKRLLPAM"
FT   gene            complement(59881..60846)
FT                   /locus_tag="Swit_0061"
FT   CDS_pept        complement(59881..60846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0061"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.-"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66434"
FT                   /db_xref="GOA:A5V2B8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2B8"
FT                   /protein_id="ABQ66434.1"
FT                   /translation="MTGGKSTLHAVVPQDAEGWRLDRALAAALPTLSRERLKALISSGQ
FT                   VSHADGALARDPAMKVAPGARFAVIVPDPAPAHNAAQDIPLVVAYEDEHLIVIDKPAGL
FT                   VVHPAAGNPDGTLVNALLHHCRGSLSGIGGVERPGIVHRIDKDTSGLMVAAKTDPAHVG
FT                   LAAQFARHSIDRRYRAIVAGTPRLAAGTVDAPLARSTADRKKIAIVADGRGKRAVTHYS
FT                   VIEPLRRAALVECRLETGRTHQVRVHMASLGHPLLGDPVYGRSRPEHRELLNRLKFHRQ
FT                   ALHAARLGFIHPVTSAALSFDSEIPQDMQDLFSELRVRVL"
FT   gene            60864..61289
FT                   /locus_tag="Swit_0062"
FT   CDS_pept        60864..61289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0062"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /note="PFAM: Mov34/MPN/PAD-1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66435"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2B9"
FT                   /protein_id="ABQ66435.1"
FT                   /translation="MELRISRAALDEILSSAAASPDAEICGLLLGQMTGRGAVVAALRP
FT                   CANVAADPRDSFEVDPAALIAAHRAARAGGPALVGHYHSHPGGSPVPSARDAAAAEPGS
FT                   YWIIAGSGALRAWYADGRPADGKGRFRAVTIVEADNR"
FT   gene            61351..61977
FT                   /locus_tag="Swit_0063"
FT   CDS_pept        61351..61977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0063"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66436"
FT                   /db_xref="InterPro:IPR018762"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2C0"
FT                   /protein_id="ABQ66436.1"
FT                   /translation="MVNRSADFASLLCSRLCHDLLSPVGALNNGIELLADETDPEMRER
FT                   CMELLAESAQTTANRLKFYRLAFGAAGGFGERVDTREAREAIEGLHGNGKVRLGWMVDA
FT                   PTLPKPAIKTLLNLALIAGDALVRGGQLDIAAEGGEVVIRAEGPRVVLDPELRNALLGH
FT                   ADPDLVSPRAAAAWLVHILVSEQGGAVQVSQPEDGLLMIGATLPA"
FT   gene            61990..62538
FT                   /locus_tag="Swit_0064"
FT   CDS_pept        61990..62538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66437"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019052"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2C1"
FT                   /protein_id="ABQ66437.1"
FT                   /translation="MAGTTLCHLLIVRGGAHRRSSAAMDSDFALTRSLNRLIAALNDTI
FT                   GACEAIARDARRFPLYAKYEREVLLRQDVIRRLRHKVGHLGGEPRRRGTLRGWLKRMRI
FT                   RLLGIGLTNERFVVRLFEREERHLAACLRALVAEERLPPAFRRELAKLLLGLNEAFCRR
FT                   ELHRFGPRSAWADRTAIGR"
FT   gene            62610..65048
FT                   /locus_tag="Swit_0065"
FT   CDS_pept        62610..65048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0065"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: CheW domain protein; ATP-binding region,
FT                   ATPase domain protein domain protein; Signal transducing
FT                   histidine kinase, homodimeric; Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66438"
FT                   /db_xref="GOA:A5V2C2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2C2"
FT                   /protein_id="ABQ66438.1"
FT                   /translation="MDDLLGDFVAETRETLDALSGEIVAWELAPDDRSRLDAIFRFVHT
FT                   VKGSCGFLDLPRLEKLSHAAEDVLADVRADRRRPDPALVSAVLAVIDRIAELADAIESG
FT                   RTVPDEDDARLIAALRPVSEAVVDTADADDVALAEALEAIRIAEEMDEEEAVVPVLVEA
FT                   PAAAAPAGPRAVSRSIRLPVDLLDRMMAGVSDMVLARNELARRLRESGAESNTEVAFER
FT                   LSHCIAEMRDAITRTRMARVEHLFTALPRMVRDISAELGKLVQLEIDGGDVELDREMIE
FT                   MIRDPLTHIVRNAIDHGIEPPEARVLAGKPVAGRLHVSARQVGNQILIEVIDDGRGIDA
FT                   DQLVDKAVAAGILGRERAATLSWERKLELIFAPGLSTAREVTAISGRGVGMDVVRANVE
FT                   RIGGLVDIDSRPGQGLRLTLRVPLTLTIIPALTISTGGQHFAIPRSAIDEIVRVGGDAV
FT                   RMGTLGGADLVFIRGVRVPVVSLGAVLGLERGAQANLVVLKLSGGARYALAVDAVHDHE
FT                   ELVVKPAAPVVMACGIYGGTTLPDNSRPMLLLDVAGVAEKAGVRRDDQAAVEPVAEEGE
FT                   EELHEKGAVPVLLFRDLDGVERGVPLALVERIEDCFSASVSHSAGRMRLNIDGRLVPLV
FT                   SCGAPIIEAKVRVLRMRDGAEELAYAIDSVIDIVPVAIELQRSAVAGPVAGVMLVEERP
FT                   VEFLDAFWLFAQGLGSEPAAEQRPVCLLSDEDPWTRQVLAPLVEGAGYRIIYAPEEGPA
FT                   ADLVIVADGAAADGPAEAAAVLRLRQHAEDRGASPDSLWRYDRAGLTAELRRYWNKRSA
FT                   "
FT   gene            65051..65482
FT                   /locus_tag="Swit_0066"
FT   CDS_pept        65051..65482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0066"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66439"
FT                   /db_xref="GOA:A5V2C3"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2C3"
FT                   /protein_id="ABQ66439.1"
FT                   /translation="MNDLYLIVEIAGQRALLPAAFVESVVEIEDIAPVPCAPPHVLGLF
FT                   ALRSRVLTVIDTIAALGGERGARGEKQAVIVHVDGHLYGVLVDDVDDVVAIDAAPSQFR
FT                   APLSAGWARYATGVLDHEGEPLLLVDVAALIAGPLDMAA"
FT   gene            65601..65969
FT                   /locus_tag="Swit_0067"
FT   CDS_pept        65601..65969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0067"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66440"
FT                   /db_xref="GOA:A5V2C4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2C4"
FT                   /protein_id="ABQ66440.1"
FT                   /translation="MKTCLVVDDSKVIRKVARHILEALHFKVEEAGDGREALDRCQAGK
FT                   LPDVILLDWNMPVMSGMEFLRSLGSSDFAQRPKVVFCTTENDVAHIRAAIEAGADEYMM
FT                   KPFDRETLESKLQLVGVA"
FT   gene            66005..67111
FT                   /locus_tag="Swit_0068"
FT   CDS_pept        66005..67111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0068"
FT                   /product="response regulator receiver modulated CheB
FT                   methylesterase"
FT                   /EC_number="3.1.1.61"
FT                   /note="PFAM: CheB methylesterase; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66441"
FT                   /db_xref="GOA:A5V2C5"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2C5"
FT                   /protein_id="ABQ66441.1"
FT                   /translation="MGVEDVGRGRPRPIRVLLVDDSLVARTVLARLLEGRPEFEIAGAA
FT                   PTADQAIQFLSSHDIDIVVLDVEMPGKDGLTALPEILEASHGARVLIVSSAAEAGAAAT
FT                   VRALTLGAADTLLKPTAGNFAGEFSHKFIDALLRIGHANHHAQRPDRKAADAAPRPAPV
FT                   PIVALRPTRSGRIACLAIGASTGGLHALSAFLRRLTPDFRAPILITQHLPPPFMPYFAA
FT                   QLRDIAGRPTAVAADGTPLVPGEMLVAPGEGHIRLARKGSRVLVSIDPAPAPSRCMPSV
FT                   DPMFAAVAELFGAEGVGVVLTGMGRDGTIGAEAMVAAGAEILAQDSASSVVWGMPGSVA
FT                   QAGLASLVMPPEELARHVCHRNAGGAWR"
FT   gene            67102..67944
FT                   /locus_tag="Swit_0069"
FT   CDS_pept        67102..67944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0069"
FT                   /product="MCP methyltransferase, CheR-type"
FT                   /note="PFAM: MCP methyltransferase, CheR-type"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66442"
FT                   /db_xref="GOA:A5V2C6"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2C6"
FT                   /protein_id="ABQ66442.1"
FT                   /translation="MEVSPRAAMTIARLFEQATGQTLSQDRFWRIGTTLMPFCRARGID
FT                   SFDQLALALERSADRELSLDMIDALLNNETSFFRDAGVFTQIGEALLPRLAAARQRERR
FT                   LRIWSAACSTGQEAYSLAMLFAEQGDRWAGWRIDIVGSDISRSAVEQARGGLYTQFEVQ
FT                   RGLPIRQLIAWFDPVLDQGWRVKPQLAAHVSFQRHNLLGPPPAGGRFDLILCRNALLYF
FT                   SPERRHQMLEGLALAIAPDGGLLLGAGETVQGSARFVADPELPMVYRPAAARTVPHAA"
FT   gene            68054..68779
FT                   /locus_tag="Swit_0070"
FT   CDS_pept        68054..68779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0070"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66443"
FT                   /db_xref="GOA:A5V2C7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2C7"
FT                   /protein_id="ABQ66443.1"
FT                   /translation="MSAMDEIIDCPSPNHDERTLPITMLVLHYTGMADAASAIARLTDP
FT                   EAKVSSHYLVAEDGQVMRLVPEDRRAWHAGQSSWRGVTDVNSASIGIEIVNPGHELGYR
FT                   PFPKPQMDALIPLISDITSRHPIEPANVVGHSDVAPRRKQDPGELFDWELLGKLGLALR
FT                   RPRHGLADPHWTPGGFLLALDRFGYDVSDGPAAVIAFQRRFRPERIDGIADGECRAILL
FT                   RLLLHREGDGLLESPSKSS"
FT   gene            68827..69157
FT                   /locus_tag="Swit_R0003"
FT   misc_RNA        68827..69157
FT                   /locus_tag="Swit_R0003"
FT                   /product="RNase P"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 330.37"
FT   gene            69284..69814
FT                   /locus_tag="Swit_0071"
FT   CDS_pept        69284..69814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66444"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2C8"
FT                   /protein_id="ABQ66444.1"
FT                   /translation="MAGRAGGRQLDLGPLQIIIAVLVHAHPCLPLIIIPHLRNGCAPGL
FT                   STRGIVALFEQLAAACGQWFEAGALIVPMDRRESMPRGDKSSYTDKQKRKAEHIEQGYE
FT                   DRGVPREEAERRAWATVNKESGGGNKSGSGRGKADTHVSSSRGGRAHKSGSAEQRSAAA
FT                   RKGWVTRRKHAAA"
FT   gene            69781..70128
FT                   /locus_tag="Swit_0072"
FT   CDS_pept        69781..70128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66445"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2C9"
FT                   /protein_id="ABQ66445.1"
FT                   /translation="MGDAPQARGGLIGGARPASALLGRVGGGAPLLYQQALALGRLAMD
FT                   AGQHQMGLPRLRAAGFRRGLLLLRGPLLEIDDVFLAHRSDSSLARQRHGGRRPTRWRAG
FT                   SVLLIAGKSAV"
FT   gene            complement(70165..70599)
FT                   /locus_tag="Swit_0073"
FT   CDS_pept        complement(70165..70599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0073"
FT                   /product="response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66446"
FT                   /db_xref="GOA:A5V2D0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2D0"
FT                   /protein_id="ABQ66446.1"
FT                   /translation="MNNPSSTLSAWPSPQQPRPAILIVEDQIIIATAMRDSLVELGADV
FT                   VGPCLTLRSALDAAASAKIDAAVLDVWLSGELSYPVADLLVERRIPFLFTSGVDLDREP
FT                   PQFHRFPRLLKPFSDQELHSALSGLLNPPRTVPPIAPFAA"
FT   gene            70997..71530
FT                   /locus_tag="Swit_0074"
FT   CDS_pept        70997..71530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0074"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66447"
FT                   /db_xref="GOA:A5V2D1"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2D1"
FT                   /protein_id="ABQ66447.1"
FT                   /translation="MAREIATLAGGCFWCVEAVFDDVIGVESVESGYTGGHVANPTYKQ
FT                   VCNGDTGHAEAIRVAFDPDVIGYGELLDIFFHVHDPTQLDRQGNDIGPQYRSAIFPHSP
FT                   EQEAEAKAAIDRARADWPDPIVTRVEPEATWYPAEDYHQEYFAREGASSGYCVMVVAPK
FT                   LAKFRKSYAARLKK"
FT   gene            complement(71669..72610)
FT                   /locus_tag="Swit_0075"
FT   CDS_pept        complement(71669..72610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0075"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66448"
FT                   /db_xref="GOA:A5V2D2"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2D2"
FT                   /protein_id="ABQ66448.1"
FT                   /translation="MTETRILPADPTGIAEAAALIARGLPVGVPTETVYGLAGDATSGE
FT                   AVAAIYAAKGRPSFNPLIVHVTDLAMAGRVAILPPLARRLAERFWPGPLTMVLPAAPGS
FT                   PIASLTTAGLPSVAVRMPAHPAIRALILASGRPLAAPSANASGSISATRAEHVARSLAG
FT                   RITLVLDDGPTAVGIESTIVAVETDRLRLLRPGAIIVEMLAEAAGVAVERRGDGSIEAP
FT                   GQMASHYAPSKPLRLNAERAKAGEYLIGFGAVAGDVTLSASGRLDEAAARLFDLLHAAD
FT                   QSDAAAIAVAPVPSDGLGLAINDRLQRAAAPR"
FT   gene            complement(72764..73111)
FT                   /locus_tag="Swit_0076"
FT   CDS_pept        complement(72764..73111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0076"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66449"
FT                   /db_xref="GOA:A5V2D3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2D3"
FT                   /protein_id="ABQ66449.1"
FT                   /translation="MSSQDRPVYLRLRDIIAESILDGSYGDGDALPSVRAFAAQHGANP
FT                   LTAAKAYQGFQDEGYVTVKRGVGMFVAEGATDRLRREARNTFLRDEWPRVVASMRRLRI
FT                   EPGDLLERVGG"
FT   gene            complement(73154..73744)
FT                   /locus_tag="Swit_0077"
FT   CDS_pept        complement(73154..73744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0077"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66450"
FT                   /db_xref="GOA:A5V2D4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2D4"
FT                   /protein_id="ABQ66450.1"
FT                   /translation="MMTMFNDLSSTAALLATRRSGKARDMIAPGPDSAELRRILEAAMR
FT                   VPDHGKLAPWRFVIVEADRRDAFADLLKDAYRAEKPEAGRIELEAMEQFAHQAPTMVAV
FT                   LSTPTQNSKIPLWEQELSAGAACMNLLFSTHAAGFVGCWLTGWPAYNGQVLESLGGSPH
FT                   DRIAGFLFLGSPGRALEERPRPTYEAVVSTWKG"
FT   gene            73968..75779
FT                   /locus_tag="Swit_0078"
FT   CDS_pept        73968..75779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0078"
FT                   /product="amino acid/peptide transporter"
FT                   /EC_number="3.1.3.1"
FT                   /note="TIGRFAM: amino acid/peptide transporter; PFAM:
FT                   TGF-beta receptor, type I/II extracellular region"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66451"
FT                   /db_xref="GOA:A5V2D5"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2D5"
FT                   /protein_id="ABQ66451.1"
FT                   /translation="MPTTQNRKNFMVNPDADATTEPASPHVSRSDGDTWFGHPRQLARL
FT                   FSTEAMERFGYYGMRALLTLYLTQHFLFSDQTTNGLYGGFTALVYLTPLVGGLLADRYL
FT                   GSKKSVKFGAILMSIAYFTLCFGGQTAKPYAVIDGSRYEVVIDEAKQQYLVDGAQKLAI
FT                   KGQEDGSVALVAPDGSVARTVAKGGFKADADRDPFHTGLMLVALSLLTVGNGFFKPNIS
FT                   TIVGALYEKGDRRRDAGFTIFYMGINLGSLFSQILCPFLAVALGWWAGFGLAAIGMLIS
FT                   WALIQFAGEKLAGYGEPPEGQEKDRSLLIYIGALAVVPIGWFLFLNLMASPAPEAGVGI
FT                   VGYLLGLPIMGKVLFATFLASVILIPLWALKAGNKVEFQMMIAAIVMIVFNVVFWTLFE
FT                   QAGSSLTLFADRNTDLSVFGLFTMSAGQTQFFNAFFIVVLAPLTSLLWNALGRRGLEPS
FT                   IPVKFAIALAGVGLGFLALVWGTQYAGADFKVSVWWLALLYLIHSMAELCISPVGLSMI
FT                   TKLSIARVVGLMMGLWFLSISCAQYVAGIVAQVASVETVGGQVTNLKVSLETYAGVFQT
FT                   IGLASVAIGAVLLVLSPVIKKWMHGVQ"
FT   gene            75766..77181
FT                   /locus_tag="Swit_0079"
FT   CDS_pept        75766..77181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0079"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66452"
FT                   /db_xref="GOA:A5V2D6"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2D6"
FT                   /protein_id="ABQ66452.1"
FT                   /translation="MVFNNKLRFSVAVALALTACTGGAAPKSASSDAPGKGKGFDHDPF
FT                   PSTYHAYPGAPTAIVHATVYDGEGGRIEDGTVLLAGGKVTAVGGPDLAVPAGATVVDGT
FT                   GKWVTPGVIDVHSHLGDYPSPAVKALSDGNEATAPVTAQVWAEHSVWPQDPGFSRALVN
FT                   GGVTTLQILPGSANLFGGRSVTLKNVYARTVQGMKFPGAPYGLKMACGENPKRVYGGKN
FT                   REPSTRMGNVAVDRQTWMKAVEYKRKWDKYEEKGGEAPARDASMDTLMGVLNGEILVHN
FT                   HCYRADEMAIVLDMAKEFGYKVTAFHHAVEAYKIADLLKATGTCAAVWADWYGFKMESY
FT                   DGIRENLAILHNAGACVMIHSDDQNGIQRLNQEVAKALAAGRRAGFTISDEQAWTWLAI
FT                   APARALGIADRTGSLKPGKMGDVVLWNGNPLSVYTRPEKVWIDGAMLYDANNPKLRPVS
FT                   DFELGQPGEGDVK"
FT   sig_peptide     75766..75858
FT                   /locus_tag="Swit_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.421 at
FT                   residue 31"
FT   gene            77178..78464
FT                   /locus_tag="Swit_0080"
FT   CDS_pept        77178..78464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0080"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66453"
FT                   /db_xref="GOA:A5V2D7"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2D7"
FT                   /protein_id="ABQ66453.1"
FT                   /translation="MKRLLLAAAALIAAPLPAETIAITGGTLAIGDGSQPIKGGTVVIA
FT                   NGRVVAAGAGVAVPAGARVVDATGKWVSPGIIAGVSTLGLMEGYGMSETNDLSADKSPF
FT                   SAALDMSTAINPTGQRIGVERAAGVTRAFVIPAAGNTMFGGQGAVIDLGADMDPVTRPR
FT                   AFQYVELGEDGMGPAGGSRPAAYALLRVALGAAANPASADFASKDALITRQDAEALAPV
FT                   VRGTQPLLVHVERAADIRSVLALKKQYPAIRLVLVGATEGWMVAGEIAAAGVPVIAAAL
FT                   LDLPEKFESIAATQSNVGRLAKAGVTVAISNADISEGPYESYLAQYAGNLVALTKIPGA
FT                   QGLDWGAAFATITSKPAAAIEMDGEIGSLRPGRRADVVVWDGDPLELSSAPTAIFIDGV
FT                   AQPTTSRQTRLRDRYLDPVEKGLPKAYER"
FT   sig_peptide     77178..77240
FT                   /locus_tag="Swit_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.675 at
FT                   residue 21"
FT   gene            78671..80008
FT                   /locus_tag="Swit_0081"
FT   CDS_pept        78671..80008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0081"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66454"
FT                   /db_xref="GOA:A5V2D8"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V2D8"
FT                   /protein_id="ABQ66454.1"
FT                   /translation="MGRRYFGTDGIRGRTNESPMTAEIAMKVGQAAGAHFVRGEHRHRV
FT                   VIGKDTRLSGYMMESALVAGFTSVGMDCVLLGPMPTPAVAMLTRSMRADLGVMISASHN
FT                   MFADNGIKLFGPDGYKLSDDDETAIEARLEKPVKLAASADIGRAHRVESARGRYVHAVK
FT                   SSFPEHLRLDGLRVVIDCAHGAAYEVAPLALWELGAELISMGVNPNGVNINDQCGSTDT
FT                   RALQDKVRETRADIGIALDGDADRLIIVDNEGRVVDGDQLMALVAVGAHRRGELRGGGI
FT                   VATVMSNLGLERFLAEQGLSLHRTKVGDRYVVEAMRAEGFNIGGEQSGHIVMTDHATTG
FT                   DGLVAALQVLAQLVESGKPASELLHQFDPLPQLLKNVRFAGGEPLKDEKVIAAIADAEE
FT                   KLTGTGRLVIRKSGTEPLIRVMAEGEDKRLVEAMVDQICDAVRKAA"
FT   gene            80133..80936
FT                   /locus_tag="Swit_0082"
FT   CDS_pept        80133..80936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0082"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66455"
FT                   /db_xref="GOA:A5V2D9"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2D9"
FT                   /protein_id="ABQ66455.1"
FT                   /translation="MTTARILIIAGSDSGGGAGIQADIKTVTLLGGHAMTAITALTAQN
FT                   TLGVSAVHPVPAEMVIAQIDAVADDIGVDAVKIGMIGNAAIAERVADRLDRPDLAGVPL
FT                   VFDPVMIATSGSRLADAATIAAFGRLMRRAAVSTPNLDELGALSGGRALGDEPAVAAAA
FT                   AGLIAQGSGPILATGGGFATGELTDLLFTAGGDAPERRWTAGWIDTIHDHGTGCTLASA
FT                   IATGLGQGLALADAITRARAFVRAALLAAPGLGRGHGPMGHRSID"
FT   gene            complement(81126..81734)
FT                   /locus_tag="Swit_0083"
FT   CDS_pept        complement(81126..81734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0083"
FT                   /product="LSU ribosomal protein L9P"
FT                   /note="PFAM: ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66456"
FT                   /db_xref="GOA:A5V2E0"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V2E0"
FT                   /protein_id="ABQ66456.1"
FT                   /translation="MDVILLERVEKLGQIGDVVSVKAGFARNYLLPRKKALRANEANKK
FT                   VFEANRAQIEADNANRRGNAETEAKALDDKSVTLIRQASNTGQLYGSVSARDIVEALAE
FT                   DGIKVAKSGVVLGRPIKTIGLHEVKISLHAEVSRTVKVNVARSPEEAELQSQGVDVMAQ
FT                   LFERDEAGFTEDYDPNAEPGEIPTELQDEAPAAEATDEA"
FT   gene            complement(81753..81977)
FT                   /locus_tag="Swit_0084"
FT   CDS_pept        complement(81753..81977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0084"
FT                   /product="SSU ribosomal protein S18P"
FT                   /note="PFAM: ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66457"
FT                   /db_xref="GOA:A5V2E1"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V2E1"
FT                   /protein_id="ABQ66457.1"
FT                   /translation="MARAFFRRRKSCPFSAKDAPRIDYKDVRLLQGFVSERGKIVPSRI
FT                   TAVSAKKQRELAQAIKRARHIGLLPYIVK"
FT   gene            complement(82112..82423)
FT                   /pseudo
FT                   /locus_tag="Swit_0085"
FT   gene            82646..83581
FT                   /locus_tag="Swit_0086"
FT   CDS_pept        82646..83581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0086"
FT                   /product="[Acyl-carrier-protein] S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66458"
FT                   /db_xref="GOA:A5V2E2"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2E2"
FT                   /protein_id="ABQ66458.1"
FT                   /translation="MRAFIFPGQGSQAVGMGQALADASTVAREVFQEVDDALSQKLFKL
FT                   MVEGPADELTLTENAQPAIMANAIATLRVLQKEGGISLADKAAFVAGHSLGEYTALCAA
FT                   EAIDLATTARLLKLRGRSMQAAVPVGVGAMAVFLGLDFEGAKAVAEEAAQGEVCQAAND
FT                   NSNRQVVVSGHKDAVERAIEIAKAKGARRAMLLPVSAPFHCSLMQPAADAMAEALGRTA
FT                   VQAPLVPVYANVLAAPVSDPAEIIRLLVEQVTGTVRWRESVAAMADAGVEQFVELGGKV
FT                   VGPMVKDITDRATATSVVTMADIEALAASL"
FT   gene            83687..84427
FT                   /locus_tag="Swit_0087"
FT   CDS_pept        83687..84427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0087"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; Male sterility C-terminal
FT                   domain; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66459"
FT                   /db_xref="GOA:A5V2E3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2E3"
FT                   /protein_id="ABQ66459.1"
FT                   /translation="MFDLSGMTALVTGASGGIGSAIAGALVRQGAKVALSGTREDALKA
FT                   VAAEIGGETVILPCNLGDAEAVDGLIPRAVEALGGKLDILVNNAGVTRDNLIMRMKDEE
FT                   WDQVISVNLEAAFRLIRAAAKPMMKARFGRVITITSIVGTTGNPGQANYAASKAGLVGM
FT                   SKALAQELASRNITVNCVAPGFIASAMTDVLADAQKEALLGKIPAGKLGEGGDIAAAVV
FT                   YLASQEASYVTGQTLHVNGGMAMI"
FT   sig_peptide     83687..83758
FT                   /locus_tag="Swit_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.937 at
FT                   residue 24"
FT   gene            84535..84771
FT                   /locus_tag="Swit_0088"
FT   CDS_pept        84535..84771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0088"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66460"
FT                   /db_xref="GOA:A5V2E4"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2E4"
FT                   /protein_id="ABQ66460.1"
FT                   /translation="MSETAERVKKIVVEHLGVEAEKVTEEASFIDDLGADSLDIVELVM
FT                   AFEEEFGVEIPDDAAEKIATVKDAISYIESHKG"
FT   gene            84906..86171
FT                   /locus_tag="Swit_0089"
FT   CDS_pept        84906..86171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0089"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: Beta-ketoacyl synthase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66461"
FT                   /db_xref="GOA:A5V2E5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2E5"
FT                   /protein_id="ABQ66461.1"
FT                   /translation="MRRVVVTGLGLVTPLGADVETAWANLIAGKSGAGRITRFDTTEQV
FT                   CKIACEVKPADHPYGFDPNKRVDHKVQRQVDPFIIYGIDAAGQALEDAGLTEMSEEESY
FT                   RAGLSIGSGIGGLPGIASESIVCETKGPRRVSPHFVHGRLINLISGQVSIKYGLRGPNH
FT                   AVVTACSTGAHAIGDAARMIAMDDADVMLAGGAEGAICPLGIAGFAQARALSTDFNDEP
FT                   EKASRPYDKRRDGFVMGEGAGIVVLEEYEHAKARGAKIYAEVIGYGLSGDAYHVTAPHP
FT                   DGSGAYRSMAMALKKSGLQPSDIDYINAHGTSTPLGDELEAGAVRRLFGDALKTVSMSS
FT                   TKSAIGHLLGGAGAVESIFCILAMRDQIVPPTLNLEDPSDGLEDFDLVPLKAKKRPVRA
FT                   VLNNSFGFGGTNASLVMRKLED"
FT   sig_peptide     84906..84965
FT                   /locus_tag="Swit_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.662) with cleavage site probability 0.360 at
FT                   residue 20"
FT   gene            86195..87166
FT                   /locus_tag="Swit_0090"
FT   CDS_pept        86195..87166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0090"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66462"
FT                   /db_xref="GOA:A5V2E6"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2E6"
FT                   /protein_id="ABQ66462.1"
FT                   /translation="MIRRLIALVLILALVGGGAALWVSRDWWGEGPLQKPASIQVKKGD
FT                   TLASAARALEKAGAIRSTTGFLRFARRFGSQDPVRAGEFEIPARASGAEILDLLQHGKP
FT                   VQHLVTIPEGMPSILVQERLMAEPQLTGTIAVPAEGSILPNSYSFEAGEPRAAVLARMQ
FT                   AAMREALDSAWAARKPTTVVTSKRDALILASIVEKETAVASERPMVAAVYSNRIREGMK
FT                   LQADPTVIYPITQGKPLGRRIRLSELRAVNGYNTYASAGLPEGPIANPSKAAIEAVLDP
FT                   AKSPALYFVADGKGGHVFANTLAEHNANVQRFYAIRRSRGEM"
FT   sig_peptide     86195..86257
FT                   /locus_tag="Swit_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.621 at
FT                   residue 21"
FT   gene            complement(87345..87791)
FT                   /locus_tag="Swit_0091"
FT   CDS_pept        complement(87345..87791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66463"
FT                   /db_xref="GOA:A5V2E7"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2E7"
FT                   /protein_id="ABQ66463.1"
FT                   /translation="MMNDTAETKGVPAWYWVLAVVLLLWGVAGIFAFYSQLTTPYEKMV
FT                   AEMGKLAADCIKGMPGWLWWVYGVAVWSGTLGSVALLARRNWAQPLYLVSVIAVIVQFG
FT                   HSFLVAKVQDLMGWGAAIFPAVIILIAVFELWFAGWARKRGWLR"
FT   gene            complement(87868..88284)
FT                   /locus_tag="Swit_0092"
FT   CDS_pept        complement(87868..88284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66464"
FT                   /db_xref="GOA:A5V2E8"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2E8"
FT                   /protein_id="ABQ66464.1"
FT                   /translation="MVPVWYWVVTAILLVWNAVGCLACFSQMRMSPDKLASLPEAQRAA
FT                   WIAMPATVKAAYVVAVGAGLLGAIALLCRCAAAGPLFIASLVGVIVQFGWFFAVYKGAS
FT                   KLGASSLAFPAVIALVAVAQIAFACWAKTQGLLG"
FT   gene            complement(88304..88882)
FT                   /locus_tag="Swit_0093"
FT   CDS_pept        complement(88304..88882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0093"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66465"
FT                   /db_xref="GOA:A5V2E9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2E9"
FT                   /protein_id="ABQ66465.1"
FT                   /translation="MFGDFCHWLTRSGKDSDQMTDSIDLDDFDRRIIAIVRRDNQQPAR
FT                   TIADQVGLSESAVLRRLRRLRSGGIIVADVSLIDPSRLAPAITIHVLVELAQSGLKVEQ
FT                   LFARTLESRPEVIGAWNVTGRTDFLVTVSVPSIEAYQRFADEVLASDDNIRGFETLVSL
FT                   REIVRFDPLRAGDPLPIVMAPKEGHPPAR"
FT   gene            88912..89811
FT                   /locus_tag="Swit_0094"
FT   CDS_pept        88912..89811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0094"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66466"
FT                   /db_xref="GOA:A5V2F0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2F0"
FT                   /protein_id="ABQ66466.1"
FT                   /translation="MSSSLSTRPRFDVQLAAAYAALIGSITAFCVGTSFAKRLFPLVGA
FT                   EATSAYRVGFAALILLTVWRPWRGRITRADLFATMRYGAAMGMMNLCFYMALRTIPLGL
FT                   AIAIEFSGPLAVSLLHARRPAHFAMVGLAVAGLALLLPIGPGDHGLDPVGIMFALGAGL
FT                   CWALYILFGKRLGHLPGGQSVSIGMATAALIVVPIGIHQGGLALLDPRLMALGLGAAIL
FT                   SSAIPYSLEMVALKRLSHNSFGIFLSLEPAAGALAGVALLGEHLTALQWLAVLLVVMAS
FT                   AGTMLSAEPSEAPPSAGS"
FT   sig_peptide     88912..89022
FT                   /locus_tag="Swit_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.829) with cleavage site probability 0.803 at
FT                   residue 37"
FT   gene            complement(89819..90760)
FT                   /locus_tag="Swit_0095"
FT   CDS_pept        complement(89819..90760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0095"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase, NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66467"
FT                   /db_xref="GOA:A5V2F1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2F1"
FT                   /protein_id="ABQ66467.1"
FT                   /translation="MTAKVFIDGAAGTTGLEIRDRLAGRADIELLAVAEERRKDPAARA
FT                   EALNAADAVVLCLPDDAAREAVALIANPAVRVIDASTAHRTAADWAYGFAELDPGQREA
FT                   LAGATRISNPGCYPTGFLALVRPLVRAGLLPADTPLSVNAVSGYSGGGKSMIAMFEDPA
FT                   SPDATDTAFRAYALGLGHKHVPEMQKRAGLAHPPIFLPSVARTYRGMLVEVPLHLHLLP
FT                   GRPTGAAIRELLAAAYEGSRIVRVATDDRPVLTIEQAAGTDRLELFVHADEKAGQARLI
FT                   AALDNLGKGAAGAAVQNLNIALGLDETEGLRL"
FT   gene            complement(90757..91695)
FT                   /locus_tag="Swit_0096"
FT   CDS_pept        complement(90757..91695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0096"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66468"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR041382"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2F2"
FT                   /protein_id="ABQ66468.1"
FT                   /translation="MPSENPSISRGPAADSFTGGGRPAAAFHLDGPTRRLDPRINAYRP
FT                   DIADVALAGTLFAPHYAAPMPAMAGGVAAMMRKAASADAEAVSQLLPGEDFAILDLTGG
FT                   WAWGFSVHDHYVGYVDARLLAPVVPATHRVHVREALRFAGPSIKAPMLGTLPFGTRLSG
FT                   EMRDDGFLATGDGFVHARHVVAADTLSDDPVGVAEGLLGAPYLWGGRGADGIDCSGLVQ
FT                   VALAACGIAAPRDTDMQRETLGTPLPEEARLRRGDVVSFPGHVGLMVDEDRLIHANAHW
FT                   MSVVIEPLADVVARLQPHHDRPILGRRRLYP"
FT   gene            complement(91652..91981)
FT                   /locus_tag="Swit_0097"
FT   CDS_pept        complement(91652..91981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0097"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66469"
FT                   /db_xref="GOA:A5V2F3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2F3"
FT                   /protein_id="ABQ66469.1"
FT                   /translation="MSENQLSQWMRALVSYVRSGQPDLTNRQMALLLISYITPGPHTVR
FT                   GLAQQLGVSKPVITRALNTLGSLGYLRRERDDNDRRNIFVAKTEKGAAFLDAFGKSIDL
FT                   ERARG"
FT   gene            complement(92121..93518)
FT                   /locus_tag="Swit_0098"
FT   CDS_pept        complement(92121..93518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0098"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17, leucyl aminopeptidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66470"
FT                   /db_xref="GOA:A5V2F4"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2F4"
FT                   /protein_id="ABQ66470.1"
FT                   /translation="MTDFAGLLLPDRGEPAHRLTPVAADGLDAWLKDQPAQVRALAEAG
FT                   RFKAKPGELLILPGRKDGEWSAAYGKAKAPGPWDIAAIAQKLPAGTYRIDGDGGDDHLP
FT                   GALGWLLAHHRFDRYLAKPDPIPARVLLTRDAAAIAPTVALAEAVALVRDLVDTPAADM
FT                   GPAELADAAEAVAKAHAAEFRVTRGDALDQGYPMIAAVGRAAVRDRAPRLIEIEWGDPA
FT                   HPRIAIVGKGVCFDSGGLDLKPSSAMLLMKKDMGGAAHALALAGLVMGARLPVRLHLLI
FT                   PAVENAVAGDAFRPGDILRSRKGISVEIGNTDAEGRLVLGDALARAGEDKPDLILDFAT
FT                   LTGAARVALGPDLPAMFANDDALAAELLAAAVAVSDPVWRMPLWADYAEMIKSTTADIN
FT                   NAGEGGMAGAVTAALFLQRFVPDATPWAHFDTFAWRPSARPGRPKGGDALGLRAAFAML
FT                   RARFVTP"
FT   gene            complement(93521..93907)
FT                   /locus_tag="Swit_0099"
FT   CDS_pept        complement(93521..93907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0099"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66471"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2F5"
FT                   /protein_id="ABQ66471.1"
FT                   /translation="MDFDSPYAEVIGAHPNRATGEPILSVSWRPAIEGRPGFIHGGVIA
FT                   GLLEMSCYEALAHEFRETGLPKVKPINIAVDYLRGGLMTETHALAQIVRIGKRVANASA
FT                   MCWQDDRSKPIATARMHILIDRQG"
FT   gene            complement(93907..94395)
FT                   /locus_tag="Swit_0100"
FT   CDS_pept        complement(93907..94395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0100"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66472"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2F6"
FT                   /protein_id="ABQ66472.1"
FT                   /translation="MTIGGGGAPGACADASSAYAGTTMTELFDSSSLKRLMDGHAGEIG
FT                   LRRVDHGDDWAELAFDYDPRLAMNAANGVLASGPIISLIDSASGLAIAAKIKAVRPMAT
FT                   LDLRIDYVRAAPPGRAITARATCYKVTRSVAFVRCVAHDGDPADPIAHSLATFFFTGD"
FT   sig_peptide     complement(94333..94395)
FT                   /locus_tag="Swit_0100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.871) with cleavage site probability 0.868 at
FT                   residue 21"
FT   gene            complement(94528..96474)
FT                   /locus_tag="Swit_0101"
FT   CDS_pept        complement(94528..96474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0101"
FT                   /product="K+ potassium transporter"
FT                   /note="PFAM: K+ potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66473"
FT                   /db_xref="GOA:A5V2F7"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V2F7"
FT                   /protein_id="ABQ66473.1"
FT                   /translation="MRNDIADPEGPPRKGRLREEGMAALTLGALGVVFGDIGTSPIYAF
FT                   REALGQAAEDGIVAGEILGVLSLALWALILVVTCKYVLFLMRADNNGEGGVLALMTLAQ
FT                   RSTRRRRTLVMALGAIGAALFYGDGVITPALSVLSAVEGLKTIPGLEHSVSRGEILLIT
FT                   SAILIGLFLMQARGTRIVGRLFGPVCLVWFVTIGGIGLIHIADQPAILAALLPHNGVLF
FT                   MANHGVAGMFVMGAVFLTVTGAEALTADMGHFGAKPIRTGWLAIVFPALALNYLGQGAF
FT                   ALHRLEVASARGVEFVNQDWFFLMAPGLARIPLVILATCATVIASQAVITGAYSLTRQA
FT                   IQLGLLPRLKIRQTSEHAAGQIYLPTITMLLFVGVMVLVLGFGSSSAMAAAYGVSVSGT
FT                   MVVTTCLAFLVVRRSWGWGWPLTVAVIVPLLLLDLFFFGANILRIYEGGWVPLIVAGGV
FT                   GLLIVTWVRGRKLLLAIDQSQAIELEELARMLRARPPERVPGMAIFLSSGMEAAPSALL
FT                   HNLKHNKILHERNLALTINTVNQPAVPAAQRLDMTNIDENFTRAVLNYGFMESPDIPRD
FT                   LAFALRHGDNKLEPMQTSYFIGRSTLRPSKHSGMPFWQDLLFIFLYRNASDPTDFFRIP
FT                   PNRVVELGSQTTI"
FT   gene            96679..97455
FT                   /locus_tag="Swit_0102"
FT   CDS_pept        96679..97455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0102"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66474"
FT                   /db_xref="GOA:A5V2F8"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V2F8"
FT                   /protein_id="ABQ66474.1"
FT                   /translation="MTRRRQIYEGKAKILYEGPEPGTLIQYFKDDATAFNAQKKGTING
FT                   KGVLNNRISEHIFTMLGTIGVATHFIRRLNMREQLIRQVEIVPIEVVVRNVAAGSLTKR
FT                   LGIEEGTQLPRTIIEYYYKDDALGDPMVADEHIACFGWASQEEMHDIADMAIRVNDFMC
FT                   GLFAGIGIRLVDFKLEFGRFWDNDYSRVILADEISPDGCRLWDMATGEKLDKDRFRQDL
FT                   GGEVEAYQEIARRLGLMPDGENMILDLESHRKNRGK"
FT   gene            97623..98303
FT                   /locus_tag="Swit_0103"
FT   CDS_pept        97623..98303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0103"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66475"
FT                   /db_xref="GOA:A5V2F9"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2F9"
FT                   /protein_id="ABQ66475.1"
FT                   /translation="MAAPRFEHPSAAPLTLLLPDLDGGEPGYWLRHWIDSRIDCRLVDL
FT                   GQARRPDRNSLVTRLDHALRRLDAPVILVGHGVGALTIAAWAGLMSSESEAAVAGALLI
FT                   APGDPAAADADPRLSDFAPLPSEVFSFPALLVASDDDPALSPDRAFSLARQWGAGFARF
FT                   GACGHFAPADGLGWWPEGEELLDRFIDLVEPGRVRAQAQDGLDRLAQSLPPRDRGSSSP
FT                   LFRP"
FT   gene            98532..99341
FT                   /locus_tag="Swit_0104"
FT   CDS_pept        98532..99341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0104"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66476"
FT                   /db_xref="GOA:A5V2G0"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2G0"
FT                   /protein_id="ABQ66476.1"
FT                   /translation="MSSRTEAVKIAPNDAFNIQTVLWVKHWNEHLFSFAVDRPASLRFR
FT                   SGEFVMIGLPTEARPLLRAYSIASPSYSDELEFLSIAVEDGPLTSRLRHIIAGDEIYLA
FT                   RKTTGTLVADALTPGKRLFLLATGTGLAPFLSVMRDPDIYERYEQVVIVHSVRHLSDLA
FT                   FRDLLESRLAGDPLVEEEAAAKFRYLPIVTREPFPRQQRITTLMENGGLFDGIDGEPKL
FT                   DPATDRVMMCGSMDMIRDCSAILERLGFEEGSNAKPADFVIEKAFVG"
FT   gene            complement(99465..101393)
FT                   /locus_tag="Swit_0105"
FT   CDS_pept        complement(99465..101393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0105"
FT                   /product="peptidase M61 domain protein"
FT                   /note="PFAM: peptidase M61 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66477"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2G1"
FT                   /protein_id="ABQ66477.1"
FT                   /translation="MHRFPSLPLSLLALTLAAPATAIELSLPQPLPIERQVPAARDIAY
FT                   PGTIELTVDATDVARGVFRIREQIPVAGAGRLYLLYPQWLPGNHAPRGPIDDIANIAIT
FT                   ANGRPLAWKRDPVDVYAIQVDVPEGARSIALSFDYVSPTSSSQGRVVMTGDMLSLQWNL
FT                   TAFYPAGYFTRRIMVAPSAVLPAGWGYGTALEPASPRGSATVAFQPVNFETLVDSPLLA
FT                   GRYFRQVQLSPKVRLNIAADHPDELQASDAQIEAHRRLVDQAVKLFGAQHYDHYDFLLS
FT                   ISDRLGGIGLEHQRSSENGVATGYFTRWEEQTARHNLLPHEYVHSWNGKYRRGADLYTP
FT                   DYSVPMRNSLLWVYEGQTQYWGYVLQARSGLVSPDDTLAYLAMAAAQLDGRPGRQWRPL
FT                   IDTTNDPIIAARRPQPWTSLQRSEDYYNEGMLVWLDVDMQLRALTGGRRSLDDFARAFF
FT                   GMRDGDWGTLTYTLDDVVATLDGIAAHDWAGFLRDRVEQARPHAPLDWIAKGGYRLVYS
FT                   NKPTNFWRIEERRRKVADFSYSLGLVIDSGDRRIEQVIWDGPAFAAGLTNSDSIVALDG
FT                   ESFDGAKLAERIDDATTTRKPIELLVRRGDQYRTVAIPYYGGNRYPRLERIEGGSAWLD
FT                   VLLKPRG"
FT   sig_peptide     complement(101325..101393)
FT                   /locus_tag="Swit_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.796 at
FT                   residue 23"
FT   gene            101719..102603
FT                   /locus_tag="Swit_0106"
FT   CDS_pept        101719..102603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0106"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66478"
FT                   /db_xref="GOA:A5V2G2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2G2"
FT                   /protein_id="ABQ66478.1"
FT                   /translation="MARQIPPLSAVRVFEAAARHLNFTRAAEELAMTQAAVSYQIRMIE
FT                   DRLGTPLFVRSGRRVSLSPAGQRLAPAVTAAFDRLDEAFAKVRLAESGVLTISAAPGIA
FT                   AGWLGPRLARFQLAKPDIAVRLLASHELVDFARDEVDVGIRIGQGEWPGLRAIEMFGAE
FT                   FTPMCSPAYIDRMGPFTDPAQLLDTLRMNSDDVWWRAWFAEVGVAVPDDLDRGSIHVDS
FT                   QVIEGMAATAGEGVAMLTPRFWPFELATGRLVQLFPHVGDGGSFWLVYPEHRHGSSKVK
FT                   AFREWLMAEVRAS"
FT   gene            102767..105019
FT                   /locus_tag="Swit_0107"
FT   CDS_pept        102767..105019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0107"
FT                   /product="DNA topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66479"
FT                   /db_xref="GOA:A5V2G3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2G3"
FT                   /protein_id="ABQ66479.1"
FT                   /translation="MTDIAELPEDSVRNTPFDSALSDRYLVYALSTITARSLPDVRDGL
FT                   KPVHRRLLWAMRLLRLDPASGYKKCARVVGDVIGKYHPHGDQSVYDAMVRLAQTFSLRY
FT                   PLVDGQGNFGNVDGDNAAAMRYTEARLTAAAGELMAGLDEGTVDFRPTYNGEEEEPEIF
FT                   PGLFPNLLANGASGIAVGMATSIPPHNVAELIDAAVLLIDKPEAETAELLDHVKGPDFP
FT                   TGGVLVDSPATIAEAYATGRGAFRVRAKIEKVDEKGGGWHLVVSQIPYQVQKSKLIEQI
FT                   AELINDKKLPILADVRDESDEEIRIVLEPRSRTVDADMLMESLFRLTELEVRVSLNLNV
FT                   LDDTRTPLVMSLKQALAAWLKHQFEVLIRRSQHRLAKIADRIELLDGYLIVYLNLDRVI
FT                   QIIREEDEPKPVMMAEFGLTDRQAEAILNMRLRSLRRLEEMELTRERATLDAEGKELEA
FT                   LIASPARQRTRMKRDLAALRERYGPETALGARRTLLSEAAPAREIPLEAMVEREPVTVI
FT                   LSQRGWIRAMKGHLDEAAQAAVKFKEGDGPAHAIRAQTTDRILLATDQGRFYTLPADKL
FT                   PGGRGFGEPVRLFADIDADARVAALLAAKPGAELLLASGDGKGFVVDMADVTAETRKGK
FT                   QVVNLREGGRLKVVHPVAPTDDYVAAIGDNRKMVIFPLGELPRMARGQGVTIQRYKDGG
FT                   LSDAISFRLDDGLSWTMGGDTGRTRTEADLTPWRAARGAAGRMPPVGFPRDNRFRG"
FT   gene            105080..106864
FT                   /locus_tag="Swit_0108"
FT   CDS_pept        105080..106864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0108"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66480"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2G4"
FT                   /protein_id="ABQ66480.1"
FT                   /translation="MRAAKTHIMSTSDRVGSDPSLPVHKLPAALQELLDTPRSAAQQEF
FT                   IDTLPIAIALVCLVDRKPAILARNRAFLQLADRHSSRREIDPGRDLCVGIALPLLPEIE
FT                   DFLNGDESDRSFDMQEGDGISGRHFAVRLSRLSGGESPVPRCILSLIDRTQQVEGERSL
FT                   RTQMLRDSLTGLPNRAAFAEQAEHAMLNYAAEGRQFAVLLIDLTRFSRVNEGVGSLAGD
FT                   ELIITVARRLVSALRAGDVLARLAGDEFAVLLGVADDPSEAIAAARRMQACLATPIRLG
FT                   DLEIKIDCAVGVAMMAPAIDDAEDLIRNAQIAMKRAKQSGHAELYQAGDSVTARQRFSL
FT                   ETELRRAIERDQLHLAFQPLIELSTGRVIGFEALARWDHPEKGAISPVDFIPVAEESGL
FT                   IVALGRWALRAATRTLAEWDRRAGAPLPVHMAVNVSAVQFQRDDVVSAIKAALTESGIA
FT                   GSRLKIELTESCIVTDPDGIARVLRAIHGLDVTIAMDDFGTGYSSLTYLQRLPIDVLKI
FT                   DRSFVAPMLHDRDSVAIVRAILGLASALGMATTAEGVESEALIETLIGLGCDIAQGYYF
FT                   ARPLPSDEAFAYLRSRPA"
FT   gene            complement(106840..108045)
FT                   /locus_tag="Swit_0109"
FT   CDS_pept        complement(106840..108045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0109"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66481"
FT                   /db_xref="GOA:A5V2G5"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2G5"
FT                   /protein_id="ABQ66481.1"
FT                   /translation="MTLLPDAAWRHLPGLDRLLDALGAAEGDVRFVGGAVRDTLLGLPV
FT                   KDIDCATRLLPEESSRRIAAAGFKAIPTGIAHGTVTALLPSGPVEVTTLRRDVATDGRR
FT                   AVVAFTDEWREDAARRDFTINALSADPSTGAVHDYFGGRADLDAGLVRFIGDPLRRIAE
FT                   DHLRILRLFRFHARFGRGTPDAAALDACIARANDLMALSRERVADELLKLLGVADPAPT
FT                   VRLMHDSGIFRPIIPEIDGDGVARLDRLIAREAIAGTAADALRRLGALLPPDPVIAAAI
FT                   AQRLKLSKAATRRLEQAASGIDDAPRALAYRFGAEVAADLLLRGERPAEALGLDTLDGW
FT                   ERPRLPIGGGELIAMGLKAGPVVAATLQAIERRWIAEGFPGDARVAELAAEAMAQAGRD
FT                   RR"
FT   gene            complement(108042..108647)
FT                   /locus_tag="Swit_0110"
FT   CDS_pept        complement(108042..108647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0110"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66482"
FT                   /db_xref="GOA:A5V2G6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2G6"
FT                   /protein_id="ABQ66482.1"
FT                   /translation="MTALADRLRGSFADARDDAPLVDEIGLVGDIATLTRAAVLVPIIE
FT                   APRPRVLLTVRHEALRAHAGQVAFPGGRLDPEDGGPVDAALREAWEEVRLPSERVDVVG
FT                   TSRPYATRSGYLITPVVGVIPEGIELHPQEAEVSGLFEVPLDVLLAEANHLRRSVIFEG
FT                   RPRQYYEIDWPDQRIWGVTAGLIVELAPRLRGALERAA"
FT   gene            complement(108644..109219)
FT                   /locus_tag="Swit_0111"
FT   CDS_pept        complement(108644..109219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0111"
FT                   /product="protein of unknown function DUF1285"
FT                   /note="PFAM: protein of unknown function DUF1285"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66483"
FT                   /db_xref="InterPro:IPR010707"
FT                   /db_xref="InterPro:IPR023361"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2G7"
FT                   /protein_id="ABQ66483.1"
FT                   /translation="MPETTPPPDFAGLSLSDIAAFAADNRLPPVEKWNPAHCGDSFMRI
FT                   ASDGTWFHEGSPIGRAAMVRLFSTILRREPDGGYVLVTPVEKLSIAVDDAPFVAVEMKV
FT                   EGEGRKRRIAFRLNTGDLVVADAAHPLRIVERDDGPHPYVTVRKGLDALIARPVYYEMV
FT                   NLALDEGGEDGDRPGLWSEGSFFALDAQ"
FT   gene            complement(109235..109762)
FT                   /locus_tag="Swit_0112"
FT   CDS_pept        complement(109235..109762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0112"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66484"
FT                   /db_xref="GOA:A5V2G8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2G8"
FT                   /protein_id="ABQ66484.1"
FT                   /translation="MITLTPIAAVAASHVEHLLDLAFGTDRHQRTAYRLREGVEALPDL
FT                   SLAALEDGELIGSIQCWPIQLTGDDGDSTPLILVGPVAVAPGRQRAGVGRMLMDAALAK
FT                   ADAADREPMMLIGDVSYYERFFGFSSRHTRGWAVPGPVERDRLLARLRPGQVVPGHGRL
FT                   GPRVAALVPGDD"
FT   gene            109870..110505
FT                   /locus_tag="Swit_0113"
FT   CDS_pept        109870..110505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0113"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66485"
FT                   /db_xref="GOA:A5V2G9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034345"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2G9"
FT                   /protein_id="ABQ66485.1"
FT                   /translation="MKLYDAAWAPSPRRVRIFLAEKGIAVERVTVDLKTGEHLRPDFVR
FT                   TNPQRQLPVLVLDDGTAIDDSLGICRYFEALHPDPPLFGATAKEIGLVESWLRRVEHDW
FT                   FQAVALHFRNRVPAFADRAVSGEWPPIPQIPALVERGQCMWNAFADVLDRHLADRRHVA
FT                   GDAFTMADIAAFVAADFGIATRLPDPREGREALARWHAAIAARPSASA"
FT   gene            110628..111389
FT                   /locus_tag="Swit_0114"
FT   CDS_pept        110628..111389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0114"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66486"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2H0"
FT                   /protein_id="ABQ66486.1"
FT                   /translation="MTPEFGPSRTAIVTGGAKRIGAEIAAALAADGWDVLIHYRRSQAE
FT                   AQALAAGLPRARTVAADLADPDGPARVIAALDGMPPPALLVNSASSFVYDSLDDFTIDA
FT                   WDMHMAANARGPALLARAFAAAVPDGAGGLIVNMLDAKLSQLNPDFFTYTISKIAFAGV
FT                   NELLARCLAGRGIRVNAIAPSVTLVSGPQSRENFDKVHGLNPLERGVEVSEIVAALRFL
FT                   IAVPTITGQTITLDGGQRFLGLPRDVQFLES"
FT   gene            111410..111808
FT                   /locus_tag="Swit_0115"
FT   CDS_pept        111410..111808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0115"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66487"
FT                   /db_xref="GOA:A5V2H1"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2H1"
FT                   /protein_id="ABQ66487.1"
FT                   /translation="MDPARLDGLVPDHLGPRTRRIVLRDLAVPVDIGFHDFEVGNPQRV
FT                   SVTVEVWLDEASFAAVDEVAAAWDYDFLRSEILLLVEGRRYNLQETLAREIYTLVAARA
FT                   GVKGLRVATSKPDVYPDCAEVGVELSSF"
FT   gene            complement(111851..112735)
FT                   /locus_tag="Swit_0116"
FT   CDS_pept        complement(111851..112735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66488"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2H2"
FT                   /protein_id="ABQ66488.1"
FT                   /translation="MPAPAKNRQMLRFGTLLAFNLVAMSAAAPAIAQPQPPAATQTSGI
FT                   RAFSYADLADLALTAQLIAGVTVVKAERLKGELAPNLAAGKARFLIEAQTGMLLRGADG
FT                   LAGTVSYIVDVSLDARGKAPKLKKARFILFANRVPNRPQEIRLTSPYSQLDWTQTTEST
FT                   LRAILTEATAASAPPLVTGIGNAFHVPGAIPGESESQIFLTTADNRPISLSILRRPGEQ
FT                   PQWAVALGEMVDDSARAPARDTLLWYRLACFLPARLPEKSTAALSASDAEAVRADYRHV
FT                   LTQLGRCGRTIER"
FT   sig_peptide     complement(112637..112735)
FT                   /locus_tag="Swit_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 33"
FT   gene            112986..113633
FT                   /locus_tag="Swit_0117"
FT   CDS_pept        112986..113633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0117"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66489"
FT                   /db_xref="GOA:A5V2H3"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2H3"
FT                   /protein_id="ABQ66489.1"
FT                   /translation="MAYGDQTLSTRKVVSIALVIVLHAVIGYAFVTGLAYNVVKKVARD
FT                   LKTFDVAEEAPPPPDQPPPPPPETRIEPPPVVAPPPIVQVAPTMAPPIVSVPVAPPVVI
FT                   TPAAPPAPPPPAVSRRGEPRGTPGEWVTPEDYPSADLRAENQGTTSFELAVGPDGKATD
FT                   CKVTNSSGFPSLDTKACQMLLRRARFKAQLDGNGQPMPFTYRNRVRWQIPKD"
FT   gene            113719..114444
FT                   /locus_tag="Swit_0118"
FT   CDS_pept        113719..114444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0118"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66490"
FT                   /db_xref="GOA:A5V2H4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2H4"
FT                   /protein_id="ABQ66490.1"
FT                   /translation="MASPAAAGSNPYGLMAALEQGGTIAWTVFIILVVMSAASWYIMFT
FT                   KLIEQQKILNQGKRARASFWQAPSLKDGQAKLEKNSAYRQIVDDGLLAQDQHTKLTDPV
FT                   DQHEWLTGSLMRSQALINSKLGNGLAVLATVGSTSPFIGLFGTVIGIYRALIKIGAAGQ
FT                   ASIDAVAGPVGEALIMTALGLAVAVPAVLGYNWLIRRNKVVAEQISAFATDLHGYMVSA
FT                   GAVKPATQVKAAPAPAVKK"
FT   gene            114567..115049
FT                   /locus_tag="Swit_0119"
FT   CDS_pept        114567..115049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0119"
FT                   /product="Biopolymer transport-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66491"
FT                   /db_xref="GOA:A5V2H5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2H5"
FT                   /protein_id="ABQ66491.1"
FT                   /translation="MAMSAGPAEDGSPMSDINTTPLVDVMLVLLIIFLITVPVVIQTVP
FT                   VKLPNVVFEPTTTKPENVALTVRASSSGVCEVYWGQTPVTAQELIDRAVVKLRKEIDRQ
FT                   GGPNAPGLELPEVHIRGDVNTPYRCIGGAVYTMQRAGFTRVGFISEPPAGYASARL"
FT   gene            115074..115502
FT                   /locus_tag="Swit_0120"
FT   CDS_pept        115074..115502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0120"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66492"
FT                   /db_xref="GOA:A5V2H6"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2H6"
FT                   /protein_id="ABQ66492.1"
FT                   /translation="MAMAASTTEGEPMMDINTTPLIDVMLVLLIMFIITIPIQTHAVKL
FT                   DLPVDTGQNTPPPVDPVKNKVVITPDNQVLWNGSPIDLVRLRQYLDITQTMNPIPELHL
FT                   EPDGQARYDLVDRVLAVTKRAQVEKMGFVGNEKYAGAF"
FT   gene            complement(115690..116676)
FT                   /locus_tag="Swit_0121"
FT   CDS_pept        complement(115690..116676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0121"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66493"
FT                   /db_xref="GOA:A5V2H7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2H7"
FT                   /protein_id="ABQ66493.1"
FT                   /translation="MTEATIDVVGIGNAIIDLLAHAEDSFLIEHKLNKGAMTLIDEPTA
FT                   ERLYAAMGSATRASGGSAGNTIAGLGSLGASCGYIGKLRDDELGAAYRHDLLASGVRFT
FT                   TPMASDGPSTARCIIFVTSDAERTMNTYLGACVNLTPDDIDEALVGSAKVTYLEGYLYD
FT                   EPHAKAAFHRAADIAHGAGRKVALTLSDAFCVLRHRADFLDLIRDRIDILFANEAELLA
FT                   LFETEDRDAALDRVAGMVELAAVTLSAEGSVVVRGAERVRSPAAHIERVVDTTGAGDLY
FT                   AAGFLYGLTQGLPLAECARIAGLAAAEIISHFGARPEVPLREFAGLD"
FT   gene            116790..117731
FT                   /locus_tag="Swit_0122"
FT   CDS_pept        116790..117731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0122"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66494"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2H8"
FT                   /protein_id="ABQ66494.1"
FT                   /translation="MLDELDDLLGKARLWLAQGHGVALATVMQTWGSAPRRRGSHAVIR
FT                   DDGLFEGSVSGGCVEGDVLVAAQALLAAGGGFDRRDYGVADDDAWSFGLACGGSIAILI
FT                   QTIDEAHVPPALLDRIAAERRAGRPIAVASDLATGAAAEAARDAGEEEGRFVNLYPPPL
FT                   RMMIVGAVHVSQHLVPLARQLGYRVQLVDPRDSFAAADRFAGIAVDTRWPDEAMAEWRP
FT                   DGGTAVVTLTHDPKIDDPALVAALGSDAFYIAALGSRRTHAKRIERLSAAGCTAEAIAR
FT                   IDGPAGLPIAAATPAEIALSILAGATAALRGA"
FT   gene            117728..118300
FT                   /locus_tag="Swit_0123"
FT   CDS_pept        117728..118300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0123"
FT                   /product="Uncharacterized MobA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66495"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2H9"
FT                   /protein_id="ABQ66495.1"
FT                   /translation="MSVGAILLAAGSARRMGADKLTADLGGRPLALHAFEALLAAGFDR
FT                   PIVAVAPGSAVAALFADRARLVLVENHALGMGHSLAAAVAAVPGDWTAAVIGLADMPFV
FT                   RPATLRALAAASAPDAIVRPVFDGTPGNPVAWGRDHFPALAALSGDKGGRDILARSPPT
FT                   PLACDDPGVVIDVDTPEALAAARARFL"
FT   gene            complement(118408..120903)
FT                   /locus_tag="Swit_0124"
FT   CDS_pept        complement(118408..120903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0124"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66496"
FT                   /db_xref="GOA:A5V2I0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2I0"
FT                   /protein_id="ABQ66496.1"
FT                   /translation="MRTAWALALRDMRGGLKGLRLLIICLFLGVAGLAGVGSLSRAITA
FT                   ELDSRGQEILGGDIEMRVAQREAAPDERAAFARQGLVSETIRLRAMASRADAAAAVLAE
FT                   LKSVDDRWPLYGTLRLEPGALAPRPAGLDAMVAPALAERLSLRIGDSVRIGETSFRVAG
FT                   LIAEEPDRVGEGFTLGPSILVSREGLAATRLVQPGSLFTARYRIRLPADRDAHAIAERL
FT                   GERFHDANWEVTDRTNAARGLRRLVDQLGQFLTLVGLTALVVAGIGVGNGVASWLDQRR
FT                   PGIATLKILGASSATIFRIYLIQVAIVSAGAILAGLAVGAAVPAIVGRLAGDALPVAPK
FT                   FAIFPLPLLISAVYGLLAALLFSLSPLARAGQVSPAAIFRARVEPFGWPRWRVLLPMLG
FT                   AGLGIALLAVATARQPMLSAGFLAATAGIFALLGAIGWLVRRGARALPRPRRPLLRLAI
FT                   ANLHRPAAQTDRLIVALGLGLTLFVLLAVLQTSLTHQIEKTVPAVAPNFFALDVPTEDI
FT                   DRFRSTVLARARGAKIDSVPSLRGSVVAVRGVRVTDMKPVPKGAWILNGDRGLTYAARL
FT                   AEGNEIVAGQWWPADYAGPPLISVEEQAAKALDLKPGDRMTLSVLGVEIETTVASIRRV
FT                   NWETMGFNFGIVFAPGALEGAPHSYMATIAIPDAREAAVNRAVIAGFPSVSLIRVKDVV
FT                   EQVSSIFGQLATAIRAAASVALAAGVAVLVGAVAASRRARLYDAVLLKLLGASRRQVLA
FT                   AQAIEYALLAAIIALLALAAGTAAGWYVVTRIFELAWAPDWPIVLATLAAGALGTLGIG
FT                   LLGSLPVLAARPAAALRSL"
FT   gene            complement(120900..121586)
FT                   /locus_tag="Swit_0125"
FT   CDS_pept        complement(120900..121586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0125"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66497"
FT                   /db_xref="GOA:A5V2I1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2I1"
FT                   /protein_id="ABQ66497.1"
FT                   /translation="MTASIIDARAVRLALGKGSARVDILKGIDLAIRAGETVALLGPSG
FT                   SGKSSLMAVLSGLERADEGNIDIAGLDFGRLDEDALAAARRGRIGIILQAFHLLPTMTA
FT                   LENVAVPLELAGEADAFARAAAELEAVGLGHRLDHYPSQLSGGEQQRVAIARATAPRPA
FT                   ILFADEPTGNLDGATGATIMDLLFDRQRKTGATLLVITHDPALAARCARIVEMRDGAIL
FT                   SDRAAA"
FT   gene            complement(121823..124138)
FT                   /locus_tag="Swit_0126"
FT   CDS_pept        complement(121823..124138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0126"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   clpA"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, ATP-binding
FT                   subunit clpA; PFAM: AAA ATPase, central domain protein; Clp
FT                   N terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66498"
FT                   /db_xref="GOA:A5V2I2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2I2"
FT                   /protein_id="ABQ66498.1"
FT                   /translation="MPSFARELEQTLHNALSAASSRRHEYATLEHLLLALIADEHASKV
FT                   MTACGVDLSELRNAVTNYLDTELDALKVEGETDPSPTSGFQRVVQRAILHVQSSGREEV
FT                   TGANVLVALFSERESYAVFFLQQQDMSRLDAVSYISHGVGKAGQPTEQREVKGAEEEKA
FT                   QAKADGKKGESALKQFCVNLNEKAKNGKVDPLIGRGPEVDRTVQILCRRSKNNPLYVGD
FT                   PGVGKTAIAEGLARKIVEGDVPEVLLPAVIYSLDMGALLAGTRYRGDFEERLKQVVTEL
FT                   EKLPHAVLFIDEIHTVIGAGATSGGAMDASNLLKPALSGGTIRCIGSTTYKEFRNHFEK
FT                   DRALLRRFQKIDVNEPTIEDTIKIITGLRSAFEEHHNVKYTPDAIKAAVELSSRYISDR
FT                   KQPDKAIDVIDEVGASQMLVPPNKRKKVITPKEIEAVIATMARIPPKSVSTDDKKVLGT
FT                   LETDLKRVVFGQDKAIEVLSSAIKLSRAGLRDPDKPIGNYLFSGPTGVGKTEVARQLAS
FT                   ILGIPLQRFDMSEYMERHSVSRLIGAPPGYVGYDQGGLLTDAVDQHPHSVLLLDEIEKA
FT                   HPDLFNILLQVMDNGKLTDHHGKTVDFRNTILIMTTNAGASDMARETLGFGNLTREGED
FT                   EEAVKKMFTPEFRNRLDAIVPFSYLPAEVVARVVEKFILQLELQLADRDVHISLDEEAR
FT                   NWLTAKGYDKLYGARPMGRLIQEKIKQPLAEELLFGKLVHGGEVKVKLKDDALSFEIVP
FT                   AAPKRPKKGGGAKPRVKA"
FT   gene            complement(124262..124489)
FT                   /locus_tag="Swit_0127"
FT   CDS_pept        complement(124262..124489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66499"
FT                   /db_xref="InterPro:IPR009579"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2I3"
FT                   /protein_id="ABQ66499.1"
FT                   /translation="MRPARVNVMPMEPDDLFAKRPDDPVTQLVRQDIDHLSVDELEARI
FT                   AALQGEIERCGTKIRNALSHRATAESLFKR"
FT   gene            124542..125537
FT                   /locus_tag="Swit_0128"
FT   CDS_pept        124542..125537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0128"
FT                   /product="Quinone oxidoreductase putative, PIG3"
FT                   /note="TIGRFAM: Quinone oxidoreductase putative, PIG3;
FT                   PFAM: Alcohol dehydrogenase, zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66500"
FT                   /db_xref="GOA:A5V2I4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2I4"
FT                   /protein_id="ABQ66500.1"
FT                   /translation="MAEIPEWMTAIDPEEKGGPEILRPVRRPVPGPGPGQVLIRVAAAG
FT                   VNRPDVAQRNGAYPPPPGAPSILGLEVAGEVVALGEGALPELLGQPVCALVAGGGYADY
FT                   VAAEAGLCLSVPNTLSMVEAAAIPETLFTVWSNVYERAYAADGDRLLVHGGTSGIGTMA
FT                   ILLGRIFQVETIVTAGSDEKCAAAIKLGAAHAINYRSQDYVAEVARITGGKGVDIVLDM
FT                   VGGAYVPRNLDCLAEDGRHVSIAVLGGAKAEIPIWKIMQKRLTLTGSTLRPRSVAFKTA
FT                   VADEIASVVWPHVEEGRLKPVIDATFPLAQAADAHRRLDEDHVGKVVLVN"
FT   gene            complement(125551..126156)
FT                   /locus_tag="Swit_0129"
FT   CDS_pept        complement(125551..126156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66501"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2I5"
FT                   /protein_id="ABQ66501.1"
FT                   /translation="MYRHFLIASTAALALSLAGCGKKAEQAADSVANGAAETADTAGAM
FT                   ASNAMVDVQQAMTPTPTGQDFADQAAKSDAFEIAAARVAQTNAASPAVKDFAAEMIKAH
FT                   TESTARIKAAAATASPAITPNATLTDEQNEDLAELAAKKGAAFDEAYIDDQVDAHQDAL
FT                   VLMRDYAEHGDTASLKTAAGEIAPVVQKHLDHAKSLDK"
FT   sig_peptide     complement(126085..126156)
FT                   /locus_tag="Swit_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.499 at
FT                   residue 24"
FT   gene            complement(126267..126698)
FT                   /locus_tag="Swit_0130"
FT   CDS_pept        complement(126267..126698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0130"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66502"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2I6"
FT                   /protein_id="ABQ66502.1"
FT                   /translation="MRIFTIGYEGATQAELVDRLRAAGVTLLADVRAVPLSRRPGFSKN
FT                   ILAAGLREAGIDYVGLKALGTPPDGRTAARRHDMATLRRVYDGQLALPEAMAQAAMLAD
FT                   MARERPTALLCFEREPACCHRSLLVEAVFPDAEVIDLFA"
FT   gene            complement(126710..126886)
FT                   /locus_tag="Swit_0131"
FT   CDS_pept        complement(126710..126886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66503"
FT                   /db_xref="GOA:A5V2I7"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2I7"
FT                   /protein_id="ABQ66503.1"
FT                   /translation="MSDDNSTPDNKPAAKKKGVPTPKITKKTAVVGAAIGIGSAAIVAA
FT                   LLYTNRNNSGGKS"
FT   gene            complement(127059..127715)
FT                   /pseudo
FT                   /locus_tag="Swit_0132"
FT   gene            127798..129042
FT                   /locus_tag="Swit_0133"
FT   CDS_pept        127798..129042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0133"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66504"
FT                   /db_xref="GOA:A5V2I8"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2I8"
FT                   /protein_id="ABQ66504.1"
FT                   /translation="MDRPCRRARRSASPRARALPGPWQCGAAPLWPAAMTAPRFHFSIA
FT                   ATDGKARTGTIRMQRGDIRTPAFMPVGTAATVKAMKPADVRATGADIILGNTYHLMLRP
FT                   GAERVARLGGLHRFMRWDRPILTDSGGYQVMSLSALTRRSEEGVSFKSHLDGSAHMLSP
FT                   ERSIEIQRLLGSDIVMAFDELVPTTTTMQQQAEAMERSMRWAKRSRDAFDAGGEHAQRA
FT                   ALFGIQQGALDERLRKASADALLAIGFDGYAVGGLAVGEGQEAMFATLDFAPGQLDPAK
FT                   PRYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTRRGPINLRNARFGEDERPL
FT                   DESCACPVCGQFSRAYIHHLIRAGEILGAMLMTEHNLSFYQALMADLRAAIAAGTLSAF
FT                   AADFRAAYHGGGAGD"
FT   gene            complement(129052..129891)
FT                   /locus_tag="Swit_0134"
FT   CDS_pept        complement(129052..129891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0134"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66505"
FT                   /db_xref="GOA:A5V2I9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2I9"
FT                   /protein_id="ABQ66505.1"
FT                   /translation="MNGPGIDFLTVFALPPVAFVELAADLGAPSISLILEPLDYDPEGH
FT                   APYSLRTDRALRRDLVAVARDRGVTLALGEGLVVRPDRDVRDLYADDIAIMAELGVRCI
FT                   NILSFDPDTARTFDQYALLAEMAGAAGIDSAIEFSRGRPSTPDLPTALAAWRHVGRPDC
FT                   RILLDTMHLVRSGGTPADVAALAPGTIGYVQLCDVPLAPAHPVYFEEAAFSRLPPGEGE
FT                   LPLFDILMALRDDPVVSVEVPMRAAAEAGVGPRERAERALAPARALIDRVAAARATA"
FT   gene            complement(130034..130108)
FT                   /locus_tag="Swit_R0004"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(130034..130108)
FT                   /locus_tag="Swit_R0004"
FT                   /product="tRNA-Val"
FT   gene            complement(130169..130543)
FT                   /locus_tag="Swit_0135"
FT   CDS_pept        complement(130169..130543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0135"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66506"
FT                   /db_xref="GOA:A5V2J0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2J0"
FT                   /protein_id="ABQ66506.1"
FT                   /translation="MIRILLAEDDDSMREYLARALERSGYAVTSVDRGTAALPLIEANG
FT                   FDLLLTDIVMPEMDGIELAQRANVIAPNMRVMFITGFAAVTLKSGATPPDAKILSKPFH
FT                   LRDLVLEVDRMFQVGSASGL"
FT   gene            130704..131564
FT                   /locus_tag="Swit_0136"
FT   CDS_pept        130704..131564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0136"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="PFAM: N-formylglutamate amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66507"
FT                   /db_xref="GOA:A5V2J1"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2J1"
FT                   /protein_id="ABQ66507.1"
FT                   /translation="MVSEPAFSILGPATPRSPVLLAVPHAGRAYPAEVVARARVPMERL
FT                   RALEDRHAERLVAQAVDAGATAIVAHVARAAIDLNRDPREIDPAMIEGKLDTDGLLATG
FT                   KVRAGLGLFPRRLPSCGELWRARMPAEDAARWIAEVHEPYHRAIAERIEATRALFGAAV
FT                   LIDCHSMPPLPVRQAGGPVRIVIGDRFGAGAAGAVVDLVLAVIDGVGLRAARNHPYAGG
FT                   YTIDRHGRPRRQVHAIQIEYDRSLYLDAALDMPTARIDDCGRLLAAIVAELGTLLSPDL
FT                   PIAAE"
FT   gene            complement(131983..132759)
FT                   /locus_tag="Swit_0137"
FT   CDS_pept        complement(131983..132759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0137"
FT                   /product="SapC family protein"
FT                   /note="PFAM: SapC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66508"
FT                   /db_xref="InterPro:IPR010836"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2J2"
FT                   /protein_id="ABQ66508.1"
FT                   /translation="MASAPANALPLFYNDLQPLSSQLHATWKAKTMESAEFFGKAHAVP
FT                   LTVEEFIPAQRHYPIVFSVGPDPVPLALFGLNEGVNVFTDEQGQPTRDLYVPAYVRRYP
FT                   FMLARLRPDSEDLSLCFDSTAGLLGEFEEGSPLFEGEEPSEAIRNTLAFCEQFEQAGMR
FT                   TGMFMQELIQNKLLIDGEVTIEPDGGGQPFVYRGFQIISEDKLKELRGDVLRKMVQSGL
FT                   LPLIYAHLFSLSLIRDVFSLQMQQGKAPAPAPAVPA"
FT   gene            complement(132825..134345)
FT                   /locus_tag="Swit_0138"
FT   CDS_pept        complement(132825..134345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0138"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66509"
FT                   /db_xref="GOA:A5V2J3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2J3"
FT                   /protein_id="ABQ66509.1"
FT                   /translation="MEPAGRRTGWQIARRLHYAARMSRPHAPDPLLLDRLGALLGPQGF
FT                   VTDPDLVTPWLTDWRDRYRGETPALLAPCSTAQVVEVVRLAAGARVALVPQGGNTGTVG
FT                   GATPPADGSALLLSLRRMNRIRAISAEDNAVIAEAGVILSDLHDAAAAIGRRFPLSLAA
FT                   KGSATIGGLVSTNAGGTQVLRFGPMRALVLGIEAVLPDGSLFDGLATLRKDNRGYDLRQ
FT                   LLTGAEGTLGVVTAAALRLVPAVAARAVAWVGVPDPRAALALLRRLEERTGEAVESFEL
FT                   VPDNALALVLRNIGGARAPLSEPCPWNVLVEAVGTAGGPDPRDALEQTLAAAIEDGLVV
FT                   DATLAANEAQAEALWALRESISEAEKIDGPSLKHDISVPVSEMPAFLEREREQIEARYP
FT                   GSRIIAFGHLGDGNIHFNLLPPEDAPRRPWIAEHGAAASALVHDRVAAVGGSLSAEHGI
FT                   GQAKLDEFARLTDPVRLNALRAIKRAIDPLGIMNPGKLVPLASGGEDQ"
FT   gene            134448..134927
FT                   /locus_tag="Swit_0139"
FT   CDS_pept        134448..134927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66510"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2J4"
FT                   /protein_id="ABQ66510.1"
FT                   /translation="MMPGRLPRLLCAGRLPTVLVALGTGLGLAIPAAADPRPIRVAPIR
FT                   VAQVTVEQSLIVRVPRRVPAKPLRWKEKKGPKCVAMSTIAGAAVVADDAIDLALKGGQR
FT                   LRAQFSSRCPALDYYSGFYILPTEDGRICADRDVIRTRSGGQCEIERFRKLVLDD"
FT   sig_peptide     134448..134552
FT                   /locus_tag="Swit_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.949 at
FT                   residue 35"
FT   gene            135024..136370
FT                   /locus_tag="Swit_0140"
FT   CDS_pept        135024..136370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0140"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66511"
FT                   /db_xref="GOA:A5V2J5"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2J5"
FT                   /protein_id="ABQ66511.1"
FT                   /translation="MSFADLGLSDELLRAVSEAGYSEPTPIQAQAIPPVLMMKDLIGIA
FT                   QTGTGKTASFVLPMIDILAHGRSRARMPRSLILEPTRELAAQVAENFEKYGKYHKLTMA
FT                   LLIGGVNMGDQVAALEKGVDVLIATPGRLMDLFGRGKILLTGCSLLVIDEADRMLDMGF
FT                   IPDIEEICTKLPAQRQTLLFSATMPAPIKKLADKFLSNPKQIEVSRPASTNLAIDQSLV
FT                   ETSSRAKRETLRGLLNGGDVSTAIIFSNRKTTVRDLAQSLGRYGFRAGQIHGDMEQPER
FT                   LRELDRFKGGEINILVASDVAARGLDIKGVSHVINFDVPWHPDDYVHRVGRTGRGGATG
FT                   TAITLVTPEDAEAIEAIEKLTGNKIARRGKPAGAIEEAAPETAEPRREKRERGGRREKK
FT                   AEVPAPREAKREERDRRPRRDDRRRDPIDDEPDDGWNGPVPGFLSVSLG"
FT   gene            complement(136546..137952)
FT                   /locus_tag="Swit_0141"
FT   CDS_pept        complement(136546..137952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0141"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66512"
FT                   /db_xref="GOA:A5V2J6"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2J6"
FT                   /protein_id="ABQ66512.1"
FT                   /translation="MRRSRTLPIALLAGAILPLAAQPVHGAAPTPVDPAQHGQMLDIWK
FT                   KMIAIPTVHGRGQTRAMADYIAGLLKQGGFAAEDIVIEGDGDDISLAARYRGTGKGKPI
FT                   LLSGHMDVVEARPSDWTRDPFVPVEENGFVYGRGALDMKFGDAVLVSTLLKLKAEGFKP
FT                   SRDILLLLSGDEETAMATTARLAERYGGDAELLLNADGGGGMLDDQGKPVAFYVQGGEK
FT                   TYADIEISVTDPGGHSSRPGATNAIATLAQAIDRIAAYKFPAQVNEITRAYFKATGKQV
FT                   GGTIGAAMLRFADDPNDAAAVATLRAEPEYVGITGTTCVPTMLSGGHALNALPQKATVS
FT                   VNCRIFPGVPIDSVRDTLAKVIDNPKATVTILDHPLGSDASPLRPDLMKAVRKGIDQSF
FT                   PGLPIVPQMAAGATDSLYFRAKGVPSYGVLGMFLNPADDFSHGLNERAPVASIDPALRL
FT                   MRTLIVDLSK"
FT   sig_peptide     complement(137872..137952)
FT                   /locus_tag="Swit_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 27"
FT   gene            complement(138007..139584)
FT                   /locus_tag="Swit_0142"
FT   CDS_pept        complement(138007..139584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0142"
FT                   /product="Phospholipase D"
FT                   /EC_number="3.1.4.4"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66513"
FT                   /db_xref="GOA:A5V2J7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2J7"
FT                   /protein_id="ABQ66513.1"
FT                   /translation="MMSSGMFAKGENCWRIERASRAAVIVDAADYFRTARDAMLRAREQ
FT                   ILLVGWDVDPRILLDPDLPAGGDGEEPPNCLAQFIPWLVRRRPDLRINLLIWNMGFLKM
FT                   LTRGLSIFTIIRWRMTRNVSIRFDSSHPIGATHHQKILVIDDSVALCGGIDMTEDRWDT
FT                   PLHLDGDPRRHRPNGKPYMPWHDTAGMIEGPAAAALGDLARDRWKHATGHDLPVPAPHG
FT                   GIWPEQVEPLFHDRPVAIARTHPKSEGAAEVREIEQLYVDMIAAAKRFIYADNQYFASR
FT                   RVAEAIARRLTERHPPEIVIVNPISADGWLQEAAMGSARAELFFALAEIDRDDHFQIYT
FT                   PVTAGRKPIYVHSKLLIVDDRILRVGSSNMNNRSMGLDSECDIALESEAPDAPDPAIRR
FT                   LRELLMAEHLGATPDAVRDAFDRTGSLIATVECLIGPAKSLLPFEPHEWSDATLAIGAS
FT                   SLLDPESVDERFEPLSNRGLFRGFLRRGTRQLFDTIREKRRARRERNRGRWRRKFRKLW
FT                   NAARQLDD"
FT   gene            complement(139682..141115)
FT                   /locus_tag="Swit_0143"
FT   CDS_pept        complement(139682..141115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0143"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66514"
FT                   /db_xref="GOA:A5V2J8"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2J8"
FT                   /protein_id="ABQ66514.1"
FT                   /translation="MSMSGSAMARIVGIQTVIQFVIDFSASLIVARLLSPHELGAFSIA
FT                   LAAVMIAQTLRSAGINMFLVSAPELDQTRIRTALGLAMIASFGFALLIFAAAPLIAAFY
FT                   RAAVIADVLRIVAFTYLLAPFQVLAHGLLNRALRFKAIMAATLAGAATSGGTAVALAFL
FT                   GWGTLSMAYATLAGGIVSLGVMLASRPAGFVFRPALVHWRSISSFTGWVLGSTLLNQIG
FT                   PRLNELFVGRSLGIAPAAFLDRAEMLPRMLWNYAAPPVLSILAPLVAHEMRRGVDARTT
FT                   LLLRMRLFGCIFSPIMIGIATQSAPILIGLYGWQWQASIAPAPWVCVAAAITGQFVVLG
FT                   ASLSGLGHARPLFLLSICEQGARVVMLAMLSRTDIVLVAIGTVGVSLVYAAAAIRLGAR
FT                   LKLFTVREVLASLMPSIAICAVVAAAGIAIDMARGGGIPAHPIPAVIEAAAILAVVWIA
FT                   ALFVFQRSVITALWKLVRH"
FT   gene            complement(141195..141866)
FT                   /locus_tag="Swit_0144"
FT   CDS_pept        complement(141195..141866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66515"
FT                   /db_xref="GOA:A5V2J9"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR039575"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2J9"
FT                   /protein_id="ABQ66515.1"
FT                   /translation="MSPATLERLVLARASALIPVRTAASGAAGVQKVETGSAMIHRFDG
FT                   ALNPAICARLCALSHSRTEKPEGAADPAKLPWQDSDTFAFDHWEEGELRHLIGGYRLMV
FT                   GQLICLAVREIVFPHFTDLVRWRPGKSMDEHKDDGYPGDDELMSCRHYSAVTYCNDNYS
FT                   GGETFIRNEHGGYYVSAPRTGTLVFYPSDERATHGVKPVVGGDRVTLSTWFTRDVRHYR
FT                   P"
FT   gene            complement(141897..142508)
FT                   /locus_tag="Swit_0145"
FT   CDS_pept        complement(141897..142508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0145"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66516"
FT                   /db_xref="GOA:A5V2K0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2K0"
FT                   /protein_id="ABQ66516.1"
FT                   /translation="MITLYHAPQSRSSRMLWLLEEIGAPYEIKPVSIFRPMTGEGEGDP
FT                   GNPHPDQRVPAIAHGGNLAAESVAIVLYLTEAFPEAGLGPLPGDPQRGAYLTWLAWYAA
FT                   EMEPAMVAAMTGELDRAPMRQRYHAQVVRRIERALAQGPYMMGDRFTGADLLIASALAF
FT                   GRQAFPESPTIDAYMTRCRERPAAIRGLALDDASGLQQAA"
FT   gene            142614..143315
FT                   /locus_tag="Swit_0146"
FT   CDS_pept        142614..143315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0146"
FT                   /product="Helix-turn-helix, type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix, type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66517"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2K1"
FT                   /protein_id="ABQ66517.1"
FT                   /translation="MRRADRLFQIIQIMRRSNRAITAADIAGELEVSPRTVYRDIADLI
FT                   GQRVPIRGEAGFGYILDDAFDMPPLMLTPDEIEAAMLGAQWVAGRGDPVLAGAARDLIA
FT                   KISSVVPERLRSYAMLPATAARPARAPRDGIDIARTRSSIHAGRKIRIDYRDEQGRATS
FT                   RVIWPVVIGFFDSARMLAAWCELRQDFRHFRTDRVVSAEFLDECHGARPGELRQRWKRH
FT                   MAEKHGPSFSG"
FT   gene            complement(143336..143545)
FT                   /locus_tag="Swit_0147"
FT   CDS_pept        complement(143336..143545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66518"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2K2"
FT                   /protein_id="ABQ66518.1"
FT                   /translation="MARRFEIGDHVSWNSEAGRVSGTIIAVHRRDFDYKGHTHHASDEE
FT                   PQYEIKSDKTDHVAAHKGSALDHA"
FT   gene            complement(143619..143978)
FT                   /locus_tag="Swit_0148"
FT   CDS_pept        complement(143619..143978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0148"
FT                   /product="response regulator receiver and SARP domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66519"
FT                   /db_xref="GOA:A5V2K3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2K3"
FT                   /protein_id="ABQ66519.1"
FT                   /translation="MSDAVIVVVDDDPRISATLLSALAETGLEARAFADGEGALDYLAG
FT                   GSETPACIVTDINMPGMSGWEFAKRARLLLPRLGVVYISSECMDDWRLKAVADSHFLPK
FT                   PFVRDQLLRAIAALI"
FT   gene            complement(143975..145570)
FT                   /locus_tag="Swit_0149"
FT   CDS_pept        complement(143975..145570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0149"
FT                   /product="conserved hypothetical protein 341"
FT                   /note="PFAM: conserved hypothetical protein 341"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66520"
FT                   /db_xref="GOA:A5V2K4"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2K4"
FT                   /protein_id="ABQ66520.1"
FT                   /translation="MTTSNAEHGMVDTVKMRIERVPLYRWWRRAIVGSVDHQEIIERIF
FT                   VDGKWSPRYAFMTMMSAGIAILGLLLSSPAVIIGAMLISPLMNPILGLGFSMALFDFAE
FT                   MRRSLIALAVGSLAAILFTALIVAISPLQAPTPEIIARTRPNLFDLAVALFASLAGTFA
FT                   IIRGRGDTIVGVAIATALMPPLAVVGFGLATWNMAAFGGALALFVTNFVTIALSATVMA
FT                   RYYGFGHHLSSQQSWTQTFILFFVFVAMAIPLGISLERIAGEAVTTNRVRSFLSKQFGA
FT                   EARVTQLEIDFAAQPLSVRSVIIAPRNGARPVGTLQADLERQLDRPVQLRLDQVLLDPR
FT                   AGAIDVQREQLRQAEHSAAMETNRISAVSQALAVSAGVDIDQITIDREQRRATVNAAQL
FT                   PGATIETYHALEKRAAAQAEGWTIAIVPPQGALPSIGFVDGGDALDPAGQAALSTSAWA
FT                   ARRWNVPALGVPGLPRLPSARPNLVERRAQAVAALLRAQGIEAVPARTTGRGFVLTVVQ
FT                   GEATSSSLPRGPGS"
FT   gene            complement(145567..146079)
FT                   /locus_tag="Swit_0150"
FT   CDS_pept        complement(145567..146079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66521"
FT                   /db_xref="GOA:A5V2K5"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2K5"
FT                   /protein_id="ABQ66521.1"
FT                   /translation="MTMRESSYGYRPERPRIVDRIAAWAGGLFVIDGLAHLWFADARAS
FT                   LTGLDMGAASIAIGIFWTIFGTVMMVGGLAHARSVAINAATSLTLASGGCLIMIALKSA
FT                   GLLPLLIYSTMAMISFVVLVSLHFTERSDLKRELAIARSAMPKPTSTRPDGPRICHRRN
FT                   ETEESGK"
FT   gene            146216..147055
FT                   /locus_tag="Swit_0151"
FT   CDS_pept        146216..147055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0151"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66522"
FT                   /db_xref="GOA:A5V2K6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2K6"
FT                   /protein_id="ABQ66522.1"
FT                   /translation="MDIVLLRTFLAAASTGSFANAALRVNASASTVTERIRQLEHRVGA
FT                   RLFERDKRGCRLTAAGKRFHEPALKAIRTWEIACHDIALPEAFSRSIAIGGQYALWHHF
FT                   LTDWLATARAALPDVAFRVTAGASARLNRDIVEGLLDLVVLYDPVFRKGITVEKLFDDD
FT                   LVLVSGAGSDDWQAHYVRIEWGQGTLGEIAARLPSLPESGLILDLGIHSARWLVEQRMC
FT                   GFMPRRVVQDLLDSGDLRLVEGAPRFHYPAYMCWRGDVDQDLVKDLARLLRSPFAGS"
FT   sig_peptide     146216..146281
FT                   /locus_tag="Swit_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.350 at
FT                   residue 22"
FT   gene            complement(147170..148198)
FT                   /locus_tag="Swit_0152"
FT   CDS_pept        complement(147170..148198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0152"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66523"
FT                   /db_xref="GOA:A5V2K7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2K7"
FT                   /protein_id="ABQ66523.1"
FT                   /translation="MTELPMGSREVRLARTRAGLPAPGDFEIVSVPRPAAAGEVLVRNL
FT                   CFLVSASLRQMIVKGASDEKGVPFPAIRTGEALRGEALGEVIAAPGDSGFSSGDLVVHF
FT                   LGWRDYAVVPVTQCRKVRDDLPDRAAHLGHGWTAYAALTRGVAVRPGDTVFISSGGGAI
FT                   GSMAAQVARLLGAARIIGSTSTREKADRLVAELGYDAAVHRDGPPILQQLSEAAPEGLD
FT                   VFLDNVGGEQFQAGVAACREGGRVVVLGTLSQQLAAEDSGNSMPVPLDSTHILMKRLLI
FT                   RGYSADDDPDARQEWERHLGDRLRSGQIRFPHVVVEGLAEAPRALERTIRGGYLGTVIV
FT                   KI"
FT   gene            148278..148895
FT                   /locus_tag="Swit_0153"
FT   CDS_pept        148278..148895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0153"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66524"
FT                   /db_xref="GOA:A5V2K8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2K8"
FT                   /protein_id="ABQ66524.1"
FT                   /translation="MATRIPASSGSMRKQPRQARSRATVEAILTAGAQLLAEVGWLKVT
FT                   TNRVAEIAGVSIGSLYQYFPDKAALVEAITRRHFDEILDVLREIDGCDLSLEARTERLV
FT                   AGMIRIHGGNPRLHRVLLRDAPASESLQATHALFEAEYLGRYDSFLARAAWRGADRGTA
FT                   AQILSSAIAGVVHDAAERGTLHSADVRRELISVVLAYVRHRQ"
FT   gene            149126..150481
FT                   /locus_tag="Swit_0154"
FT   CDS_pept        149126..150481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0154"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66525"
FT                   /db_xref="GOA:A5V2K9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2K9"
FT                   /protein_id="ABQ66525.1"
FT                   /translation="MGKITKRLVDASELRAKDYVIWDDELPGFGLRVFVSGKRSYVIQY
FT                   RSGGRSRRYTIGLHGVWTPETARQEAKILFGRIAQGDDPAEERQLNHRAITIKELCALY
FT                   VADLEAGLILGKGGRPKKPGTIVTDMGRIRRHIVPLIGRRKVKDLTKADVNRVLKDIMA
FT                   GKTAVVAKTKKLRGKAIVRGGVGTATRTIGLLGGILTYAIEAGIIDTNPAHGIRKPKDN
FT                   VRDRRLTESEYRLLGQIIRDAKEEGRYAVVAEITRVIALTGCRRGEIINLARTEADIGA
FT                   SCLRLDDTKEGKSVRPVGLPAVEALEARLDATTGTYLFPGQGEDNAFGCFPTHWKKLIE
FT                   NTPLEDVTPHVLRHSFASIANDLGFTEVTIAALLGHAKGSVTGKYIHTLDTALIMAADT
FT                   VSGYIQGLLDGVEFKQTAYALDRDSRKAALARFLQEAAGNDDTPVSDDRLAA"
FT   gene            150539..150928
FT                   /locus_tag="Swit_0155"
FT   CDS_pept        150539..150928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0155"
FT                   /product="protein of unknown function DUF1044"
FT                   /note="PFAM: protein of unknown function DUF1044"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66526"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2L0"
FT                   /protein_id="ABQ66526.1"
FT                   /translation="MSVFMSKSFARFARKAGLASEALIEAASAVAAGQADADLGSGVFK
FT                   QRVARSGGGKSGGYRTIILFKVGGHSFFAHGFAKNEKANISAKELKALKLLAALYLGYS
FT                   AEEITAAVNGGALIEVTEDGREDEK"
FT   sig_peptide     150539..150634
FT                   /locus_tag="Swit_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.721) with cleavage site probability 0.704 at
FT                   residue 32"
FT   gene            150906..151238
FT                   /locus_tag="Swit_0156"
FT   CDS_pept        150906..151238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0156"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66527"
FT                   /db_xref="GOA:A5V2L1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2L1"
FT                   /protein_id="ABQ66527.1"
FT                   /translation="MVAKTKSKRAASPILASVHEAAADLHELGLVDKATMREFDAFCLT
FT                   PVEPLSPAEIRSLREREHVSQPVFAHYLNVRKDAVSKWERGEKKPDGPSLKLLNLVRAK
FT                   GLQAIA"
FT   sig_peptide     150906..150974
FT                   /locus_tag="Swit_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.787) with cleavage site probability 0.597 at
FT                   residue 23"
FT   gene            complement(151314..151709)
FT                   /locus_tag="Swit_0157"
FT   CDS_pept        complement(151314..151709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66528"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2L2"
FT                   /protein_id="ABQ66528.1"
FT                   /translation="MDAIDRVHWERIHIDRFPHGACGHCSEMLAYYLQLRFGITANYVC
FT                   KEFYDAHGARETSHAWLELGGLIIDISGDQFGWPAVIVTRHSDAHERGEGDLRHPFKLD
FT                   PAWWSQQCAGVWAAIQRHLPDRHGCQV"
FT   gene            complement(151817..152434)
FT                   /locus_tag="Swit_0158"
FT   CDS_pept        complement(151817..152434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66529"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2L3"
FT                   /protein_id="ABQ66529.1"
FT                   /translation="MRSGDIPFKFDLTALLARARRQVAGRVGEITLNLPFVSIAVSPKD
FT                   RERTIAREVVLRLRDRRVLSAWECCDDCIDNALASLKDIRQLIVDKEVELGDLQDGPLF
FT                   LLLDAMATGIRQFMTFEELLRRDSGAPPHPRFGEFHRPPDIRQAYFDGLEVLRGHLSRC
FT                   LGQIALIAGMPAPADGIIENYQGPWQLEAYREPPKLAAPPRE"
FT   gene            complement(152453..153385)
FT                   /locus_tag="Swit_0159"
FT   CDS_pept        complement(152453..153385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66530"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2L4"
FT                   /protein_id="ABQ66530.1"
FT                   /translation="MNPWPAMPDDVVAWFRSVFAEANRRVCERLVNLPNIRETSLDDGL
FT                   IEALIPDSAPTLLPSGAIVRMDTHNIGGLRRLGPPHWDWDFPQRRRWETADIAILVFVY
FT                   QRDRLIAKKIGLLQSKRLFPTNQDVEDEDEISFLHGMNAFIRRDGHQAAAALHRTFSFD
FT                   DSCTFAAIQAGHRQVGLIDGLNRDFGKAVYYLLYNPPELPYSVSYPLRERIRVGNMAVG
FT                   NRVVDADDVHHALAGLTEGQSPSYGLLRSACALRDWPLETWAADLLLTCQVGQQFDDGT
FT                   DDRVRYFLERRSGPIGAALAASITLSDED"
FT   gene            complement(153521..154114)
FT                   /locus_tag="Swit_0160"
FT   CDS_pept        complement(153521..154114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66531"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2L5"
FT                   /protein_id="ABQ66531.1"
FT                   /translation="MRILRGYNSIPRPSQGRRQPDILARVVGAAVAAEPPLNLNLDATR
FT                   PDLIRAGTGRDRRIIFGHAATAQACSTDEVPMQDIPHFVAWIDYLIASNDPADQALATE
FT                   YRTQSWAMRELVEAMSAEMTAGQIAEGWVQKMEAQRRVCDELTKQVYARAQTLVAAGAA
FT                   PADEATVARDWRARAAGTHLAGRPDSHEPSPIIN"
FT   gene            154172..155143
FT                   /locus_tag="Swit_0161"
FT   CDS_pept        154172..155143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0161"
FT                   /product="P-type conjugative transfer ATPase TrbB"
FT                   /note="TIGRFAM: P-type conjugative transfer ATPase TrbB;
FT                   PFAM: type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66532"
FT                   /db_xref="GOA:A5V2L6"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2L6"
FT                   /protein_id="ABQ66532.1"
FT                   /translation="MTQPSAIVHARSTSMLRSALGPAIAAWLDDNGVAEVMLNADGRLW
FT                   VDRLDSGMAETGERLTAAQAERIIRLVAHHVGAEVHRATPRVSAELPESGERFEGLLPP
FT                   VVAAPVFSIRRPASLPLALADYVAAGTMTATAAAFLAGAVKDRANILVAGGTSTGKTTL
FT                   TNALLAVASDSDDRIILIEDTRELRCDAANVLALRTAPGVTMTDLVRSSLRLRPDRIPV
FT                   GEVRGPEALDLLKAWGTGHPGGIGTIHAGTATSALHRLEQLILEAIAHVPRPLIAETID
FT                   VIAVLSGRGTERRLSELVRVEGLDAAGAYCLRNIHTAQGVTA"
FT   gene            155140..155454
FT                   /locus_tag="Swit_0162"
FT   CDS_pept        155140..155454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0162"
FT                   /product="Conjugal transfer protein TrbC"
FT                   /note="PFAM: Conjugal transfer protein TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66533"
FT                   /db_xref="GOA:A5V2L7"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2L7"
FT                   /protein_id="ABQ66533.1"
FT                   /translation="MIRVRSARLAAALALAALYAAPAWAGGSGMPWETPLQSIVDSVQG
FT                   PVARVIGVIIIVITGLTLAFGDTAGGFRRLIQIVFGLSVAFAASSFFLSFFSFGGGALV
FT                   "
FT   sig_peptide     155140..155217
FT                   /locus_tag="Swit_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            155454..155720
FT                   /locus_tag="Swit_0163"
FT   CDS_pept        155454..155720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0163"
FT                   /product="Type IV secretory pathway TrbD component-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66534"
FT                   /db_xref="GOA:A5V2L8"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2L8"
FT                   /protein_id="ABQ66534.1"
FT                   /translation="MGEEDLPGFAVPVHRALAEPIMLAGAPRALAIFNGTLAAAVGIGL
FT                   RLWIAGIVIAIVGHGLAVFAARRDPQILPVARRHMALPTLFES"
FT   gene            155727..158195
FT                   /locus_tag="Swit_0164"
FT   CDS_pept        155727..158195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0164"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66535"
FT                   /db_xref="GOA:A5V2L9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2L9"
FT                   /protein_id="ABQ66535.1"
FT                   /translation="MMFLREHARRASRLSDFLPWAAMIAPGIVLNKDGSFLRVARFRGP
FT                   DLDSATQAELIATSNRLNSALKRLGTGWAIYVEAQRKASPGYPVSTGFADPVSALIDEE
FT                   RRDQFEGGDVTQPNFTSAYYLTLQWLPPADDTSRASSMLFEGGAEGIATAADHLEDFER
FT                   DTGRVLDMIEGVMPEAAWLSDGETLTFLHSTISTHEQNIAVPETPMHLDALLADDALVG
FT                   GLTPQLGEKHLRVLSITGFPAWTVPGMLDELNRLGFAYRWTTRAICMDKVTAQRTLSRI
FT                   RRLWFSKRKSLAAIVKEVLTNEASVLVDTDATNKSADADAALQELGADIAGFAYVTTTI
FT                   TVLGDTPRDADLKLQSIEKIVRGRDFACIAESLNALEAWLGSLPGNPYANVRQPPISTL
FT                   NLAHVMPVSAVWAGQDEDTHLGAPPLFHARTEGATPFRFSLHVGDVGHTLVVGPTGSGK
FT                   SVLLAFMALQFRRYEGAQIFAFDHGGSIRAATLGVGGEWHDLGGALGGGGAPVALQPLA
FT                   RIDELDERAWAADWLAAILAQEVFAITPEVKDHLWTALGSLADAPLEQRTLTGLAVLIQ
FT                   ASGLKRALQPYTLAGPYGRLLDADGERFGTHDAQAFETEGLVGTPAAPAVLAYLFHRIG
FT                   RRLDGRPTLILIDEGWLALDDPLFGRQLKEWLKTLRKKNASVVFATQSLADIEGSAIAP
FT                   AIIESCPTRLFLANERALEPQIAGIYRRFGLNDRQIEIIASATPKRDYYCQSALGNRLF
FT                   DLGLGPLALAFAAASQRSDLNAISALLDAHGADGFADAWLRHRGLGWAADIVTAERPPS
FT                   PALQEEEIIA"
FT   gene            158192..158926
FT                   /locus_tag="Swit_0165"
FT   CDS_pept        158192..158926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0165"
FT                   /product="P-type conjugative transfer protein TrbJ"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbJ"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66536"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2M0"
FT                   /protein_id="ABQ66536.1"
FT                   /translation="MTPIRTFFVGAAALALLAAPPASAQITVYDPTNYSQNLLSAARAL
FT                   QQINNQITSLQNEAAMLLNQARNLTSLPTSTLSQIQQSMDRTRQLIGEARQIAYNVQDI
FT                   DRVFDQRYPAGSLAGTSHGQMVGNAEDRWRDAVASFQDALRTQATIVTNLTDTRRELDT
FT                   LVGASQDATGALQAAQAGNQLVALQTRQIADLTALVAAQGRAAAIEAARAAADEAQARE
FT                   RGRRFIGTRSEYRPRSVTIFND"
FT   sig_peptide     158192..158266
FT                   /locus_tag="Swit_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            158919..159284
FT                   /locus_tag="Swit_0166"
FT   CDS_pept        158919..159284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66537"
FT                   /db_xref="InterPro:IPR027587"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2M1"
FT                   /protein_id="ABQ66537.1"
FT                   /translation="MTEAPEKPAPAKRAGRTLPFRALAIALLILAAGMAATVALRAPAG
FT                   NDSRFTVGDGREGMVERPADPLATELARCRTAAPDTVDERCRAAWEVNRRRFFGESRSS
FT                   ILPKVDVPAASPAREER"
FT   sig_peptide     158919..159038
FT                   /locus_tag="Swit_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.818) with cleavage site probability 0.289 at
FT                   residue 40"
FT   gene            159290..160606
FT                   /locus_tag="Swit_0167"
FT   CDS_pept        159290..160606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0167"
FT                   /product="P-type conjugative transfer protein TrbL"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbL;
FT                   PFAM: TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66538"
FT                   /db_xref="GOA:A5V2M2"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2M2"
FT                   /protein_id="ABQ66538.1"
FT                   /translation="MQNTGVIDRFLDLFGRYIDSGFGLIGGDVGFLASALIVIDVTLAF
FT                   LFWTWGGDEDIIARLVKKTLQVGFFAFLISNWNALAQVIYLSFSGIGLKAAGSGSPDDL
FT                   LHPGRIAQVGIDAGRPLIEQASELAGPVGLFTNFAEIAVLLIAWAIVLLAFLIIAIQIF
FT                   VTLIEFKLVTLAGFVLVPFGLFGRTAFLAERVLGNVMATGVKVLVLAIIIGIGSTIFDE
FT                   FVRDFGGTPPDLEQVASLALAALTLLGLAIFGPGIAAGLVSGGPQLGAGAAVATGIVAT
FT                   GAGAAVGMGAASLAGAGARAGTRAAGSLSSRSAARASGGSPSAPSPPPAPAGGAPAVPP
FT                   PSGAPKGGGASATRSPAPASSGAPASAVETESPTAASSPDPVVTGGPALPPAAPHAPAW
FT                   ANRLRRRQAMMQGATMAAYALRSSDSGGGAAQISVEDRS"
FT   gene            160603..161292
FT                   /locus_tag="Swit_0168"
FT   CDS_pept        160603..161292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0168"
FT                   /product="Conjugal transfer protein"
FT                   /note="PFAM: Conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66539"
FT                   /db_xref="GOA:A5V2M3"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2M3"
FT                   /protein_id="ABQ66539.1"
FT                   /translation="MNPFRRPSSRFGREPKPETPYQRAQQAWDDRIGSARAQAYSWRLM
FT                   AFGAIAVLGLSAADNLRLRYGTKVVPYVVEVDRLGAARAVAPLEAGYRPTDPQIAWHLA
FT                   RFIENVRARPADPIVLRQNLSAAYDFTTEQGAASLNDYARANDPFASLADTQVGVDIRN
FT                   VVRASADSFRIAWDERRYVRGQLATTTRWSAVLTIVVRTPTDAPTLSRNPLGLYVHALN
FT                   WSQDLGD"
FT   gene            161296..162132
FT                   /locus_tag="Swit_0169"
FT   CDS_pept        161296..162132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0169"
FT                   /product="P-type conjugative transfer protein TrbG"
FT                   /note="TIGRFAM: P-type conjugative transfer protein TrbG;
FT                   PFAM: Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66540"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2M4"
FT                   /protein_id="ABQ66540.1"
FT                   /translation="MRTLLLATTMLLPAAAAAQAPERGTRPVAAATDAARIAPREAGWQ
FT                   GATQLFAYAPGGLYQVYAAVGRVTDIVLQEGESLSDTGAVAAGDTVRWVIGEAASGTGP
FT                   TRRVHILVKPTDPGLITNLVINTDRRTYHVELRSTPSTYMASVGWSYPQDELIAIEARQ
FT                   RAAEQVAATRVQAGIEAASLDFAYRLRGANPPWRPTQVFDDGAKTYILFPETIAQSELP
FT                   PLFLIGERNQAELVNYRFSGRYMIVDRLFERAEFRLGTRRQEIVRIERTRARERQQ"
FT   sig_peptide     161296..161352
FT                   /locus_tag="Swit_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.915 at
FT                   residue 19"
FT   gene            162132..163319
FT                   /locus_tag="Swit_0170"
FT   CDS_pept        162132..163319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0170"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66541"
FT                   /db_xref="GOA:A5V2M5"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2M5"
FT                   /protein_id="ABQ66541.1"
FT                   /translation="MDHRHDPSDPAQPRAPLSTRATPPRPRRLSRKAIALLSGAGAFAV
FT                   AGALAYSLSGTSGQRGPQETVSVERRQAELLSDAPRDYSELAERSAEGMGPPAPMTPDP
FT                   EPTFGGTESGAAPSTTEADQAEQRRRQQAESARGSRLFAGAGEGRGPPQAANATPTEPA
FT                   PAPPAEGTSRAGAPLDRRAAFVAGGTPEPTTNSGRLTPPPGRHVVTAGSTIAAALITGL
FT                   SSDLAGQVVAQVTEDVFDSVTGRTKLIPQGTRLLGVYDSNVSTGQSRALVVWTRMILPD
FT                   GRSIGLDRLVGTDAAGQSGFADRVNNHWGTILRAGLLSTLLGVGTQASGFGQNDAIADA
FT                   IRDSAGQTVGRAGDRIVERQLGIQPTISVRPGARVRVLVSRDLILEPWPGRDAGG"
FT   sig_peptide     162132..162284
FT                   /locus_tag="Swit_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.710) with cleavage site probability 0.652 at
FT                   residue 51"
FT   gene            complement(163326..163589)
FT                   /locus_tag="Swit_0171"
FT   CDS_pept        complement(163326..163589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66542"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2M6"
FT                   /protein_id="ABQ66542.1"
FT                   /translation="MPRGVYSLQRICYALLLSDDKRIARDPSMTQRTASDVRDRAEARR
FT                   LIEIARAKLMGKSEEMAALYLDHALSELREIERRAPLAPSQV"
FT   gene            163608..163835
FT                   /locus_tag="Swit_0172"
FT   CDS_pept        163608..163835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0172"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66543"
FT                   /db_xref="GOA:A5V2M7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2M7"
FT                   /protein_id="ABQ66543.1"
FT                   /translation="MDIRKLVGGNVARLRKKTGLKQEPFSEAAGISQSYLSQIENGHVN
FT                   LTLLGVNDLAQALGVPPIELFRELSEMNPD"
FT   gene            complement(163859..164815)
FT                   /locus_tag="Swit_0173"
FT   CDS_pept        complement(163859..164815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0173"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66544"
FT                   /db_xref="GOA:A5V2M8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2M8"
FT                   /protein_id="ABQ66544.1"
FT                   /translation="MPLAPEPRRLSRPRPSRRPEFNQLEMFLEVADARSFSGAARGTGR
FT                   TQPAVSRAIGRLENLCGGDLFQRRPGAPLILTPIGEAILPTARLLLHTVDQMLLRATQT
FT                   AQSRAGTLKLGLYPGLAAGPLRAALTDFTRASPDVQLRLIEGIQSELHRQLMDGGIDLM
FT                   IAALMTDLASTVLTQEALWEEQLVVALPEDHPLAAKPALDWGDVASLRVILWTSPGGSA
FT                   DGGVLYEIGGRAIECERHAVSRTTLLEMVAMGLGATIACESAVALCTGVIYRPIEDENA
FT                   LAVIEAIWPTSDGNPLRHRLLTDIRRCAASRAMSAPA"
FT   gene            complement(165032..165517)
FT                   /locus_tag="Swit_0174"
FT   CDS_pept        complement(165032..165517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66545"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2M9"
FT                   /protein_id="ABQ66545.1"
FT                   /translation="MHGQDQFIEDVYAREVVMARVGHLIRRKQQEIERITRIVRAAASF
FT                   EGVAAPVSGKILKIVLIGPYARRTWYEDKASLYFSDYEFWVIVNHTLYADDTRWCRAKA
FT                   IIARELGNRCAVSLSVFSKADIKSAKASKDHFILDRLEAGIVLFKASRDAPLPHPIT"
FT   gene            complement(165609..166373)
FT                   /locus_tag="Swit_0175"
FT   CDS_pept        complement(165609..166373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0175"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; Autoinducer-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66546"
FT                   /db_xref="GOA:A5V2N0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2N0"
FT                   /protein_id="ABQ66546.1"
FT                   /translation="MLMVQAIDTAQLRDFEEVHKACEAAESSAQLSEVIAGAIQQFGFR
FT                   WFALVDDGDLYKHRSGCMMLTNYPSSWVDEVISARLYRDDPVHAASIRSPTGLCWDRIP
FT                   DVIAPTRAQLSVLERGRAHGLTTGYTVPFRIPGERGAFFSIARPKDRSFTYSEAISAQL
FT                   LGGIAFEAGRALVKGRAVKAHGAPLTPRQIDCLRLIAAGKTEWEMGKILGLSPSTIHEY
FT                   VEAARRRYGVKTRSQLVLAAARDGYVSLNYLT"
FT   gene            complement(166438..167058)
FT                   /locus_tag="Swit_0176"
FT   CDS_pept        complement(166438..167058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0176"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66547"
FT                   /db_xref="GOA:A5V2N1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2N1"
FT                   /protein_id="ABQ66547.1"
FT                   /translation="MPPEIADGAIWSVIMVPSPSQPAPSADDTARPLSSENGPTPSLIG
FT                   LAELHRVHSARLLRFFARHGARQDAADLVQESFARLAGARAKKPDMALERPAAYLSTIA
FT                   SNLLRDRARIAACRSTAHHIPVDEVPLAGNDPIAALEARDQLERVQATLARLSPKTRSV
FT                   FLAHRRDGISYKDIANREGLSEKAVQRRMSKAIAHIKRAGRVY"
FT   gene            complement(167308..169044)
FT                   /locus_tag="Swit_0177"
FT   CDS_pept        complement(167308..169044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0177"
FT                   /product="Type IV secretory pathway VirD4 components-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66548"
FT                   /db_xref="GOA:A5V2N2"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2N2"
FT                   /protein_id="ABQ66548.1"
FT                   /translation="MARPDMSGAARAPGPTPGVQPIAFVGGLIAIWVCWPLVRMHIPAE
FT                   SQFALIDLVHEHWEHRAELQPWLDRRWAWLALHNYHLWFAAAILPGTIAVGIVQGLDRR
FT                   SFLPLLLAPFGWLGGGLVGYLLYGSFRGDSWPLAVMMPATFAFLGGAVAARLAAPPRRV
FT                   RHLRGTKMRPAVSAWRGRLWARLTGGLTLAGVPLSREDETMHVAAIGATGSGKSTALHG
FT                   LMAGALRRGDRHIVADPEGAAMSAFFADGDILLDPFDARCARWDLLAEIESPSDYAFLA
FT                   SSLLPHLGTGDHDQWISYAQRLLADTMENFVTLELGSTSDYVALLGSARIAELKELCAG
FT                   TSSARYFEEGGERMLASILGTLAPAVAHLRLIAMASGEVFSLRRWIREGRGSLWMPYAA
FT                   NQVAAMRGLVSCWMNIAILETLSLPASRDRRIWFHIDELDALGRIEGLKDAQARLRKVG
FT                   GCVAIGFQSFAQVKHVYGEAAHTIVENCGNLLILRCGGGGDESTANLANELIGEREAER
FT                   DDLSRSQSRGRNASQSTSVQSRRSVDPAVLASEIMQLPNREGFVKRALDPRWQRVRFPF
FT                   RA"
FT   gene            complement(169044..171488)
FT                   /locus_tag="Swit_0178"
FT   CDS_pept        complement(169044..171488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0178"
FT                   /product="Ti-type conjugative transfer relaxase TraA"
FT                   /note="TIGRFAM: Ti-type conjugative transfer relaxase TraA;
FT                   PFAM: MobA/MobL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66549"
FT                   /db_xref="InterPro:IPR005053"
FT                   /db_xref="InterPro:IPR014136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2N3"
FT                   /protein_id="ABQ66549.1"
FT                   /translation="MAIYHFSAKVIGRGSGRSAVAAAAYRAAERLHDERLGRGHDFTNK
FT                   AGVVHSEIMLPDGAPERLRDRQTLWNEVEAGEKRKDAQLAREVEFAIPREMTKEQGVAL
FT                   ARDFVKAEFVTRGMVADLNVHWDVGADGEAKPHAHVMLTMREVGPDGFGAKVRDWNATA
FT                   LLQHWREAWAEHVNERCAALRIDARIDHRSYEAQGIGLEPQHKIGAAGARREAKGEDAE
FT                   RAEDHRTIARENGAAIVADPSIGLEAITRQQATFTMRDLAMFAHRHSDGKEQFDAVLSA
FT                   MRHHESVLALGRDGRGAERFTTANMLGCEEALVRNAERLAHARDHVVSKLDIACAVGIN
FT                   EARGLRLGAEQRRALDHVLCKPGLALVVGYAGAGKSAMLGVAREAWERAGHRVRGGALS
FT                   GIAAENLEAGSGIASRTLASLEHGWAGGHDSLTKGDVLVIDEAGMVGTRQLQRVLSQAA
FT                   DAGAKVVMVGDVQQLQAIEAGAAFRLLAERHGAAEIGEVRRQSVEWMREATRAFATGRT
FT                   GDALDAYTDAGMVHAAESRQAAREALIDRWDAERRAAPAASRMILTHLNAEVRMLNDAA
FT                   RERRAAEDELGDDVAVRTERGLRQFADNDRVLFLRNERELGVKNGTLGTIEKASADRLE
FT                   VRLDDGRRIEVDLKSYGHLDHGYAATVHKTQGMTLDRTHVLATPGLDAHSAYVALSRHR
FT                   EATALHYGRDDFADEEKLKRTLARERPKEMALDYGQDGRTRPAAGTEAAKSARAAAQEQ
FT                   SANPAQSERANRLRTMVAARAAEPRRTAEAMREALAKIANAAKDVGRSRARGRDRDYGA
FT                   ER"
FT   gene            171641..171967
FT                   /locus_tag="Swit_0179"
FT   CDS_pept        171641..171967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66550"
FT                   /db_xref="GOA:A5V2N4"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2N4"
FT                   /protein_id="ABQ66550.1"
FT                   /translation="MRKVRDFDAELKALNERAKLLRQRKIQQFGELVEATGADALDPDL
FT                   LAGALLAAVAEKDKAIMTAWSTRGGQFFHETSRKSSRRARGSTEDGKAADAGAQSARGG
FT                   AGAA"
FT   gene            171984..172247
FT                   /locus_tag="Swit_0180"
FT   CDS_pept        171984..172247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0180"
FT                   /product="Conjugal transfer TraD family protein"
FT                   /note="PFAM: Conjugal transfer TraD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66551"
FT                   /db_xref="GOA:A5V2N5"
FT                   /db_xref="InterPro:IPR009444"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2N5"
FT                   /protein_id="ABQ66551.1"
FT                   /translation="MARRERTRHLIELGGLVQKAGLVGIADDDRAMLYGAFLDLAARMR
FT                   GEDGASLRALLRRRGARAFATEAEEEKAARAAAVVRKVLDRQ"
FT   gene            complement(172259..172963)
FT                   /locus_tag="Swit_0181"
FT   CDS_pept        complement(172259..172963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0181"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66552"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2N6"
FT                   /protein_id="ABQ66552.1"
FT                   /translation="MKTPAALALGVIAAVVSAAPADAQSASPRGASACAVHAPEAASRA
FT                   RLPVDVVLRVMRAESAGNPRAVSHKGAMGCMQIMPGTWADLTRRHGLGRDPFDPRMNMI
FT                   GGALYLAEMVARFGLPGAYSAYNAGPGRYQRHIANDVPLPRETIAYTARVTGAAPSRGA
FT                   VPAAPRWQDAGLFMAQSDVPRSSPARVGNDGDRTAHSRHDATAHSSGVLFPLAGPVRDA
FT                   SEPGRAGIGTEP"
FT   sig_peptide     complement(172892..172963)
FT                   /locus_tag="Swit_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.951 at
FT                   residue 24"
FT   gene            complement(172960..173403)
FT                   /locus_tag="Swit_0182"
FT   CDS_pept        complement(172960..173403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0182"
FT                   /product="Type IV secretory pathway protease TraF-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66553"
FT                   /db_xref="GOA:A5V2N7"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2N7"
FT                   /protein_id="ABQ66553.1"
FT                   /translation="MHRPPLRLVWNVSPSVPVGLYRIDSAGDPRPGDLVALRPSPDLTR
FT                   LMAERHYVEAGALLLKPIAAGAGATVCRNGAVVTIDGVSVATARERDRLGRPLPRWSGC
FT                   RLLNASELFLLATESPDSFDGRYFGPAARSNVVGRAMPLWTRP"
FT   gene            complement(173517..174275)
FT                   /locus_tag="Swit_0183"
FT   CDS_pept        complement(173517..174275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66554"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2N8"
FT                   /protein_id="ABQ66554.1"
FT                   /translation="MPIGISPIAPRPRRGCAGRSGSASHCGHGPTATPIAWPRCSTFTI
FT                   ARRTAFRCATSRPSCSRRCPTTGARAPSARTCGASPTRPPSWSRAVIAPCSRRAATPKA
FT                   DRLIAPRIRRRSAPRLWSQPAPLYSGHPLTPSSADHVPGRAVRPLGGAATSFIARTIMA
FT                   DIIKDTRYLRTKEAAHYVGLSARTLEKHRTYGTGPAYRKIGGRVIYSIEDLRAWCDRGA
FT                   CASTSDPNNGKVLPAIRQPDGGADDEDGRA"
FT   gene            complement(174539..174802)
FT                   /locus_tag="Swit_0184"
FT   CDS_pept        complement(174539..174802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66555"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2N9"
FT                   /protein_id="ABQ66555.1"
FT                   /translation="MPGYHKLLLPESYRTLLDLDASGFAWEWLRRNPEFRALWDRTGED
FT                   ARRTSARALIAGRRITHMVTRLGPHPLERRTAPWGLTFLAGA"
FT   gene            complement(175047..175598)
FT                   /locus_tag="Swit_0185"
FT   CDS_pept        complement(175047..175598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0185"
FT                   /product="protein of unknown function DUF736"
FT                   /note="PFAM: protein of unknown function DUF736"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66556"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2P0"
FT                   /protein_id="ABQ66556.1"
FT                   /translation="MTASGFASAAHGRNGLRQRFFPLRLRRIPRGAKKRTRRRPPRMLR
FT                   AFGCVRGSPGPSQAIEAALGRARGSQGDFIMATIGNFKKTANDEFVGEIVTLSVQAKGV
FT                   RIVPDSNPASENAPSHRVMVGRAEIGAAWTKRSNEGRDYLGLKLDDPSFTAPIYANLFD
FT                   DEDGETFNLIWSRPSRRNGD"
FT   gene            176196..177875
FT                   /locus_tag="Swit_0186"
FT   CDS_pept        176196..177875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0186"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66557"
FT                   /db_xref="GOA:A5V2P1"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2P1"
FT                   /protein_id="ABQ66557.1"
FT                   /translation="MSDNSPQTLVPAAQYLRMSKEHQRYSIRNQARAISTYAEQHGFKI
FT                   TKTYTDPGESGLTLRERPGLQALLADVIKPSRPFERILVLDVSRWGRFQNLDQSGHYEF
FT                   ICFEAGVPVIYCAEPFDNDGTPVMALLKQIKRLQAAEYSRELSSKVLYAQLLQAKIGHK
FT                   LGGPRRFGFERVLVDEDDQPIQKLERGQAKALNNQRVVYAIGPSDEVKVIRDIFTWYTR
FT                   DRMSIQKIAERLTDSDAPTGDHPTWSYSRVRRILADELVLGIYVFNRTTQRLKSKPRKN
FT                   PPEALVKTKVTEPIISRVQFESAARRLRIRRHNVPPEENLAAVSRLLRTKGYLTGKLID
FT                   QCLYTPCSSVLLRQFGSLHRVYELVGYKPEGWWHPRKGIKPASKDELLTRLRALHERLG
FT                   YVNEHVINSDSTVPSVSVFQRHFGKLTDAYRLAGIPHGRTELQRLGHERLKASRAGEPP
FT                   RKITTPRWPELASRFTDEDLLACLRRLHEQHGFVTARIIREDENSPTPMLFTARFGSLL
FT                   NAYACAGIENRRFDIWSRAGKARAAARRARKLAIELQPPGRK"
FT   gene            complement(177968..178366)
FT                   /locus_tag="Swit_0187"
FT   CDS_pept        complement(177968..178366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66558"
FT                   /db_xref="GOA:A5V2P2"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2P2"
FT                   /protein_id="ABQ66558.1"
FT                   /translation="MIAILLPLALLGIGFLLYLILAGATYALPLFVGLAAGLAGFGAGL
FT                   SIAAALLVGIIAFALAIAVGRFMALTLPKHGRFGVALAFAVPAAVAGYSVGRMIAALTG
FT                   FAGFAFVVALGTAAICAAVAVQRVHRPA"
FT   sig_peptide     complement(178283..178366)
FT                   /locus_tag="Swit_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.971) with cleavage site probability 0.815 at
FT                   residue 28"
FT   gene            178990..179478
FT                   /locus_tag="Swit_0188"
FT   CDS_pept        178990..179478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0188"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66559"
FT                   /db_xref="GOA:A5V2P3"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2P3"
FT                   /protein_id="ABQ66559.1"
FT                   /translation="MPEEEKGANSHLELATELTIAWLANPNTRATKEEVPEFLKSMHEA
FT                   VASLSSDASADAEPSAAAPEHVPAVSVRKSLASKDHIISMIDGKPYKTLRRHLSTHNLT
FT                   PEEYRERYGLKADYPMVAPSYSEHRREMAKRIGLGRKPGQKAPPRKAGGRRKAAPAAT"
FT   gene            179510..179989
FT                   /locus_tag="Swit_0189"
FT   CDS_pept        179510..179989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66560"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2P4"
FT                   /protein_id="ABQ66560.1"
FT                   /translation="MPDYRAVMSDQDFEALIDAAPFATGSARVAYEVPSDADVVVKKSK
FT                   GAFAAANLIEWFVWRSAETQNALQAVLGRCLAISESGAYLMMERLDDITKDDYADVPDV
FT                   PTWFNDPKPNAFGKRNGAIKIRDYGLGRMERLVVPDLTFPPAFAVNARTARRFGR"
FT   gene            complement(180004..180912)
FT                   /locus_tag="Swit_0190"
FT   CDS_pept        complement(180004..180912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66561"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2P5"
FT                   /protein_id="ABQ66561.1"
FT                   /translation="MDPQDEDGALSQTAHLLDEIALYGYRPFEDEPDPRPLPEPRQAAG
FT                   AIADMFDAMVATLQDTRLEPDLEDLLWAFGNVFHRAAERIERQLDDNEVAQRRSVRAQD
FT                   GSEVKSVELETLLREGSTLIERRDAMEFFREASAEQFRLHLGRAWTPRSGSLVNRKALT
FT                   AAMVDSREFIAARKRADNQVLIPAGTRIAITGGADYQDHRRIWDALDKVHAKHPDMILL
FT                   HGGTPTGAEHIAECWARSRKVATIAFRPDWNRHHKAAPFKRNDALLAELPVGVLAFPGS
FT                   GINANLADKAHKMGIPVWRFD"
FT   gene            complement(181212..182258)
FT                   /locus_tag="Swit_0191"
FT   CDS_pept        complement(181212..182258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66562"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2P6"
FT                   /protein_id="ABQ66562.1"
FT                   /translation="MSSAASDLSRKLARNAEDVCRHYLRAGRRVGNYWIVGDALGSPGR
FT                   SLYVRLDGPEYGKGAAGKWTDAATGEHGDLLDLIGLNRGHVGFTETLDEARSFLSVPKP
FT                   ALDYDPNEPRAPRGSCRAARRLFAASRPIAGTLAESYLRTRGITGVRTERWLRFHPRCW
FT                   YRADVDDAPGTPSSFPALVSAVTDNDGQITGVHRTWLNAATCKKADIVTPRRAMGDLLG
FT                   HGVRFGTAKPVMAAGEGLETILSLRMPLPALPMIACLSSTHLAAIVWPKPLRRLYVVRD
FT                   ADGAGTSAWGTLVERGAGNGIEILPLVPPTGIDFNDALLTLGREALAAAIKRQLVPDDA
FT                   DRFLMSAA"
FT   gene            complement(182319..184430)
FT                   /locus_tag="Swit_0192"
FT   CDS_pept        complement(182319..184430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0192"
FT                   /product="ParB family protein"
FT                   /note="PFAM: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66563"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2P7"
FT                   /protein_id="ABQ66563.1"
FT                   /translation="MTKHVKIALNGSIDIPFSQLVLSQANVRRVKAGVSIDALAADIAR
FT                   RGLLQSLTVRARRDEEGSETGLYEVPAGGRRFRALQLLVKQRKMTKAQPVPCILRDDDE
FT                   ISAEEDSLAENTHREALHPLDQFRAMQHLVGQGTDIETVAATFMVTPAVVKQRLRLASV
FT                   SPKLLDIYAEDGMTLDQLTAFSVTEDHARQEQVWEMVEGTYNAEPYYIRRKLTENTVHA
FT                   SDRRVRFVGLDAYTEAGGHVLRDLFDDDSGGWLEDVALLDRLVDEKLQAEGARIGEEGW
FT                   KWVAVAIDFPWNASQGLREIDGEQPALSEEDEARLVAFQQEADALEAEWAQSSDIPDEV
FT                   DARITEVDEEIAGIVERPLVYDPEEVARAGVFVSLDRNGSLYIERGFVRPEDEPPSEPD
FT                   ADVEVGENRMVEDEQQGAIVSVGGAPDTAADEETVDEAEDQLRPLPDRLVSELTAWRTI
FT                   ALQDAFARSPNVAFAAVLHAMALSVFYHASRESCLQLSLTKAIFSQSAPGTRTAPPTQA
FT                   IAERHNAWKARLPEDDAELWDALRKLCADEQADLFAHCAAYAVNAQWERVSPYDGRMSP
FT                   ATIERRIAHSHVLAHAVGLDMTASWQPTVASYLGQVTKARILEAVSEAKDPATASRIEK
FT                   LGKADMAREAEQLLAGTGWLPEPMRTPEPTASDVEPSTANDGEPAIDTIEPTSEDSADA
FT                   DEMLPVAAE"
FT   gene            complement(184862..186058)
FT                   /locus_tag="Swit_0193"
FT   CDS_pept        complement(184862..186058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66564"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2P8"
FT                   /protein_id="ABQ66564.1"
FT                   /translation="MATVLSQPDRPAAAAAYRVDISRGQRIGRVSSEWFSRPDDERYLS
FT                   LTELHAAVKARAERAATRTVETQEVRVEADRDNAERLALVIPGRDAPVAPTHWSFGQLC
FT                   SLVGAPSSYLRALPAPLAGINLQHGLLAHRAELVKTLETEDGRTELRAVTGPDYGRIWD
FT                   HELVAAAMQIAGNGTGDTRWKVPGVLDWSTMTHNPFVEVTKDTTTLYASDRDVFLFLVD
FT                   DAHPIEAGRLPNGDPDLYFRGFYCWNSEVGSKTLGVASFYLRAVCMNRNIWGAEGFEEI
FT                   SIRHSKFAANRFAHEAAPALERFATSSPAPFMAGIKQARAQIVARDDDDRQDFLRKRGF
FT                   SKGETEKIIATVLDEEGRPPASIFDFVQGITAVARAKPHQDARLALEARAGKMLAAAR"
FT   gene            complement(186280..186516)
FT                   /locus_tag="Swit_0194"
FT   CDS_pept        complement(186280..186516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66565"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2P9"
FT                   /protein_id="ABQ66565.1"
FT                   /translation="MADRYVTKHPKGWAVKAPGAERASSVHGTQREAERAAKQTVRNLG
FT                   GGEVRIQGRDARWRDSDTVAPGNDPNPPRDKKH"
FT   gene            186619..187482
FT                   /locus_tag="Swit_0195"
FT   CDS_pept        186619..187482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66566"
FT                   /db_xref="InterPro:IPR016634"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Q0"
FT                   /protein_id="ABQ66566.1"
FT                   /translation="MSWGVTQRLEFIEFRLFWEGSINRADIMGCFGVSTPQASKDLTLY
FT                   QERAPGNMEYDTRAKRYVAAEKFVLRFLDPDPYVYLTQLRSVAEGIVPAHDSWIAELPK
FT                   ADVALTPKRDIDMEVLRKILDAVRERASVDVFYQSMNKVRPEPIWRQITPHAFGYDGFR
FT                   WHVRAYCHLELKFKDFLLPRILEVGSKGKSGVAGDQDWLWNNYFDVLIGPHPDLTESQK
FT                   KVVAKDYGIDQGNGVLSIRYAMLFYVLKRLGLLDDASKRSARTQHIVTINRKETEAALE
FT                   KAEYQL"
FT   gene            187508..191011
FT                   /locus_tag="Swit_0196"
FT   CDS_pept        187508..191011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0196"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   type III restriction enzyme, res subunit; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66567"
FT                   /db_xref="GOA:A5V2Q1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Q1"
FT                   /protein_id="ABQ66567.1"
FT                   /translation="MGARLEDIKNGASVRGIGSAQPVQVVSVDWIGDQAINVVYRDHNG
FT                   VVAEAVLYRDDEHQLAVEQAGRPWSFDADGALLRLVTEANRIKLAHYFDPYLAIHTSLV
FT                   DPLPHQISAVYGEMLPRQPLRFLLADDPGAGKTIMAGLLMKELIARSDLERCLVVAPGS
FT                   LVEQWQDELGQKFNLEFDILTRDMIETSRSGNPFSDRDRLIVRLDVLARNEELQEKLMS
FT                   AREWDLIICDEAHRMSATYFGGEVKYTRRYQVGQKLGQVCRHLLLMSATPHNGKEEDFQ
FT                   LFMALLDGDRFEGRFRDGVHYADTADMMRRLTKEELLKFDGRPLFPERRAYTVKYELSE
FT                   GEAALYTAVTDYVRTEMNRVQRFAEGDGKKRNNVGFALQILQRRLASSPAAIYQSLKRR
FT                   RERLENELGEARLATRGRRTGIDEPSVGPDVLRNIEEYGQDEIDELEELISTGATTAET
FT                   VEQLALEVETLKGLEAMALGVLRSGVDTKWSQLNRILDDDLMVDAAGNRRKLIIFTEPK
FT                   DTLHYLLDKVRARLGNAEAVDVIHGGVSREERRKVIERFMQDKDLLVLIANDAAGEGVN
FT                   LQRGHLMVNYDLPWNPNKLEQRFGRIHRIGQTEVCHLWNLVAADTREGEVYARLLEKLE
FT                   AAREALGGRVYDVLGELFEGIALKDLLFQAIQYGEQDEVKARLFRQVDGAVDQGHLLEL
FT                   LRRRALTNDTMPEAKVEELRLEMERAEALRLQPHHIQSFFVEAFQHLGGRLKRREEGRW
FT                   EITHVPVRIRERDRQIGTGAPLQKQYERICFEKGLIHQQPVAAFVCPGHPLLEAVISLI
FT                   REQYEQIMRQGAILVDDTDAGDALSAIFLLEHIVQDGRATSAGKPHVISQRLQFAAIDK
FT                   AGDARNAGIAPHLNLRPATAEEAGVVRDLLDEDWLTSELERTAIRFATVELAQGHVAEV
FT                   KARRLPEIEKVEQEVRARLKKEINYWDSRAFELKEEEKAGKKTRLNWQNAQRRAEELAE
FT                   RQKRRMDQLERERFISSQPPRVRGGMVVIPRGLLEARHSPAVANRFAEDPAARRAIELA
FT                   AMEAVMAAERALGHAPVDVSAQKIGYDIASHDPKSGHLRFIEVKGRIDGADSVMITRQE
FT                   VITSLHEPEKFILAIVPVASGFAHEPHYVRGALVEREPSFLETAIQFDLRRLLARAESP
FT                   R"
FT   gene            191049..195293
FT                   /locus_tag="Swit_0197"
FT   CDS_pept        191049..195293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66568"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Q2"
FT                   /protein_id="ABQ66568.1"
FT                   /translation="MSAKRQSVAASASPPVFFEAIRTRAAQRWDQLEADPELAGPWHQL
FT                   FKQVQSPRHILSELLQNADDAGASEAHVSIEGERFVFEHNGEDFIEAHFASICRFGYSN
FT                   KRALHTIGFRGIGFKSTFSLGDRVELYTPSLAVAFEKARFTEPHWIGGERLTVGSTRVE
FT                   VAIASDLRRREVEKNLDEWLKSPTSLLFFRNIRKLRIGEKTVHWQSMGAGPVPDSEWMA
FT                   LDDKDENPFLLMRSGEEAFPSDALEEIRQERMLGAEDGGEFPPCRIEIVLGAKGRLYVV
FT                   LPTGVETPLPFACNAPFIQDPARLKIKDPSISPTNRWLLECAGTLAAEAMAGWLRDAKT
FT                   GLEDRAGAYGLMPDVNREANDLEGACGAIVELAFDEAIGEAPILLTDEGKLVGGKAAII
FT                   MPSAIFDIWPAEQAMALLDEDARPALSRHVSRANRTKLQNWNLVEAFSKENLLERLAEV
FT                   HLPRPATWRHLLNLWTYIAPEVTGYGCTDPKALRIVPVQGQDVLFAASEVVRLGEKKLL
FT                   QSDEDWAFLSEHLVVVNQNWTRFLADQRRDKPDAKATREDPVQGAFDVLEEIGLDATSD
FT                   VSAVIERIAEAYFGAGQPKLADCVRIAQIAAKLGATIGASFRYAAADRKLRRTSQTVLF
FT                   DEDGTLDALLPKTIRETQLLHPDYVARFSSCSREEWLRWVGSGRSGLHTFVPLASTRFS
FT                   VYGRSRIAAEAKARGQNGPLHYPYVTDNFVVEDWDFAADYWKHWQAVSGSDPSIWAKVA
FT                   GNILAQRESYWSRASSARLLQVATTGSTRAVSWETLVAGWVLKLRDKPCLPDTRDVAQL
FT                   PADLLRRTPETESFIDVEPFVHGLLDREATRPLLDILGVRRTPSGPGQLLKRLRALAGS
FT                   ARAPAHEVEKWYRRLDTMLESCSTADAVSVKDAFKTERLILAQDGSWVTAGSVFIHGDE
FT                   EDVPGAALIRASVADLTLWHRVDVADRPSADLALQWLGSLASGSSLSPDDARRVRALLV
FT                   KYPVRIWQECGHWMNLLGEWAAIDTLDYALSMQGLVRWSHLHDWVKRKTADLQRLSGEI
FT                   AREAPFTGLAALSDKIEERFDQPSFPAGFEDKRAWLSAFGRQLQRIELDDPAETERVRA
FT                   VAVDIADTAWVTAPRLEVIPYLDGTPAGTGRPADLVWLDRTLFVTPLSKAKLAKRVPEE
FT                   IGKSLSPDVRSALAYAFERSADDIRDYLEENFRLAPEDSTYEPADTPSADAAPESSTNS
FT                   PPAEDSRPDDETIEPEDDAVLLNADDADADAPASSAEPSDDAPSDDLMDEPASPSRPRA
FT                   APKPRQPGVMARFALAQGFKADGEDRFFHSDGSWIARANGAKFPWERRSASGEVLRHYY
FT                   PKEHCLEREPLQVEADVWGLLDQKADIYSFILVNPEGEPVEMTGSRLCALRDGGEITIH
FT                   PATYRLVYDLDE"
FT   gene            195277..198078
FT                   /locus_tag="Swit_0198"
FT   CDS_pept        195277..198078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0198"
FT                   /product="protein of unknown function DUF1156"
FT                   /note="PFAM: protein of unknown function DUF1156"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66569"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Q3"
FT                   /protein_id="ABQ66569.1"
FT                   /translation="MTSTNNPKKKLIEVAIPLEAINGASAREKSIRHGHPSTLHLWWAR
FT                   RPLAACRAVLFAQLVDDPSSHPDLFPTHEAQEIERKRLFGIIEDLVIWENSTNEEVLDR
FT                   AKAEIRKSCGGELPPVYDPFSGGGSIPLEAQRLGLPAYGSDLNPVAVMIGKSMIEFPPR
FT                   FKDKPAIHPGVKERQFYRNAEGLAEDVKYYGGWMRDKARERIGHLYPQIDLPKEYGRGK
FT                   ATVIAWIWARTVPSPDPAFGNVQVPIAASFLLNSKSGQEAWIEPIVDRNAKAITYRIRH
FT                   GGAKSEIAAAKQGTKAGRGANFRCLMSDTAITPEYVKQMGRDGRMGQTLIAVVAEGNRS
FT                   RSYVAPTEDQEAIAFSAKPDWKPETSLPNDPRNFWTVDYGLTTFGDLFTDRQLVALNTF
FT                   SDLVHEARAQIETDALAAGLSSDPTPLREGGANAKAYAEAVSLYLAFAIDRMADAGSSI
FT                   ATWASGGFIRFTFARQSIPMTWDFAECNFFSDSTGNFGGAVEWIVRAISEFQPRNNGSL
FT                   RQQDAQQVVLPDIAAISTDPPYYDNIAYADLSDFFYVWLRRATKDVFPDLTAVLAVPKS
FT                   EELVATPYRHGGRTGAELFFLNGMTQAIASLARQASSEFPATIYYAFKQSEVEKEGLSS
FT                   TGWATFLQAVIDAGYAIVGTWPVRTERSARTIASGTNALANSVVLVCRKKEAAAEVVTR
FT                   AEFIRAMKRELPAAIAELQAANIAPADMPQSAIGPGMGVFSRYKAVLGSDDTPMSVKGA
FT                   LQLINKELDEYLGGIQGEFDADTRFAITWFEQYGLGKGDYGTADNLARARGISVESVKH
FT                   AGIVDSAAGKVRILARDELDDGWEPESDGHLTVWECLQHLVRRHEKDGTSHHTAVLLKK
FT                   IEAMAEAVKDLAYCLYDISSNKRKDAKEGNPYNALIADWTELTRQAATIHDTSGDRQAR
FT                   LDI"
FT   gene            198092..201388
FT                   /locus_tag="Swit_0199"
FT   CDS_pept        198092..201388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0199"
FT                   /product="ATPase (AAA+ superfamily)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66570"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="InterPro:IPR041650"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Q4"
FT                   /protein_id="ABQ66570.1"
FT                   /translation="MAKSTRQYVFEGMELLPTALIPFVEKRLENSLKGHWQLEVVQRVQ
FT                   GLKPNSAGDVGWDQQGLLKTMMAFWKDAFATVLGHPERSYVSELLDVRNRLSHNENFTY
FT                   DDAERALDTMRRMMEAISAGETAEQLSKMRDTILRTKFTELQRNEERRKTQRLEISVET
FT                   VAGLLPWREVVEPHQDVATGEFQQAEFAADLAKVHSGSAPAEYRDPKQFFSRTYLTEGL
FT                   SALLVGAAKRLSGTGGDPVVELQTNFGGGKTHSMLALYHMAGTTPVQDLSGLDRLLDEH
FT                   GLSVPKTINRAVLVGTSRGPQDVLNTEDGRKIRTTWGDLAWQLGGAEAFDMIAENDANG
FT                   IAPGSNVLEAIFKKFAPCLILIDEWVAYLRQIYKVEGLPSGSFDANLSFVQSLTEAVKA
FT                   SPGTLLVASLPASQIEVGGEGGVEALARLKQTFSRVESSWRPASQEESYEIVRRRLFKE
FT                   IPGDKFHHRDNTLKQFAKLYRDNANDFPQGCADEDYRRKLEKAYPIHPELFDQLYTSWG
FT                   SLEKFQRTRGVLRLMAQAIHELWMSADPSVMIMPGSVAVSSPRVEPELLHYLDLTWQSI
FT                   IAGDVDGTASTPYRIDQSAPNLNRYSATRRVARAIFMGTAPTHQQQNTGLDDKQINLGV
FT                   VQPGERPAIFGDALRRLTNQAKFMHADLGRYWYSMSASLNRIATDRAAQIENALVMMTI
FT                   DNELTKYVNGLADHGHFDAVQAAPSSSAEVPDEAGGVRAVVLGVAHPHHGRDGSEALVE
FT                   AKDILTQRGSTPRVYRNMLVFISADARQLDNLKDAVRGALAWGEIVRDKDRLNLPPSDQ
FT                   RLAETKLAEARETMKTRLKEAWCYLHYPAQESAQADVEWVSGKIPAQDGLLARASKKLL
FT                   AEEGLLTELGPTRLDRDLQKYIWNGKPHLSLKDLREYLNRYIYLPRLKNEQVLVKAVQA
FT                   AVTGMLPGPFAYAERWDEKTDAYLGLAIEQAVSAIVVIDSDSVIVRPDVAEVRRPAPAP
FT                   PGPAGGPEEPGDKSSETGERPTGGVPEQPTAEKRPTRFTGTVMISAERPARDMHQIVEA
FT                   IVEQLTTLPGGHVKLRLEIDAEIPSGLDRAKVRTLVENATTLGFIEKSVE"
FT   gene            201457..202764
FT                   /locus_tag="Swit_0200"
FT   CDS_pept        201457..202764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66571"
FT                   /db_xref="GOA:A5V2Q5"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Q5"
FT                   /protein_id="ABQ66571.1"
FT                   /translation="MLWLAPRLEAAGYKVFADIFDLDAGDEWRGKLTAALQTRAVKMLL
FT                   CCSDETLARRGVLEEIAIAEDLTKQLPDSNFIIPLKIRAFKKVFGIGGLQYVDFESGWA
FT                   KGLANLLKSLEKQQVPKAGGGVIQPEWYAYLRRHAVEIEGAPEVLTSNWLRIMRMPDKL
FT                   NHLVPRNRANEAVLRKLGASFEFPMAEFGDGFLTFASPPDLEEYFEQVGPFRTERDFDI
FT                   LGFLENGSADAGIEGRDAKSIMVNLFRQAWEKHCVRQGFLAHTFSNGLSFHVGEEKFGL
FT                   KKRMSWGRQGERRSSMLRGVARKKIWEYGVSVVPSLFPYPHMRLKGRVLFSDIGDRNKA
FT                   IVIPDTKTQFRLRRSVCSSWRNKAWHGRVMAFMELLAGDSPYVDLAVGSGGSITLDAMP
FT                   IQFTAPVTARQTNRLGEDAEDPDTSTLGGHFEDEDA"
FT   gene            202761..204317
FT                   /locus_tag="Swit_0201"
FT   CDS_pept        202761..204317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66572"
FT                   /db_xref="GOA:A5V2Q6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Q6"
FT                   /protein_id="ABQ66572.1"
FT                   /translation="MIEFPEKSAPVLYIPEPPLGFGHGQTSDHPKDGLTLYGPASAPDR
FT                   PQITIGAVGTKHGLGFLRRWLEAINTPVAIPPRGKRDKEFRLHLSDFPGLEEAFGIRTD
FT                   PAALITYELETTEIEAAIAIENHHEAVAATTKLFIDPIDRHAKNEERTVDVWIFVVPEA
FT                   VFETCRPVAGQRRKVELVKGELSKRQKGRADLPLLAGIIDNTLEAVFDDIPDFHRQIKA
FT                   KLLKQGMTSQLIRETTLAPYEFVNKAGYPKRGTQDSATVAWNLATGLFYKTQAEPPWKI
FT                   AGMRPGVCYVGLVFKLLPNHPDNHACCAAQMFLSEGDGVVFRGANGPWQTENREFHLND
FT                   LAAGKLIKTVLDTYKQRFGAYPKELFIHGRTKFNDAEWDAFSKAAPDSTNIVGVRIQST
FT                   HGETKFFRDGDYPCLRGTAIRLGDKDAFLWTTGYAPRIDTYIGPETPNPLFVTVLRASG
FT                   EFPAVEVVLTDILGLTKINYNACNFSDGLPVTIRFADKVGEVLTMGSAAGAERQPFKFY
FT                   I"
FT   gene            complement(204481..204557)
FT                   /locus_tag="Swit_R0005"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(204481..204557)
FT                   /locus_tag="Swit_R0005"
FT                   /product="tRNA-Arg"
FT   gene            complement(204785..205171)
FT                   /locus_tag="Swit_0202"
FT   CDS_pept        complement(204785..205171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66573"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Q7"
FT                   /protein_id="ABQ66573.1"
FT                   /translation="MSRMSAGAAALMLAAIGMTADARPLKPEQEAKIKPAGPAENCIQL
FT                   RSIRNTRVRDDRTIDFYMNGGKVYRNVLPQSCPGLGFEERFAYATSLSQLCSVDIITVL
FT                   NSSPVPQGASCGLGKFQPITGAPK"
FT   sig_peptide     complement(205103..205171)
FT                   /locus_tag="Swit_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.944 at
FT                   residue 23"
FT   gene            complement(205257..205913)
FT                   /locus_tag="Swit_0203"
FT   CDS_pept        complement(205257..205913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0203"
FT                   /product="endonuclease III / DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /EC_number="3.2.2.-"
FT                   /note="TIGRFAM: endonuclease III; PFAM: helix-hairpin-helix
FT                   motif; HhH-GPD family protein; SMART: iron-sulfur cluster
FT                   loop"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66574"
FT                   /db_xref="GOA:A5V2Q8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Q8"
FT                   /protein_id="ABQ66574.1"
FT                   /translation="MKKADIFEFYRRLAEDDPAPETELNYVNPYTLLVAVALSAQATDV
FT                   GVNKATGPLFARVTTPQQMLELGEEGLKRHIKTIGLFNTKAKNVIAAAHILVDKYGGEV
FT                   PQSREALEELPGVGRKTANVVMNTAFGAETIAVDTHIFRVANRTGLAPGKNVLQVELKL
FT                   EKVTPKPFLQGAHHWLILHGRYICKARKPECWRCPVADLCAFKPKTPAPPPPRAA"
FT   gene            complement(205910..206668)
FT                   /locus_tag="Swit_0204"
FT   CDS_pept        complement(205910..206668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0204"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66575"
FT                   /db_xref="GOA:A5V2Q9"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Q9"
FT                   /protein_id="ABQ66575.1"
FT                   /translation="MTVIGILGANGRMGRAIATVAPELGAGLAGGVDQEGAVFGPHGDA
FT                   PALAAASDVLVDFSAPSALAGHLDAALAAKVALVVGTTGLQPEHHRLIDDAAARGLAVL
FT                   QSANTSLGVNILAHLVRETAARLGSDWDIEIVEMHHRHKVDAPSGTALLLGTAAAQGRN
FT                   ATPEALNRFDRIGHGNDRPREEGTIGYASLRGGSVAGDHMVVFATDNERIELGHRAENR
FT                   AIFARGAVKACLWMAGRPAGRYAMGDVLGL"
FT   gene            206797..207129
FT                   /locus_tag="Swit_0205"
FT   CDS_pept        206797..207129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0205"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66576"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2R0"
FT                   /protein_id="ABQ66576.1"
FT                   /translation="MVPSDWMFSLESALATLPEGPDGRFAYPIRHGSMRIGVYAPLGID
FT                   EQAPHEQDELYIIASGTGTFAKSGERRPFKPGDAIFVEAHALHRFEDFSDDFATWVIFW
FT                   GPKGGE"
FT   gene            207126..207680
FT                   /locus_tag="Swit_0206"
FT   CDS_pept        207126..207680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0206"
FT                   /product="secreted Zn-dependent protease-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66577"
FT                   /db_xref="GOA:A5V2R1"
FT                   /db_xref="InterPro:IPR010321"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2R1"
FT                   /protein_id="ABQ66577.1"
FT                   /translation="MILSLGLALTAATSAEVPASSPFAGMPNLTFRYYDVEGRTPAQIY
FT                   ASMRARAPQKGDGVAHTAWHIRVGWRQTRRGKTCEVADPITSLSITVVLPRLATTDGVT
FT                   PEGLAFWERTMHGLEIHEAGHARIAIDHRNDFVKAAAKANCGSIKDVAKRTQERIEDIQ
FT                   EEYDRRTRHGLTQIPRPGETP"
FT   sig_peptide     207126..207200
FT                   /locus_tag="Swit_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.903) with cleavage site probability 0.700 at
FT                   residue 25"
FT   gene            207677..208381
FT                   /locus_tag="Swit_0207"
FT   CDS_pept        207677..208381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0207"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66578"
FT                   /db_xref="GOA:A5V2R2"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2R2"
FT                   /protein_id="ABQ66578.1"
FT                   /translation="MTDIRNIVVLTGAGISAESGLNTFRGPGGLWEGHRVEDICTPEAL
FT                   ARNRALVLDFYDQRRAALATVAPNAGHVALARLDREWQGGLLIVTQNVDDLHERAGAER
FT                   MLHMHGELMSAFCEHCGHRQRFGGAMLDGTRCGGCGAADTLRPDIVFFGEMPYEMDRID
FT                   AALGAADLFVSIGTSGAVYPAAGYVQQARHAGIETLELNLEPSAGSYFFHETRLGPAGE
FT                   LVPAWVEEMLGK"
FT   gene            complement(208531..209424)
FT                   /locus_tag="Swit_0208"
FT   CDS_pept        complement(208531..209424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0208"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein, HSR1-related; KH,
FT                   type 2 domain protein; Miro domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66579"
FT                   /db_xref="GOA:A5V2R3"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2R3"
FT                   /protein_id="ABQ66579.1"
FT                   /translation="MTERCGFVAVVGAPNAGKSTLVNALVGQKVAIVSPKAQTTRTRLI
FT                   GVAIAGESQILLVDTPGIFAPRRRLDRAMVAAAWGGAQDADLIAFVIDAKTGITHRIGE
FT                   LLDTLAQRREPKLVVLNKVDICSKESLLELAVRLQEKLAPEAIFMVSAATGDGVADLRQ
FT                   TLADRVPEGPWHFPEEQVSDATDRMLAAEVTREQLYLQLHAELPYDSAIETEKYEERRD
FT                   GSVAIHQQILVARDTQRAIVLGKRGVRLKEIGSRARAELETLLERKVHLFLHVKVAEKW
FT                   GEDRGLYREIGLDWVD"
FT   gene            complement(209421..210125)
FT                   /locus_tag="Swit_0209"
FT   CDS_pept        complement(209421..210125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0209"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66580"
FT                   /db_xref="GOA:A5V2R4"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2R4"
FT                   /protein_id="ABQ66580.1"
FT                   /translation="MTQSPRSAKARAMNDTALRAWIADTLGHEPRDLALFERALTHGSY
FT                   GPNHYERLEFLGDRVLGLVAGAWLFELFPDEPEGKLSRRLNAIVSRETCADVGRAIGVA
FT                   THMKLGKQARDDGAVQSDNVLGDVVEALIGALYLEGGLDAAQAFVRRAWDDRATGQAQA
FT                   PKHPKSALQEWAAAHRCKPPVYTMGNRSGPHHAPRFTVTVAIPGRAEASAEGSSKQEAE
FT                   TAAAKALLEKLS"
FT   gene            210152..210328
FT                   /locus_tag="Swit_0210"
FT   CDS_pept        210152..210328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66581"
FT                   /db_xref="InterPro:IPR025227"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2R5"
FT                   /protein_id="ABQ66581.1"
FT                   /translation="MGDVVNLNKARKAKARSGAKVVAEANRAKFGRTKAEKDRDRIDKA
FT                   RADRLVDGAKLEE"
FT   gene            complement(210338..210616)
FT                   /locus_tag="Swit_0211"
FT   CDS_pept        complement(210338..210616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66582"
FT                   /db_xref="GOA:A5V2R6"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2R6"
FT                   /protein_id="ABQ66582.1"
FT                   /translation="MALFKHKPDADAAPFRERRVRGKVVAFSADIVAEHVPSPAHALQQ
FT                   MLAERTADGYILDPVARRRALIRFLGTALLLWGGSAVGLATMMMLAR"
FT   gene            complement(210675..211076)
FT                   /locus_tag="Swit_0212"
FT   CDS_pept        complement(210675..211076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0212"
FT                   /product="Flagellin-specific chaperone FliS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66583"
FT                   /db_xref="GOA:A5V2R7"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2R7"
FT                   /protein_id="ABQ66583.1"
FT                   /translation="MYMSHGYGSPMNGAKLRYQTVDVDSRVEGASPHRLIGILFEELMK
FT                   ALEIMTAAQRAGMTAKAIDRQARASNILLALETSLDYRNGGEIAVNLAKIYREARRLVR
FT                   LGGRDNQPELVDRARSYLAEIVEAWEAIG"
FT   gene            complement(211096..212727)
FT                   /locus_tag="Swit_0213"
FT   CDS_pept        complement(211096..212727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0213"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated 2 domain protein;
FT                   flagellin hook IN repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66584"
FT                   /db_xref="GOA:A5V2R8"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2R8"
FT                   /protein_id="ABQ66584.1"
FT                   /translation="MVTSVGSSILTALGASSIDTSSLVDQLATAAIANKTKALTDRETA
FT                   NTAKISDLANAVNSITTFSSSLSSLISGGSLFTQPTSSNSSIVNVSAVAGSRLSGLSST
FT                   IKVERIASAQTLTAAALPGAASPVGLGTMELTVGDKTKTITITSANNSLAGLAQAIKDS
FT                   GLGVTASIVTDSTGARLVVKGATGEANAFSLKVTSGTTGELDRFAFDPATYDPDAVTGL
FT                   TLQQQAQDAQIVVDGVTVNKASNSFSDVIPGVKIDLVSASPGTTVSIGSSQPVDSIKQA
FT                   VSDFVAAYNEMKATLTAMTGTEGSLRSDAGIRALVTKLGGLTSTRLTYASDGSPTTLAE
FT                   IGVSTNRDGTLSLDSAKLSSVMASNPAAVEAMFNPGQRSDNPLIQITNAVGQVKGGVYT
FT                   VTNATPGGSGSTAQATLDGGYTLPLGATGVQASFTSAAAGLSFDVLGPVASATITIDLG
FT                   LQGALDAIKNELTASSGQLTASQTRLDNEKKSISDDKDKLTARDTAYRAQLTAQYTRMQ
FT                   GALSAFSSTQSYLSQQIKLWTNDSSS"
FT   gene            complement(212954..214093)
FT                   /locus_tag="Swit_0214"
FT   CDS_pept        complement(212954..214093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0214"
FT                   /product="type III secretion exporter"
FT                   /note="PFAM: type III secretion exporter"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66585"
FT                   /db_xref="GOA:A5V2R9"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2R9"
FT                   /protein_id="ABQ66585.1"
FT                   /translation="MAEGPEDDEKTEAPTPKRRQDAAEKGDVLQSRELGTALVMVVGAG
FT                   WIAIAGPWAMAALKRMLSNALSFDAGAIENFDPLSAALAMVATVALPLLLLFALTLAAA
FT                   IAAPAMLGSLGFRWSALGFKANKLNPMAGLKRIFGMQGLIELGKSLLKILALGAVGYWL
FT                   LMDRIAAIVTMGQQDLRTALDSLGSTFVFAVLVMTLALAVVAGADVPMQMFQRGKRLRM
FT                   SKQEIKEESKQTEGSPELKAAIRQKQMAAAMGSARKAVVEATVVLTNPTHFAVALRYRP
FT                   GFDTAPVVLARGRGATAQAIRELATENSVPMLHYPQLTRAIYYTSRSGQVIREDLFIAV
FT                   AAILAFVFNLDRAMAEGIAQPEVDVPQGARFDEEGRRAG"
FT   gene            complement(214097..214879)
FT                   /locus_tag="Swit_0215"
FT   CDS_pept        complement(214097..214879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0215"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66586"
FT                   /db_xref="GOA:A5V2S0"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2S0"
FT                   /protein_id="ABQ66586.1"
FT                   /translation="MIPQGLAGIETQLWLWMIAMIRPGAAFIAAPVFGAPQVPMQLRAV
FT                   VALAIGIPALANTPFVMPVGGIVTIEGFLLVAGEILAGLALGFAVQIGFSAALVAGEVI
FT                   GNAMGLGFAGMMDPATGSPSPAVSQYLSLLATFLFLATGGHLQLAAIIVESYRALPPGE
FT                   AWLGARSIQGLALFGGDLFAAGLAIALPVGFALILVQLVMAMLARSAPQMNIFSVGLPA
FT                   TLMAGLVLLAIAAPVMADGITAAIQRGLAEARLLALGR"
FT   gene            complement(214890..215171)
FT                   /locus_tag="Swit_0216"
FT   CDS_pept        complement(214890..215171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0216"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliQ; PFAM:
FT                   export protein FliQ, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66587"
FT                   /db_xref="GOA:A5V2S1"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2S1"
FT                   /protein_id="ABQ66587.1"
FT                   /translation="MDSAGSPDYFIGIAQQAMWILALASAPILIPALVAGIILGMIQAA
FT                   TSINEQTLSFVPKLIVVGIALALFGGAILMLLADFTREIFARIPDMLR"
FT   gene            complement(215208..216044)
FT                   /locus_tag="Swit_0217"
FT   CDS_pept        complement(215208..216044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0217"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /EC_number="3.1.1.3"
FT                   /note="TIGRFAM: flagellar biosynthetic protein FliP; PFAM:
FT                   type III secretion system inner membrane P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66588"
FT                   /db_xref="GOA:A5V2S2"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2S2"
FT                   /protein_id="ABQ66588.1"
FT                   /translation="MNRLKLPCPSAETPCMTAPRRPTIRSILAVAALLLSAPLIADPAL
FT                   ASTAGPAQTGALDRAMTTIAGDGRPLSLSLQILVLMSLLTVLPSLVLMMSSFTRIIIVL
FT                   SLLRQALGLQQTPPNQVLVGLAMFLSLFVMRPSIDQINADAFKPYGAGQITIEEAITRS
FT                   GAVLHRFMVLQTRQTDLKLFADLAKAPKFARPADIPFSILLPAFVTSELKTAFQIGFLI
FT                   FLPFLIIDLVVASTLMSLGMMMLSPAIISMPFKLLLFVLVDGWALTMGSLAASFAT"
FT   sig_peptide     complement(215919..216044)
FT                   /locus_tag="Swit_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.872 at
FT                   residue 42"
FT   gene            complement(216147..218351)
FT                   /locus_tag="Swit_0218"
FT   CDS_pept        complement(216147..218351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0218"
FT                   /product="primosomal protein N'"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: helicase
FT                   domain protein; type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66589"
FT                   /db_xref="GOA:A5V2S3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2S3"
FT                   /protein_id="ABQ66589.1"
FT                   /translation="MRRPEAPPKHGRMARAHVLLLNPALGPLDYRADREHVVEPGSIVL
FT                   APLGPRQMVGVVWEEETLPSADQVGDNRLRPLLDVYDVPPLAAPLRRLIEWTSDYYLAP
FT                   PAAVLRMALPSSSALDGARTIVEYRATGERPGRMTPQREQALDRIGQRQGLIRELATIA
FT                   DVSEGVIRGLVKSGAIEAVTVSIDTPWDAPDPDHKAVELSDEQQLAAGMLAEAVAAKRF
FT                   QPFLLDGVTGSGKTEVYFEAVAEALRAGRQTLVLLPEIALTEPFLKRFEARFGHLPVAW
FT                   HSELRQSQRRRAWRGIVHGEAKVVVGARSALFLPYRDLGLIIVDEAHETSFKQEDGVLY
FT                   HARDVAVMRAKLEEIPIVLASATPAIETRQQATIGRYTELKLTARHGAAEMPEIEAIDL
FT                   LADPPPRGRWIAPTLVRALADRLEKKEQSLLFLNRRGYAPLTLCRTCGHRFQCPNCTAW
FT                   MVEHRLLGRLQCHHCGHSMAPPAECPECKDEDSLVACGPGVERIADEVAALFPDARVAI
FT                   ATSDTLSTPARAAEFVERMEAGDIDVVVGTQLVTKGYHFPELTLVGVIDADLGLSGGDL
FT                   RAAERSFQQIAQVAGRAGRGAKPGHVYIQTHAPKAPVIQALLSGDAQSFYTAETEARKI
FT                   AEAPPFGRYAAIIISAEKLEEAATTARLIGRTAPAIDGMHVYGPAPAPLAMLRGRHRQR
FT                   LLVHARRSLDVQQVIRDWLGPLQWPRGVRVAVDVDPYSFL"
FT   gene            218460..219113
FT                   /locus_tag="Swit_0219"
FT   CDS_pept        218460..219113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0219"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="TIGRFAM: putative transaldolase; PFAM:
FT                   Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66590"
FT                   /db_xref="GOA:A5V2S4"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V2S4"
FT                   /protein_id="ABQ66590.1"
FT                   /translation="MKFFVDTADTADIAEMAATGLLDGVTTNPSLIAKSGKQFVDVIAE
FT                   ICKIVPGPVSAEVVALDHATMMKEAEVLRKIADNVCIKVPLTIDGLKTCKALSDDGTMV
FT                   NVTLCFSANQALLAGKAGAAFISPFVGRHDDVGLDGMGLIADIRQIYDNYDFGTEILVA
FT                   SVRHPIHILESAKIGADVMTAPPAVIRALFNHPLTDKGIQGFMADWAKTGQSIL"
FT   gene            219164..219466
FT                   /locus_tag="Swit_0220"
FT   CDS_pept        219164..219466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66591"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2S5"
FT                   /protein_id="ABQ66591.1"
FT                   /translation="MPSTLGAAIETATACPRGRSGEIVVCRRGNAAERYRIPEALRPDG
FT                   FDFHQEAVDGVSRERHRLMEGGESGIGSCSPSGAAGASGCLVQKFRAWEQQKAGH"
FT   gene            219644..220204
FT                   /locus_tag="Swit_0221"
FT   CDS_pept        219644..220204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0221"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66592"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2S6"
FT                   /protein_id="ABQ66592.1"
FT                   /translation="MGSVIDFEGGAMASLKRRMAEVEEANQDLIAFARGHSGAVSSIHA
FT                   AVLAATESDGLDHLIHIVTQVWPDMLGLDAVSVALFVGDQGLRADASGMQFVERRIIER
FT                   SIVDIEGVVMRSVERGHPLFGPASELIRAEALIRLSAEAPLPGGVLALGQRRPMGFDTR
FT                   AGSELLGFLGAMLSRMIGRWLLP"
FT   gene            220189..221115
FT                   /locus_tag="Swit_0222"
FT   CDS_pept        220189..221115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0222"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66593"
FT                   /db_xref="GOA:A5V2S7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2S7"
FT                   /protein_id="ABQ66593.1"
FT                   /translation="MVAALTLDDHPARDIAVAWADHLRRDRRRSEHTVRAYLATAHRLI
FT                   AFLGRHRGAAVDGALLARLDRGDLRGYLAERRGEGLSNVSTARELSAVRNFLDYVAERE
FT                   GAAKPVKVKGPRIKKGVPRPVAPDDIAAIAEDAAESAAEPWIAARDEAVLLLLYGAGLR
FT                   IGEAMALTGDILPLGDTLSVTGKRAKTRIVPMLAPVREAIERYVALSPHGAAPGEILFR
FT                   GARGGPLAPELIRRAMRAARVRLGLGERTTPHALRHSFATHLLGRGADLRSLQELLGHA
FT                   SLSSTQVYTGVDAAHLMDVYRNAHPRA"
FT   gene            complement(221291..225325)
FT                   /locus_tag="Swit_0223"
FT   CDS_pept        complement(221291..225325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0223"
FT                   /product="LVIVD repeat protein"
FT                   /note="PFAM: LVIVD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66594"
FT                   /db_xref="GOA:A5V2S8"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2S8"
FT                   /protein_id="ABQ66594.1"
FT                   /translation="MRWAARGAMALAAAVAFLVSAPSPAPASEGEKPVARSYPKFADAP
FT                   RTQDWAEADGKSAGCVSCHTATDRKTMHQTEAVVLGCVDCHGGDATVHVDAGAKMGDAA
FT                   YTRARDKAHVLPKYPESWHWPSPANPKRGYTLLNREAPEYVRFVNPGDYRVARQACGSC
FT                   HLEIIQAAERSLMSTGTMFFGGGAYNNGIVPYKNYIFGEAYTSKGEPAQVKSPGTPAGT
FT                   VTPEQKARGALPVVYPLPTWHVLPPADVFRVFERGGRTINSTFAEIGLPNSTGSIQRLE
FT                   EPGRPDLKQSNRGPGTGLRVAIAVLNLHKTRLNDPFMWFMGTNDQPGDYRSSGCSGCHV
FT                   VYANDRDPTHSLIYAKYGRDGQTATVDPTIKDRLEPKDDGHGGHGAKGSGPKGDHGDDH
FT                   GTADTPRHPIGAMKEKGHPIEHAFTKAIPTAQCMNCHMHQPNIFLNSYLGYTMWDYEAD
FT                   APLMWPEKQKHPTMAERHAVYERNPEGAAAIGKWGDLDFTRNVYDDINPRAKDTQFADY
FT                   HGHGWNFRAVYKRDREGNLLDEAGNIVSPDDPEKFRKAGMPEFAPVGEQKGKAVHMMDI
FT                   HAEKGLQCADCHFAQDSHGSGLIYGEVAAAVEIGCKDCHGTADDFPTLRTSGPAAPPGG
FT                   TDLSLLRNQDGKRRFEWTTDANGERALIQRSIVDPKLEWKVSLVKEAVDRNSAHFNPLA
FT                   ARSKLMGKAGKDTGQYLWGPGIAKADRAHDTDKMACFTCHLSWTTSCGGCHLPIEANWK
FT                   TSSHKYEGWETRNFASYNPQVARDEMYQLGIHQTTKGNIIAPIRSTSALVLSSTNLNRE
FT                   RIYVQQPPISSAGFSSQAFAPHFPHTVRKTETKKCTDCHLSEEDDNNAIMAQLNLLGTN
FT                   FVNFVGLNAWTGLEKGIEAIRVTEWDEPQAVIGSYLHKYAYPEWYKQHLDHGRELIEWV
FT                   RGTRFDKKLSGEPDSLEEFANTHHPTGGAARCVQLRGEYFFVAEGKGGFRVYDVASIAN
FT                   KGTSQRILTAPFSPLGHDTHVPSQNATCMALPTDQAISTERNDHILKYYPENQEQKMGE
FT                   IYRYAFVTDSVEGLIVVNVETLADGEPRNNFLKRTATWNENNVLAGARHITIGGNYAYI
FT                   AAAVGLVVVDISDPKHPRLAATVPLRDARASALQFRYLWVTTADGLQLVDVTQLDKPVL
FT                   IPSATLPIANAQRIYLARTYAYVAAKQDGLVIVDITRPLKPKLYEKVTFDGRLNDAEDV
FT                   IVGTTNASLFAYVADGRNGLKVIQLTSPDSQPNFYGFSPAPKPELIAWAKTPSPALALS
FT                   KGLDRDRGVDESGNQIAIFGRLGSRPFKRNEMEKLYLNAKGQVWKVSDTPTFADWVPAR
FT                   K"
FT   sig_peptide     complement(225236..225325)
FT                   /locus_tag="Swit_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.749 at
FT                   residue 30"
FT   gene            complement(225361..227103)
FT                   /locus_tag="Swit_0224"
FT   CDS_pept        complement(225361..227103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66595"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2S9"
FT                   /protein_id="ABQ66595.1"
FT                   /translation="MIAGRRRPGYVTELPAPVVQNNVGAVYAPPPEAFPTDQFPIPDRW
FT                   RLVTALCPDKNFVGLQTVCKSRFDPYHQNPLKADRPIQLDKKPFFLPITGDDWFFGINA
FT                   ISDTVVEPRSFPTPVADQTSSYPGAIDTFGRDRSLVLAQTGLLGFGLTKGSTAYKPPDV
FT                   EYRVLLAYQVNYVNVQERRVLNVESSRPTHRTDTFLGVQEFFVDKHLGNRSDRFDFDSI
FT                   RIGIQPFQFDFRGFLFQDNQLGIRFFGNRDNNRYQFNLQAIWRLDKDTNSGLNDITKKP
FT                   RDDYILSANIFAQDFPLPGLTSLASFTANFNRETERELDHNGFPVRPALLGDQRPREYD
FT                   VYYVGYSLDGRLKRFNLSSTLYGAFGEDRNSFFTSKPAKIRAFFAAAELSYDIDWIRVK
FT                   LSGLYATGDGKPKDNKETGFSAIFENPIFAGADTSYWIRQTVPFAGGGVNVALSPRNGL
FT                   LNDLRTSKEQGQSNFNNPGTMLLGVGADFDILPQLRFSTNLNHLWFENTATLRELRNEG
FT                   SIPKSIGWDLSGALIWRPSMIQNIVFRLSGAVLDPGKGFSDLFTNSRGDDRYYSVLFNA
FT                   ILSF"
FT   gene            227178..229349
FT                   /locus_tag="Swit_0225"
FT   CDS_pept        227178..229349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66596"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2T0"
FT                   /protein_id="ABQ66596.1"
FT                   /translation="MLSRRAAARRPRRARPRPARPRGGAGRRALPPLFPAADVLVGRIE
FT                   EGSEGAVDEAQADARADRHDDVVGADVLGRVRDGGDPLAAVMEAQEGDHVVLVDAVAGH
FT                   ADAADQLVAAIDRHRSGEDLHAVLQAVLGRAGNVGQEGAALARVGGRGAQHEAEMLGQV
FT                   VEDQRALQSGGEGTPLVEGARQRSVGPSHLAVREEGAREIAARAIGEGVGAGQRARIVE
FT                   EGPDLLDEGLDVGAGVAEQVGRGVGAREEGRGARLLQRHVGAEDRGVGAAHHAEHDAAR
FT                   VDDGHRHLRAAVERLADLRAGAAHHLEGFLEDRLHLGLGQRRRDLGGVGAAAQRVAVVA
FT                   GAVGQDEGVDIVDRVARAALGRGHRAIAGRLGAIGMAGEHRRGASLRIIARDRYQRSGA
FT                   RQGREGAGVGRVGAQLGGVRVGIAKLDDHLDIVGADVLGRIEAAQARRRDIFVVVAVDV
FT                   VDVRIIAVEAVRHDADAADHHAVLVEREAARIGGEAERRALRADEGGAAPGGQVAPREI
FT                   RAGELAELHAEQRAAGELVVAGRIMFLDDEAGGAGREGVARRGQIGAGDRLGDRRRRER
FT                   VGGGRSGDDEALDVGRRHDAVGGLDRQRRRRAGHLVDGEDVADPVDDRDDGRLVARRGF
FT                   LDRLRQHLLHVGDGQRLLGRRGVERGGRRRRGRGGRRGRTAAAAAAAAGGEREGEGGES
FT                   GYTTRGNGHLRALIEAAACPRAARNSAGR"
FT   gene            complement(229283..230695)
FT                   /locus_tag="Swit_0226"
FT   CDS_pept        complement(229283..230695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66597"
FT                   /db_xref="GOA:A5V2T1"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2T1"
FT                   /protein_id="ABQ66597.1"
FT                   /translation="MGGKVSSRLSCVCGLIGAAVLGIALLFLATTGTADQAVASSASAA
FT                   TGAVHVGVASCAGSTCHGRSEPTGKVVRQDEILHWQNASSKTGAHSRTYAALASARGQA
FT                   IAAKMGIGPATSAGECLGCHADPAFNGKGPRWQVSDGVGCEGCHGGAGGSNGWLTTHYA
FT                   VGQSHAANVARGLYPLDQPRARAEKCLDCHLGSDKPGQFVSHRIMAAGHPRVAFEVDLF
FT                   SALQQHHDEDADYVQRKRRTNNVQLWAVGQATAVGRATNLFANPRLGTDGIFPEIYFFD
FT                   CQSCHRQIIDGPNGRANWVANPGRPIPSGMPPFNDENMIMLSAAAKVAAPGMAAKFDAD
FT                   SRAFHAALAKDRPAAVAAARRLSATAGSLADTLSRSAFGREQTFAIIDTIAGNAISPRF
FT                   TDYEGSAQAVMAVDTLLNALVRQGHVSEDRARGARGAIDRAYKAVGNSNAYRPAEFRAA
FT                   LGQAAASIRALK"
FT   sig_peptide     complement(230591..230695)
FT                   /locus_tag="Swit_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.539 at
FT                   residue 35"
FT   gene            complement(230812..232248)
FT                   /locus_tag="Swit_0227"
FT   CDS_pept        complement(230812..232248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0227"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66598"
FT                   /db_xref="GOA:A5V2T2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2T2"
FT                   /protein_id="ABQ66598.1"
FT                   /translation="MKLKDTYPLYLANEAQQPNTDLKVTDKFTGEVATRVALADAKTID
FT                   AAIGWAVKAAEPMAKMASYERQAVLQHCVDRFVERKDELAYALCVEAGKPINDSRGEVG
FT                   RLIDTFRIAAEESVRMTGEVQPLDISPRARGYQGIWKRVPIGPCSFISPFNFPLNLAAH
FT                   KIAPAIAVGCPFVMKPASRTPLGAIIMGEVLAETNLPKGAFSILPAARDGADLFTVDDR
FT                   LKLLSFTGSPDVGWDLKARAGKKKIVLELGGNAAVVIDADADLDDAVERTVFGAFYQSG
FT                   QSCIGVQRILVHDAVYDAFRDKLVAKTKTLIAGNPHDEKTFVGPMIDVKEAERLDGWIQ
FT                   EATAKGATLLCGGRREGAMLEATLLEKVDPDTKLNREEAFGPAAFLIRFSDWHEALRIV
FT                   NDSKFGLQAGIFTRDIFKILDAWDDLDVGGVVVNDVPSYRVDNMPYGGVKDSGLGREGI
FT                   RFAMEDMTEIRNLVIRRRSA"
FT   gene            complement(232344..233996)
FT                   /locus_tag="Swit_0228"
FT   CDS_pept        complement(232344..233996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0228"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66599"
FT                   /db_xref="GOA:A5V2T3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2T3"
FT                   /protein_id="ABQ66599.1"
FT                   /translation="MATKASDLFIQCLEEEGCEYIFGVPGEENLDMLDSLSRSTKIKLI
FT                   LTRHEQGAGFMAATYGRHTGKTGVCMATLGPGATNFVTAAAYAQLGGMPILMVTGQKPI
FT                   KKSKQGRFQILEVVEMMKPITKFTHQLASADNIPSRIREAYRLAEEEKPGATHIEFPED
FT                   VADEHTDSKPLKRSLARRPEAEDKAVRAAVKMIEDAKSPILVIGAGGNRKQTGRMLLQF
FT                   IEKTGIPFVTTQLGKGVIDECHPKFLGCAALSAGDFVHRSIEHADLIINVGHDVIEKPP
FT                   FFMRNGGTPVIHVSSKTAEVDPVYFPQVEVIGDIANAIWKMQKDIVPSGRWNFDFMMKA
FT                   RKAEVAHTETLEDDERFPIFPPHLVREIRRAMPADGIICLDNGVYKIWFARNYPARQQN
FT                   TVLLDNALATMGAGLPSAMASAMVYPDRKVMAICGDGGFMMNSQEMETAVRLGLNITVL
FT                   ILNDSSYGMIRWKQANMGFKDWGLTYGNPDFVKYAESYGAKGHRVESAAHLTKLIKECL
FT                   DTPGVHLIDCPVDYSENDQILNKDIKTLSKEIS"
FT   gene            complement(234277..235809)
FT                   /locus_tag="Swit_0229"
FT   CDS_pept        complement(234277..235809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0229"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase, class Ia-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66600"
FT                   /db_xref="GOA:A5V2T4"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2T4"
FT                   /protein_id="ABQ66600.1"
FT                   /translation="MTDTAPAGAPLMLFDSLTRSTRAFAPIDPAMVRLYSCGPTVYNFA
FT                   HLGNLRAYVFTDTLRRTLNWKGWPVNHVINITDVGHLTSDADEGDDKMEAAAKKAARTI
FT                   WEIAAFYTDAFKADLRDLNIIAPTLWSVATDHIQDMIAFARTIEAAGASYELDGGLYFD
FT                   TSKVPDYGRLAGARGDETVGRIAEVEGKRNAADFALWRRSATGEQRQMEWMSPWGPGAP
FT                   GWHLECSVMSMKYLGSQFDIHTGGIDHREIHHCNEIAQNQAFTGTAASGANFWMHNNFL
FT                   VDRGGKMSKSKGGFATLAGVIDKGVHPLAYRLLCLSAHYRSELEFSPEALASALTRLTR
FT                   LVLAAQQLRDKAGDPDWLRLIDETGASKGASFAYQRSVVEAGLGAKAHALIVQFDEALS
FT                   NDLMVPQTLPLLETAIADKAIPAEERLRLLASMDLALGLGLLRLRRVDLRLRPADARIG
FT                   DDEIEALIEQRQAARADKDYAASDRIRDELAERGVSVMDGAGDMRWDWILDL"
FT   gene            complement(236075..236833)
FT                   /locus_tag="Swit_0230"
FT   CDS_pept        complement(236075..236833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66601"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2T5"
FT                   /protein_id="ABQ66601.1"
FT                   /translation="MLWTNKRRPQAAIAAFLGIMLAGSAVAAPLVVRSAGPSAKVYPAG
FT                   KALPDNAKITLKAGDTVVLLDGRGTRTLSGPGTFSSTGSTVAAATTGSTLGALVSGGGE
FT                   RRARIGAVRSASGIDKNAGRNPNVWYVDVTRSANMCVADTSSVTVWRPDASKAASVRVT
FT                   RADGTSGTIDLAAGQAAGLWPASLPVTDGSAYKLSWDGAKAPTSLKFVVVKPTSPGLED
FT                   MAQSLIKAGCNAQLDLLIETVALPDGKSQG"
FT   sig_peptide     complement(236750..236833)
FT                   /locus_tag="Swit_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(236817..238844)
FT                   /locus_tag="Swit_0231"
FT   CDS_pept        complement(236817..238844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0231"
FT                   /product="putative adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   CHASE2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66602"
FT                   /db_xref="GOA:A5V2T6"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2T6"
FT                   /protein_id="ABQ66602.1"
FT                   /translation="MAGSGEGVSLAARIRGFGPLLRKTLRQIGATRLVVTAIFLILGLA
FT                   FARYSWNVMLAKDAERALFDVRLLLASPRVETDPRIAMVTFTEDTLRLTGRRSPLDRSM
FT                   LAKGLLALDRMKPKAIGIDILVDQPTPEDQILIDAFRTMKTPTYLGFASHATNTTFMTL
FT                   DQENFLRDFLRQTKPGNVHPTSIRLLADDDGVMRSWPNQPRELPPLMANSLTGGGEQFR
FT                   SYQGSIRYRLPKFADRPVFDKFPIEIIANPDLIEAFRPQIEGRYIMIGGDIPDVDQFIT
FT                   PASRIQKGETTIGLEIHATLLAQMLDNIMPRKIPGWGLWLIALSVIALGALTAVSNMKI
FT                   WKLGLLLLVQAGAIAAVPFIWQFHGIDTQGLPVFGWLIGWVFAYSAVGTAARGIGSEQR
FT                   NFAQSALGKYLPGDIAKDIMKNPERLQLHGEKREIYALFSDLEGFTKLSHQIEPEMVAF
FT                   LLNKYLDVLSETVLEHGGTIDKFVGDAIVAFWGAPISRPDDCERAVRCAVAMYEAGEQF
FT                   RREAPEGVPPIGVTRVGVHFGEAIVGNFGGEGRIQYTALGDSMNTASRLEGANKYLKTK
FT                   TLVSDTVVERSALSCFRPVGRIAVSGRSTPMEVFEPVFDFSETAVQQFTDIFRRYDAGD
FT                   EGALAEFEKMATENPDDKALANLIERLREVGPGGYSALDK"
FT   gene            238969..240306
FT                   /locus_tag="Swit_0232"
FT   CDS_pept        238969..240306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0232"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66603"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2T7"
FT                   /protein_id="ABQ66603.1"
FT                   /translation="MSPIAALALPACLLIGLAIGWLVRGRLLASGAEDAAGLRRALDAA
FT                   RDALARSEADRAGLAAERQARTEAFEAQIRQLQEAKEQLAAQFAEVGGKLLDQAQRQFL
FT                   ERADQRFHQAGEKNEAQLKALLNPVETTLKRYEEGLQRVEKERVDSYAGLREAVELVRQ
FT                   GQGQVRDEAARLVNALRASPKARGRWGEQSLRNVLEQAGLSPYADFATEVSVDTEDGRL
FT                   RPDVVVRLPGGRKLIVDAKCSFNAYMDASEEVDEAARATLLKAHAAALRTHANQLGQKS
FT                   YWDRFGDAADYVVMYIPGEHFLSAAMEQDPELWDWAHQRRVLIATPINLVALARTIASV
FT                   WRQEKMAEEARAIGRLGKEMYERLSTAAGHLRRVGGGLNSAVENYNKFVSSFEGRVLVT
FT                   GRKFRELNVETGDKEIDELGAIETRASEPSVDLLASPEGGEPGLPN"
FT   sig_peptide     238969..239058
FT                   /locus_tag="Swit_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.952) with cleavage site probability 0.519 at
FT                   residue 30"
FT   gene            240322..240780
FT                   /locus_tag="Swit_0233"
FT   CDS_pept        240322..240780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66604"
FT                   /db_xref="GOA:A5V2T8"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2T8"
FT                   /protein_id="ABQ66604.1"
FT                   /translation="MALAENRPDHWLSLRIVWAVLIVLTLVFAWVSATEYARRDAILRG
FT                   GRELSARVVAQYRSDPSPLESCSLRIEFRDRTMAFQDGLPIACGELADYPVGRRFAIVA
FT                   DMERGDWMPAGQGRFPPAIFGVVAGLVGLAFAGVHTLRMRGQPDSEVY"
FT   gene            240932..241636
FT                   /locus_tag="Swit_0234"
FT   CDS_pept        240932..241636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0234"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66605"
FT                   /db_xref="GOA:A5V2T9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2T9"
FT                   /protein_id="ABQ66605.1"
FT                   /translation="MADLSAFPITRRWPAEHPDRIQLYSLNTPNGVKASIMLEETGLPY
FT                   ESHLVDITADQSHTPEFLSLNPNGKIPAIIDPDGPGGRPLGLFESGAILIYLADKSGRF
FT                   IAADPALRYETIQWVFFQNAGIGPMFGQVGFFNKFAGKAYEDKRPLERYVAESKRLLGV
FT                   LEQRLDGRDWIMGTDYSIADVSTLGWVRNLITFYEARDLVEYDGLKNVPAWLDRGLARP
FT                   AVQRGLEIPKRG"
FT   gene            complement(241656..242342)
FT                   /locus_tag="Swit_0235"
FT   CDS_pept        complement(241656..242342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66606"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2U0"
FT                   /protein_id="ABQ66606.1"
FT                   /translation="MQAARAADWSPSLSATLTSDERRRGLSWSDGRPAASARLSLQPAE
FT                   GLSVSVAGTTLRHGARHDGAAIGIDSALVYTQDFGAIRADAQISHHAFPGHGGANYVEL
FT                   GGGAGTTIGPVQFDLFGLYAPKQDAIGGDNLYLAAAASVAIVGTPVTVGAQVGRSSGTS
FT                   DDPVRSARLRPHGRYTDAALRVDYVAGPFTIGVDLTDSWHGRRVASGPIAADAGRRVSA
FT                   RIGVSL"
FT   gene            complement(242399..242836)
FT                   /locus_tag="Swit_0236"
FT   CDS_pept        complement(242399..242836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66607"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2U1"
FT                   /protein_id="ABQ66607.1"
FT                   /translation="MTMMMLLGALTASLAGADGGHLHRTTIEHRGAPVTIDYRASTALS
FT                   TRQTGMSPPTRTGGVVRCAWVARVAVERRLGGADGLSRVVDTGLQLKGSQPGTCTAAKK
FT                   AIEREVAARGDEVRRHVLAVVERDRATLLAELEAAARPNAS"
FT   sig_peptide     complement(242783..242836)
FT                   /locus_tag="Swit_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.906 at
FT                   residue 18"
FT   gene            complement(242964..244379)
FT                   /locus_tag="Swit_0237"
FT   CDS_pept        complement(242964..244379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0237"
FT                   /product="peptidase M28"
FT                   /note="PFAM: peptidase M20; peptidase M28"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66608"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2U2"
FT                   /protein_id="ABQ66608.1"
FT                   /translation="MGSGWLATNPMKKISLLALAASAALSSPLLAQAKPEETAALRDAA
FT                   LTDSVAWDITEGLTTEIGPRLAGSDAEARARDWAVARLKALGFSNVRVEPFEVPYWERG
FT                   EASAEIVAPYPQPLVLTALGNSAATPAKGLTAEVIGFDSLDSLKAADPAAVKGKTVFLT
FT                   HRMAVTQDGSHYGTVGKVRREGPSVASKLGAAAILIRSIGTDHHRAPHTGAQSWSDGAQ
FT                   PIPALALANPDADQLERVLKRGQPVTVALKATARMAGKRLSGNVIAEVPGRDPNAGIVL
FT                   VGGHLDSWDQGTGAIDDAAGVAITTAAAKRIMDAGQPLRTIRVVWFGSEEIGLFGGAAY
FT                   REKHKDEKHHLLAESDFGSDRIWRYQTSIAEAALPAMKPLAAALAPLGIQPAPRNGDAS
FT                   GSDISEIQKLGIPVIELGQDGTRYFDVHHTPDDTLDKVDPAQLRQNVAAWTALLSVTAN
FT                   DPTDYGPVPPRAH"
FT   sig_peptide     complement(244284..244379)
FT                   /locus_tag="Swit_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.713 at
FT                   residue 32"
FT   gene            244453..246132
FT                   /locus_tag="Swit_0238"
FT   CDS_pept        244453..246132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0238"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66609"
FT                   /db_xref="GOA:A5V2U3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2U3"
FT                   /protein_id="ABQ66609.1"
FT                   /translation="MAVQYSFVMKGLTKTFPGANKPLFNNIHLQFLPGTKIAIIGVNGA
FT                   GKSTLMKVMAGMDTDYSGEAWAAEGVSVGYLPQEPQLDPDKTVKQNVMDGVREVADMID
FT                   RFNAISAEMGDPKDDTDFDALMEEMGVLQEKIDAADGWTLDNQLEIAMEALRCPPGDLP
FT                   VTGLSGGEKRRVALCRLLLEKPDILLLDEPTNHLDAESVAWLEQHLVDYSGNVILVTHD
FT                   RYFLDNVVGWVLELDRGRGIPYEGNYSSWLDAKAKRMEQEEREDAGRQKAIKEELEWIR
FT                   QSPKARQTKSKARIRAFDELVEKQNNRAPGKAQIVIQTPERLGGKVIEAKGLTKSYGDK
FT                   KLFEGLDFTLPPGGIVGVIGPNGAGKTTLFRLITGQETPDAGSIDIGPTVKLGFVDQSR
FT                   DALDSNKNVWEEVSEGHDIMTVGKFEMSTRAYVGAFNFKGPDQQKKVGQLSGGERNRVH
FT                   MAKMLRKGGNVLLLDEPTNDLDVETLRALEDALENFAGCAVVISHDRFFLDRLATHILA
FT                   FEGDGHVEWFEGNFESYEEDKRRRLGDAADRASAGAYKKLTR"
FT   gene            complement(246273..246692)
FT                   /locus_tag="Swit_0239"
FT   CDS_pept        complement(246273..246692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66610"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2U4"
FT                   /protein_id="ABQ66610.1"
FT                   /translation="MIARSILAITALIAVAPLAAQSSPAQTDPAHQAADAREVPETRAL
FT                   NDKVGSAIAQTQTNNAVAQAQNEENQAQYEADKAAYAAALRQHNREVLENDATFIRQRE
FT                   AYAMAMRDWRAQVAMCKRGYQSACKLPTPDPMNYM"
FT   sig_peptide     complement(246624..246692)
FT                   /locus_tag="Swit_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.448 at
FT                   residue 23"
FT   gene            complement(246774..247406)
FT                   /locus_tag="Swit_0240"
FT   CDS_pept        complement(246774..247406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0240"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66611"
FT                   /db_xref="GOA:A5V2U5"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2U5"
FT                   /protein_id="ABQ66611.1"
FT                   /translation="MTDFSGLIEGYRRFKANGWKQQRERWTQLASGQNPRLMVIACSDS
FT                   RVDPTIIFDTSPGEIFMVRNIANMVPPFETTAGRHGVSAALEFAVTQLEVPEIVVLGHQ
FT                   SCGGCAAALTRRFENAEKGQGGFIADWMSMLDEARDKVVAEHGHGEEAVRALEWEAVKV
FT                   SIANLRTFPCVPIREQKGKLKIHGAYFAVADGILHLLDEETGEFSPA"
FT   gene            247474..248412
FT                   /locus_tag="Swit_0241"
FT   CDS_pept        247474..248412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0241"
FT                   /product="lipoic acid synthetase"
FT                   /note="TIGRFAM: lipoic acid synthetase; PFAM: Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66612"
FT                   /db_xref="GOA:A5V2U6"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V2U6"
FT                   /protein_id="ABQ66612.1"
FT                   /translation="MSEPLPITDAPKQRKPDWIRVKAPMGQAFSDTKALMRRLNLATVC
FT                   EEAACPNIGECWTKKHATVMILGDTCTRACAFCNVKTGMPRPVDALEPQHVADAAAELG
FT                   LEHIVVTSVDRDDLPDGGAKQFVKVIEALRRTTPRTTIEILTPDFRNKADAAIEMIVAA
FT                   RPDVYNHNLETVPRLYPTIRPGARYYASLRLLETVKRLDPTIFTKSGIMVGLGEERLEV
FT                   HQVMDDMRSADIDFLTMGQYLQPTPKHAKVADFVAPKTFEAYAAIARAKGFLLVAATPL
FT                   TRSSYHAGDDFVKLRDARNAELARKAAVPAA"
FT   gene            248414..248899
FT                   /locus_tag="Swit_0242"
FT   CDS_pept        248414..248899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0242"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66613"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2U7"
FT                   /protein_id="ABQ66613.1"
FT                   /translation="MPRHRETRTLPYSPEQMYALVADVASYAEFLPWVSAVRVRSDSET
FT                   EMVADLMVGFKALREKFTSKVSKQRPASIHVDYVDGPLKFLHNDWAFAADGKGGSIVDF
FT                   SIDFEFRSRLFEMIAGQMFDRALRMMINAFEERAAKLYGSSASVAPGISSSSAHSAA"
FT   gene            complement(248836..249372)
FT                   /locus_tag="Swit_0243"
FT   CDS_pept        complement(248836..249372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0243"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66614"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2U8"
FT                   /protein_id="ABQ66614.1"
FT                   /translation="MTEHQDTLLPPELVEAARRVIEANRAEGRKIAVAESCTGGLVAAA
FT                   LTEIPGSSDVLGCGFVTYSNEAKVSLLGVSVEMIETFGAVSIAVAWAMARGALEQSGAD
FT                   TAVAITGVAGPGGGSEKKPVGTVVFGRARKGADPEDIAADKRHFGDLGRGGVRLQAALC
FT                   ALELLMPGATLAEEP"
FT   gene            complement(249389..250537)
FT                   /locus_tag="Swit_0244"
FT   CDS_pept        complement(249389..250537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0244"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase"
FT                   /EC_number="2.7.7.60"
FT                   /EC_number="4.6.1.12"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; 2C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66615"
FT                   /db_xref="GOA:A5V2U9"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V2U9"
FT                   /protein_id="ABQ66615.1"
FT                   /translation="MTGKPSIAALIVAAGQGVRSGGGVPKQYRRIGGKAVLAHAVDALA
FT                   RHPAIGSVQVVIGAGQEDLHAEAVGGRTLPPPVTGGATRRDSVIAGLAAVDADIVLIHD
FT                   AARPFLPAAVIDRLIAALDGSDGAVPALAVADTLAKGDALLGDAVPRDGLHRVQTPQAF
FT                   RRADILAAHRAWDPAREATDDAQVARAHGLSVAIVEGDRSLEKLTFAADFEAAEERMAM
FT                   ISRTAMGFDVHGFTAGDGVQLGGVRIAHDRALAGHSDADVALHALTDALLGTIAAGDIG
FT                   SHFPPSDQRWKGADSAMFLAHARDLVAAAGGIVDFVDLTIICEAPKVGPHRAAIRDRIA
FT                   ALLGLTAGQVSVKATTTERLGFTGRREGIAAQAVATVRVPSI"
FT   sig_peptide     complement(250475..250537)
FT                   /locus_tag="Swit_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.604) with cleavage site probability 0.337 at
FT                   residue 21"
FT   gene            250766..251767
FT                   /locus_tag="Swit_0245"
FT   CDS_pept        250766..251767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0245"
FT                   /product="putative TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: putative TIM-barrel protein, nifR3 family;
FT                   PFAM: dihydrouridine synthase, DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66616"
FT                   /db_xref="GOA:A5V2V0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2V0"
FT                   /protein_id="ABQ66616.1"
FT                   /translation="MTPRLRPIDIGPVRIDSPVILAPMTGVSDLPFRKVVRGYGSGLNV
FT                   TEMIASQAAIRETRQSVQKALWDPAEEPVSMQLVGCTPKEMGEAAKLSQDRGAAIIDIN
FT                   MGCPVRKVVNGDAGSALMRTPELAVEIVKATVAAVEVPVTLKMRMGWDHDSLNAPELAR
FT                   IAEDVGVKMITVHGRTRCQMYKGSADWAFIRRVKEAVSIPVIVNGDICSIEDAETALDQ
FT                   SGADGLMIGRGAYGRPWLLSQVMHYLATGERRPDPTIEQQYHVILAHYHAMLELYGKEV
FT                   GVNMARKHIGWYTKGLAGSAEFRNAVNQEPDAARVIAMLGEFYAPWLSRAAA"
FT   gene            251743..252864
FT                   /locus_tag="Swit_0246"
FT   CDS_pept        251743..252864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0246"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66617"
FT                   /db_xref="GOA:A5V2V1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2V1"
FT                   /protein_id="ABQ66617.1"
FT                   /translation="MALPGSSLIRFGRRASAADRPADAPSAAEIMAAMATAVLTIDPEG
FT                   QVVEINAACESLFNLSRSQIVGHGVLDAIGHPLTTMPSDAPFAAYDIDIVLPGRRRMRV
FT                   DLMVAPLPDRPGWRAVSIHGHARSAIGARSIDREGGTRTAVAAAAMLAHEVKNPLSAVR
FT                   GAAQLLETSCDEESRPLTRLIREEVDRVAALIDRMQGFTDTRPIEMTPQNIHAILGHAR
FT                   EVALKGFAQGRVIREVYDPSLPAVLGHRDSLIQIVINLLKNAAEAMGEEPGAITLTTAY
FT                   RHGVSMRRADGDARQPLPIELCVIDEGPGAPPEIEGHLFDPFVTTKRTGSGLGLALVEK
FT                   LVSDQGGIIEYAREGTPSRTVFRLLLPRARVTA"
FT   gene            252861..254318
FT                   /locus_tag="Swit_0247"
FT   CDS_pept        252861..254318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0247"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="TIGRFAM: nitrogen regulation protein NR(I); PFAM:
FT                   response regulator receiver; sigma-54 factor, interaction
FT                   domain-containing protein; helix-turn-helix, Fis-type;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66618"
FT                   /db_xref="GOA:A5V2V2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2V2"
FT                   /protein_id="ABQ66618.1"
FT                   /translation="MTGTGGRVLVVDDDGAIRTVVREALRRAGHIVETAASVAEQRRLF
FT                   ASFDPQVLVTDVILPDGNGLDIIPEMLRTNPGLPVIVLSAQNTFTTALRATEQGAFDYL
FT                   PKPFDLGELTRAVSDALAARAGGGAAAFDGEAAEDLPLIGRSPPMQEVYRTIARVVAND
FT                   LTVLVLGESGTGKELVARAIHDFGPRAAAPFVAINMAAIPRELIESELFGHERGAFTGA
FT                   QARSAGRFEQAQGGTLFLDEIGDMPMEAQTRLLRVLQAGEFTTVGGTRSIRADVRIIAA
FT                   THKDLPRLIADGGFREDLYYRLNVVPIRLPALRQRGDDIGELARFFLDRAAADGLPRKA
FT                   LDAGAVARLIQHGWPGNVRELENLMRRLAVLSREDVITAALVEQQLHQRPAADVPPPVP
FT                   AGSGGLADAVEQHLARYFTTFGRELPPDGLYDRVLAEVERPLLELSMAAAKGNQLRAAR
FT                   LLGINRNTLRKKLTDLGIDAGASRRAD"
FT   gene            complement(254329..255078)
FT                   /locus_tag="Swit_0248"
FT   CDS_pept        complement(254329..255078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66619"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2V3"
FT                   /protein_id="ABQ66619.1"
FT                   /translation="MTFKGRSSFLLSALILVPAAGQAQSSEDVADLVGARAAGAETQME
FT                   ARGYRATVSNTVRDQRFTFWWNERKGRCVSVSTIDGRYASIDAVPPGNCDAQDASRPAY
FT                   GAQQAPGHDAKSLVLVCYGAGTKPTVEPSRYAWNPWNHKWEWSTPQNGAKGFSSDVQIE
FT                   LYGASGRIHLGKSLVPPIHSGGDNGWWDIENLAVTPDRISGSYRLNGMNKPRFTVDRRT
FT                   GRIEVKAVTNFAGQCDMGDWGKGQHRF"
FT   sig_peptide     complement(255001..255078)
FT                   /locus_tag="Swit_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.636 at
FT                   residue 26"
FT   gene            255218..257524
FT                   /locus_tag="Swit_0249"
FT   CDS_pept        255218..257524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0249"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   PAS fold-4 domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66620"
FT                   /db_xref="GOA:A5V2V4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2V4"
FT                   /protein_id="ABQ66620.1"
FT                   /translation="MLTVFPKPRPCGNPATMAAYGLVSRRWRRRAVTALRPRRLLPLLE
FT                   ILAPLAALLVVAVSYRVVTASGKPEIPISPTVVALLLGANLLSFMVLMVLAARRVALHR
FT                   AARSGLGGKARLHVRLVAFFSLIATAPTLLVVIFASLLFQLGTEFWFSDKATVVLRSSE
FT                   RVAQAYVTESKERLLGDILAMSGDLRSALSATTIDDPRFAPFFARQVAYRGLSEAAIIS
FT                   VDRAGTPQLIALANLDKRPLDKRLPPATLPFLAGGQPRITAGAGDRIEGTILLDAASRT
FT                   YLYISRQSDRNVLAQAARARSALGDYVATVDRARALQLRFNILLMIIALAILGIAIWVA
FT                   MTVADRLVRPVNDLVAAARRVAAGDLSARVHIDPSPDEIGTLGSAFNRMTRKLGEQTGA
FT                   LVAANSQLESRSAFIEAVLSGVTAGVISVDGDRRITLVNPSARAMLALEEPVDGRPLAD
FT                   ISPELHHILDAGDREAVVQIVIAGEPRTLSVRAVAAEGARVLTFDDITQRLADQRRAAW
FT                   ADVARRIAHEIKNPLTPIQLAAERLQRRYGKEIQSDPGVFERLTATIVRQVGDMRRIVD
FT                   EFSSFARMPKPAFREEAIVDIARQAMFLQEVAHPAISFSLDSEGLTPTMICDRRQLGQA
FT                   LTNLVKNAVEAIEENPAQHAPGVIAMTIRIAERRLRIVLADNGPGLPPERERLTEPYMT
FT                   TRKRGTGLGLAIVRKIVEDHLGTLALRDRPGGGTMVEMDFDLEALGSLAVEGADRAGNA
FT                   AEEAKFPELKRSGTG"
FT   gene            257528..258916
FT                   /locus_tag="Swit_0250"
FT   CDS_pept        257528..258916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0250"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66621"
FT                   /db_xref="GOA:A5V2V5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2V5"
FT                   /protein_id="ABQ66621.1"
FT                   /translation="MALEILIVDDEADIRDLVAGVLEDEGYAARTAADSDSALAAIDER
FT                   RPSLVLLDVWLQGSRLDGLDLLDEIKRRDPSLPVLMISGHGNLDTAVTAIRRGATDFIE
FT                   KPFEAEHLLLLVDRATETDRLRRENATLKAQIGQEEELTGNSGAINGIRATLKRVAATG
FT                   SRVLISGPAGVGKEVAARLLHVWSHRAQAPFIVVSAARMEPERVEEELFGVEENGELLR
FT                   PGLLEQAHGGTLFLDEIADMPLTTQAKILRVLTEQAFNRVGGQRIVKVDVRVVSATSRN
FT                   LAEEITAGRFREDLYYRLNVVPVNIPPLAERREDIPALVEHFLARFASERRVPTPVVTD
FT                   DAVGALQTYDWPGNVRQLRNIVERTIILAPGERIGQIELDMLPPEILSDQARLAPGEAA
FT                   RSIMGTPLREARETFEREYLRVQIRRFSGNISKTASFIGMERSALHRKLKTLGLVDPRE
FT                   EGEE"
FT   gene            259186..259668
FT                   /locus_tag="Swit_0251"
FT   CDS_pept        259186..259668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0251"
FT                   /product="RNA-binding protein Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein, core"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66622"
FT                   /db_xref="GOA:A5V2V6"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2V6"
FT                   /protein_id="ABQ66622.1"
FT                   /translation="MADKVNNLQDIFLNSVRKTKTPVTMFLVKGVKLQGIITWFDNFSV
FT                   LLRRDGQSQLIYKHAISTVMPAHPLDMAEIDKSFEDKKSHLLQEVFLSAVRKAREPVTM
FT                   FLVNGVMLQGEIAAYDLFCMLLRRDGLSQLVYKHAISTVQPAHPINLAEIDSTDDD"
FT   gene            259665..260993
FT                   /locus_tag="Swit_0252"
FT   CDS_pept        259665..260993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0252"
FT                   /product="GTP-binding protein, HSR1-related"
FT                   /note="PFAM: GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66623"
FT                   /db_xref="GOA:A5V2V7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2V7"
FT                   /protein_id="ABQ66623.1"
FT                   /translation="MSVFNRDEDDGLSRGARALVALPERSGDNPRSAEARLDEAAGLAA
FT                   AIGVDVVDKLAFRLRDPKPATLFGSGQVDQIALAARQGEAELIIVDAALTPIQQRNLEK
FT                   ATEAKVIDRTGLILEIFGERAATAEGRLQVELAHLDYQAGRLVRSWTHLERQRGGFGFL
FT                   GGPGETQIEADRRLIRDRMAKLRRELEQVRRTRGLHRARRQRAPWPVIALVGYTNAGKS
FT                   TLFNRMTGAKVMAEDLLFATLDPTMRQISLPGLDKAILSDTVGFVSDLPTQLVAAFRAT
FT                   LEEVTGADIILHVRDISHPDSDAQAGDVLAVLGEIGVGPRAPEGHGSGEAGEGAPILEV
FT                   WNKIDMLDPEARAATEAEAARRDDVAPLSALTGEGVEELRRLVSDRLSTGNRVRTLSVP
FT                   IADGAALAWLHANGEVIGQEVEGDAMIVEVRLSDKDLARFEAR"
FT   gene            complement(261084..261815)
FT                   /locus_tag="Swit_0253"
FT   CDS_pept        complement(261084..261815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0253"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66624"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2V8"
FT                   /protein_id="ABQ66624.1"
FT                   /translation="MLEELRDIMARLRDPETGCPWDVEQDFRTIAPYTIEEAYEVADAI
FT                   ERDDMAALRDELGDLQLQVVFHARMAEEAGAFDLKDVLDSISAKMIRRHPHVFGDGASP
FT                   GWEEIKAAERAGASEDGSALAGVASALPALLRAEKLQKRAARTGFDWPDPDGARDKVAE
FT                   EIDEVRTAATDADRFEEMGDLLFAVVNWSRKLGIDPEAALRAANLKFEKRFRAMEDIAG
FT                   EAFKGLSLEDKEALWVRVKRS"
FT   gene            complement(261821..262711)
FT                   /locus_tag="Swit_0254"
FT   CDS_pept        complement(261821..262711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0254"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66625"
FT                   /db_xref="GOA:A5V2V9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2V9"
FT                   /protein_id="ABQ66625.1"
FT                   /translation="MHEDYNLFVTIVEAGSLSAAGRRLRISPAMVSKRLARLEARLGAT
FT                   LVHRTTRRLLLTDVGQGFYEDASHILDAVRTAEARVAGRVGQPGGRLRVSAPTSFGRMH
FT                   VAPYLHAFLDRYPRIELSLDLDDGFVDLLGERIDVAIRIATRPEGSLVAHHLAENRRIL
FT                   CAAPAYLAAQGTPATLADLSRHRLLAADHQFPWRLEGSDGPVGLDGVSAVRTNSSEVAR
FT                   ELTVAGLGIALRSTWDVGPALRDGSLVRILPEISGATDVAIYAVQPRGTAGAPNAGAFV
FT                   DHFRALFSPVPPWDR"
FT   gene            262797..264284
FT                   /locus_tag="Swit_0255"
FT   CDS_pept        262797..264284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66626"
FT                   /db_xref="GOA:A5V2W0"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2W0"
FT                   /protein_id="ABQ66626.1"
FT                   /translation="MLQRWLFHLGCVLALAWPAFINGQPFYFPDSTAYVRAADSAAYIF
FT                   SGERIRTEWTEHYRRSLDPEAKARDADRHVGARGNDLASESIMAGRSPYFGALLWLSYL
FT                   LSRFWLFVVAQAAIAYWLVRVALRLFGLARPATVAGTVLLLSAVTALPYFTGLLMPDLL
FT                   AGIGILAFLLLAIDRGRLARGERIGLLALLLLSVVAHLTHILIVAAMAAVLAIRAWAGH
FT                   WPRARIVAPIAPTLLILAAGIASVLLTSTVVEQVFGRKPLLVPLLTARFMADGPGLDYL
FT                   RRHCPEAGFAACAWADRDEVVAADLLWSHDPAKGGYMFADAATRRALSAEDKAFALAVL
FT                   ADHPLAQGADILCNGWRQAIAVEADLLNYACVAGPHCWPALPPRERAALQASLGGRGLW
FT                   PQPAIARLQQGAIVAAILLLLAWLAVDARRGGERRDDLRLWLLLIVVALAANALLGGGI
FT                   SEPQARYQARIVWLLPLAAIIAGLLWRGAGEARATDG"
FT   sig_peptide     262797..262868
FT                   /locus_tag="Swit_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.833) with cleavage site probability 0.779 at
FT                   residue 24"
FT   gene            264316..265269
FT                   /locus_tag="Swit_0256"
FT   CDS_pept        264316..265269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0256"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66627"
FT                   /db_xref="GOA:A5V2W1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2W1"
FT                   /protein_id="ABQ66627.1"
FT                   /translation="MTPDIAVILPCYNEEAAIGATVAAFRRALPDARIYVFDNNSRDRT
FT                   VEVARAAGAIVRTERMQGKGHVVRRMFSDVEADIYVMADGDATYDAAAAPEMIRMMFDE
FT                   RLDMVVGARKSEVEAAYRRGHRFGNRMLTGLLARLFGRTFSDILSGYRVFSRRFVKSFP
FT                   VLSAGFEIETEISIHALELQMPVGELVTQYGARPEGSASKLSTYRDGWRILWTIATLFR
FT                   IEKPMLFFGVIAAALALFAVLLAIPLGITYFQTGLVPRLPTAMLATGLMILAFLNLFCG
FT                   LILATVVRGRREVRRLAYLSFAAPGGDDRSIGSTTA"
FT   gene            complement(265209..266009)
FT                   /locus_tag="Swit_0257"
FT   CDS_pept        complement(265209..266009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0257"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66628"
FT                   /db_xref="GOA:A5V2W2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2W2"
FT                   /protein_id="ABQ66628.1"
FT                   /translation="MVTLSIEALRIDLGGRAILHGIDAEMRSGSLVGVIGPNGAGKSTL
FT                   ARAVTGLLRSASGRVAIDGTNVRAFSPADLGRRIAYLPQGQTVHWPLTAERLVALGRLP
FT                   HLAPFSAMARADRDAVERAMARADIGGLRDRVVTELSGGERARVLIARALAAEAPVLVV
FT                   DEPLAALDPGHQLELMDLMRAEAEAGTLVLLILHDLAMAARFCDRLLLLHEGRLVADGA
FT                   PGAVLTPEYLSDCYNIRAWTGTIEGQAVVLPIERSSPPGAAKLR"
FT   gene            complement(266003..267007)
FT                   /locus_tag="Swit_0258"
FT   CDS_pept        complement(266003..267007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0258"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66629"
FT                   /db_xref="GOA:A5V2W3"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2W3"
FT                   /protein_id="ABQ66629.1"
FT                   /translation="MSSTFPKRLILIAALAAAALLLAVGSLLTGPTRFGSGEIAAILAG
FT                   GGDPVLRAVLLELRLPRALLGLLVGGMLGLGGAVLQGYLRNPLAEPSVLGTSNVAALGA
FT                   VIALYFGLAQAHPLALPLLAVAGALLGLAPLLLLAGRAESPLSLILAGIAVGTLGGAGI
FT                   SLALNLAPNPFAAMEIMSWLMGSLEDRSFEHFWLALPCIAIGATLLLWNARALDALTLG
FT                   EDAARTLGVDLRALRWRLLAGVAIGVGGAVAVSGAIGFVGLIVPHLLRPLTDRSPSALL
FT                   LPSALGGAALLSAADIAVRLIPTADSELRLGVLTSLLGVPVFLYHLVRERRLW"
FT   sig_peptide     complement(266918..267007)
FT                   /locus_tag="Swit_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.647 at
FT                   residue 30"
FT   gene            267017..267889
FT                   /locus_tag="Swit_0259"
FT   CDS_pept        267017..267889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0259"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66630"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2W4"
FT                   /protein_id="ABQ66630.1"
FT                   /translation="MTLAGPSPNEKPMRFRNLGRLLTGLSLALAAAGPLSAAPRRIVSL
FT                   SLCADQYLLLLADPGQIVALNRFSHDPAMSWGVAKARRFPAVRGSAEEMLTLKPDLVFT
FT                   SGFGTPAALAVLRSRKVRLVDIGWADSFAGIERTARTIAAEIGHPARGEALIAAMRARI
FT                   RALGPPPGRGRIAAYYQRRGYLTGQGTLIDEMMRRAGLTNLATRLDRPMLSRLSLEEMA
FT                   VARPDFLLVENGDQVRDKGTELLQHPLLRRAVPAGRRIVIPEALTTCGGPSYPDAMATL
FT                   YRGIERADR"
FT   sig_peptide     267017..267130
FT                   /locus_tag="Swit_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.994 at
FT                   residue 38"
FT   gene            complement(268045..268758)
FT                   /locus_tag="Swit_0260"
FT   CDS_pept        complement(268045..268758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66631"
FT                   /db_xref="GOA:A5V2W5"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2W5"
FT                   /protein_id="ABQ66631.1"
FT                   /translation="MADSRVTMDRAEEVLERIRARTTPRAIKAHRRRVVGFFRRLKYAF
FT                   FAVLGVALAGGLIGSFVTPLGIWGFFLMLVAMAIVFFGILGWPQAPEPTPQQMAKSELP
FT                   LLPSQTERWLEAQRPALPAPAQQLADAIGIKLEAIGPQLAQIDPREPAAFEFRKLMAEE
FT                   LPELVEGYKRVPEGMRRAERNGSSPDRQLVEGLQVVDEELARLSEQIVSGDLNKLATQG
FT                   RYLELKYRGEDGETR"
FT   gene            complement(268775..269962)
FT                   /locus_tag="Swit_0261"
FT   CDS_pept        complement(268775..269962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0261"
FT                   /product="toxic anion resistance family protein"
FT                   /note="PFAM: toxic anion resistance family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66632"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2W6"
FT                   /protein_id="ABQ66632.1"
FT                   /translation="MATTTTTEEPDLVLQAPAPVKVLAPEKAAGLVPLSDEQRTKLDEK
FT                   VDGFIEELVAQDVNSPEFGKRVDSISNMGRKEIAEAAGQSNRFLDRPVRAMDADTGVGA
FT                   DLAELRRTIEDLDPGSKGDLFTRRKLFGIIPFGSRMRDYFDSYKSAQSHISSILRNLAS
FT                   GKDELIKDNAAIDVERQNLWAAMGRLEQMIHLSKKLDDKLEAKALELDSSDPEKAKTIR
FT                   ETALFYIRQRSQDLLTQMAVTVQGYLALDLVKKNNVELVKGVDRASTTTVSALRTAVTV
FT                   AQALTNQKLVLEQITALNTTTANMIESTGSMLKNQTGEIHKQAAASTIPIETLQRAFQN
FT                   IYDTMDTIDRFKVEALSSMKQTVNTLTSEVEKSRGYIARAEGANQAQAEPFKALE"
FT   gene            270347..272170
FT                   /locus_tag="Swit_0262"
FT   CDS_pept        270347..272170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0262"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor, GTP-binding; elongation factor
FT                   Tu, domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66633"
FT                   /db_xref="GOA:A5V2W7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2W7"
FT                   /protein_id="ABQ66633.1"
FT                   /translation="MSLRNVAIIAHVDHGKTTLVDQLFRQSGTFRDNQRVEERAMDSND
FT                   LEKERGITILAKCTSVEWEGTRINIVDTPGHADFGGEVERILSMVDGVILLVDSSEGAM
FT                   PQTKFVTGKALALGLRPIVVVNKIDRPDERTQEVLDEVFDLFVSLDATDEQLDFPVLFA
FT                   SGRNGYANEDPSARSGTLKPLFQKIVDHVPAPKADPNGPFKFLVTLLDRDNFVGRILTG
FT                   LVQSGTVKINSPVHALDPEGNVVETGRASKIMAFRGLERVPVDEAKAGDIISIAGLTVA
FT                   TVANTIADPSVTEPLHAQPIDPPTLSMRFAVNDSPMAGREGSKVTSRMIRDRLFREAES
FT                   NVAIKVTESDDKDSFEVAGRGELQLGVLIETMRREGFELGISRPRVLFRENEQGGREEP
FT                   YETVVIDVDDDYSGTVVDKMAQRKAEMTDMRPSGGGKTRITFSAPSRGLIGYHGEFLSD
FT                   TRGTGIMNRLFEKYGPHKGNIEGRKNGVLISNGAGEANSYALGPLEDRGILFVGHGEAL
FT                   YEGMIVGENAKTDDLEVNPMKAKQLTNFRASGGKDDAIRLTPPKRMTLEQAIAYIDDDE
FT                   LVEVTPKSIRLRKRHLDPHERKRASRAKAAA"
FT   gene            complement(272336..272602)
FT                   /locus_tag="Swit_0263"
FT   CDS_pept        complement(272336..272602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0263"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66634"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2W8"
FT                   /protein_id="ABQ66634.1"
FT                   /translation="MSMNCPVCAVPLTMSTRQNVEIDYCQQCRGVWLDRGELDKIIERS
FT                   AAELAPQAPPRGPDPAPQPSYGRPHDDRHRYKRKKSFLEELFD"
FT   gene            complement(272765..274201)
FT                   /locus_tag="Swit_0264"
FT   CDS_pept        complement(272765..274201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0264"
FT                   /product="glutamate synthase (NADH) small subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="TIGRFAM: glutamate synthase, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66635"
FT                   /db_xref="GOA:A5V2W9"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2W9"
FT                   /protein_id="ABQ66635.1"
FT                   /translation="MGKATGFLEIERKDRGYTKPGERLKHWNEFVVPLAGNDLRDQASR
FT                   CMNCGIPFCHNGCPVNNIIPDWNHLVFEDDWKNALEVLHSTNNFPEFTGRVCPAPCEAA
FT                   CTLNIQDTPVTIKSIECAIVDRGWEEGWIMPQPPARRTGKSVAVVGSGPAGLACAQQLA
FT                   RAGHSVTLFEKNDRMGGLLRYGIPDFKMEKHLINRRLVQMEAEGVTFRTSTEVGVQVSL
FT                   DSLRENFDAIVLSGGAEKPRPLEVPGFELSGVRYAMEFLTQQNKRVAGDDELRAAPRGS
FT                   LTATGKHVVVIGGGDTGSDCVGTSNRQGAASVTQLEIMPRPPEKEAKALSWPNWPLKLR
FT                   TSSSHEEGCERDWAVVTRRAIGTNGQLTALECARVEWVDGRMQEVPGSAFTLKADLVLL
FT                   AMGFLGPNTAGMIEQAGVELDPRGNVKADTSGYATSQDDIFACGDMRRGQSLIVWAIRE
FT                   GRQCARAVDLHLMGRTDLPN"
FT   gene            complement(274215..278969)
FT                   /locus_tag="Swit_0265"
FT   CDS_pept        complement(274215..278969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0265"
FT                   /product="glutamate synthase (NADH) large subunit"
FT                   /EC_number="1.4.1.14"
FT                   /note="PFAM: glutamine amidotransferase, class-II;
FT                   glutamate synthase, alpha subunit domain protein;
FT                   ferredoxin-dependent glutamate synthase; glutamate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66636"
FT                   /db_xref="GOA:A5V2X0"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2X0"
FT                   /protein_id="ABQ66636.1"
FT                   /translation="MQGHVILEGSLGISSLYRHGRNARAIGPKGAACRMAYPHNQGLYD
FT                   SRNEHDACGVGFIANIRGEKSNAIVQRGLEILLKIDHRGAVGADPLLGDGAGILIQIPD
FT                   ALLRAWAAGIGVALPAPGDYGVAMCFLPRDAAARDLAVGNFEKFIAKEGQHLIGWRDVP
FT                   VDTAGLGQAVLDEMPVIRQAIIGRGGDCADQDAFERKLLVIRKQTQNPLEALARKHDLP
FT                   GLTDLYMPSFSTRTVVYKGLLLAGQVGSFYKDLSDPLTTSAIALVHQRFSTNTFPSWKL
FT                   AHPYRFIAHNGEINTVRGNVNWMNARRRTMESDLIGADLDKIWPIIPHGQSDTACLDNA
FT                   LELLVAGGYSLAHAVMMLIPEAWAGNPLMDPARKAFYEYHAALMEPWDGPAAVAFTDGR
FT                   QIGATLDRNGLRPARFLVTDDDHVIMASESGVLPVPEEKIVRKWRLQPGKMLLIDMEQG
FT                   RIIEDEEIKASLAEAEPYAKWLEANQYKLKDLEVLATDDGTATPALPNDPQALLDRQQA
FT                   FGYSQEDIARFLEPMARAGEDPIGSMGTDTPIAVLSARPRLLYDYFKQNFAQVTNPPID
FT                   PIREELVMSLVSMIGPRPNLLGREAGTHKRLEVDQPILTNRDLTRIRSAEEQLDGAFRT
FT                   ETIDITWDAATGADGLAMALKEMCWAATEAVLADKNILILSDRAQSADRIAMPALLATA
FT                   AVHHHLVKQGLRMQTGLVVETGEAREVHHFCVLAGYGAEAINPWLAFDTLEEIRVRQEL
FT                   PLSPNGVQKNYIKAIGKGILKVMSKMGISTYQSYCGAQIFDAIGLSSAFVDKYFTGTAT
FT                   TIEGIGLAELAEETVRRHAAAYGDNPIYRNMLDVGGVYGYRIRGEEHAWTPESVSALQH
FT                   AVRGNSKERYEAFARSINEQNARLLTIRGLMTLKKADRPLSIDEVEPASEIVRRFATGA
FT                   MSFGSISREAHTTLAMAMNRIGGRSNTGEGGEEADRFKPLPNGDSMRSAIKQVASGRFG
FT                   VTAEYLVNADDIQIKMAQGAKPGEGGQLPGDKVDKNIARVRHSTPGVGLISPPPHHDIY
FT                   SIEDLAQLIHDLKNVNTGARISVKLVSEVGVGTVAAGVSKARADHVTISGYEGGTGASP
FT                   LTSLTHAGSPWEIGLAETQQTLLLNGLRSRIAVQVDGGLRTGRDVAIGALLGADEFGFA
FT                   TAPLIAAGCIMMRKCHLNTCPVGVATQDPVLRARFTGQPEHVINYFFFVAEELRQIMAE
FT                   MGFRTIEEMVGRVDRIDMRPALDHWKAHGVDLGRLLHQAPPAMGNTLHHSQFQDHGLDA
FT                   ALDNHLIAAAMPALEQGEPVVIERPVANVNRTVGAMLSGEVAKRHGHEGLPENSITVRL
FT                   TGVAGQSFGAFLAHGVTLELTGDGNDYVGKGLSGGRVIVRQPAGVDRDPLENIIVGNTV
FT                   LYGAIAGEAYFQGVAGERFAVRNSGAIAVVEGTGDHGCEYMTGGVVAVLGRTGRNFAAG
FT                   MSGGIAYVHDADGLFRQRCNLAMVDVEPIDPAADADVEEGRPHQRAASVHDYGMGDMLR
FT                   HDAARLRILLERHHLHTGSDQAAALLEDWDTTLSRFVKVMPRDYRRALQQLEAERLAAA
FT                   NVAAE"
FT   gene            279135..279917
FT                   /locus_tag="Swit_0266"
FT   CDS_pept        279135..279917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0266"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66637"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2X1"
FT                   /protein_id="ABQ66637.1"
FT                   /translation="MKNILLLVHDDEGQEARFQAALDVTRALEGHLTCVDVVVPPQAPA
FT                   ELWDGGAGSALLMAEERQREAANRATLEQRLAKEDVSWSWVDMVGEPGRCLRGAAAIAD
FT                   LIVVDRDPHGAVAGLVLESGPPVLAVPDRARGIALGGRALIAWDGSPEAEAALRAAVPL
FT                   LGLAEQVMILQVDDGSIRIPAGEAASFLSRHGIHPLVILEKATKGRAEANILAAIAGQR
FT                   ADYLVMGGFGRSRLVEALFGGVSRSLLSKSPVPLFMAH"
FT   gene            279959..281854
FT                   /locus_tag="Swit_0267"
FT   CDS_pept        279959..281854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0267"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66638"
FT                   /db_xref="GOA:A5V2X2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2X2"
FT                   /protein_id="ABQ66638.1"
FT                   /translation="MVGAVRIRGKMSMGRTIPAVLLALAAVGVAALVQVELAMSTGAAG
FT                   DYLPLIVAMLVAGLTGGSAAAAIAAVAATGFVVLQGKGAPLDHARAADLAGFLLVAAVI
FT                   VGLSRSVERTRRRLAQDKLEGYRRAVAASETADELNLLIDGATDHAIYMLDPDGRVTIW
FT                   NKGAERLMGWSEAEAVGQPIAFFYPPEAVAAGKPAADLDRARQEGRFEEEEWRIRKDGS
FT                   QFLAHMSLTALYDEHRQLRGFGKVIRDVTEQRAVERQLRSSAGQMRSILSTVPDAMVVI
FT                   DARGLIISFSAAAERLFGYAEAEMLGSNVSRLMPSPYRERHDSYLDRYARTGERHIIGI
FT                   GRKVIGQKRDGSTFPMELSVGEAEAGGEPVFTGFIRDLSEAVRMEERIEDLRSDLIHVA
FT                   RVSAMGTMASTLAHELNQPITAVVNYVETVRDMLVEPKAGDLPVIREALAESASEAMRA
FT                   GQIVRRLREYVARGDVEKTVEDLPALIDVAAKLGLIGAQERGVELRFDVDPLAGPVLVD
FT                   RVQIQQVLINLMRNAIEAMADSPVRLLRIETRREGDGMVRVTVADSGHGVAPEIEAGLF
FT                   SAFNSTKAGGMGLGLSICRTIVEANGGRITYERDPGGGSRFHFTLLGFTPEDEHG"
FT   sig_peptide     279959..280060
FT                   /locus_tag="Swit_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.926) with cleavage site probability 0.326 at
FT                   residue 34"
FT   gene            281847..282458
FT                   /locus_tag="Swit_0268"
FT   CDS_pept        281847..282458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0268"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66639"
FT                   /db_xref="GOA:A5V2X3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2X3"
FT                   /protein_id="ABQ66639.1"
FT                   /translation="MDDTRLVHIVDDEEAIRRSTRFMLTTVGYAVECWESGTAFLKAVR
FT                   HAAPGCILLDVRMPEMDGLQVQQQLNERGVTMPVIILTGHGDISTAVQAMKAGAVDFIE
FT                   KPFERTALLAAIEAAHARLGRQADEAARGAEAQVMLAKLTAREREVLDGLARGLPNKTI
FT                   AYDLAISSRTVEVHRANLMTKLGVKSLSDALRIAFAAGLG"
FT   gene            282571..284085
FT                   /locus_tag="Swit_0269"
FT   CDS_pept        282571..284085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0269"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66640"
FT                   /db_xref="GOA:A5V2X4"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2X4"
FT                   /protein_id="ABQ66640.1"
FT                   /translation="MSDNPQNAGKCPVTHLTTAFGAPVVDNQNSLTAGPRGPLLMQDVW
FT                   LLEKLANLNREVIPERRMHAKGSGAFGTFTVTHDISRYTRADIFSQVGKKTEMFARFTT
FT                   VAGERGAADAERDIRGFALKFYTEEGNWDLVGNNTPVFFLRDSRKFPDLNKAVKRDPRT
FT                   NMRSATNNWDFWTLLPEALHQVTIVMSDRGIPKSYRHMHGFGSHTYSFYNDAGERFWVK
FT                   FHFRTQQGIDNLTDAEAAAVVAGDRESNQRDLYEAIERGDFPKWTMFIQVMPEKDAETY
FT                   HVHPFDLTKVWYKSDYPLIEVGEFELNRNPENFFQDVEQSAFAPSNLVPGIGVSPDKML
FT                   QSRLFAYADAQRYRLGVNYHQIPVNAARCPVFSNHRDGQGRTDGNYGGLPHYQPNSFGQ
FT                   WVDQPDFREPPLKIDGNADFWNFREDDDDYFTQPRKLFQLMTPAQQQVLFDNTARAMGD
FT                   APDFIKQRHIDNCTRCDPAYGAGVAKALGMSAKAPGDLPATPELAD"
FT   gene            284371..286119
FT                   /locus_tag="Swit_0270"
FT   CDS_pept        284371..286119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0270"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66641"
FT                   /db_xref="GOA:A5V2X5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2X5"
FT                   /protein_id="ABQ66641.1"
FT                   /translation="MNSTTPIARGLRPFSRMLRVTAPNRADIIAVLLLAGLSILVIRGA
FT                   EGMAEPLARLRNAPVTLDPWNLPGYALRTTLRMFAALFASLAFTLAIGTLAARSRRAEQ
FT                   IIVPALDILQSVPILGFLTFTVTFFMGLFPGRQLGVELASIFAIFTSQAWNMAFSFYQS
FT                   LRSVPSDLEEVSRGFGLSPLRRFLRLELPFATPALVWNAMMSMSGGWFFVVASEAITVG
FT                   NTSVTLPGIGSWLALAIDRSDFTGVAWAVGAMAVVILLYDQLVFRPVVAWADRFRFEQV
FT                   ASTERPRSWAYELFRRTRLLPLLLMPLAGLGRALLMLDPVRAPRPAGRAEARRGVIGDR
FT                   VWTAAIAIAVLFAAWTIIGYVGRTLDWAEAAAVFGLACLTMLRVLALIAVASLIWVPVG
FT                   VWIGLRPQWAERLQPVAQFLAAFPANVLFPFAVIAIVRWKLDPDIWLSPLMVMGTQWYI
FT                   LFNVIAGASAIPTDLREAAGMFGVRGWQWWRQVALPGIFPYYVTGALTASGGSWNASIV
FT                   AEAVSWGDDHLHASGLGAFIADATAIGDYPRVALGIAMMSLFVIAFNRLLWRPLYSFAE
FT                   RRLRLA"
FT   gene            286162..287469
FT                   /locus_tag="Swit_0271"
FT   CDS_pept        286162..287469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0271"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66642"
FT                   /db_xref="GOA:A5V2X6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2X6"
FT                   /protein_id="ABQ66642.1"
FT                   /translation="MAATILDRRPLVRVVNVRHHYGRGHGRALVLDNVDLTLDENEIVG
FT                   LLGRSGSGKSTLLRSIAGLIAPSEGEVRFVPSEDGSPPSVSMVFQTFALFPWLTVLQNV
FT                   ELGLEARRVPAAERRTRALAAIDLIGLDGFENAYPKELSGGMRQRVGLARALVVDPSLL
FT                   LMDEPFSALDVLTAETLRTDLLDLWSEGRMPIRSILIVTHNIEEAVLMCDRILVFSSNP
FT                   GRVAAEIRVDLPQPRDRLDPAFRALVDEIYALMTARPAAAPAHDGLFPGTGIAMALPVV
FT                   STNALAGLIEEVDGAPFDGEASLADLADQLQLEVDQLFPMAETLQLMRFAELKGADLRL
FT                   TPAARRYAQADVDTRKGLFAQALLAHVPLAGHIRRILDERPGHVAPARRFRDELEDHMS
FT                   PDYAAGTLSAVTHWARYAEIFAYDEDADRFSLEDPS"
FT   gene            287469..288143
FT                   /locus_tag="Swit_0272"
FT   CDS_pept        287469..288143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66643"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2X7"
FT                   /protein_id="ABQ66643.1"
FT                   /translation="MRAASWGAWLLLAAPGPAFAAGGGHVVDDAAVEAPGACHVESWVT
FT                   RSSHGAGLINVAPACTREAWPDLEIGGFVSHGWTRAAADTVIGIAPKLMLRSEDHGLGV
FT                   GVATSVGYDIGHGRIETASMIVPVTIPVGARLRFNLDGGWQWSRADHGHDLFVGGQVEF
FT                   ALRPTVGLMTELFTRDQGKPGGQAGVRWTVDAGRIDLDVLAGRYLDGATPTAITIGVTV
FT                   RR"
FT   sig_peptide     287469..287531
FT                   /locus_tag="Swit_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            288229..289152
FT                   /locus_tag="Swit_0273"
FT   CDS_pept        288229..289152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0273"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66644"
FT                   /db_xref="GOA:A5V2X8"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2X8"
FT                   /protein_id="ABQ66644.1"
FT                   /translation="MTSPDAPPSFEMERIKQEIADSFDEELEMEIDESRLEAMLGELAE
FT                   HPEQEQLDRRLYFRELFRLQHELVRLQDWVQHSGLKVLVIFEGRDSAGKGGVIKRITQR
FT                   LNPRVCRVVALPAPNERERTQWYFQRYTAHLPAAGEIVLFDRSWYNRAGVERVMGFCTE
FT                   DEVEEFFRSVPAFERMLVRSGIILLKYWFSITDDEQQFRFNMRIHDPLKQWKLSPMDVE
FT                   SRRRWEDYTRAKEAMLERTHIEEAPWWIVEAVDKKRARLNCIAHLLGRIPYDEAPRPSV
FT                   VLPARVRHDDYIRHPVPREMYVPEIY"
FT   gene            complement(289177..290781)
FT                   /locus_tag="Swit_0274"
FT   CDS_pept        complement(289177..290781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0274"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66645"
FT                   /db_xref="GOA:A5V2X9"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2X9"
FT                   /protein_id="ABQ66645.1"
FT                   /translation="MSATIAASDQHSRPNLDGGLGLAGQLGFGATIVAAIAYVAYSIYM
FT                   DANAAGVSALAILPFILLFVALMIALGFEFVNGFHDTANAVATVIYTNAMPAHVAVVWS
FT                   GFFNFLGVLLSTGVVAFGIVSLLPVELILQVGSNAGFAMVFALLIAAIIWNLATWWIGI
FT                   PSSSSHTLIGSIIGVGVANAMMHGKSGTAGVDWSKATEIGQALLFSPLIGFGVAALLFV
FT                   AMKLLVRNQALYQEPKDGLPPPWWIRGLLIFTCTGVSFAHGSNDGQKGMGLIMLILIGT
FT                   VPTAYALNRAVPAHYTAEFHANADAARVALHEGPDAGIAAPDARKLVTAYIADRQFTPA
FT                   VTPAMAALVKDIDRQVAEYGSLAQVPAAAVENVRNDMYLASEGIKRLGKEKAIQFSEGE
FT                   KKALDTYKASLDAGTRFIPTWVKVAVAFALGLGTMVGWKRIVVTVGEKIGKSHLTYAQG
FT                   ASAELVAMGTIFAADHLGLPVSTTHVLSSGVAGTMAANRSGLQMSTIRNLAMAWVLTLP
FT                   VSILLSGTLYMLFSSLF"
FT   gene            290959..292200
FT                   /locus_tag="Swit_0275"
FT   CDS_pept        290959..292200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0275"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66646"
FT                   /db_xref="GOA:A5V2Y0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Y0"
FT                   /protein_id="ABQ66646.1"
FT                   /translation="MKLLFAGGKVWDGLAEEAVAADVLIEDGMVAMVGAVPAGRCEGAR
FT                   RVDARGATLIPGMVDAHAHLSFPVVTYAYQIEDTPPEETVLITMHNARILLDAGFTGVV
FT                   GAGSPKLRAEVVIRNEIEAGRIPGPRLMASTPTLTATGGLNDTAQLHQGRDVAAMVVDG
FT                   ADACRRAVRTGYREGVDLVKVNVSGDDFFPRPSGRTTTLAEDEMRAIGETCAALGLPIS
FT                   AHARSAESIKRALRAGATLINHADFADEEALDMLEAAKDRVFVAPTIGYYHSLLHDSPF
FT                   DRATLDRMGVEAAMEANVEVHRTLRRRGVRAVIGGDYGLAWQPNGGNARDVAHFVTYLG
FT                   YSPREALVAATRNGGELMGMGAGRIAPGAPADLLLVDGDPLVDPTLLARSDALLAIVRG
FT                   GGLHKAPAVPERAA"
FT   gene            292197..292670
FT                   /locus_tag="Swit_0276"
FT   CDS_pept        292197..292670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66647"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Y1"
FT                   /protein_id="ABQ66647.1"
FT                   /translation="MIPFNIFQAAYVAADIDAAVALAARRFGVAKMQVNRAVAIETGRG
FT                   AALCHFALAFVGPVQIELIAPAGGTDEVYRDMLPPDGGLRLHHIGCLVGSDAEWDAVLA
FT                   DAAASGVAMPVRGDFGGLMRYVYLDRRAEIGHFVEYMRPGPAGQSLFEAVPRF"
FT   gene            complement(292863..295190)
FT                   /locus_tag="Swit_0277"
FT   CDS_pept        complement(292863..295190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0277"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66648"
FT                   /db_xref="GOA:A5V2Y2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Y2"
FT                   /protein_id="ABQ66648.1"
FT                   /translation="MKQSLHIASIATIAFLTMIPVEAQAQEAARAAPADEAPAAGGIDD
FT                   IVVTARRRAERLQDVPLAVSAVSTAALERANIQNVAQLSRLVPSLTSVPGQGGSRSLPN
FT                   FSIRGLSQQELTILADQSVSTYIGDIVAARTQGINSALFDIASVEVLRGPQGTLFGRNT
FT                   TGGAIIIRPARPTDEFEGRVGVTVGNLDTFNVEGMVNVPLSPNIAIRVAGQRQRDDGFV
FT                   YDEILQRNVNDTKQEGARASILMHNDDLESLTVYNYFHENDGGTASFLQNVRATGSLNG
FT                   AAVRASRGYRPLEDLLAEQQARGIYRIANGSPIFTKVETHDIANTTSFDLSETIKLKNI
FT                   VGYRHVKDHIFDDMDGSSNALHPQERIDRAKQFSEEFQILGDTANLNWIAGLYYFRESG
FT                   RNQGISAVGAVDPGLVEPDNVAAFPGTAYSNTDTAARNTSYAAFAQGTYRFGGGLSLTA
FT                   GIRYNRDERQATIRNRTATACRFTRDLDNNPATPETAVPLAQCELGVKDSFSEVTYNVS
FT                   LEYKIAADKLVYIAHRHGYRTGGFGARASTEAGLRRTFRPETVDDVEVGVKADWRMGDA
FT                   FLRTNLAGYYAKYKDIQRLLTDPVAVPPTTVTTNAGRARIYGIEADILFRPVKMIELTA
FT                   NYAYTNAKFTKFIYPDGTDHSNDPFARAPRNVYTLGARLLAPLDEGQGDASVGVSYYHT
FT                   GDYSGNDTYVPGYTDVKGYSLLNFDASWNRVMGSGFDVALFVNNVTKKKYDFLLINLDS
FT                   LGYTSHTPGMPRTYGATLRYHF"
FT   sig_peptide     complement(295113..295190)
FT                   /locus_tag="Swit_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.808 at
FT                   residue 26"
FT   gene            295457..296254
FT                   /locus_tag="Swit_0278"
FT   CDS_pept        295457..296254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0278"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66649"
FT                   /db_xref="GOA:A5V2Y3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Y3"
FT                   /protein_id="ABQ66649.1"
FT                   /translation="MFAVIRIARLDSRRSVATAARSRHDGAMASEDGSADTGREDRAGK
FT                   ALSVLARPEALTGRVAGLIRQAILSGELAPGERLSVPELARRLGVSRTPARESLLLLER
FT                   EGLVVPRSSAGMAVIAGGREEILDLLDIREGLEIMTARRAAERIDAAGVARLEAILADH
FT                   RAVLEEGDLARHVELDAAFHAAIREAAGNDRLARQLGQIELQLRVLNGRLSRAEGWSGR
FT                   AVLRDHAAIAGAIVARDADAAERHMRAHIGRTRAFHLRSLATT"
FT   gene            296382..297269
FT                   /locus_tag="Swit_0279"
FT   CDS_pept        296382..297269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0279"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66650"
FT                   /db_xref="GOA:A5V2Y4"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Y4"
FT                   /protein_id="ABQ66650.1"
FT                   /translation="MARVECVLDIRAESGETPVWSVAEQRLFWVDQLAFTLNAFDPATG
FT                   RNEAWTMPAHISSFAIRGRGGKLLVALRTGLFDFDRASGALTPVAAPPPYDQAALRYND
FT                   GRCDRQGRYVVGSVDLDFFENRIAGRAAVYRLDAAGLAPIVTGITCSNGLAFSPDGRTM
FT                   YLADTVQNAVFAYDYDVATGTPGNRRDFVRFGPDEGKPDGAEVDSEGGYWVALLMKGAV
FT                   ARYTPDGKLDRLIPVPVLQPTKIAFGGPDLATLYLTSAGHRHMPGDEPLGDQAGGLFAI
FT                   DTGFRGIAEPQFAF"
FT   gene            297308..297868
FT                   /locus_tag="Swit_0280"
FT   CDS_pept        297308..297868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66651"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Y5"
FT                   /protein_id="ABQ66651.1"
FT                   /translation="MTIRVLDPTASLAHDIADPGPDAGALRGKRIAIRIDMLWRSWDWV
FT                   SAIWAEGLRAEGAEVTFWRSCGRTGAEGEAAAMDYAALLRESDAAIVGLGNCGSCTSWT
FT                   IADALEAAATGLPTIAVATAHFEGLAHNLAKRGGRSGLRLHVLPYPLDILPRDQVDDIA
FT                   RDQYRSFLRNFGVRGGLAEQSAA"
FT   gene            298068..298880
FT                   /locus_tag="Swit_0281"
FT   CDS_pept        298068..298880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66652"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Y6"
FT                   /protein_id="ABQ66652.1"
FT                   /translation="MAGCAGDAMPLLCAAIEAMADPKFDLAGLNATTGSVVPAIIVNGP
FT                   VRHALDIPCQAGCLGGVAGPAPAIGRAIRLIMRNVAGQLIDATSQSVYGTPGRVAGIVF
FT                   GEWEERSPWAPLAERRGVAGDAVTVYGAMGTANICDVVADSADGFLDIIAKSMAYPGAN
FT                   GFLTSSAFSETLCAINPVWAEVIAKAYPAMADVQAYLWDRCALPIDWWRPEYRAPIEAL
FT                   GRIEPDGRVHLTLTPDDVIVMVAGGLGGLHAAMLHSWGTCLTVTRPIR"
FT   gene            298877..300355
FT                   /locus_tag="Swit_0282"
FT   CDS_pept        298877..300355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0282"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66653"
FT                   /db_xref="GOA:A5V2Y7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Y7"
FT                   /protein_id="ABQ66653.1"
FT                   /translation="MTPVVIVGDRVRTRDEAIERGARLAAAMHAAGVEAGDAVALLLRN
FT                   DFAVLEANLAVRRLDAYGVPVNWHWHADEIGYVLRDCAPRLLIGHRDLLEAIEDRIPAG
FT                   LTVVAIGGDPARGWIDYDGWIAGHEPHAGTGTGLGSSMVYTSGTTGRPKAVRRLPASGE
FT                   ESAQRARVLAAIHDSAPGNVALVTGPLYHLFGQALMTATFGAGGSVVIMERFDPEACLA
FT                   LIERHRVTHSALVPTLFVRLLRLPDAVKARYDLSSLRHVVHSGAPCAPEVKRAMLGWWG
FT                   PVLHETYGSTETGVVTKIGPAEWLERPGSVGRPVLTGEVRIRGEDGGWAPAGTVGDVYL
FT                   RIHGTPDFTFHGDPAKRAAVEHDGLVTCGDIGWLDAQGYLFLCDRRVDMLISGGVNIYP
FT                   AEIEAALLEHRAIGDCAVFGVPDPEYGEAPVAYVQPASAIDAGAVRAFLRGRLAGYKVP
FT                   RHIVLTDALPREETGKIMKRKLREQFLAAERVDG"
FT   gene            300348..301424
FT                   /locus_tag="Swit_0283"
FT   CDS_pept        300348..301424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0283"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66654"
FT                   /db_xref="GOA:A5V2Y8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Y8"
FT                   /protein_id="ABQ66654.1"
FT                   /translation="MADPATAALAGLRVIDMASLYAAPFAATIMADFGADVLKIEPPGG
FT                   DPFRESRMWPLVARGKRCLELDLRAAEGIETLKALVAEADVVVENYPAALLRKRGIGWE
FT                   VLSAINPRLVMLSVSCFGADGPYADRPGSGTIGEGFGGLTWLTGEGDGPPMLPSVALGD
FT                   AVGAMSAVIGVLSALYWRERSGQGQQVDTSLYEPILQIVAHAAQRWSPGDPPMRCGSKL
FT                   PGVLRNVYATGDGHFVALSASTARHHADLVALAGGAEGDDDARVAAWMAGRTRHEAIDA
FT                   LVARRIPIAPVNDLDALLADPHVRARDSLRHVRSERLGDLALAAPSPRLSHTPAQIGEI
FT                   DPPLGTDADAALARWAAA"
FT   gene            301409..302227
FT                   /locus_tag="Swit_0284"
FT   CDS_pept        301409..302227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0284"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66655"
FT                   /db_xref="GOA:A5V2Y9"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Y9"
FT                   /protein_id="ABQ66655.1"
FT                   /translation="MGGGLTPRLDGRRRFAAHLGIASPDRPLLGGGVDPIAQIERAHVL
FT                   GFAGITDNGLMLRPPDVQRQMGERLRAFGMEMGSFTHDPPGEGPRFFWGAPQPDLAAAL
FT                   APTFAAAERVSGVINLVLLDAGAPRADQLARATDNLGRAAALARARGFRLALEPVSRIR
FT                   VPLALVEHMAEAAAIVARIDDEALGLIVDSCHMALGGEDIPAAILAQADRLRVVQIADV
FT                   PGRVEPGAGGLAFAPILAALDRIGWRGMLEAEFDPLGDEAAMLRALARLG"
FT   gene            complement(302373..302696)
FT                   /locus_tag="Swit_0285"
FT   CDS_pept        complement(302373..302696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0285"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66656"
FT                   /db_xref="GOA:A5V2Z0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Z0"
FT                   /protein_id="ABQ66656.1"
FT                   /translation="MMTEIRFIDADGAVTIARGDNGFSLMEVAKRHGVSGIVAECGGSC
FT                   ACATCHVHVDAAWLEAVGEPNPGEADMLDFARGRRPDSRLSCQIRITPALDGLIVHVPE
FT                   SQG"
FT   gene            302847..303860
FT                   /locus_tag="Swit_0286"
FT   CDS_pept        302847..303860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0286"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66657"
FT                   /db_xref="GOA:A5V2Z1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Z1"
FT                   /protein_id="ABQ66657.1"
FT                   /translation="MRAAIFHGAGKPMTIEDVPDPEPGPGEAVIKVCRCGICGSDIGMT
FT                   SGSHADYPAGTTLGHEYAGEVVAVGRDVSNLKVGQRVSAMPAKGCGRCASCLAGFPLGC
FT                   TAMAGMIGGFGQYMRIYAPAAIHLPDTLSMADGALVEPLAVGLRGVALAGLRPGATVAV
FT                   LGAGAVGLAAIYWARLLGAGRIVAMSRSARRADLATAMGADGFEAFGEGEGDRLAAALG
FT                   GLPDAVLECAGAVGLMQKAVELVRPGGTIVSLGFCGSPDPIIPSLATWKQVTMKFSFAY
FT                   DLREFQHCADALDAGHVAPRMMVSETIGLDALPSGFEALRTGSTQTKVHVDPWIAA"
FT   gene            303857..305008
FT                   /locus_tag="Swit_0287"
FT   CDS_pept        303857..305008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66658"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Z2"
FT                   /protein_id="ABQ66658.1"
FT                   /translation="MSMADLLAPETMLAASTARTGLSDFGDPGFREGFDRLLSDIRALD
FT                   LPEAFAQATAFRIGQFLDARALAVDGLRRHGEVLATPVRRPLIIAGLVRSGTTALHQLL
FT                   SLDPQFQGPEHWLTVAPKPRPPRDRWQDDPHYRAVADSIAAFVASAPEMLDDHMMSADG
FT                   IEESLFILATGFASNMWPSMWPVPRYDLWYRDRDDRDSYRWLADVLRLIGKGDDRRWLL
FT                   KNPTDLFSLGEVLDVFPDAMIVQTHRDPVEAMPSICNLILAAQRVFSGDRADPVAIGGR
FT                   EAEMWAVALDRAERVRAGSANRFFDIEFRDFTRDQLGTVKRLYDHFGLTLDASTEAAMQ
FT                   AWLDAHPRRAAVAGPRYRPEDFGLTADGLRERFADYRARRGYA"
FT   gene            305011..305514
FT                   /locus_tag="Swit_0288"
FT   CDS_pept        305011..305514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66659"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Z3"
FT                   /protein_id="ABQ66659.1"
FT                   /translation="MKETEMRNLLGGTFHQIAYVTADFDAGLAALRAGHGIERFLELRD
FT                   IRFPVDRAGAEAHCHIALGRTGGLEIELIQPLGGAADLYREPLDRPGPLHFHHVAQRVD
FT                   TLAELEALHRTARERGFAIPIDSESNGMTYFYADARATLGHHVEYIYGSPDYWAAVGAM
FT                   IPEN"
FT   gene            complement(305532..306761)
FT                   /locus_tag="Swit_0289"
FT   CDS_pept        complement(305532..306761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0289"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66660"
FT                   /db_xref="GOA:A5V2Z4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Z4"
FT                   /protein_id="ABQ66660.1"
FT                   /translation="MARLPLENIRVLDLTRVLAGPFGSQVLADMGADVIKIERPVVGDD
FT                   ARIFGEPYLRDTEGNRTRENAFYMSVNRNKRSVALNIASARGQALIRELVLSCDVVMEN
FT                   YKVGDLKRYGLDYESLKAINPRIVYCSVTGYGQTGPLAAKPGYDAVFQGECGLMSVTGV
FT                   PDGKPGAGPMKVGPSIIDLFTGLNVANAILAALYHRDAAGGEGQYIDVALLDCGISALS
FT                   HYAQIHLTSGEVPVRRGTQGNGGMPTSKFACSDGAIMITSGNDKQYVALCDAVGHPELA
FT                   THPRFHTNVLRVQHRDEITEVFDAIFATDTVAHWLEKLGAAGIPSGPINDLEQVFDYPQ
FT                   ARHRGMRVRAPHPLKPDLDLIRSPLNFSETPITDYRAPPMLGEHTRAVLAGELGLSEAE
FT                   IDALGDEGVI"
FT   gene            306951..307754
FT                   /locus_tag="Swit_0290"
FT   CDS_pept        306951..307754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0290"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66661"
FT                   /db_xref="GOA:A5V2Z5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Z5"
FT                   /protein_id="ABQ66661.1"
FT                   /translation="MGDILRDTPAEGVCRLTLNRPDALNSLSYAMYGELIDHLESIRYD
FT                   HDVRVVLLTGAGRAFCAGHDTRAGGAPDWVDEGLGKAQWQRRIMDKLGQIPLRMRALPQ
FT                   PVICAVNGAAAGAGYALALAADMTVAARSAKFVNAFHNAGTGHELGFSYMLPRLVGAQR
FT                   AAELMLTGRAVMAEEAERIGLVLRCIDDARLMDEALALADAVMANSPIGIALTKSSMWL
FT                   NADAPSLEAAIEMENRAIFMSQSTGDTGEKRKAFFEKRRPKFTGQ"
FT   gene            307756..308898
FT                   /locus_tag="Swit_0291"
FT   CDS_pept        307756..308898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0291"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66662"
FT                   /db_xref="GOA:A5V2Z6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Z6"
FT                   /protein_id="ABQ66662.1"
FT                   /translation="MSAIEPLLRPFALRGLELPNRVVMAPMTRYRSPAGVPTGEVASYY
FT                   ARRAATGLGLILTEGVALPHYAAADHPDIPRIDGVEVLEGWRKVIEEVHAAGGRIVPQL
FT                   WHQGPMWNVEYAGPGTGNPMRPSGIWGPADGVISFRPEGRDASLAPVPPMTDGDIADVI
FT                   AAYALAARNAVALGADGIAIHGAHGYLIDTFLWDYTNRRDDRWGGDPARRAAFGAEVVR
FT                   AIRAEIGEDRPIVLRFSQFKMQNYQALLADTPDALGALLGPLADAGVDLFDASQRYFDT
FT                   PTFEGSTLNLAGWAKKLTGKASMTVGGVALDKARGHAKHIDDSQQSVNNLSLLVERFER
FT                   GEFDLVAVGRAILNDPAWFTKAVAGEPFLPFDPASLERLT"
FT   gene            308895..309467
FT                   /locus_tag="Swit_0292"
FT   CDS_pept        308895..309467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66663"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Z7"
FT                   /protein_id="ABQ66663.1"
FT                   /translation="MSGMTDIAQRIDRLESQAAIQQLPIRYALAVDGRDLDAWVGLFVP
FT                   DVNCGRRGSGRAVLRSIIEPAVRTFYRSIHQICGHRVEFDDADHARGVVYCRAEHEAEG
FT                   QWIVMAIAYFDSYERRDGAWYFVRRQEKHWYAADWQERPSAPFTGWAAHPHPPTLPQEF
FT                   EAWNPFWAEEAADRIAALTALPTGDTA"
FT   gene            309464..310231
FT                   /locus_tag="Swit_0293"
FT   CDS_pept        309464..310231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0293"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66664"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Z8"
FT                   /protein_id="ABQ66664.1"
FT                   /translation="MSSNRRFEGRSVIVTGAGSGIGEATARAFAAEGALVAIAELDGDK
FT                   GRAVCDAIVAEGGTARFVETDATDEASVRAMVEAACAAHGPVRHAFNNVGAAKLGSLEE
FT                   LSLDDWNWTVGISLTSTFLAMKHEIPVMKANGGGTIVNTASMSGRIFTPSAPPSYSAAK
FT                   AGVIHLSHYASCTYAADNIRVNSVLPGLTATPQIASMFTLEQQAEVASHHQMIHRCVQP
FT                   AEIAAAVLFLSSDEAAMITGRGIEVSGGGAHAS"
FT   sig_peptide     309464..309556
FT                   /locus_tag="Swit_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.802) with cleavage site probability 0.773 at
FT                   residue 31"
FT   gene            complement(310386..311540)
FT                   /locus_tag="Swit_0294"
FT   CDS_pept        complement(310386..311540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0294"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66665"
FT                   /db_xref="GOA:A5V2Z9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V2Z9"
FT                   /protein_id="ABQ66665.1"
FT                   /translation="MAKPLKVGIISANWSLKVHGAAWRRIEGVEVAAICTSRRETAEKA
FT                   AADFDIPKAYWNHEEMSADPDLDIIDVGTRPSFRFPMVMAALRNGKHVYDALPFATSVA
FT                   DADAMRDAQKAAGVVGVVDAQFRWSPPAQQMKAMIDAGYIGKPLGFHVQLFLPLIVEND
FT                   KPYCYSAWSGNTDPYYWLAEKSSGGSGWRNFATHSLLFLTHLIGPVEEATGLLATGVPE
FT                   WFLPNGDVLRPETHDLGTATLRMANGAIGSLQAGWCVPDTEGWRVEVWGDRGRLLLSDS
FT                   SFGNLLSARLYAGDARLMPYGERACAEVEIDPAFYMVPGTTGGETGPRPFVAMDWMFAN
FT                   MAAAIRSGREGSPSFTEAAAVHRVVEAVERADAERRWIRMDEMG"
FT   gene            311704..312666
FT                   /locus_tag="Swit_0295"
FT   CDS_pept        311704..312666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0295"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66666"
FT                   /db_xref="GOA:A5V300"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V300"
FT                   /protein_id="ABQ66666.1"
FT                   /translation="MDRIDFSGQVAVVTGAGGALGGAFCRELARRGAAVVANDLGGSTT
FT                   GEGGSADYADAIVRELRAAGARAVANYDSVASAAGGQAIVDTALRHFGRVDIVISNAGN
FT                   QRNAPFGTLTEEDVEAVYAVHVKGAFNVCQPAYREMVRQGYGRLVLVGSQSGVFGNPMR
FT                   ANYGSAKTAMIGLMNVIAQEAPAGIAVNTLFPNAQGGRLGGTPLAERPDIDFLKAAGER
FT                   TRHFADAMKPEFVAALACYMASRQCDGSQNMYSVLGGKYSRLFMGLTEGWYAPGPDAPS
FT                   CDDILAHIGEIDDRSRYAVPLSGLDEMDTVLAAQRAAHG"
FT   gene            312659..313564
FT                   /locus_tag="Swit_0296"
FT   CDS_pept        312659..313564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0296"
FT                   /product="Palmitoyl-CoA hydrolase"
FT                   /EC_number="3.1.2.2"
FT                   /note="PFAM: acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66667"
FT                   /db_xref="GOA:A5V301"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A5V301"
FT                   /protein_id="ABQ66667.1"
FT                   /translation="MADGGTGQAGDAAMRVSAGEILAIEPAGGDRFIGGAGGVNHIGTV
FT                   FGGRLVAQALLSAVRTVAAMPPTSLHGYFLAPAQVSLPIEYRVARLRDSRRFAHRQVTA
FT                   VQEGRAVFTLLCQFHAPEDGFVHQAAEMPDVPPPEEVATLQQFVRDNGDRLDFAAIRNF
FT                   SGALPIEMRAIAPEAYFYERPREPMRDFWFRLPGAAAIDDPREQACLLAYASDYWLAGV
FT                   SATPHGFPTNSSSLLISSLDHGLWFHRPVRCDEWLLHHTHSPAAADGLGFAQGRIFDRE
FT                   GRLVASTTQECLLRQLPPEA"
FT   gene            313585..314433
FT                   /locus_tag="Swit_0297"
FT   CDS_pept        313585..314433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0297"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66668"
FT                   /db_xref="GOA:A5V302"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A5V302"
FT                   /protein_id="ABQ66668.1"
FT                   /translation="MAFTDTPLAPAIGSVVEGLDLSRDMSEPTMRRLLALLFDRGVVVI
FT                   PGQTIDDAAYVRFASFFGTPLDFFIPEHRNADFPAIIRINNDPATPAAMRDGAVHWHSD
FT                   SSYESVPGCVTMLFGKEAPDQGGETHFASTSAAYADLPEATRARIDGLVARHELGRAPW
FT                   IEGETRPDPNRPPRKTDAPSHPLVMVHPVTGRKGIFTSGTAYAIDGMDDAEATALIREL
FT                   REHVAKPAYRISYKARPGDIVLWDNFGTVHCASPIEYSNEAGKRRLLHRISTKGMPALC
FT                   S"
FT   gene            complement(314443..315792)
FT                   /locus_tag="Swit_0298"
FT   CDS_pept        complement(314443..315792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0298"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66669"
FT                   /db_xref="GOA:A5V303"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5V303"
FT                   /protein_id="ABQ66669.1"
FT                   /translation="MRRGWRCAVIRFARVASRAQDCSLRSRRADVRADRTAMGEAHDGR
FT                   SHGAMVVHEWRQAWRPGLAALIGGSISYSLYAAVSSLFVEPLQAQFGWSRGQIALVHSF
FT                   GLVTAFAAPVVGALTDRYGVRPVLSTGLVLTAIGYALLALMRGSLDYYYAAYFFFSLVG
FT                   MSTTGITFTRILSGAFHHTRGTALAIGRSGLAVAGALVPMALFPVIGHYGTAGGYLLLG
FT                   GLVLMLALPLVWFWVPAKAQERIGAAAAHGLADSWRVLLAQPKVRILTAAAVLNYVPVV
FT                   SLMSQMKPLAVSKGLEASMAVAAVSTLGLAAAAGALLSGLLVDRFWAPAVAFVLNALPA
FT                   VGCLFLLQDHVPPVMFYGAILLIGLGQGAEIDIVAFMIARYFGLRSYASIYGVSTLGIA
FT                   LGVAFGASMIGKGYDMFGNYNFALMAASASFALAACCYLAMGRYPERQPD"
FT   gene            315865..316662
FT                   /locus_tag="Swit_0299"
FT   CDS_pept        315865..316662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0299"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66670"
FT                   /db_xref="GOA:A5V304"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5V304"
FT                   /protein_id="ABQ66670.1"
FT                   /translation="MSDILVERRDEGIAVVTINRPERLNALTREAVAALNATLDGIAAD
FT                   PGCRAVILTGAGRGFCSGQDLAAANARKGDRASGVIEKLFWQEQFAGMGKRLRSMPQLV
FT                   IAAVNGPAVGAGMAIALSADVRIATPSARFLVAAVRIGLSAGESGISYLLPRMIGIPRA
FT                   FDILLTGRPIEAEEAERIGLVLRLAEPAALVDEAIGYARAVLANSPYSVAHSKKLMWEN
FT                   LDASFDAAIGAENRTQILATMTQDYAEATAAFVEKRPPRFEGR"
FT   gene            316680..317468
FT                   /locus_tag="Swit_0300"
FT   CDS_pept        316680..317468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0300"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66671"
FT                   /db_xref="GOA:A5V305"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V305"
FT                   /protein_id="ABQ66671.1"
FT                   /translation="MDLGLTGKRALVTGSSSGIGAATARMLAEEGCAVVVHGRDAARAE
FT                   AVAAGIRDGGGTAHVALGDLATPDGADGVIAAVRAIWPEGPDILVNNAGGSAASPQPWE
FT                   EIGDATWLASYQKNVVAAVRLIRAFLPMMKTRGWGRLIQVGSASGAQPVPVLPDYAAAK
FT                   AAINNMSVALARTLAGSGVTANTVSPGRTLTPAVERAFAGRGANAAWSADQGDGGSVGA
FT                   VAIGTPEDIAFAICTIASPRSGFVTGANIRVDGGQVKGVN"
FT   gene            complement(317507..318259)
FT                   /locus_tag="Swit_0301"
FT   CDS_pept        complement(317507..318259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0301"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66672"
FT                   /db_xref="GOA:A5V306"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5V306"
FT                   /protein_id="ABQ66672.1"
FT                   /translation="MRQRSRAALRRAPAMPPPEREWLDRAGRSAHPDGMAGHPSRSYKS
FT                   TPMAIIEAAERLFGSYGIEAVSLRQIGLEANVANKSAVNYHFGDRAELIRAIWQHRLPT
FT                   LEARRKMLLRQMHERGETRDPHAVARLLVQPNYELLDAQGVHRYTAFFRHALRWRQGQE
FT                   LRAREMGTTPASLEAISLLKDLAGDIPEDLLMHRLRYACCSLFDMIFDRDCDVAEGRPV
FT                   MPEDAFLAEGIDMIVALCLRPARHPRPV"
FT   gene            318450..320837
FT                   /locus_tag="Swit_0302"
FT   CDS_pept        318450..320837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0302"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66673"
FT                   /db_xref="GOA:A5V307"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5V307"
FT                   /protein_id="ABQ66673.1"
FT                   /translation="MRCRTIFLSGCAFALNALPSMGMAQTAVPPQAAEAADVAAGDIVV
FT                   TARRREESIQDVPISVSALSGEQLRRQGVTDAQSLQYATPSLSITSAQSQRNTVAFALR
FT                   GQRTQETQLFTDPPVGTYFAEVVQPRPYGFGKTFFDLQSVQVLKGVQGTLFGRNMTGGA
FT                   VLVEPAHPELGSFSGEVRGQYGNYDMKDLYGMVNIPVGDNFAIRVAGKTRKRDGWAHEV
FT                   TTGRDYDNQDFNTFRVSTLWKPIEGLETLTVGDWYKSKEHGTAAFITDLRLPSVISNYE
FT                   GLRAAGLITANIPAQYAAARDMFYKKHFTLDMGAGEGGNLDVFGKPYENIKNWGITNKT
FT                   TWELSDTITLKNIFGYRRLQRDQVQDYDGIPAFLITPYQYARSRNISEEFQIQGKAFDR
FT                   KLDYIAGLYYFEEKGKDGSLANTLPELNIVGAGQNPRTASATQFVTANPGVGYSRTAAA
FT                   FLAGTFHATDQLSLSGGLRYNYDKRKITVSPSLPFRTNPAGGTGVCSFDIDAATAGTQT
FT                   VPFDQCSFTNQKSFKEWTYDATVQYEPSANVTAYASYRHGFRAGGFSTRATSYVTLAPF
FT                   LPEFVDEYEIGLKTSTRIGSSGRLTTSTAIFRQDGSDVQKQRATFVNGNVFTVIDNTAK
FT                   QRNSGGEFEATLSVPNFSLTGFYSYTKVKILRGAAVSAIGPEIAQRGTPKNQAGFTATV
FT                   SPPISEDVGQLNLIGNFTWRSKNYLDDFEVSGVQPAFALVNLRAELNDIGGSKASIAFF
FT                   VNNATNEVYRIGVLGLVAEGLGFSSSVYGEPRMYGVELGYKF"
FT   sig_peptide     318450..318524
FT                   /locus_tag="Swit_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.410 at
FT                   residue 25"
FT   gene            320929..322011
FT                   /locus_tag="Swit_0303"
FT   CDS_pept        320929..322011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0303"
FT                   /product="protein of unknown function DUF227"
FT                   /note="PFAM: protein of unknown function DUF227"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66674"
FT                   /db_xref="InterPro:IPR004119"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5V308"
FT                   /protein_id="ABQ66674.1"
FT                   /translation="MVEIVHRPALPLPLSPEQVDAGWLSRALGQTTPGAVVAAADIVDI
FT                   VWGTSTKIRVRVDGHDGQGAALPATLIVKGGFEEHSPRMAAMYANEARFYADIQPHVPM
FT                   PSPRCWFAGSDPASHQSIVIMEDLRRDGLAFCDPLQPQDFEPIARRLEVMAGYHAATWQ
FT                   SPRFEPGGSWSDIHSRFESWGLDYMRRYLVADVWAHYMASPRGAAVSRRFHDRAWMERA
FT                   LLRIGEIQHAQPRCLIHGDTHLGNLYVAEDGTPGFFDAQVARTAWHHEVSYHIVCAADL
FT                   ADRAEWERPLLDRYLRAMARHGVALDAEAAWLDYRRSIAWGLFIFLTNEVRFQTESVNT
FT                   AYAARFSQAALDHELKELLP"
FT   gene            complement(322008..322832)
FT                   /locus_tag="Swit_0304"
FT   CDS_pept        complement(322008..322832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0304"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66675"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V309"
FT                   /protein_id="ABQ66675.1"
FT                   /translation="MPEPLSYHDRLAGQAAIVTGAGAPGEEMGNGRAIALLFAREGARV
FT                   CVVTRDRANAERTVAMIEASGGEAVACTGDVTRAEDCERIVAEALAAFGTLDILVNNVG
FT                   RGFGGPKLADIDDATWREIVDVNLTGAFHMCRAAMPALAEGRGKAIVNISSTAGQRAHG
FT                   SLGYGPAKAALDAFTREIATVYGRQGIRANIVSPGHLHTPHVANNPQLAPLREKRRKVG
FT                   PLGIEGDAWDVAAATLFLASPEARLITGVLLPVDAGVSQIAGMTGHSLIESP"
FT   gene            complement(322843..323589)
FT                   /locus_tag="Swit_0305"
FT   CDS_pept        complement(322843..323589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0305"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66676"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V310"
FT                   /protein_id="ABQ66676.1"
FT                   /translation="MNRRFEGKVAIVTGAGAGIGRACMARLASEGAIVVGTDVNQAKLD
FT                   DAVAAAGANAHGMICDVADQAAIDAMVADVVARFGGVHVLINNAGIGNPRRLRLHEQPP
FT                   EDWDKVMGVNVRGVYLMQRAVIPHMLRQGGGSIVNMASTGSFRATALSSPYITSKGAVL
FT                   MMTRAAAADYARDNIRINAVCPGTTNTDILANSSAEMIEMLVARSPQARLGEPEEVAAL
FT                   VAFLASDEAPHIHGGAYLIDGGRSAV"
FT   sig_peptide     complement(323512..323589)
FT                   /locus_tag="Swit_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.608) with cleavage site probability 0.295 at
FT                   residue 26"
FT   gene            complement(323586..324074)
FT                   /locus_tag="Swit_0306"
FT   CDS_pept        complement(323586..324074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66677"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A5V311"
FT                   /protein_id="ABQ66677.1"
FT                   /translation="MKFEGDFYQIGVVVRDIDAGMEQYRRLLGLGPFWRLDTDYEGRYR
FT                   DWRGRFANRNAFTRWGDVYLEMIEPVIGEGNAKEWLETRGEGIFHLGYAVDDLGQRPGG
FT                   VECVFESWGATMPNGDAAVVHLDTVAQLGYFVELSDRALVAKLNARIDQHMIEQGASA"
FT   gene            complement(324089..325228)
FT                   /locus_tag="Swit_0307"
FT   CDS_pept        complement(324089..325228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66678"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V312"
FT                   /protein_id="ABQ66678.1"
FT                   /translation="MSGFDPTDADALHEEAIARTGRSDFGDDGYREGLGVLIDAIRASP
FT                   RHDRIAPRFGAMAVNLLVGRLASQAGWNAHPELLDDPVPAPLIITGLPRSGTTILHFLM
FT                   SVDPQFQWTPRWVGEAPLIRPPREEWESHPQYRQVHDRLEATFAANPGLRAAHDMGAAL
FT                   ADECITVMSQSFMTNTFNSTLPLPDYRRWWYEADEEPSYRRYKDNLRLMGARARDRTWL
FT                   LKNPSHSYGMDAMLRVFPDARVVVLHRNPVETIASGASLIWRNGQLFEKAETGPIRLDI
FT                   FARAVERMREARERHPGAAVLDVHYRDLIADKLGTVRRIYRHFGLTLSAEAEAAMQAFI
FT                   GDNPQGKHGRHDYSSGEFGITDDQVRDRFADYIARHDLA"
FT   gene            complement(325225..326457)
FT                   /locus_tag="Swit_0308"
FT   CDS_pept        complement(325225..326457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66679"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="UniProtKB/TrEMBL:A5V313"
FT                   /protein_id="ABQ66679.1"
FT                   /translation="MAISVEEREKLRAAWNGHCDALKQVASEAIDGALGDPADGGELAE
FT                   LLRSIARLAAMSLQHRLDFNDPDFPLFLRQMDDRYRYGGPDNNIAYFMAALRGDATYRL
FT                   RGNNGGDGRSVNIGRLWHDNIATAANGDFEVVVSAEEQPGNWTPIAPGLTGDTGIPDQY
FT                   PTAGNGITVRRYDWDWDRDLPPGWLTIERIDPGAPAYPPALSPDRLADQIANATRLFLA
FT                   AARWWNQRAANVRADNPPNAITPPSTEPPGVRDFKPPMTGGKAWLYYGIICLDLAEDEA
FT                   ILIETDLPDGPYWSFTLYNMWWEAPDIMNRQTSLNARQAHVDGDGKARFVISARDPGVP
FT                   NWLDTGGARRGFLHYRWFRPDQTIPTPVSRLLKVDAVRAALPADHPAVDADARRATLSK
FT                   RREQLARRFQR"
FT   gene            326572..327534
FT                   /locus_tag="Swit_0309"
FT   CDS_pept        326572..327534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0309"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66680"
FT                   /db_xref="GOA:A5V314"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5V314"
FT                   /protein_id="ABQ66680.1"
FT                   /translation="MLCDPDTQRASLAPLRDLARLSERLASELDGQAGMQPLRLDLLHD
FT                   ARLGEAPLSESRPIAFRPGGERYDLVYVAAGEDPATGDEWGDARLSEWLRWHHDRGAWV
FT                   VGLGSGVLALAAAGLLDGGPASIPPRHARLARQRHPDIRLAHVGAIAEHDRVLTAAEPS
FT                   SVFALVVAMTRRFHSHGLAERYRRACGLPETAVPDNALLPMRSNQDLLIAEARAWIIAH
FT                   MHDAIDTNAVAAQFHVSARTLARRFERSMGISPARYLREARLDAARSMLHRTRFSIEQI
FT                   AHLVGYRDVGFFRDLFRKSSGCSPRAYRMAAQAGTASPS"
FT   gene            complement(327507..329108)
FT                   /locus_tag="Swit_0310"
FT   CDS_pept        complement(327507..329108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0310"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66681"
FT                   /db_xref="GOA:A5V315"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5V315"
FT                   /protein_id="ABQ66681.1"
FT                   /translation="MDDAASPHFSGLTISLDHTLPALIAHVAETYGDTPFVVGEDGRAT
FT                   SFAAFRDRADRLAAALVAHGVAYGDRVAIWAPNSPEWMVAASAIESIGAIMVPINTRFK
FT                   GAEALYALGKTRARVLFTVAGFLGNDYAAMLRQAGGGAGVVHPVAALPNLREIILLDDA
FT                   SLAAFEADRCSDAELAARIAGVRSDSIADILFTSGTTGFPKGAMHDHGQALWMVANWNR
FT                   SNDLRAGDRALIVNPFFHSFGYRSGWVSGLVAGMTVFPVASFDPEAVLKLIERERISVL
FT                   MGPPTIFTTLMEHPRFGAYDISSLRVGHTGAANVPVDLIRAGREVFGFDLFLTSFGQTE
FT                   TTALVTVNYPDSDFETIARTVGVPLPGVEVRIAEESGELLVRGPNVMRGYFEDPEQTAA
FT                   TIDAEGWLHTGDVACLNADGTVRILDRLKDVVIVGGFNAYPAEIEHVLRAHPAVADVCV
FT                   IGWPDDRMGEVCAACVIPRPGAALSLAELTAWSRERMANYKVPRHLFLVEDFPRTPLGK
FT                   IQKFVLRDQLGDAVPA"
FT   gene            complement(329111..329542)
FT                   /locus_tag="Swit_0311"
FT   CDS_pept        complement(329111..329542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0311"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66682"
FT                   /db_xref="GOA:A5V316"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A5V316"
FT                   /protein_id="ABQ66682.1"
FT                   /translation="MAKLDDKQEAGIGFITGIMGEAFGSAFRDSAASDRFGAPITRMAA
FT                   TACFHDAWQHEGIGRKEKSIAIIAMLVAQRQPLELKNHVKIGIANGLTVAELEGILVQL
FT                   APYVGFPCIATATTAVIEAMREAGVSPDGLQTSEERGLL"
FT   gene            complement(329570..331306)
FT                   /locus_tag="Swit_0312"
FT   CDS_pept        complement(329570..331306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0312"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: amidohydrolase; D-aminoacylase domain protein;
FT                   Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66683"
FT                   /db_xref="GOA:A5V317"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5V317"
FT                   /protein_id="ABQ66683.1"
FT                   /translation="MSAEFDIVIRGGTVVDGTGAPGFQADVAISDGAIAAVGTVAGKGR
FT                   EEIDATGLTVTPGFVDVHTHYDGQVTWENTLAPSSNHGVTTVVMGNCGVGFAPSRPEHR
FT                   QLMVKLMEGVEDIPEVVMTDGVPWKWETFPEYLDFLDTRRTDVDFAAQLPHSPLRVYVM
FT                   GERGTNLEPPTEADLAEMRRITREAIEAGALGVTTSRQLAHSFRDGRPAPSTKTEVDEL
FT                   KALAGGLKDAGAGVFQIIPNTNLPTPHEWEVIETLNETSGGKSVNFSLFTGSQVVGGPE
FT                   PLLEGLARAKQDGRRIQGQFFPRPIGMLFGIELSYHPFSLNPSYKQIEHLPLEEKVARM
FT                   RDPAFRQQLLSEQPEDPNPFFLWVVQQTHILFPLGDPPNYNPHPSDSIKARAETLGIDE
FT                   RELMYDELLRQNGKAIIYCPMGNTENNRFDAAVDLFGKPGTVLGLGDGGAHYGMICDAA
FT                   YPTYMLSEYVRDSHKMPIEQAVSMLSRETAETVNLFDRGVIKPGYKADLNLIDLDRLHL
FT                   YAPRVRHDLPAGGKRLSQQSDGYEATIVSGEITYRRGRPTGRLPGRLVRHGRPAPALAA
FT                   AE"
FT   gene            331618..332850
FT                   /locus_tag="Swit_0313"
FT   CDS_pept        331618..332850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0313"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66684"
FT                   /db_xref="GOA:A5V318"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5V318"
FT                   /protein_id="ABQ66684.1"
FT                   /translation="MSSQAQPKSADRTPLYAGPIFDADTHFWETDEAWTRYLPRDAAEK
FT                   YGISFKTGEDGDFAMYVGPRKVEISADHLFEDGRVPAPGKLHEWLRAMKEGKAEIDLHV
FT                   PKTADMMEPAARVEKLDGWDVRSSILFIGNMITAISFLDDPRYAYPVLNAYNGWMYDQW
FT                   KYNYDDRIYTAPIVTLDDVDEACRQLRDVIGKGAKLILMPMGPYNGKAPAHPDHDPFWA
FT                   IANEAGLRVVFHVSEAIYMKHHMAVWGEPVQQSRIKQTAFVWMHGYSERPVVETLSSFI
FT                   FWNFFARFPKVKLLSAENGAEWVPAMLTKMDKCRGIAKNGFWPGGQLKDRPSRIFAEHV
FT                   SVVAYPEDDLRSIVDQVGTADWLLMGSDYPHAEGVEEPRIFADEACRGLSAGDTRKIMY
FT                   ENGMRFMGLPY"
FT   gene            complement(332866..333675)
FT                   /locus_tag="Swit_0314"
FT   CDS_pept        complement(332866..333675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0314"
FT                   /product="Transcriptional regulator IclR-like protein"
FT                   /note="PFAM: regulatory protein, IclR; Transcriptional
FT                   regulator IclR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66685"
FT                   /db_xref="GOA:A5V319"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V319"
FT                   /protein_id="ABQ66685.1"
FT                   /translation="MTTSPKAEARTVKGPRAIGRVLDLLMLLSKHRDGLGLAEISAAMA
FT                   VPKSTFLDTLRGLCDMRYLVQEEGRYRLGPVAYRLAGRIMSTWSAPEVVRQPLKALART
FT                   THESVGFAIADWEIGQAIYTEAVNSTQPVRYAMHVGIRAPLYASAAGRVLLAHAPPARV
FT                   SAYLKRAKLRPLTESTRITEADIMADLEEIRRTGYCASFGEMLSDTAAMSVPVFGPDDE
FT                   PIGAMMLAAPLDRMRNSYDAFLQLLIDAGHEASGRPVTAVPELLSGD"
FT   gene            333812..334651
FT                   /locus_tag="Swit_0315"
FT   CDS_pept        333812..334651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0315"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66686"
FT                   /db_xref="GOA:A5V320"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V320"
FT                   /protein_id="ABQ66686.1"
FT                   /translation="MATSDSRTIKSAHRVLEILEYFDQDRRHATVMDMSRTLSYPQSST
FT                   SELLRCLTRLGYLHYNRFRRTYSPTARVALLGAWVKPALFRGGPVLSAIDRVSDLVGET
FT                   VILSTASNYVVQHLHVIHGQEEDAIDAHVGDTLPLLHSPQGKLLLSSYQNDHIRSAVHR
FT                   LNAEEGDASRHVRLADVMEEMAALREKGWLVTDEEDGSGCIAVLLPARRGMDRLVISVL
FT                   ASREVIEQRSGEIIAALLDHRDEIDAVEGAEVREMTESNLARMNDNVKIVSYRRHFA"
FT   gene            334667..335632
FT                   /locus_tag="Swit_0316"
FT   CDS_pept        334667..335632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0316"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66687"
FT                   /db_xref="GOA:A5V321"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V321"
FT                   /protein_id="ABQ66687.1"
FT                   /translation="MSPPANIGLLAGTADGVRFEPQAMPDAPGPDGLTVRMLFAPVNPA
FT                   DLLAIDGGYAFALAADDPLGAEGVGVVEQAGSRVSDLGPGDLVLPLDRGNWTRYRAVAR
FT                   DRVLAVPPGVDPRQAAMMRINPATAWLLLAASGAGPGDCLVQNAAGSTVAHWVRRLAAL
FT                   RDVAVIDVVRPGASAPGLADDEHLEAAVKAASGGRRVRAALDCVAGDATGRMAACLDAE
FT                   GTVLVFGHLSGEPSTIRSQLLTGRGLTVRGFSLRPAEARMTPAARDAMVAGLWAAAGQG
FT                   AVELPIRAVLPLAEAERAIALARTPGRGRVLIDLDAISGM"
FT   gene            335709..336869
FT                   /locus_tag="Swit_0317"
FT   CDS_pept        335709..336869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0317"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66688"
FT                   /db_xref="GOA:A5V322"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5V322"
FT                   /protein_id="ABQ66688.1"
FT                   /translation="MNLEFTPEEIAFRDEVRAFFREALPDDLRRKMINREHLEKDDTVR
FT                   WQRILNARGWAVTHWPVAYGGQPWTPAQRYIFQEEMALAHAPEGSPFNVNMIGPVLCRF
FT                   GTDEQKRRFLAATANIDIWWCQGFSEPGAGSDLASLKTSAVRDGDHYVLNGQKIWTTQA
FT                   QHADWMFGLFRTDNSGRKQQGITFLLLDMRTPGITVRPIETIDGGHDANEVFFDDVRVP
FT                   VANVVGEEGKGWDVAKHLLGSERSGIARIGLSKERLSQLRSLERRLAAEGVLTPAERER
FT                   LAFKLAEVEVELRALELTQLRVVSADAHGGGANAAASILKVKGTEMQQRMTELVLELAG
FT                   PAGLATAGHDWLAAAAPFYFTMRKVSIFGGSNEIQKNIIAKTMLGL"
FT   gene            336876..338006
FT                   /locus_tag="Swit_0318"
FT   CDS_pept        336876..338006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0318"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66689"
FT                   /db_xref="GOA:A5V323"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5V323"
FT                   /protein_id="ABQ66689.1"
FT                   /translation="MDFELTDEQKMLSETVTRFVAETYDFLKREHALRSADGWSREAWA
FT                   ALAEMGLLGLPFAEEDGGFGGSGVEMMLIMEALGRGLMVEPYFATVVLAGGVLRHGASA
FT                   AQRGAIVPGLIAGERILALAHDEAGQARHTLAARTSARPSGDGWIIDGAKIAVIHGRSA
FT                   DTLIVSATTGEGLGLFLVDAKADGVAIEAARGYDGVPVASVRLNGVAVGADALVGGAGG
FT                   GAAILERSFDEARAALAAEAVGAMAETLDVTVDYLKTRQQFGVAIGSFQALQHRAVDML
FT                   MQVELSRSMAVLAALSLDGDEDQRRRNIAAAKAQIGKSGRMVGQDAVQMHGAIGITAEY
FT                   KVGHAFKRLTAIDALLGDRDHHLTRLVELGGVYPAE"
FT   gene            complement(338035..339021)
FT                   /locus_tag="Swit_0319"
FT   CDS_pept        complement(338035..339021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0319"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66690"
FT                   /db_xref="GOA:A5V324"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:A5V324"
FT                   /protein_id="ABQ66690.1"
FT                   /translation="MTVAALNRPEAEDIKVADVRPDRELESCNHLLDDHDALERFYDEN
FT                   GYILLRGVFDQASVAEARDAMLRVAETLGLARADDPDGKYTGGAFDGGMEESYIYSGIA
FT                   ARLIEHPVNLAVMEKVLGEPACAVPIVQYRTYPPNGPTTVVHQDGFYSPGIQDYKPVWI
FT                   TLTPCTREMGGLALAVGQNKRGYFHNTAKPAPYPIPRDAIPDDAWATTDYMPGDVLIVN
FT                   PFTPHCGMPNRSDRLRISFDSRVQSAANPSAIAATVKAVTPDSITVDAGARGELTVKVD
FT                   ADTFIRVLHPGKREPFEGFADYTVPGMRLVVVRDGDRAVMLRKASEG"
FT   gene            complement(339134..340102)
FT                   /locus_tag="Swit_0320"
FT   CDS_pept        complement(339134..340102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0320"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66691"
FT                   /db_xref="GOA:A5V325"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V325"
FT                   /protein_id="ABQ66691.1"
FT                   /translation="MGGFRGHQAIGTVAAIGGGVIGGGWVAAFLGSGRAVRLHDPAPGA
FT                   EARIRAHVTQAWPQMAALGLARADDDWTGRLSFHETIEDAVEGTDFVQENTPERSDVKR
FT                   ALFAELDRLVPADVLVGSSTSSLPISDLQAGLSTAARFVLGHPFNPVHLIPLVEVGGGD
FT                   ATDPAAVDTALAFYAALGKEPVRLNREVFGHIGNRLTSAMFREAVRLVAEGYASVEDVD
FT                   KAIRFGPALKWAIQGQFTTFHTSGGAGGLAEFLPKFVPGILKRWETMADPPLGDPALQA
FT                   ELVRQMEAATDGRSVEEIARRQDALLMAMLALMGRDQAGQP"
FT   gene            complement(340108..340947)
FT                   /locus_tag="Swit_0321"
FT   CDS_pept        complement(340108..340947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0321"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66692"
FT                   /db_xref="GOA:A5V326"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5V326"
FT                   /protein_id="ABQ66692.1"
FT                   /translation="MMSDDNEFQREIDYSEFDFLTVDIGEDGVAVVTMNDPDTLNAVGP
FT                   HNHWQLEDIWLKLARDERIKVIVLTGAGKAFSAGGNIKLMAERAQTEYGLKYALRVPIN
FT                   TLRIWDQILMTPQPIIAAVNGDAIGLGTSLFAFCDMSIVAEDARLGDTHVRVGLVTGDG
FT                   GSVMWPLLVGPQKAKEYLMRGKLLNGRKAEEIGLVNYAFPKEQVLDEAMKIAREIAGQP
FT                   IWAVRWSKAAVNKCIRDQVNLTGELSIAYEAMTMMTHDYKAATTAFANKEKPVFKGY"
FT   gene            complement(340991..343237)
FT                   /locus_tag="Swit_0322"
FT   CDS_pept        complement(340991..343237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0322"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase / short chain
FT                   enoyl-CoA hydratase"
FT                   /EC_number="1.1.1.35"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66693"
FT                   /db_xref="GOA:A5V327"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V327"
FT                   /protein_id="ABQ66693.1"
FT                   /translation="MRRRPDKASHSRYLRPAPALCLTVRAPDSFCGGRTIASTGPDQAI
FT                   MTQVNEKISTRVEGDIGFIRSDNPPVNALGQAVRSGVVEALDRLNADPAVKAIVLHCEG
FT                   RTFFAGADITEFNKPRVPPTLQEMILAIENSPKPVVAAVHGTALGGGFETALGCPFRVA
FT                   VPSARMGLPEINLGLFAGGGGTQRLPRIIGPEKALEFVLSGKPVGAAQALALGILDAVE
FT                   DGAPDAIGAAFARRVIDEKLPAVAVSRRDDRIAATRADPSAFDALAAKLTARSKGQEAP
FT                   AANVAAVRRSFTLPFDEAMAIDAEANRALMAGSQSRALRHLFFAEREAARIPGLPKDAR
FT                   ARDVASAAIIGAGTMGGGIAMCFAGAGIPVVIVDTTQEALDRGMERVRANYATSVKRGS
FT                   ISQEQVDKRLALITPATDRAAVADADLVIEAVFEDMAVKKEIFSDLEKRVKPGTVLASN
FT                   TSALDVDEIAAALDRPEDFVGMHFFSPANVMKLLEVVQAAKSSPEAILTAMAVGRKIGK
FT                   VPVWSGNCDGFIGNRMVAKRSAQAERLLQRGAFPPQVDAALTKLGFPMGPLTTNDMSGL
FT                   DIGYAIRKRRGTPFPIADAIVESGQLGQKTGSGYYRYEPGDRTPRPNPDTDALIVATSA
FT                   KLGIERREMSEGEMVERLLFPLINEGARIVEAGIALRPSDVDLVWINGYGWPRHLGGPM
FT                   FHADETGLAHIVARLREFAADTPDDPSLEPAPLLVELAAKGQGFSEWQKSRAAA"
FT   gene            343307..344461
FT                   /locus_tag="Swit_0323"
FT   CDS_pept        343307..344461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0323"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66694"
FT                   /db_xref="GOA:A5V328"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5V328"
FT                   /protein_id="ABQ66694.1"
FT                   /translation="MQFDLTEEQSMFRDAVAAFAQRHLAAGALERAHSDDYPWEVARMM
FT                   AEQGLIGITIPEEKGGLGGSLMDAVIAIETIASVCPRSADVVQAGNFGAIRTFAQFASD
FT                   AQKEQYLAPLLKGDGLISVAMTEPNAGSAVTELTTTAVPDGDGFRISGQKIFTTHGTHA
FT                   TVFLVYVRYGPGTGNIGSVLIERGQEGFSFGKPVRFLSGEEWNPLFFDNVHVPKDKVLL
FT                   GPGGFKQQMSGFNVERIGNTARSLALGRYAFNAAVEHAKTRKQFGRALCEFQGLQWKFA
FT                   EMKLKLDAAQLLLYRAATNADKGLPSPDETAIAKVACNRAGFDCANEAMQVMGGAGYSQ
FT                   DGLVEYCLRRTRGWMIAGGAIEILLNRIAEGVFDMRFPQGPARA"
FT   gene            344488..345816
FT                   /locus_tag="Swit_0324"
FT   CDS_pept        344488..345816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0324"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66695"
FT                   /db_xref="GOA:A5V329"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A5V329"
FT                   /protein_id="ABQ66695.1"
FT                   /translation="MNEISKVKTAGGTVRPDYVPADAYVSPDYVRLEKERLWPRVWQIA
FT                   CREEEIPNPGDFYTYDIADESIAVVRKTDGAIAAYHNVCPHRGRRLTAGCGRMGKFHCK
FT                   YHGWQWNLDGKPTEVVDRKDWGELLQDSEITLHPVKSASWGGWVFINMDPDSESLEEHL
FT                   GEAKTLLDPFEMDRMRYVWRKRITMPCNWKTAQEAFMEGYHVQTTHRQLLPYQDDYTFS
FT                   RAYGRHAMFGYAPTALFGLPSPRIGDQSGDMRKGLYEFNKEIWDTLKATTTDEMLAAGR
FT                   RLMELPETATPFEIYVAFATFHREESAKAGRPWPAITPEQQMAAGTDWNIFPNLVFLQQ
FT                   PTNVLFYRARPNGDDPDSCIFEVNVMERFAEGAEPRNVEVEVADDWRTVDWGLILEQDF
FT                   QNMEAVQKGMKSRVFKAARPSPVQEVEISNFHATLLAYLHGGQ"
FT   gene            345816..347468
FT                   /locus_tag="Swit_0325"
FT   CDS_pept        345816..347468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0325"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66696"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5V330"
FT                   /protein_id="ABQ66696.1"
FT                   /translation="MAATNWDETADFVICGSGGGSMAAALYLKSIGKQPLILEKTDKLG
FT                   GSTAMSGGVLWIPDNHLLARDGIADSHELGRMYMDATVGNDAGPAASPERKEAYLRNGP
FT                   VMMKWLEEQGMQWLRTEGWADYYDDRPGGCTRSRSVGAPMLDARKMGPLFDKLRLGPMV
FT                   MPLPTDKAGIIGLATRTPRGMWEGMKLLFRMWLVKKRGAPLLSFGGALQGRMLMLADKA
FT                   GVDMRTGHGVVELVEEKGRITGVVVEHEGRTLLIGARDGVLINAGGFSKNAEMRKKYGP
FT                   QPSSVEWTNANPGDTGEMIEIAERHGAALDLMDQAWWVPGTMVPEGGPANMHNTDISKP
FT                   HCIIVNRQGRRILNESGSYMENGQRLYRNDVPAYVILDSRHRKRYAWGYYPPGKTPQSW
FT                   LDSGMMKTADTIEELAAKAGIDPVGLKDEIAKFNRYCETGKDLDFNRGGRGYDNWFGDP
FT                   TVKPNPNLGKIDKPPFHVMEMVPGDVGTSGGMLTDEHARVLRADGSVIEGLYATGNSTA
FT                   SVMGRCYPAAGASIGASFVFAWIAAHHAVGAND"
FT   gene            complement(347634..348605)
FT                   /locus_tag="Swit_0326"
FT   CDS_pept        complement(347634..348605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0326"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66697"
FT                   /db_xref="GOA:A5V331"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5V331"
FT                   /protein_id="ABQ66697.1"
FT                   /translation="MPDFALVALDGAYHASVGALTDSFILARDRIEQVFADSGPMRMET
FT                   RLRILSLDGGPIRMSDGRRLDVDGAISSVDDHGFVWLPAFRVMGIPALEERLARSHALL
FT                   PWLRQQAAGGAVIGASGASALILMAAGLTHDVAVPIARALQPVARAMFPRHRAEERLAL
FT                   ADHGDLLIANGMAHDLALIVRVMERTLSPDVGRWLTSIMGLDREEEHLLASDPLVARAQ
FT                   IWLEQRFTGAIGIQELAEALSTSQPTLVRRFRKALGMSPKSYIQHLRLQAATRMLEKSN
FT                   RSIDRIAELVGFSDSRLFRAMFRQRTGMTATQWREASQARRG"
FT   gene            348746..349702
FT                   /locus_tag="Swit_0327"
FT   CDS_pept        348746..349702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0327"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66698"
FT                   /db_xref="GOA:A5V332"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:A5V332"
FT                   /protein_id="ABQ66698.1"
FT                   /translation="MTMAAPSLIPEMGEFNVSNHLLGDREGLKAAWERDGYWFFRDVLD
FT                   KQAIAELRQIYMDYLGELGVADPQDPDARYNGADLSAMPAMVNETAMNERRVDRVLHRD
FT                   PRIAAFFRRLFGCDPFWVPFTVHRQVPPARDRDARRLEFIHQDGTYNDGLDFLICWIPL
FT                   AEIAPEVGGLALVEGVHRRGSLHRKDGMKILPIAEADMEIGRWRSTHYRPGDVLLMDLN
FT                   TPHSGITNHSDRFRLSVDTRIMPSNGNVPVVGTIAAVSADGVTIGDRALRFDVTSFVRG
FT                   LRGDQMPLADIPGRYRVGQEVIAAVTGDLVRNMRPIQ"
FT   gene            349720..350538
FT                   /locus_tag="Swit_0328"
FT   CDS_pept        349720..350538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0328"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66699"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V333"
FT                   /protein_id="ABQ66699.1"
FT                   /translation="MPEPTRYLGRLAGKAAIVTGAGAAEDEIGIGRAIAYIMAREGAKV
FT                   ACADLDGARAEATAAQIRAEGGEAIAVAADVSLPEDCEALVETTVKTFGQLDILVNNVG
FT                   ISVPTNLESVTLDLWNRTIAVNLTSVMLMSKYAVPVMAARGGGSIVNISSLAGMRAMGA
FT                   VAYGPSKAAMAQLSREIGVLHGRQGIRVNTVAPGHVMTPHAMSKLPASMREARRKVGPL
FT                   GVEGDAWDVAQAVLFIASDEARFINGVHLAVDGGVEGIGPMVGHALISEA"
FT   gene            350535..351617
FT                   /locus_tag="Swit_0329"
FT   CDS_pept        350535..351617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0329"
FT                   /product="protein of unknown function DUF227"
FT                   /note="PFAM: protein of unknown function DUF227"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66700"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5V334"
FT                   /protein_id="ABQ66700.1"
FT                   /translation="MSDLRLPLLPEEVTAAWLGEALSVYAPGIVVERIEVTDILWGTGT
FT                   KMMITAAYDRAGRDAGLPERLCVKAGLAEHRELVKFCYQTEARFFAEVAPRLSIGLPRC
FT                   FFAAANADQGVVIMEDLRPAGAQICRVQQPLSRDQAAAFLDDLAALHARWWNGPALADG
FT                   GELGWLMRHDPLPDAAWGDFGRGQLQPETWAHYMGLPRSLGIPRVCRDRETMHAALQAL
FT                   RRFAPGGPTCVIHGDAHLGNMYLDAAGRPGFLDWQTARRGHWAQDVTYFYVSALDPLDR
FT                   RAWERDLIAGYLAALGRHGVADAPGEAEAWAAIRAHIVYGLFYWMVNPVEWQAEENNAA
FT                   VAPRFGWAAVDLGAPPAAAV"
FT   gene            351788..354121
FT                   /locus_tag="Swit_0330"
FT   CDS_pept        351788..354121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0330"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66701"
FT                   /db_xref="GOA:A5V335"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5V335"
FT                   /protein_id="ABQ66701.1"
FT                   /translation="MAFRRTCLLACAASLLPQLAAAQTASPPAEAEAAVTGAADSGEII
FT                   VTARRRAESLQDVPISVSAISGKALTQGGVTDALSFQSRVPSLSLTNQGTTRSELGFSI
FT                   RGQRTQESQLLTDPPVGTYFAEVVQARSTGFANTLYDLESVQVLKGVQGTLFGRNMTGG
FT                   AVLVEPAKPTDQLAAEVRGQIGNFDLRDAYAMLNLPISDGIAVRFAGKTHERDGFTKDV
FT                   SSGRDYDDQNYDTFRVSLAINPAENIESTTIFDWVRTREHGTALVGTAANPAAPAIAGY
FT                   AALRGFGIPVSDVLAQFAAQAARPHYRFDTAAGEDGTLDAYGVKPFEHLKNYGITNRSS
FT                   IDLGGVTIKNIFGYRRLKFNQIMDLDGVPAFLINSNRFRDIKQYSEELQAQGKAFDDRL
FT                   TYVVGAYYFLEKGTDGSTSSQFPELAIAGQGLPLTTPASTFLNAYVGQGRAKTGALYAA
FT                   GTYNFTNQFKLSAGIRYTEDKRRATVTAYYPNLGACLFRLADGTTPSLANCPQTNAKKW
FT                   DDVTWDVTLQYEPNDGLTAYVSTRRGFRAGGFSLRAASTAELAPFNPETVQEYEIGLKN
FT                   RADLGGGAALRTSLALFYQDYKNVQKQASSIDAAGNVNTIITNTARQKHYGGELEATLS
FT                   AGAIDLTAFYSYVKVDISKGRQPGEFELVGAPHHQLGANLSYRLPLSESVGAASLNANV
FT                   AYRSKQHLDKNDVLATEPGYALVNLRANLDNIAGTGFGAALFVNNATDKYYRIGVIGIY
FT                   NEAGYISSVYGEPRTYGLEVSYRF"
FT   sig_peptide     351788..351856
FT                   /locus_tag="Swit_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.929 at
FT                   residue 23"
FT   gene            complement(354181..355113)
FT                   /locus_tag="Swit_0331"
FT   CDS_pept        complement(354181..355113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0331"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66702"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V336"
FT                   /protein_id="ABQ66702.1"
FT                   /translation="MAGRLEGKVAVVTGAGRNIGRAEAMLLAEQGARVVVNDLGGGPYG
FT                   TEAADASLAETVAKEIRDVGGEAIGQCSSVATRDGAEAAVQAAIDRWGRIDILVNNAGI
FT                   VRPARIDRMTDEDWRLCVDVSLTATFHSCRAAARHMIGQRSGAIVNTGSPSGFGHWGMG
FT                   NYSAAKEGVLGLTRSIARDLGEFGVRCNMIRPVSHLTGTHTPEIDATIAESARLGIPLL
FT                   WNKPMAAPRMTALPEHVAALVAWLCTDAAGHVSGRDFYIQGDEVALIPEPEAIRTSFHP
FT                   GGWTLDAFDEEANRAYLFGDIPNRFVRRD"
FT   gene            355243..355476
FT                   /locus_tag="Swit_0332"
FT   CDS_pept        355243..355476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66703"
FT                   /db_xref="UniProtKB/TrEMBL:A5V337"
FT                   /protein_id="ABQ66703.1"
FT                   /translation="MEGEALSKDISDEESRRIMATATDVRPDENVHRDPALAPPPVAKA
FT                   RPVTSQESRVIMALATDMRPLENIHPERDEEA"
FT   gene            complement(355496..356446)
FT                   /locus_tag="Swit_0333"
FT   CDS_pept        complement(355496..356446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0333"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66704"
FT                   /db_xref="GOA:A5V338"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V338"
FT                   /protein_id="ABQ66704.1"
FT                   /translation="MIRFDGQVAIVTGAGGGMGRAYALELARRGARVLVNDYGGGVLGQ
FT                   QDGTPGPAEAVAAEIRAAGGQAEANGQAVGTADAARAIVRAALDAFGRVDILVNNAGTA
FT                   LAGSFTSHRDEDIERHYATNLIGGHHLMRAVWALMAVQGYGRILNISSNGALGVGGNAP
FT                   YAAAKAGMIGLTLDAAIEGRPLGILVNAVMPTSYSRMIEQIPDPATVAWFRDHLPPEQV
FT                   AAAMAWFLSRDCTLSGRIWLTGGGRLSSLVMAETGEVCDPTLGAEQVAGVLNRIIDESR
FT                   LTVVHDQAEAGARYFEHFPWTATASADFGPEVERG"
FT   sig_peptide     complement(356375..356446)
FT                   /locus_tag="Swit_0333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.758) with cleavage site probability 0.757 at
FT                   residue 24"
FT   gene            complement(356443..357327)
FT                   /locus_tag="Swit_0334"
FT   CDS_pept        complement(356443..357327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0334"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66705"
FT                   /db_xref="GOA:A5V339"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V339"
FT                   /protein_id="ABQ66705.1"
FT                   /translation="MAELDFTGRTAIVTGAAKGLGRAYARWLAARGCAVVASNRPAADG
FT                   GSAAQATVDEIVAAGGRAVAHDGPVESEAAAAELADLALSRFGGIDILVSNAGVVRWGE
FT                   FGAVTADDMREVIDINLWGCIHGLKAAWPAMTARGYGRIVLTASSAGLWGQMRSPAYGA
FT                   SKAAMIGLARSIALDVPEGADIRINVIAPAAYTPMSAAHFDEKWADYASADRVAPVVGW
FT                   LASDRCGSSGGIYHAGAGHVRRVQILEGPIEELSSGPIDEVMARLEPKPEWTSSFASGA
FT                   ELMPELANAANGS"
FT   gene            complement(357327..358085)
FT                   /locus_tag="Swit_0335"
FT   CDS_pept        complement(357327..358085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0335"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66706"
FT                   /db_xref="GOA:A5V340"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V340"
FT                   /protein_id="ABQ66706.1"
FT                   /translation="MGRLSGKVAIITGGGQGVGQGITQVFAREGARVLITGRTPDKLEA
FT                   AVAELKAAGGDAAWIAGTAGVRADAEAAVARAVELFGGLDILVNNAQTSRPGALFEDTD
FT                   DDLFALTINSGLYGTFQHMQAALPAMKKRGGGSIINFGSYEGIHGGIGFAAYAATKEAI
FT                   RGLSRTAARELGKHKVRVNVICPAALSPIAEQWVKDFPEEAEKVMKLVALGYLGDCAED
FT                   IGPAALFLASDDSRYVTGQTINVDGGQMML"
FT   gene            complement(358103..359446)
FT                   /locus_tag="Swit_0336"
FT   CDS_pept        complement(358103..359446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0336"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66707"
FT                   /db_xref="GOA:A5V341"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A5V341"
FT                   /protein_id="ABQ66707.1"
FT                   /translation="MDQPVQQMQPEITRRAKAGPDDFIPKEDYVSRDFARREAERLWPR
FT                   TWQMACREEEIPRVGDYVTYDVLDESIIVVRTAPDRIAAYHNACQHRGRRLAEGCGHAA
FT                   RLHCRFHGWSWKLDGTIAHVVDRDNWDGSLKDEDIALPKVRVDSWGGWVFVCMSEETEP
FT                   LLEFLAPLPEVFRNYPFERMRYRWYKSTGIACNWKTALEAFNEGYHVQTTHTQLLPVHD
FT                   DEALAHAEGRHGSYQLAPGRISLGERSPRLAARTVDYRHNVRDFVLMLEQDLKASIPPH
FT                   MAGLMDRLVEELPAEASLLDVLMKYGQIAYEAAGERGIPFPALTPEEIARAGADWHLFP
FT                   NMVFLPAPDAMLAYRARPDRDDPERCIFEVYSLLLYPEGEEPPLERQCFADWKDHDGWG
FT                   LILEQDFQNMTEVQRGMRSRGFTGSRTNPVQEKSVSNFHRALREFISE"
FT   gene            359620..360417
FT                   /locus_tag="Swit_0337"
FT   CDS_pept        359620..360417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0337"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66708"
FT                   /db_xref="GOA:A5V342"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V342"
FT                   /protein_id="ABQ66708.1"
FT                   /translation="MAQRWFVTGVAGGLGQALATALLDRGDIVVGTARRVAEAEAFARS
FT                   RPGAAHGIALDLDDHARIAAAVEQAMALAGGGIDVVVNNAGRSLFAPVEETPLDDAKAL
FT                   FATNLFGPMAVMQAFLPHVRRQGRGTFVTISSGCGLMGVPGLGAYCASKFALEGLCETL
FT                   AIEMAGFGGRMMLVEPGAVRTRFISHGTAEVGARGGHYGTLDGGKDLLDAYYQDKAMAP
FT                   EAVAAAILAALDGGDPPPRLVLGDDTRPGARAKFQALADMLAD"
FT   sig_peptide     359620..359679
FT                   /locus_tag="Swit_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.603) with cleavage site probability 0.544 at
FT                   residue 20"
FT   gene            360431..361618
FT                   /locus_tag="Swit_0338"
FT   CDS_pept        360431..361618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66709"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="UniProtKB/TrEMBL:A5V343"
FT                   /protein_id="ABQ66709.1"
FT                   /translation="MTGTDAAWADYQRVIDEARTRAMTSSWASTPQLRAQAAYYISMLQ
FT                   AFGFNLYMAPRQAYPTFFSHTIFTPVEYQWGAPSPDFRYHWTAIDGRRTYRIWGRRGNT
FT                   RWLDIQAQHGWWGDVDQRNLANWDIDEFDLGPDGSFEAIASADPQPGNWMKLDRDSHNI
FT                   CLLVRDVWDDWANADGATIHIECIDRDPADTVLLSEAQIAERLGKIAHMTSFSVDWYQD
FT                   MSDTVLREAGGPNRLWLPTLSVSNVGGNPRAVYIQMIYDLAEDEALIIDSEIPDCKYWS
FT                   LQLADPWFQTTDYRFHASSINDKQARRDADGRVRIVLSPRDPGVPNWVDTAGLLKGLGM
FT                   WRWYLSPSHPVPATRKVRLAEVRDHLPADTPIVSSAERAEMLATRQAQVARRFGF"
FT   gene            complement(361626..362069)
FT                   /locus_tag="Swit_0339"
FT   CDS_pept        complement(361626..362069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66710"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A5V344"
FT                   /protein_id="ABQ66710.1"
FT                   /translation="MDAIETLLAIEEVRAVKARYFRCVDTKDWAGFAALFAEDALFDIS
FT                   DDVPGGVIRGRAAIVEAASTPLARCRTVHHGHCPEVEILSPTEARAIWAMEDILRWDDD
FT                   DPDAPLRRLHGFGHYHESYEKRDGRWLITAMKLTRLIVDHEPR"
FT   gene            complement(362069..362866)
FT                   /locus_tag="Swit_0340"
FT   CDS_pept        complement(362069..362866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0340"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66711"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V345"
FT                   /protein_id="ABQ66711.1"
FT                   /translation="MGRLDGKVALIMGATRAGNMGQAIARRFIDEGATVVVSGRGREGL
FT                   DAFAAETGATALPCDVRHRAGIEALADAVVARHGGLDIAVNAAATGALAPFEEETEEQV
FT                   DEMLSIIFKGGLFFMQAVVGRMKRPVGRGGSIITVSSAVADIMSENHCSYMGAKAGLNH
FT                   MTRFVAHEYGRHGIRANILSPGLTVTPMLGGYDVPGMAEAYAREYPLGRIGTVDDIANA
FT                   ALFMAGDECFMTGETFHVTGGLTLRRNPTTAEIMASIAAAGAA"
FT   gene            363041..363949
FT                   /locus_tag="Swit_0341"
FT   CDS_pept        363041..363949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0341"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66712"
FT                   /db_xref="GOA:A5V346"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5V346"
FT                   /protein_id="ABQ66712.1"
FT                   /translation="MGMKWLKSTDCVAFDVRDNVARITLNRPDKRNALSARTIQELNQA
FT                   LLEADDRRDVNAILLSGAGRDFCAGYDLTDSYGGAADLSSDYDADRYRTRAGTLDDDIW
FT                   NLERQQELTLIMLDLHKPIVAKIQGNCLAGGTDLAFSCDIVLAADDARIGFPAARANGT
FT                   PPTNLWFYHCGPQWAKRMLFTGDTISGIDAARIGLVLEAYPADAIDAEADEMVRRIACV
FT                   DAEILATHKRVMNMQMELAGARLSQRYAAELDARAHLSQGPRRSQFRKDMAEKGLKEAL
FT                   TNRDAPFGNSRVALRARKPSA"
FT   gene            complement(364142..365287)
FT                   /locus_tag="Swit_0342"
FT   CDS_pept        complement(364142..365287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0342"
FT                   /product="Propanoyl-CoA C-acyltransferase"
FT                   /EC_number="2.3.1.176"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66713"
FT                   /db_xref="GOA:A5V347"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A5V347"
FT                   /protein_id="ABQ66713.1"
FT                   /translation="MRHGFPSGRTAIVGAATFGIGRCPGVSAVDMAARAAMLALADAGL
FT                   SLADVDALYTSAPYEALGGMELSEYLGLTPKVVDCNRTGGSAFEVYVQQAALALEAGLI
FT                   DCALIAYGSNPASNPPPGVGMTRQSPWEAPYRPVAPISSYALAASRHMHLYGTTRAQLA
FT                   EVAVAARRWAQLNPEAAVRDPLTIDEVLSARMISDPLTARDCCLFNDGAAAVVMVRADR
FT                   AKDCARRPIPVLGAAHAVTHREISSMPDLTVTGAAISGPQAFAQAGVTPADIDLAMVYD
FT                   AFTITPILFLEDLGFCPKGEGGRFVENGAIAPGGRLAVNTNGGGLSCVHPGMYGLFLLV
FT                   EAVRQLRGEAGDRQLERAELAVAHGNGGVLSSEATVVLARG"
FT   gene            complement(365290..365649)
FT                   /locus_tag="Swit_0343"
FT   CDS_pept        complement(365290..365649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0343"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66714"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A5V348"
FT                   /protein_id="ABQ66714.1"
FT                   /translation="MIQPEAEWRAHLAEGRFMIQRSRSTGGHVFYPRIVEPGTGADDLQ
FT                   WVEASGKGVVHAVTVVRKKDPADSYNVVLVDLAEGPRLMSRVDGIDVDAVRIGMDVRAR
FT                   IVEGEGKPLLVFVPA"
FT   gene            complement(365654..366424)
FT                   /locus_tag="Swit_0344"
FT   CDS_pept        complement(365654..366424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0344"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66715"
FT                   /db_xref="GOA:A5V349"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5V349"
FT                   /protein_id="ABQ66715.1"
FT                   /translation="MTISVEKRGAVAIVTLDRPETRNAITQEMRGQLYGAFEQIALDHD
FT                   IRAAILTGANGAFCSGMDVGGMGRGGVTGSMDRMYTLNRIARAIHTLKKPTIAAVPGIC
FT                   VGVGWSYALACDIVLAAEKARFAAIFRNIALAPDGGLVWQLRQQISVQKAKELVYSGRI
FT                   IGADEALAMGLVFEKTSDEGLMERAMELAESFAAGPSIAMGLAKRQFDLSWNAGFEQYL
FT                   DMEFTMQPIASRSEDHEEGLRAFREKRKPVFKGE"
FT   gene            366611..367789
FT                   /locus_tag="Swit_0345"
FT   CDS_pept        366611..367789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0345"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66716"
FT                   /db_xref="GOA:A5V350"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A5V350"
FT                   /protein_id="ABQ66716.1"
FT                   /translation="MKEAAIVATARTPIGKAHRGSLNNVHGATMAGHVIAAAVARAGID
FT                   PGEVEDVLLGSARCEGAVGSNVARQAALRAGLPVGVCGVTLDRKCSSGLQTIAFAAQRI
FT                   RAGEGGIYVAGGVETVSLVDPHRNTFRTRDDWLVEHKPEIYMAMNLTGDIVARRYSVGR
FT                   EAQDAFAVTSQARAAAAQQQGHFDAEIVPIDVTRNLVDKALAVTGQEDVRFERDECNRP
FT                   GTDIEGLAKLKPLFEGGTVTAGNCSQLSDGSSVCVVMDADEAARRGIPILGLYKGMQVA
FT                   GCEPDEMGIGPVFAVPRLLARAGLSVDDIDLWELNEAYASQALYCRDRLGIPQERLNVD
FT                   GGAIALGHPFGMTGSRMTGHALLAGRRLGARNAVVTMCIGGGMGAAALFELV"
FT   gene            367912..368892
FT                   /locus_tag="Swit_0346"
FT   CDS_pept        367912..368892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0346"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase, E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66717"
FT                   /db_xref="GOA:A5V351"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5V351"
FT                   /protein_id="ABQ66717.1"
FT                   /translation="MTNRAVPDAGTQIEIYRRMALIKANDERSRKVIMTGRLVMPYYSP
FT                   RGQEVIPSAISVSLTDEDYVCTIYRGSHDQLAKGLPLKDLWAEVAGRTTGTCKGKGGPM
FT                   HVTYPTKGIMVTTGIVGSTMPIANGLAWGSQLRGDGRVTVANFGDGAANIGAFHESLNL
FT                   ASVWKLPVIFVCQNNEWGEHTAYDKTSNVRVADRAAAYGIPGERVDGNDPFAMYAAARE
FT                   AIERARAGEGPTLIEAMTYRFHGHVFGDQDAYMDKDRKARAMADDPVPRFRARLIADGV
FT                   ASEEQLVAMEAEIEAQIDEAVEFALASDFPGVEELKRDVFAEELN"
FT   gene            368892..369896
FT                   /locus_tag="Swit_0347"
FT   CDS_pept        368892..369896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0347"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66718"
FT                   /db_xref="GOA:A5V352"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A5V352"
FT                   /protein_id="ABQ66718.1"
FT                   /translation="MATQTAAKPAKANILQAINAAIADAMEADDNVVVLGEDVADPEEG
FT                   GVCGVTKGLSSRFGDARVRSTPISEQAIVGAAIGASLVGFKPVAEIMLMNFTTVAMDMI
FT                   VNHAAKLRFMSGGQTHVPIVIRTMTGTGFASGGQHCDYLEAWFAHTAGIKVVAPSSPRD
FT                   AYGLMRSAIDDPDPVLFIENLPTYWTPAEAPEKDHRVPIGKAKLLSEGSDITIIAYARM
FT                   IQEALPAVAQLAEAGISAELIDLRTIAPWDRDTVLASVARTGRAMIVHEAVTPFGVGAE
FT                   IGSVLNEELFGKLKAPVKRLGGAFCAVPFSKPLETAFAPQTADIVAAAKALMA"
FT   gene            369922..370152
FT                   /locus_tag="Swit_0348"
FT   CDS_pept        369922..370152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0348"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66719"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A5V353"
FT                   /protein_id="ABQ66719.1"
FT                   /translation="MAVEVLLPKLGFSMNEGVLAEWLVADGGQAVEGAPLYALESEKST
FT                   QEVESPASGTLKIVAQVGETYEVGTVLAVIE"
FT   gene            370149..370451
FT                   /locus_tag="Swit_0349"
FT   CDS_pept        370149..370451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66720"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A5V354"
FT                   /protein_id="ABQ66720.1"
FT                   /translation="MTARYKLHVSSRALPGREEDYDRWYAETHVADMLALPGFLACDRY
FT                   RQLGMDGRPTGVFIALYEVETDDPAALLQSVFAAVPTMRLTDAIDPASAAFTFLQ"
FT   gene            370448..371356
FT                   /locus_tag="Swit_0350"
FT   CDS_pept        370448..371356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0350"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66721"
FT                   /db_xref="GOA:A5V355"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V355"
FT                   /protein_id="ABQ66721.1"
FT                   /translation="MTMRAVAIRGHGGPEVLEFGTWPHPMPKPGEAVVAIRAAAVNPAD
FT                   GKWRAGMFAGFAPVSFPHILGYDVAGVVVGGAGLTPGTRVAAMLDPFTKGGYADYVAVA
FT                   ADRLVAIPDGLSFEVAAAVPTAGLTGAQLIERAVDARPGQFVLLTGAVGAVGRFALDAA
FT                   RRRGVEVVAAVRGTRKDEALALGAAQAIALGEDDWSGGPFDHVVDTVGGDAVAALCRHL
FT                   RPGGRIATAATTPIDPQGLAAIPEFYAVVADAERLGRLLDAVAKGEIAVPIARVMPLEE
FT                   AAEAQRLTDAGGTGGKIILTP"
FT   gene            complement(371400..372923)
FT                   /locus_tag="Swit_0351"
FT   CDS_pept        complement(371400..372923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0351"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66722"
FT                   /db_xref="GOA:A5V356"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5V356"
FT                   /protein_id="ABQ66722.1"
FT                   /translation="MAEPVDPAEWIDPASGRPVAGAPLGMLLSAQAAATPDRPAFTLGE
FT                   SSLSFAAFERRANRRARHLIDRGIAAGDRVMLAMANRPDYLECAFALWKIGATPCPVSE
FT                   RLAPAEFAEIVALADPRAVIGLPGLPVDADRLYAIDDPLPDGIDDGSLPPAVATPGKIA
FT                   NSGGSTGRPKLIVDPLPSVWGPDKEGCRRGPRLTLLNPGPLYHSAPFNTTTMALAQGSH
FT                   IVCLDRFDPHRWLDAVERHGVDYAYMVPTMMARIARLPAAETEGRDLSTIRTLLHMAAP
FT                   CPAEVKRWWIDRIGAERVWEVYGGTERIGVTTIGGAEWLDHPGTVGKASPGQQILITDE
FT                   DGAPLPTGTIGEIHFRKTGGTASGYAYIGAAGRAKGDIDSFGDMGWLDEAGYLHIADRR
FT                   TDMVLVGGINIYPAEIEAAIEALPGVRGCAVIGLPDADMGNRLHAIVEVAAPGDVPEDA
FT                   DAFLAALADRLPGLKRPRSAEFTCRPIRDEAGKVRRSALREERLSPRGA"
FT   gene            complement(372916..373818)
FT                   /locus_tag="Swit_0352"
FT   CDS_pept        complement(372916..373818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0352"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66723"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V357"
FT                   /protein_id="ABQ66723.1"
FT                   /translation="MMAGFLDERAGLGGKVAAVVGGGFGIGAAISTALAEAGVDLAICD
FT                   IDAAAMEETAQAARALGRTVTTCHADATDEAALDAYYDRLAKDFGRLDILVNVAGGTRR
FT                   RAFMEASRAAIADDIQRNYGYVVQSVQRAVPLIRRSGDGGSIVSFTTIEAHRGAAGFSV
FT                   YAGAKAATTNFTRAMAVELGKEKIRLNCIAPDTTPSRGNINGLPPEYGEAFMRLPDAVK
FT                   PQGMAMYIPRGEQPPPEALADAVLFLASDLARFVSGTTLHVDGGTMAAAGFLDWPFGDG
FT                   FVPVPLAGTLERMYRDGDG"
FT   gene            complement(373835..375007)
FT                   /locus_tag="Swit_0353"
FT   CDS_pept        complement(373835..375007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66724"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="UniProtKB/TrEMBL:A5V358"
FT                   /protein_id="ABQ66724.1"
FT                   /translation="MRNWADYADLLKPAAELLARTHSPDSEAMKAQLWRQFAMNLSQGY
FT                   FLLFQSTPDHPEFAPFENSVFLAQPNPDAVYYYAPVDGNGTYRVTGERGNAPVAGFALG
FT                   NRIIGMDPLPGKGLGNHDFDDLEIDADGRFEVIFSCERPVGYRGNWLKLPEETDFILVR
FT                   QFSYDWGNERDVRLAIERLDAPPIRPALTPAQVDAKLAHLFGGYARNLSQISIGAVARC
FT                   AEQGFVNRFNLTSFQELGNGKDWPQAYWETVFDIAEDEALIIESELPEQRPYWNIQVID
FT                   GLWNQVDYVYRQSSLNGLQATVDADGKFRAVLAHRDPGVANWLDTGGNLYGMLIGRWYR
FT                   CSGHPTPSVTRVKFADLDRHLPEGVARIGGDERAEALRRRRIGSQLRRKW"
FT   gene            375168..376061
FT                   /locus_tag="Swit_0354"
FT   CDS_pept        375168..376061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0354"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66725"
FT                   /db_xref="GOA:A5V359"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V359"
FT                   /protein_id="ABQ66725.1"
FT                   /translation="MDRLTAMEAFVAVAELGSFSRAAARMRMSAAMMTLHVARLEEHLG
FT                   VRLFNRTTRRVDLTEDGRELLDHARAALHAYVQAENALKPGSGLSGRVRIDAPASIGHG
FT                   FVVPALEHFHRLHPGIVVDLSLGDRGTVFRADGFDILLRVGEAPLAGWITVPLGATRLC
FT                   CLAAPDYLDRHGTPETPEDLNEHRCILYASVEGPGGNPWSLVRNGRRVRIRPPAAFTFN
FT                   DGAAIMAMTAAGLGIAQNLEMLAHDALQSGTLLRVLEDWTTPTLPVVLMSAKDRYALPY
FT                   VRAAMDFLAERIDWRL"
FT   gene            complement(376135..376680)
FT                   /locus_tag="Swit_0355"
FT   CDS_pept        complement(376135..376680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66726"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A5V360"
FT                   /protein_id="ABQ66726.1"
FT                   /translation="MSDAALTPELIAFVREQKDRFDIQQCLLRYTRGVDRHDRELMLSA
FT                   YWPNAFDEHGVAEGEAAAFVDWAIGWHGEYQTRHQHIIANHSLELDGDTAHGETYYVFW
FT                   GENRMGPPTLAFGRYVDRFEKRDGEWRIAHRVCVNEKAGLFMENRLPEEAEAMLYKSGP
FT                   NRRDKDDISYLRPLTRSR"
FT   gene            complement(376703..378436)
FT                   /locus_tag="Swit_0356"
FT   CDS_pept        complement(376703..378436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0356"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: amidohydrolase; D-aminoacylase domain protein;
FT                   Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66727"
FT                   /db_xref="GOA:A5V361"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5V361"
FT                   /protein_id="ABQ66727.1"
FT                   /translation="MAEFDIVVRGGSLYDGTGGEPFTADVAVKDGRIVAVGTVEGKGAE
FT                   EIDARGRIVTPGFVDVHTHYDGQITWENRLAPSSDHGVTTVVMGNCGVGFAPVKPGDHH
FT                   LMIKLMEGVEDIPEVVMAEGVPFDWESFPDYLDALDKRESDIDFAAQLPHSPLRVYVMG
FT                   ERGAHLEPPTEQDLAEMRRLTAEAIEAGALGVTTSRSYAHRFRTGELAPSVPTEDQEVL
FT                   ALAAGLRDAGKGVFQMVPSYDVTARQRFDLLRDIAKTSGRPVSFTFMQTPQTPGDWRET
FT                   LADLEQANAEGLEIRGQVIPRPTGGLLGLELSLHPFALNPSFREIEHLPLDQKVARMRD
FT                   PDFRKRLISESPEDPQPFFKFIVSDLDALFVLGDPPNYNPSAEDSIAAKARAQGIDPKE
FT                   LIYDALLERDGHEVLYRPMGNAEGEKFESSGRHLVKHPYTVPALGDGGAHYSMICDAAY
FT                   TTYFLTYWVRDADPDRRIELPYAIRKLAYEPARTVGLDDRGLIKPGYKADLNVIDMDRL
FT                   HLHAPHASYDLPTGGRRLSQRADGYEATIVSGVVTYRNGEPTGALPGRLVRGGRSAPVA
FT                   A"
FT   gene            complement(378507..379616)
FT                   /locus_tag="Swit_0357"
FT   CDS_pept        complement(378507..379616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0357"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; Epoxide hydrolase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66728"
FT                   /db_xref="GOA:A5V362"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5V362"
FT                   /protein_id="ABQ66728.1"
FT                   /translation="MVTPLRIDVPQAKLDRIAARLALSEVGYAPEDDADWRYGTDARWL
FT                   AGLLDHWRTRYDWRRCEAALNRLPHFRTRIDGIDIHFIHVRGAGPARPFPLLLTHGWPG
FT                   SVLEFLGVIEPLAAMGFDLVIPSLPGYGFSSRPPRPIGPAGVARLWRRLMTEALGYPRF
FT                   GAQGGDWGSAVTAALGAGHGDVVSAIHLNLFMAPPATDGDDAETAAYRQKLSAIQLRES
FT                   AYMMEHATKPQTIGLALADTPLGFAAWVCEKFHGWGDTGGDIESRFPKDWLLDNIMTYL
FT                   VNDAVQSAIWMYHTIFTEARPGERIEVPTGLALYPAEFMPYPPRSAAERAFNVADWQEM
FT                   RAGGHFAALEEPAAFADNVGRFFAQISQG"
FT   gene            complement(379622..380470)
FT                   /locus_tag="Swit_0358"
FT   CDS_pept        complement(379622..380470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0358"
FT                   /product="metal-dependent hydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66729"
FT                   /db_xref="GOA:A5V363"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:A5V363"
FT                   /protein_id="ABQ66729.1"
FT                   /translation="MKARIPKIDYSQVRPHWAPNREFAHNVNASSTIPVFVEPWLIKVM
FT                   NKAKAALPAGETRLHAVIDIFIAQEAQHYRQHAGFNRRIREAYPEIVEHERRIEREYQE
FT                   MLDHRSLKYCLAYSEGFEALGSLGAVMWFDKYRPYLEGADYEAVALWKWHMAEEYEHRE
FT                   VCFQLFRALYARSLWGRFWNGWLYRCYGFVRTVRHLGAYTNRVAQALIDADRRSMTPEE
FT                   VERSRASVKQFQAHMRSTAGAEILKVFSPFYNPARRPEPRGMAAYLERFEKGGDMGRAA
FT                   A"
FT   gene            complement(380491..381786)
FT                   /locus_tag="Swit_0359"
FT   CDS_pept        complement(380491..381786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0359"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66730"
FT                   /db_xref="GOA:A5V364"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A5V364"
FT                   /protein_id="ABQ66730.1"
FT                   /translation="MTGAAQARPRDEAVERELKTGADHAFDPLDPETVRNPGPAYSELA
FT                   AKCPFYHYQGDEYQFYITSDYKEIRDKVLSDNPVWSFKWGDGPIDWAEFSDFGILTDPP
FT                   FHLEYIAALRKGMTPSRMKFYQPEVEAIAEELVAGLEARADKSGNFHDLFALPLPARTM
FT                   CFMLGADQAMYADYKRWADELQSLLFNDKNPAAEQSLIAEIMPHFMGLIEERKALLRDA
FT                   GIDDPTHEHWGTVLPFDYISLGLVSRVEGRRFNDQELFQICTAFLTGGQETTTSLLTNV
FT                   VWRLLEKPELWEQLKAHPELVENAIEESLRFDPPINSHFRTSLCPVTMHGAELPERSKL
FT                   MFSMMGANRDPAIFEDPDTFRIDRPLNQVKRHLSFGYGVHFCLGAPIARLEAQIGLRKL
FT                   VERLPNLRLTGETERIDSWMYWGRRRLPVAWG"
FT   gene            complement(381862..382395)
FT                   /locus_tag="Swit_0360"
FT   CDS_pept        complement(381862..382395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0360"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66731"
FT                   /db_xref="GOA:A5V365"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V365"
FT                   /protein_id="ABQ66731.1"
FT                   /translation="MPKKPIEELEAGRDYYARLLPELDVEYFATMWHLSTVGHLVATDL
FT                   DRIARKLGYSFADVHLLGSLGRDRRRALRATDLTSILYVSNAVLSTRVARLERDGLLVR
FT                   ERCGDDKRAFELHLTDKGRALIKDAISLIASEAKIVQLFRRLAAMDREALSRILGEMHE
FT                   QLDRDFVGVPHGDD"
FT   gene            complement(382423..383643)
FT                   /locus_tag="Swit_0361"
FT   CDS_pept        complement(382423..383643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0361"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66732"
FT                   /db_xref="GOA:A5V366"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A5V366"
FT                   /protein_id="ABQ66732.1"
FT                   /translation="MQDVMERALAPRPDHVPADLVRDFDLYDIPGAAEDIQAAYRAIQQ
FT                   ASPDIFWTPHNGGHWVATRGEDIIEMQRDYSRFSHRRIVLPPMPDAPRQIPLEMDPPEH
FT                   ARYRRPLMQALMPSIVAELEAKVRQVAIDAVERLLPRGECEFVEDFAKVLPIHVFLALV
FT                   ELPLDDKAYLLTLAEDSVRGRDAETRGRSQQLMGAYLLPWIRARRETPGNDLLSKLVNV
FT                   DIGGERISEAEATSYATLVLFGGLDTVAGMIAFIARFLAQNPGQRRQLVERLDDDAFVR
FT                   NAIEEMVRRHGLANTARVIASDFDYKGVSFRAGDRILPANLFVGVDDRLNPDPLVVDFS
FT                   REKPVHAAFGNGAHACPGAVLARREIRIFLQEWLSRIPDFRIRPGTSPVLATGMVNGVL
FT                   RLELVWP"
FT   gene            complement(383666..384658)
FT                   /locus_tag="Swit_0362"
FT   CDS_pept        complement(383666..384658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0362"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66733"
FT                   /db_xref="GOA:A5V367"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V367"
FT                   /protein_id="ABQ66733.1"
FT                   /translation="MAEDIRFDGRVAVITGAGNGLGRDYALEIARRGGAVLVNDLGGSG
FT                   AGVGASRNAADAVVDEIRAAGGKAAANHDSVATRAGGEAIVAAAVEAFGKVDIVISNAG
FT                   FLRNARFEDIDDDRLDALIDVHLKGAFYVAQPAYRIMRRNGYGRFVFTGSASAMFGHAW
FT                   QANYAAAKGGLMGLSHIVAIEGSAYGITSNLLLPTAQSRLMAEMDDGFMEIPDFARSVQ
FT                   EADYSAVQDRLLPAFNTPLALYLASERCRTTHGIFSANGGRYAQVLIQATQGWISPAGS
FT                   EAPSVEDVAGHFDRICDATTLHRPMTVYDEFTAVAAAARERDMTGAPAA"
FT   gene            complement(384662..384979)
FT                   /locus_tag="Swit_0363"
FT   CDS_pept        complement(384662..384979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0363"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66734"
FT                   /db_xref="GOA:A5V368"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A5V368"
FT                   /protein_id="ABQ66734.1"
FT                   /translation="MPTIIVTTRDGQELSLEADTGLSLMEVIRDGGADELLALCGGCCS
FT                   CATCHVKVDPAFLAALPPMSEDESDLLDSSDHRDATSRLSCQISVDDGLAGLRVAIAPE
FT                   D"
FT   gene            complement(384984..386225)
FT                   /locus_tag="Swit_0364"
FT   CDS_pept        complement(384984..386225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0364"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66735"
FT                   /db_xref="GOA:A5V369"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A5V369"
FT                   /protein_id="ABQ66735.1"
FT                   /translation="MESAVRIQEFDDPNYDPFNSDEINFGDHADPYPLIARWRAEAPVI
FT                   EGGYRPLMGLPAALYPDRKMFTVVGSREVNEVLTDTDRFSNAGYKFNLGVTFGQGSIST
FT                   MDNPEHGRWRRIFQKIFLPQYVKKWGETIVDPVVHGLMGKFLPLGRADLIEQFTLRYPF
FT                   EVIYHQLDLPEEDVRTFQRLALGQTDYVNHEKAIEAGRKLGDYFTALVEERRRDPGDDL
FT                   VSLLASTEADGEYLPHEVLISFLRQLMNAAGDTTYRGTSILLTALLEHPDQMEAIRADR
FT                   GLIPQAIEEALRWDGPVAVQMRMAAVDTELAGVAIPAGSLLDVVAGAANRDPEIYSDPD
FT                   RFDIFRDRKPHFAFSRGPHICVGQHLARVEMTRALHAVLDHLPGLRFDPDEPRPRIQGS
FT                   MMRVPRHLHVRFGD"
FT   gene            complement(386280..386921)
FT                   /locus_tag="Swit_0365"
FT   CDS_pept        complement(386280..386921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0365"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66736"
FT                   /db_xref="GOA:A5V370"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5V370"
FT                   /protein_id="ABQ66736.1"
FT                   /translation="MSNAAAIDAAPEPRTRRRRRTREDVVERIRAAARELFAERGYAFA
FT                   TTKEIARLADVSETLLFRYYGDKATLFDEVVTAPFNRLMEDFVALHPDPRDPNRDADAR
FT                   RFVRAVYTLFEQNQEMFRALLFQMPADGRGQPALPFGGLDNFFEKSTTYAAQDGATRAD
FT                   TAIAVRLGFGMIASAVLFQPMLFPPHTDREALIAALEQMIADMMWRGRSD"
FT   gene            complement(386962..388557)
FT                   /locus_tag="Swit_0366"
FT   CDS_pept        complement(386962..388557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0366"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66737"
FT                   /db_xref="GOA:A5V371"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5V371"
FT                   /protein_id="ABQ66737.1"
FT                   /translation="MSWDYIIVGAGSAGCVLADRLSANPANRVLLLEAGPEDRSPFIHM
FT                   PRGVAKLYTDPRHVWYFQTEAHDDVPSETWIRGKMLGGSSSVNGMMYFRGQPQDYDGWE
FT                   RLGAKGWGWNAMGPAFRAIERHELGEDEVRGGSGPLGISIERERTPLTEAFIAAGEQMG
FT                   LPRVEDLNRPRQEGVGYATRTIWKGRRQSSAQTFLKQARGRPNLRIVTGATVDRILFDG
FT                   RRAIGVAATVGGAAQRFDAEGEVILSAGSLMSPQILQRSGVGNAAHLQAIGIAPVIDSP
FT                   GVGEHLLEHRLMMMQFDIAVPHSHNPQLRGLRLAANVLRYYLSRSGMMAVAYGTVGAFA
FT                   RVLPESGTSDIEILFSPAVAMPDAKGNMVVDRNHSVQLFGYPLRSRSEGWVRIASADPN
FT                   QPAQIHAGYLTDPYDCAVTVAMHRYIREWMRQPAIAPMVIGEREPSRSMQTDEQILSAF
FT                   RSQGQAGYHACGTCRMGDFDDAVLDEKLRVRGVDGLRVVDGSIMPTMVSANTNGPIMAA
FT                   AWHAASLILEGRNR"
FT   gene            complement(388554..389696)
FT                   /locus_tag="Swit_0367"
FT   CDS_pept        complement(388554..389696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0367"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66738"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5V372"
FT                   /protein_id="ABQ66738.1"
FT                   /translation="MAVANKVNEAVQRTLDSLVADGREIGVQVAAWVGEEQVVDCWAGI
FT                   ADPGTGRPVDGDTLFNVYSVSKAVTATALHIQAERGLVDYDAPVTTYWPEFAQAGKSDV
FT                   TVRHVLGHVSGVLRMPSDVTPELMTNWDWMCGRIAEMPGAYPAGSRSSYQSMTFGWLVG
FT                   EVVRRTDPRRRPFGQFVREEIAEPLGATDLWFGIPAEVEARIARLDAVAVYVMPDGNAM
FT                   REAQPLVVDLMPDPFERPYVRRACIPAVGGIFNARSEARFWAMLANGGQLGGVRLLSEE
FT                   RVASFAGPRPHFDDADPVFFGMKVPIGWAGFWLGGAEAPPVSSPRSMRALCHPGMGGSI
FT                   GWADPDRKLAVAFCHNRMFDTIEIDQDSRTLIGDVIRAAL"
FT   gene            389797..390543
FT                   /locus_tag="Swit_0368"
FT   CDS_pept        389797..390543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0368"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66739"
FT                   /db_xref="GOA:A5V373"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5V373"
FT                   /protein_id="ABQ66739.1"
FT                   /translation="MGGKYETIALRREGGILELRIHHKGEAARWGLWGGLHRELGQAFA
FT                   EIAADPDLRALILTGTGDSFCAEFDMEGEMPPPMSPAVWDVIFREGRSLLNNLLAIEVP
FT                   VIAAVNGPAFIHAELAVLADIVLASDTAIFADKAHGVAGVVPGDGVHTVWPMLLGPNRG
FT                   RYFLLTGQEIGAEEALALGIVGEVLPRAALLDRAWDHARAIAARPPLAMRYARIALTTR
FT                   LREQVARELGPGLMLEGMAVLAGQGG"
FT   gene            390644..392632
FT                   /locus_tag="Swit_0369"
FT   CDS_pept        390644..392632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0369"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66740"
FT                   /db_xref="GOA:A5V374"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5V374"
FT                   /protein_id="ABQ66740.1"
FT                   /translation="MGFPHLFAPFAIRDLRLKNRIVMAPMESHLGNADGSVSKEAIAYY
FT                   RERALGGVGMVVVEYTCVDGQEGFSSMAPQLRLDSPFYRSGHGKLAAAIQSGGARACVQ
FT                   LSHAGRQSRESVLGRQPVAPSAVPLTSLYLNAVPRALEADEIARIVRRYADAAALAAQC
FT                   GYDAVMLHGAHGYLLQQFLSPLVNRRDDEWGGDFERRLRFPLEVVKAVRAAIGNMPLLY
FT                   RLSVSDFIEGGLTIEDSERIAPHLCEAGVDAIDISCGSLDRVDVIVEPMSIEEGWRLPM
FT                   ARRIRAATGKPVICAGVIRRPEMAEAAIAAGDADMISLGRALLADPLWPNKARMGRADD
FT                   IRPCTSCNWCIKETGSNRGVSCAENPRCGHETDPPIDAFGRGRRAVVVGAGPGGIAAAL
FT                   LLDQAGFAVTLFEKRRAAGGNLITSATPPNKEKLFWYHDFLQRRLAASGVDLWLGTEAT
FT                   METVDAERPDVVVVAGGSRLAPLELGGSGGLPVHPAFALLLGDVELPPSSPERPILIYG
FT                   GGETGTETAEHLAGQGHHVLLATRSDAAMLARNAEPLYRIHLLQRLRANAAITVADHSL
FT                   LTVIEGDHVLLESGGETRRQPAAAVLLAHGLVPDTALAEALRDLPVPVVPIGDAVRVGR
FT                   IGEAVRDAYRCVQDLRRTLYQPEAIAC"
FT   gene            392626..393603
FT                   /locus_tag="Swit_0370"
FT   CDS_pept        392626..393603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0370"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66741"
FT                   /db_xref="GOA:A5V375"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A5V375"
FT                   /protein_id="ABQ66741.1"
FT                   /translation="MLIEDTRANGLTIRPLAPGFGAEIVGLDLNRPIDAATEAAIRAAW
FT                   IEHGILLFRGEDQDDAAQMRLSAIFGEMEPAATADMNDPDNRFMMTLAYDPDDKAPRFQ
FT                   QHYNVGGIDRAGWLGWHWDQSFMPTIVRGAVLRMEMPSPEMGETGFIDAVGAWDRLPDD
FT                   LKARIEGLEVVYLFNPDFVSGQYGFPEDIRALPRERPSKEPSYDFPPVVHPMVITQVET
FT                   GRKVLKLSPMHARYILGMDAAESDALLKEVAAHLVDPAHAYFHDWRKNDMVVWDNWRVI
FT                   HGANGVPLHCARRARRTTIMGDYEVGRYLDPTLDRDRKVKRLVD"
FT   gene            393722..394711
FT                   /locus_tag="Swit_0371"
FT   CDS_pept        393722..394711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5V376"
FT                   /protein_id="ABQ66742.1"
FT                   /translation="MQRIERRIDVSEAAGLGEPVEMAVSIVLPDPADIPERPVAIFAVP
FT                   GGGYSRAYYHLNFAGHEGYDEAAWHAARGTIHVAIDHVGVGESSIPDLSRVSFQTLAAT
FT                   HDSCVRQVAAMIERGDLAPGFPACPGLFRVGMGQSMGGGVTILAQGRFASFDAIAPCGV
FT                   SAIHTALPQRSAEEFELGKRRFAEVSVGDASQSHLTTSHEGVDYVYPFHWEDVPADILE
FT                   ADMVGGYPIRRTAPAFGSLTIPHCAVQMMTPGCFAEDAARIAVPVLVAVGERDTCPDPR
FT                   AEPSAYRASPDIGVFIVPRMAHMHNFASTRELLWRRLHGWSRMLAAAA"
FT   gene            complement(394708..395946)
FT                   /locus_tag="Swit_0372"
FT   CDS_pept        complement(394708..395946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66743"
FT                   /db_xref="UniProtKB/TrEMBL:A5V377"
FT                   /protein_id="ABQ66743.1"
FT                   /translation="MTNPIANADQFAAEEEVRHMWALPQTRAARDHAAQLWRVGHGTDI
FT                   PDGLLDSFDGAMDGWVTNYLFKATTIDPAAPRIVRNFMPGYRWQGGDVPDARMGGDNPD
FT                   NCYRLAGIAPGGRYRISGRILDARPAHASFTLVENWGTSVTAQTLELPGIAVDEDGRFT
FT                   ISIDGDPADGRPNHLTSTPRTKFLFIRDSMMDWGHETPLDLAIERLDAAAPLDLEQRLD
FT                   EALRRMREDVPLYYWFFRLSAGKPVNTMVQPVAVAGYGGLVTQASSLGRFHLEDDQAAI
FT                   VRFDPAGACYNSFQMAMWWYRSIDAHRIQSGLTAAQAEHDADGTISLVVSARDPGIANW
FT                   VDTGGLKDLLPMIRWQGIPATQVRKGPRHWLDIVPFAEIDRHVSADATRVDAAERAARI
FT                   ARRQREWDRRTTA"
FT   gene            complement(395943..397154)
FT                   /locus_tag="Swit_0373"
FT   CDS_pept        complement(395943..397154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66744"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V378"
FT                   /protein_id="ABQ66744.1"
FT                   /translation="MRSRSPDIRTGSAGDGTPIDVERLFHSAGIVSGAFDRLDDGLRGR
FT                   VEKLVSWVNGQVVMAGERKEEVELQLRKLLATRLRLAADRKRIPAIAEERIERPIFVIG
FT                   FARTGTTLIHSLLAEDPRARAPLWWHTHDPSPPPGEVPVVPERIEYTGRELDRLVAQTP
FT                   GLLTMHPYWDKRGHCLIEDEEIFTLDFQNAYPTLLYRMPALAMILDAGNAREAYGFHRQ
FT                   FLQHLQWNQEPKHWVVKGIYHQFVLEELFEAYPDALCIWPHRDPVEVHPSTMAITAVLY
FT                   GAITNWQMDFRELGPAFVQGIAQSVAQAIESPFVDDPRILHVDFRELVRDPIAIVRKAY
FT                   GRWGLDYGPEFEARMKAWLADPANAPDRYGRYRYTMEPYGLTREMIETAFEGYCRRFGL
FT                   GKFA"
FT   gene            complement(397337..398089)
FT                   /locus_tag="Swit_0374"
FT   CDS_pept        complement(397337..398089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0374"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66745"
FT                   /db_xref="GOA:A5V379"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V379"
FT                   /protein_id="ABQ66745.1"
FT                   /translation="MARSRTTAPMIDACRAALEAHHARHGTIPSMAGLAKLWGYASKSS
FT                   AARRVGELVEAGVLAWSADRRLRPGPAFHSGHPPSPMPDPGLDEARERWSTGYDGELTR
FT                   AYMMTVRLLRLARSIEIGLARTAASEGLTAGEVLVLDTLFRAGPPHRLAPTALKKHFVI
FT                   SLAGVAKRLERLLALGLIERVPNPDDRRGMLVQLTASGIALLQRLVQLDRHSSHIMWPT
FT                   ALPEQDYRVMLDALQAAQALIEAESDDL"
FT   gene            complement(398133..399260)
FT                   /locus_tag="Swit_0375"
FT   CDS_pept        complement(398133..399260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0375"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66746"
FT                   /db_xref="GOA:A5V380"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5V380"
FT                   /protein_id="ABQ66746.1"
FT                   /translation="MDFAKSDIQTMLLDSAERLLADSSGVEYWRERRHDPLGFDEGRWA
FT                   RFAELGWLALPLPEAAGGLDGSIEDVALLNVALGKSLATEPYVSTVVLAGQILRQAADR
FT                   GRAAELMGEIATGALRVALAHQEPGADPLSTDAVATVARRTADGFALTGAKLMAADAPS
FT                   AARLIVSARIEGEDGVALFLVPSDADGLAVDAYPLIDGTRAADIRLTDVALPAEALLVG
FT                   GHGGVAVLDEAIHRAGVALMAQAVGAMEACIRICGDYARERKQFGAAIGSFQAIQHILA
FT                   DMFVATHQARSMLYHAIANSSRPAAERAAALSAARIVIGEAGQLVSRNGIQVHGGYGLT
FT                   DEYAVSHYFRRLMSLEKQYGDLVRHTERFGDSLFA"
FT   gene            complement(399270..400469)
FT                   /locus_tag="Swit_0376"
FT   CDS_pept        complement(399270..400469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0376"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66747"
FT                   /db_xref="GOA:A5V381"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5V381"
FT                   /protein_id="ABQ66747.1"
FT                   /translation="MELLHDPELEGFRKEIRAFIDEVLPPEMKARQRTKVQNNATIQDQ
FT                   QDWMRILNRHGRAVAHWPKEHGGCDWTPQQLFIFNEELYAADAPEFDWGGTHMLGPVLY
FT                   TFGSQVLRERFLPMIRNGDTYWAQGFSEPGSGSDLASLRTSAELVGDTYVVNGQKIWTS
FT                   GAAHARWGFFLVRTDKTVKPQKGISFLIIDMASPGVTVRQIPQINGEAHLCEVFLDNVE
FT                   VPAEQLVGEPGMGWTYAKFLLEHERTTSSFIYWSKRELERAKEIARHETAGGRRVCDDP
FT                   AYRARFARVQADLIALEWSVLRVLAHEETGFPEAAAASVLKIRGSELQQEITMLQLDAL
FT                   GAKSLRYYEPGPDAPAPSADWAEHVPGRTTIALITRAATIYGGTKQVQKNILAKLAYGL
FT                   "
FT   gene            400605..401285
FT                   /pseudo
FT                   /locus_tag="Swit_0377"
FT   gene            401363..402232
FT                   /locus_tag="Swit_0378"
FT   CDS_pept        401363..402232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0378"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66748"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V382"
FT                   /protein_id="ABQ66748.1"
FT                   /translation="MSGFSIEGRTAFVTGGASGIGLGIARALIGRGARVAVADVDGAAV
FT                   GRAVEALSAAGRVEGVALDVRDRNGWQAARATVEAALGPVSLLVNNAGVTGYDPIVDTP
FT                   PAHFDWIVGVNLTGAFNGVHCFGRAMIDRGEGGHILNTASIAGLYGSNALTVGAYAASK
FT                   FGLVGLSERLRVELAPHGIGVSLLCPGLVSTAIGANAAKLRPGPAGMALADNPAFAGLR
FT                   QRAPTAGLDPDRLGPFVVRAIEENRAYIIPHPHFAEQVEARHAALMADFGEPADPALPL
FT                   APDWRDLA"
FT   gene            complement(402321..404006)
FT                   /locus_tag="Swit_0379"
FT   CDS_pept        complement(402321..404006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0379"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66749"
FT                   /db_xref="GOA:A5V383"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5V383"
FT                   /protein_id="ABQ66749.1"
FT                   /translation="MAGGADGRIEDGAEADYVIIGAGSAGCVLANRLSTDGRHKVVVLE
FT                   AGADDRPTRNLSDPAQAFANINIHMPAGFTRMLKDPKVNWNYMTDPDPGTEGRQHSFPR
FT                   GKVLGGSSSINGMLWVRGLPEDYQGWRQLGCDGWSWDDVEPYFRRIEHQHGEGQVSGVQ
FT                   PGPLHVSDVPMKHAMLDVMTRAFEEAGAPVSTDLNGTTREGVARVRLNARNGVRVSAAV
FT                   AYLHPAMKRPNLTVLLRAHATRILFEGKKAVGVDYVQGGVRRQVRARREVILSGGAINS
FT                   PQMLELSGIGDGERLRALGIDILVDRPRVGENLQDHYAAMVRARMKPGSAGFNELSRGV
FT                   RLVGQLLRYAFTRSGLLALGGSNLTAFLKSDPALDLPDIQFFASPATVDFEGLAKHGTM
FT                   SMERAPGMTVGGYVMRPRSHGSIHIQSPDYRDHPSIKPNYLADEADRRAQVASLRWARR
FT                   IMHSPALAPYFDHELTPGAAVDSDEALLAFARASGSTGYHQSCTCAMGPGADAVVSPTL
FT                   RVNGVEGLRVVDASVMPNIVSGNTHAATVMIAEKAADLILADAR"
FT   gene            404177..404977
FT                   /locus_tag="Swit_0380"
FT   CDS_pept        404177..404977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0380"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66750"
FT                   /db_xref="GOA:A5V384"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V384"
FT                   /protein_id="ABQ66750.1"
FT                   /translation="MTALFSLEGRTAMVTGASRGLGRAIALGLADAGASLILAARDAAK
FT                   LGEVADEVRAKGRDARIVTFDLADMASVEAAARGLVDEGAPIDILVNNGGIAEWGPLHG
FT                   SSLDHWERTFDVNVSAIYLLCRELSKPMAERGWGRIINFASYVAETGRPNLSAYVASKH
FT                   AVLGLTRAVAADLAPHGVTCNAIAPGIFLTDMAAPTAGHPQRAKIFRDAIAIGRFGDPA
FT                   EIVGPVQFLASEASRYVTGHMLPVDGGIANILSLPVVVEGGSLD"
FT   gene            404987..407323
FT                   /locus_tag="Swit_0381"
FT   CDS_pept        404987..407323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0381"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66751"
FT                   /db_xref="GOA:A5V385"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A5V385"
FT                   /protein_id="ABQ66751.1"
FT                   /translation="MERDPNKLSRREAIAAGITGSAAVAAGLTAAPAQARDAAGFKGRI
FT                   APVMSASTPDIRQEVVPAAGSPNVLLIILDDVGFADLGCYGGEIPTPNIDRLAASGIRY
FT                   TNFRTTGVCSATRASVMTGLNPHSAGIGWLTFSDAGYPGYRGDLAEDAETMAERFSDAG
FT                   YCVYHVGKWHVNLADTTNAAGPTRNWPSQRGYARSYWFQGHSTDYFAPAQLYAGNERIT
FT                   PPVDGYYATDDFTDKALAFLRDHRAQRGDRPFLMTLAHPGAHSPLQARREDIARFKGAY
FT                   DAGWDVLRAARLERQKAMGLIPADAVLPPANPGVPRWDTLDPAARRVQARYMEVYAAMI
FT                   ARIDDGVGRILDALDASGDHDNTIVALISDNGGAPDGRGGTPNLLAMVNGGVTPAQVAE
FT                   RFDEIGGPDSYPMYSLGWASVSNTPFRLYKHDTHLGGVADPLILSWPKAIPARGELRGQ
FT                   FLHAIDLLPTLIDAAGLSATSGRAGAKPIEGRSARPSFTDRAAPDPRDRQYFEMGGLRA
FT                   MRLGRWRIVSKGRFGLPGDAWELYDTATDPNETRDLAAERPDIVERLDRAWMKEAQAHQ
FT                   VFPIDDRSLLERSFAELFRGGGKDRWSIIPPIDLIPEESSPKLLGRDFEVELTLADAGR
FT                   QGVLFAHGNQFLGAVAFVRDGRVWFEFRCDPHLIALDAPWPAKARSVRFVQRLSARPRV
FT                   GRLSIVIDGREVAALDSDRLLLGTPMQGLQIGRNGAVRASPRYAAPFAFDGRIERVEIR
FT                   TDNKPYDAGEIAAASRAYAAPARKD"
FT   sig_peptide     404987..405094
FT                   /locus_tag="Swit_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.938 at
FT                   residue 36"
FT   gene            407327..408802
FT                   /locus_tag="Swit_0382"
FT   CDS_pept        407327..408802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0382"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66752"
FT                   /db_xref="GOA:A5V386"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A5V386"
FT                   /protein_id="ABQ66752.1"
FT                   /translation="MTDTLLNLSNPEKLFIGGDWAASSDDGGIEIVSPSTEEVVGRVGK
FT                   AGRADMDRVVAVARHAFDHGPWPRMTGAERAAVLRRIAGEMGKRADDFARAWSLQVGMP
FT                   YAQSSMTAPYMAAYLTYFADLAEKGFEEVRQPMMGGHCIVVHEPVGVVAAVVPWNAPLA
FT                   TLLLKVAPALAAGCAVIAKPSPETPLEALILAECIAAAGVPEGVFSVLTADREVSDHLI
FT                   RNPGIDKVSFTGSTAAGLHIASVCGGRMARVTTELGGKSAAIVLDDATIETVVAGIMPN
FT                   LVGLCGQQCAAFSRILVPAARKAEVTEAMAAAMQAVTVGDPFDQATQMGPLVTRNQHGR
FT                   VFGYIEKGKAEGARLVTGGGRPAHLPKGWFVEPTLFADASNDMAIAREEIFGPVGTIIA
FT                   YDDEEQAIAIANDSNYGLSGGVFTESPDRAYAVARRIRTGNFGHNGRVIDFTMPYGGFK
FT                   QSGIGREGGIEGLYAFTETKAVFMPKLPTHLRS"
FT   gene            408799..410172
FT                   /locus_tag="Swit_0383"
FT   CDS_pept        408799..410172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0383"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66753"
FT                   /db_xref="GOA:A5V387"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5V387"
FT                   /protein_id="ABQ66753.1"
FT                   /translation="MSSAPAPAQAHDDWPDNYRAPAAWWAVAVTMIFQIVSMIDRQVVS
FT                   VLIPEMRADLGLNDFQISMVQGMAFALFYGAMGLIIGALVDRHSRRKIMFAGIVLWSIA
FT                   AAGTGFARNYMQLFVARLFVGFGEGAISPAAQSLLSGIFPRGKLATPMSCFTAAGVIGI
FT                   SLSYALGGHLLDRFTTAPLGGLLEGMAPWRQVLVVTGAPGVAVALLAFTLREPKRAGMP
FT                   KPQRHEASWGSFFSYIGAHARLMLGVILGSALVAMMTQAAMTWTPTYARRVLGVSAGEV
FT                   GTIMSLAVGLGGVVGGIALGLIIDHWFRRGVHDIALRLLAIAALAVPPLIALCFLADDA
FT                   TILFGGITLMMLTMGAIFGPTLAAVQMIAPPAMRGRFGALVVLASNLFGFAFGPMLVGA
FT                   ITDYGFGDPGKVGVSVAIVLVLVCPFAAWLIWSARGDFVRRLAAAPPPTHSLSNEVCS"
FT   gene            410169..411737
FT                   /locus_tag="Swit_0384"
FT   CDS_pept        410169..411737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0384"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66754"
FT                   /db_xref="GOA:A5V388"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5V388"
FT                   /protein_id="ABQ66754.1"
FT                   /translation="MSLTIPALLRAAAARYKDRAALHSSTDGPIGYRELDRRADEVARA
FT                   MIADGARPGDRAAIWAPNMWEWVAATVGVQRAGGAMVPLNTRLKGGEVADIVRRGGVAR
FT                   LFVIGDFLGRHYPEMLRGEAMPGLRRTIVLRGTPDKLAAGEEGWDDFIARGRSTSDAAL
FT                   AEREAGVTPDSIADIMFTSGTTGAPKGAIFDHRRSLGGGRAWANISRQTADDRYCVFGP
FT                   FSHNASYKAGWVAGLMTGSTVYWPEAYDAVSILDLIAGNRISVMPAPPTVFQEMLAHPN
FT                   WRDWDISSYRFLSTGATVVPIELMKRLQAETTIAEITTGYGMTECAGSATHTRPGDPVE
FT                   RVAYTVGAAIEGTEIKLVGPDGRAVPTGEPGEVLIRDDKLLIEYLDNAEATRATIDAEG
FT                   WLHSGDVGTLDAEGYLKLTDRLKDMYIVGGFNVYPAEIEKQMTGLPGIHQSAIIGVPDQ
FT                   RLGEVGHAFIVRSAGSTITAEEVIGWSKANLANYKVPRGVTFVDALPMNATGKVIKFAL
FT                   REMVK"
FT   gene            411743..412474
FT                   /locus_tag="Swit_0385"
FT   CDS_pept        411743..412474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0385"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66755"
FT                   /db_xref="GOA:A5V389"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5V389"
FT                   /protein_id="ABQ66755.1"
FT                   /translation="MGDVLLRAEVGEGVLLLTLNRPAQRNAIDLELCDRLSAALTDFRD
FT                   DPRWRVAIVTGAAPAFCAGLDLKSFAAPDAPRHRVTELIHMVPGLGKPVIAAVNGAAYT
FT                   GGLELALACDFILAAEEARFADTHARIGALSGSGMGSRLPHAVGPRFAKQMMLACEPID
FT                   AATALRVGLVNELLPADRLLPRAIALAGAIAGHDPALIRIARDVVDRGSAATLAEAIAI
FT                   ESEALATRKAEGAMRWEAKPA"
FT   gene            complement(412500..413606)
FT                   /locus_tag="Swit_0386"
FT   CDS_pept        complement(412500..413606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0386"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66756"
FT                   /db_xref="GOA:A5V390"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5V390"
FT                   /protein_id="ABQ66756.1"
FT                   /translation="MNDITPTPWPKDRIIPATSWQRPEGVRLISSDDHVIEEPHLWEER
FT                   LKGADKDRAPKYWKDETGFHMTVDGESYDVPGLPSDFPEGREGFWDVSKRLADMDAEGV
FT                   DASIVYHGRAAGLIRMADRGLFIRCMDVFNEWLAEWKQAAPDRLYPVAYLPTFFEPEAT
FT                   ADYLQKLKQLGFKAIEIPLNPRGIRYNSLKMDPMWRAIEDSGLPLSIHIGAYIQYSGRG
FT                   SLGANLNANLMPFTGMFGQFVFSGIFDRFPGLKLVFTEGGAGWVPATLENADKIARDYA
FT                   TELRPRIAHAPSWYWHNNCYATFMQDDVAIENVDRIGADRIMWSVDYPHPESIVGNSET
FT                   VVKGIFDKVGDAQARKIVGDNAAAVWGI"
FT   gene            complement(413943..414018)
FT                   /locus_tag="Swit_R0006"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(413943..414018)
FT                   /locus_tag="Swit_R0006"
FT                   /product="tRNA-Glu"
FT   gene            414166..414372
FT                   /locus_tag="Swit_0387"
FT   CDS_pept        414166..414372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66757"
FT                   /db_xref="UniProtKB/TrEMBL:A5V391"
FT                   /protein_id="ABQ66757.1"
FT                   /translation="MQAELTSPDKADDLIALHGADAIAVLVDRIADAVRHCDDQAVDSL
FT                   DRLLQIVEQRFEEPWRAMRAIPG"
FT   gene            complement(414445..415821)
FT                   /locus_tag="Swit_0388"
FT   CDS_pept        complement(414445..415821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0388"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66758"
FT                   /db_xref="GOA:A5V392"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5V392"
FT                   /protein_id="ABQ66758.1"
FT                   /translation="MATNWTPASWRQQQAVQMPDYPDAAALAAAEQELSSFPPLVFAGE
FT                   ARELTASLAQVAAGKAFLLQGGDCAESFAEFHPNNIRDTFRVLLQMAVVLTFASKLPVV
FT                   KVGRMAGQFAKPRSAPTEEIGGVTLPSYRGDIINDIGFSEESRIPDPRRMVRAYSQSAA
FT                   TLNLLRAFAQGGYANLHQVHAWTLDFMGRSPWAAQYGEVAARIGDALDFMAACGINPET
FT                   VPQLKGTQFYTSHEALLLPYEQAMTREDSLNTGQYFDTSAHFLWIGDRTRFEGSAHVEY
FT                   LRGVGNPIGLKCGPSLEPDALLRLLDTLDPQRQPGRITLITRYGHDKIEKHLPALVRAV
FT                   KREGRPVVWSCDPMHGNVVKAANGYKTRPFDRILAEVRGFFAVHRAEGTHGGGIHAEMT
FT                   GQNVTECTGGAMAVTDENLADRYHTHCDPRLNAGQSLELAFLLAEMLNQEMKERDRAAA
FT                   "
FT   gene            complement(415927..417054)
FT                   /locus_tag="Swit_0389"
FT   CDS_pept        complement(415927..417054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0389"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66759"
FT                   /db_xref="GOA:A5V393"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:A5V393"
FT                   /protein_id="ABQ66759.1"
FT                   /translation="MTSSDTSPGGGPRPTRRDASIDILRGLALITITINHITGFTDRMH
FT                   MVGMQFPTLTLWGFSSAAEVFFLLSGYLVGAVYFRVDRDPAIATFTDKLWRRTGKLYVY
FT                   NLGLFLVLIPLALNSPDLARLSFYSYFIKGGPSTIVDFLILYIQPYCLEILVTYMVLLG
FT                   TAPLFALLLRWQPIVALLVSAGLYWFAHEHAWFNVIGGSPVGDWRWNFNPASWQLVFFG
FT                   AMAAGRYRLLARLERRAEGNWHWLVPPVLLFAGLTILFLAQSWFSFEVLYQSKIRIGPV
FT                   RVAHALSVCWLIMSILWMWPRLQQLWPMRQCAVIGSNSLQTFVVSVALSYAAGFLWIEV
FT                   WPNHDAYIALCIASVVLLGLFANGYKYWKATRPAG"
FT   gene            417204..419606
FT                   /locus_tag="Swit_0390"
FT   CDS_pept        417204..419606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0390"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="TIGRFAM: ATP-dependent protease La; PFAM: peptidase
FT                   S16, lon domain protein; AAA ATPase, central domain
FT                   protein; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66760"
FT                   /db_xref="GOA:A5V394"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A5V394"
FT                   /protein_id="ABQ66760.1"
FT                   /translation="MTETLPVLPLRDIVVFPHMIVPLFVGREKSVAALESAMAADKSIF
FT                   LVAQLDPAEDDPDRDALYDLGVVATVLQLLKLPDGTVRVLVEGKQRARLEALTGEDAHL
FT                   TAEVELIEEAEAEGTEVAALMRSVVDQFENYARLNKKLPAETSVQLGQIEEAAKLADAV
FT                   AANISIKVSDKQALLVELDPAKRLEMAFALMEGELGVLQVEKKIRSRVKRQMEKTQREY
FT                   YLNEQLKAIQRELGNGEGEDGGDELSELTAKIAKLKLSKEARGKANAELKKLRTMAPMS
FT                   AEATVVRNYLDVLLGLPWGKKSKLKKDIAAAQAVLDADHHGLEKVKDRIVEYLAVQART
FT                   NKLKGPILCLVGPPGVGKTSLGRSIAKATGREFVRQSLGGVRDEAEIRGHRRTYIGSLP
FT                   GKIVTNLKKAGTSNPLFLLDEIDKLGQDFRGDPASALLEVLDPEQNSKFQDHYLEIDVD
FT                   LSDVMFVCTANSLNLPQPLLDRMEIIRLEGYTEDEKVEIAKEHLRDKQVEAHGLKAGEF
FT                   ELTDAGLRDLIRYYTREAGVRTLEREIAKLARKSLRRILEGKDEKVVITPDNLSDFAGV
FT                   RKYRFGIGEEEDQVGAVTGLAWTEVGGELLTIEAVTVPGKGGISTTGKLGDVMKESVQA
FT                   AFSFVKARAPAYGIKPSLIARKDIHIHLPEGAVPKDGPSAGIGITTAIVSTLTGIPVRK
FT                   EVAMTGEVTLRGRVLPIGGLKEKLLAALRGGITTVLIPKENEKDLVEIPTNIREGLKII
FT                   PVSHVDEVLGLALAGHLTAIDWTEADELASTLKGATSPDGGEVAVRH"
FT   gene            complement(419653..420222)
FT                   /pseudo
FT                   /locus_tag="Swit_0391"
FT   gene            complement(420225..420653)
FT                   /locus_tag="Swit_0392"
FT   CDS_pept        complement(420225..420653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66761"
FT                   /db_xref="GOA:A5V395"
FT                   /db_xref="UniProtKB/TrEMBL:A5V395"
FT                   /protein_id="ABQ66761.1"
FT                   /translation="MIRQLLYGALMWAVCLYAFFRGGWAERVTAGSILIATYVTVLVLS
FT                   PLAVRYQFVELPVMAVDTIVLLVLVGISLKSEKFWPLWLTAMQGLTILSHLAPYVPHVL
FT                   PWAYGNAVAVWIYPMLIVLAFAVHFHHRNRKVGGSFTD"
FT   sig_peptide     complement(420576..420653)
FT                   /locus_tag="Swit_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.617) with cleavage site probability 0.571 at
FT                   residue 26"
FT   gene            complement(420705..421052)
FT                   /locus_tag="Swit_0393"
FT   CDS_pept        complement(420705..421052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66762"
FT                   /db_xref="UniProtKB/TrEMBL:A5V396"
FT                   /protein_id="ABQ66762.1"
FT                   /translation="MSKNRDDATLRVYAALEQYERALDIAAKQGALLAAELPQARLDGN
FT                   FALEVAQGAFTHFFNSLSTIIEARGQVVEGHRELAVVQRKFNLPVVSTGDKGTIPKLPI
FT                   DNGESFPRRVA"
FT   gene            complement(421104..421661)
FT                   /locus_tag="Swit_0394"
FT   CDS_pept        complement(421104..421661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0394"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR; Bacterio-opsin
FT                   activator, HTH domain protein; sigma-70 region 4 domain
FT                   protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66763"
FT                   /db_xref="GOA:A5V397"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5V397"
FT                   /protein_id="ABQ66763.1"
FT                   /translation="MRYFSPMSIEAISKLTARQRDCLRLVLHHKQSKEIGRELGISPMT
FT                   VDNHFRSAIQTLGVSNRLEAALMLASHEGDEPSQRLTSQPHPVVSPAESSIMASSSDIG
FT                   DGQREMTSALREDQVPYRTYREASFIDFPLPVPTRGKPRNDLSIAQRLFWIAILIFGMG
FT                   LGAGALLSGFAALTNIALALKH"
FT   gene            complement(421767..422258)
FT                   /locus_tag="Swit_0395"
FT   CDS_pept        complement(421767..422258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0395"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66764"
FT                   /db_xref="GOA:A5V398"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A5V398"
FT                   /protein_id="ABQ66764.1"
FT                   /translation="MSSQPPPNYITPAGFAAMRARYDHLFGTERPALVEVISWAAGNGD
FT                   RSENGDYIYGRKKLREIDRELAYLSRRMKAAKVVDPARQAERGKVFFGATVTVVDEDDV
FT                   ERTVTLVGADEADAGSGRISWLSPLARALRGAAVGDVRRVALPGGDREQEILSIRYPDA
FT                   "
FT   gene            complement(422255..423058)
FT                   /pseudo
FT                   /locus_tag="Swit_0396"
FT   gene            complement(423171..423443)
FT                   /locus_tag="Swit_0397"
FT   CDS_pept        complement(423171..423443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0397"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66765"
FT                   /db_xref="GOA:A5V399"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A5V399"
FT                   /protein_id="ABQ66765.1"
FT                   /translation="MTQFRREVQITNIRGLHARASAKFVTLASAHSAEVEVEKDGSKVA
FT                   GTSIMGLMMLGAAKGDSVVISATGDGAEKALAALIELVEGKFGEE"
FT   gene            complement(423440..423847)
FT                   /locus_tag="Swit_0398"
FT   CDS_pept        complement(423440..423847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0398"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66766"
FT                   /db_xref="GOA:A5V3A0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3A0"
FT                   /protein_id="ABQ66766.1"
FT                   /translation="MIGLVLVTHGRLAAEFVTAMEHVVGPQTAIEAICIGPDDDMESRR
FT                   ADIARAVKAVDDGSGVILLTDLFGGTPSNLAISLMEPGRVEVIAGINLPMLIRLEGARK
FT                   MMKIKAAVAAARDAGRKYISVASEVLGEAAA"
FT   gene            complement(423867..424808)
FT                   /locus_tag="Swit_0399"
FT   CDS_pept        complement(423867..424808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0399"
FT                   /product="uncharacterised P-loop ATPase protein UPF0042"
FT                   /note="PFAM: uncharacterised P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66767"
FT                   /db_xref="GOA:A5V3A1"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3A1"
FT                   /protein_id="ABQ66767.1"
FT                   /translation="MTKAGMTKAGEPRRILFVTGMSGSGKKTALTALEDMGWETVDNLP
FT                   VSLLERLLAASPAEGSIDEGRPLALGIDSRTRDFDSRGVVRRVRSLRDGGRDASILFFD
FT                   CSNTELSRRYSETRARHPLARDRQVEDGISYERELLAPLREAADELIDTTDSSTNELQA
FT                   LLRRRFGDSAGTGTTLTVMSFAFSRGVPRDADLMFDMRFLRNPHWVPELKPHSGLDPDV
FT                   GAYIAGDPIYPEARARIEELILLLLPRYETEGKSYVTIAIGCTGGKHRSVHFAETLASR
FT                   LRQEGFSPTVRHRDLTRQKSNAEESTVPGVGS"
FT   gene            complement(424805..425254)
FT                   /locus_tag="Swit_0400"
FT   CDS_pept        complement(424805..425254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0400"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66768"
FT                   /db_xref="GOA:A5V3A2"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3A2"
FT                   /protein_id="ABQ66768.1"
FT                   /translation="MSDSVPLADPIHASSVMVDGRVVLIAGRSGSGKSDLALRLIDRGA
FT                   LLVADDYTRVEGRDGRLIASAPPQIAGRIEVRGVGIVELASAVEGSVALLVDLDRAVER
FT                   MPAEPLPTTALDGIAIPTLGLSAFEASAPIKVEQALRRHGLGGPQ"
FT   gene            complement(425258..426847)
FT                   /locus_tag="Swit_0401"
FT   CDS_pept        complement(425258..426847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0401"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66769"
FT                   /db_xref="GOA:A5V3A3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3A3"
FT                   /protein_id="ABQ66769.1"
FT                   /translation="MAKSSSALGTPEAAARTSLTTRILAVNIFALAMLAGGFFYLDSYR
FT                   AQLIDARLEETATQVRLVAEAYAVTPPAGRPQLLSKFGLLTDTRLRVYAYPSPAARASE
FT                   VVRSFDSWSISGPTYQLRDPSQEEWQKRVARFLDRSIDIIVDADHPEHFQEPARDTLAA
FT                   WPIALRAARDPNIETSVERAPDRTPMILAAIDVRRPDGSGAVILSTENQRDITRIVRAE
FT                   RLRLGVVLLIVVLVSVSLSLFLARTIVRPLRRLALAAHRVRLGRAREVQVPRLPERRDE
FT                   IGTLARALSDMSMAIRQRIDATEAFAADVTHELKNPLASLRSAVDSLGIVKEPALQKQL
FT                   IDVIRDDVGRLDRLITDIAEASRVDAELARARFESVDLGTMIEGLLTTREERGRNGDVR
FT                   VAFARPHRGTAVVFGDGSRLTRVIENLVENAVSFSPAAGLVQVAATRDGDDVVIRVEDE
FT                   GPGVPPDAREAIFNRFHSDRPEGEEFGRHSGLGLAIAKAIVEGHNGSIVATDRDNAPNG
FT                   ARFVIRLPAWSR"
FT   gene            complement(426834..427541)
FT                   /locus_tag="Swit_0402"
FT   CDS_pept        complement(426834..427541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0402"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66770"
FT                   /db_xref="GOA:A5V3A4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3A4"
FT                   /protein_id="ABQ66770.1"
FT                   /translation="MTPTIALVDDDRNILTSVSIALQSEGFTVRVYSDGESALKALLDN
FT                   PPDLAVLDIKMPRMDGMELLRRLREKSSIPTIFLTSKDDELDEALGLAMGADDYITKPF
FT                   SQRLLIARIRAILRRTEVRATPEDEADATPVEKIVRGRLEMDPARHRVQWDGKDVTLTV
FT                   TEFLILEALAQRPGFVKSRDQLMDTAYQDDVYVDDRTIDSHIKRLRRKFRQVDPEFKAI
FT                   ETLYGVGYRFGEE"
FT   gene            427798..429396
FT                   /locus_tag="Swit_0403"
FT   CDS_pept        427798..429396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0403"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66771"
FT                   /db_xref="GOA:A5V3A5"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3A5"
FT                   /protein_id="ABQ66771.1"
FT                   /translation="MPQLIPAFGLDKQGIDVAAQLHWNLGTAPLVEHAVQRGEGLLAKD
FT                   GPFVVKTGAHTGRSANDKFIVRDAETEDSVWWGKTNKGMTPEQFAALKADFLAHLKTRE
FT                   TLFVQDLYGGSQATHRVNVRVINELAWHNLFIRTLLVRPEAAELAAFVPEFTIIDLPSF
FT                   AADPERHGCRSQTVIAVNLTEKLILIGGTAYAGEMKKSVFGILNYKLPVAGVMPMHCSA
FT                   NIGPKGDTAIFFGLSGTGKTTLSADASRTLIGDDEHGWSDEAVFNFEGGCYAKMIRLSA
FT                   EAEPEIYATTKRFGTVLENVVIDPDTREIDLDDDSLAENSRGSYPIDFIPNASEHNLGP
FT                   VPKNLIFLTADAYGVLPPIAKLTPEQAMYHFLSGYTARVAGTEIGVTEPSATFSTCFGA
FT                   PFMPRHPSVYGNLLKERIAKGGVDCWLVNTGWTGGQYGVGHRMPIKVTRALLNAALDGS
FT                   LNNAEFRVDPNFGFKVPVAVPGVESKILNPRETWPDGAGYDATARKLVDQFIENFAQFA
FT                   DHVDEGVRQAAPKAA"
FT   gene            429538..430674
FT                   /locus_tag="Swit_0404"
FT   CDS_pept        429538..430674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0404"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66772"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3A6"
FT                   /protein_id="ABQ66772.1"
FT                   /translation="MYEGKPPSSAGRKGWSFDALFGRSAVDDSAAVPAAQVPVPAGPDD
FT                   APPTDLFGRIGGFLRTHRLDPSPINYDLAYQYIGGHDPALVASVDAAIARDGLLRHDVA
FT                   QEIAEAASSRVSSDLLGKLIDQAHRSVTLAAALVGQSRTDARAYGSALDRGSAAIEAGG
FT                   EPAGRALELMAELTRTMIDKTNDAERRLVEMGSQMSSLQGELAEAQAVAESDPLTGLAN
FT                   RRAFQARLARAMAQAAAEGTPLSVAFCDIDHFKSINDNHGHDTGDRILKMVAEALVEGV
FT                   GEDAFVGRFGGEEFLILFDGIMARRAAMRVDEVRDELSGRHLVSKTTGEPLGTVTFSAG
FT                   VAQLLVGEDDGAMLRRADEALYAAKNGGRNRVIIHGEE"
FT   gene            430782..432239
FT                   /locus_tag="Swit_0405"
FT   CDS_pept        430782..432239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0405"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="TIGRFAM: inosine-5'-monophosphate dehydrogenase;
FT                   PFAM: CBS domain containing protein; IMP dehydrogenase/GMP
FT                   reductase; 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66773"
FT                   /db_xref="GOA:A5V3A7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3A7"
FT                   /protein_id="ABQ66773.1"
FT                   /translation="MDISLGLTFDDVLLRPGESDVLPSQANTATQVTKAITLNIPILSS
FT                   AMDTVTEADMAIVMAQLGGLGVLHRNLTVEEQAAAVRAVKRFESGMVVNPITMQPHQTL
FT                   ADAHELMARNKISGIPVVEADGKLVGILTNRDVRFAENPNQPVSELMTSQNLAVVRSGV
FT                   SQEEARRTLHQRRIEKLLVVDDAYRCVGLITVKDMEKAVNYPSATKDPSGRLRVAAATT
FT                   VGDKGFERTEALVDAECDLIVIDTAHGHNRDVARAVERVKRLSNSVQVVAGNVATAEAA
FT                   RALIDAGADGVKVGIGPGSICTTRIVAGVGVPQLTAVMEAAAEAAKSGVPVIADGGLRT
FT                   SGDIAKALAAGASTVMVGSLLAGTEEAPGETFIYQGRAYKSYRGMGSVGAMARGSADRY
FT                   FQQDIKDQMKLVPEGIEGQVPYKGTARDVIHQLVGGVKAAMGYTGARTIPELQKRARFV
FT                   RITNAGLKESHVHDVSITREAPNYPTR"
FT   gene            432246..433415
FT                   /locus_tag="Swit_0406"
FT   CDS_pept        432246..433415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0406"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66774"
FT                   /db_xref="GOA:A5V3A8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3A8"
FT                   /protein_id="ABQ66774.1"
FT                   /translation="MTPGARAQAAIELLDGIVRAAREGGAAADTLIARYFKTRRYAGSK
FT                   DRRAIRELIYRAIRRTGEVPASGRAALVGLAREDAALAAAFDGAPHTPAPIAADEEGSP
FT                   AGALPRWLADRIDPSEHAALLERAPLDLRVNHSRADRDAIAALLPDAQPTPFAPHGLRL
FT                   PEGTPIEASAPWVDGLVEIQDEGSQLIALAGQAAGGMTVLDLCAGAGGKTLALADDMGG
FT                   GGRLIASDTNRARLDRLAPRAQRSGFGGIETRLLDPGREMATLGDLRDACDVVLVDAPC
FT                   SGTGTWRRNPEARWRLTPDRLARLVETQARLLDLAADLVRPGGALVYAVCSLLDEEGAG
FT                   QLRAFLGRRSSFAAAQLPFSAGRYQDGGTLLSPGHDGTDGFFVARLVRA"
FT   gene            433451..433984
FT                   /locus_tag="Swit_0407"
FT   CDS_pept        433451..433984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0407"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66775"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3A9"
FT                   /protein_id="ABQ66775.1"
FT                   /translation="MRFSPVAIALSLTLAAVSSGVNGQKADDQINPKSLALLTEGQAAL
FT                   KAGNLQGANDALETALAIDPRNRAAFVALGRVAQAQQLPGKAIRMYFEALALEPNDVAA
FT                   LSAQGEAMVQKGAVERARANLARVKALCKSECAPATELAAAIAKGPPPAAVAAAQPNDK
FT                   VPPKGEEKSVVSDK"
FT   sig_peptide     433451..433522
FT                   /locus_tag="Swit_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.934 at
FT                   residue 24"
FT   gene            complement(434118..434948)
FT                   /locus_tag="Swit_0408"
FT   CDS_pept        complement(434118..434948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0408"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66776"
FT                   /db_xref="GOA:A5V3B0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3B0"
FT                   /protein_id="ABQ66776.1"
FT                   /translation="MSRALPDLPPLREVIARHGLSANKALGQNFLLDGQLLDRIARVPG
FT                   DLDGATVYEVGPGPGGLTRALLGAGASVVAVERDDRCLAALEELNQASGGRLRVISADA
FT                   MKIDERAEAGDGAHIASNLPYNVGTALFVRWMTLDAWPPWWRSLTLMFQKEVAERIVAK
FT                   PGSAAYGRLAVLAQWRATPVIAMNVHRSAFVPPPKVMSAIVHVVPAAQPEGASMATIET
FT                   LTAAAFGQRRKMLRQSLKGVKGAVEALATVGIDPERRAETVTVDEFVALARALS"
FT   gene            complement(434945..435940)
FT                   /locus_tag="Swit_0409"
FT   CDS_pept        complement(434945..435940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0409"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66777"
FT                   /db_xref="GOA:A5V3B1"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3B1"
FT                   /protein_id="ABQ66777.1"
FT                   /translation="MEIGPLAVALGDPAGIGPEIVAKAWDAREAQHLAPFFAVGDRRSI
FT                   EAVWQGPIRQIASPDEAAAHFADALPLIQISDTGPIIPGRPDLAGARCALDSLELAAGL
FT                   ARSAMVGGLVTAPVAKAQLYAIGFAHPGQTEFVAERCGVASANTVMMLAGPTLRAVPIT
FT                   THMPLRDVADHVTVDLIVAKARATDRGLSRNFGIERPRLAIAGFNPHAGEQGAIGREEI
FT                   DLIIPAVEQLRAEGIDIVGPLAADTMFHARARAQYDCALCLYHDQALIPLKTLHFDEGV
FT                   NMTLGLPIVRTAPDHGTAFGIAGQNKAHPGAMIAAIALAAEAARNRLVHA"
FT   gene            complement(435945..437285)
FT                   /locus_tag="Swit_0410"
FT   CDS_pept        complement(435945..437285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0410"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66778"
FT                   /db_xref="GOA:A5V3B2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3B2"
FT                   /protein_id="ABQ66778.1"
FT                   /translation="MLRRGGFWMTAAAVGAIALATPIIAQTMMDDEDVGGLNIPKDITV
FT                   FGNRDPNIRTATAIVNGTIITQTDVEQRLALVIAANGGNIPDEERERLRLQVLRNLIDE
FT                   TLQIQEATAQKVEVSREEVQQTYDRVAANFRKSPKEFAEFLHEKGSSQASIKRQIEGEA
FT                   AWRRVLSRKVEPFVAVSDEEVNAIIARLKASKGANEYHVGEIFLSATPETMNEANANAE
FT                   RIIDQVRRGASFAAYARQFSEASTAAVGGDLGWVRAEQLPDQLSAVVNQLQPGQISQPI
FT                   AIPGGYSILLLSDKRQVLGADPRDAQLLLKQLTVNFPPGITQAQATPKVEAFAKALEQI
FT                   KGCGNANEVAANIGAEVVNNDQMKIRDLPPQLQEVMLNLQIGQSTPPFGSMRDGIRALI
FT                   LCGRDDPAPSSGPSFEQIQSQIEQERVNRRAQRYLRDLRRDAVIEYR"
FT   sig_peptide     complement(437208..437285)
FT                   /locus_tag="Swit_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.635 at
FT                   residue 26"
FT   gene            complement(437361..439607)
FT                   /locus_tag="Swit_0411"
FT   CDS_pept        complement(437361..439607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0411"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: OstA family protein; Organic solvent tolerance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66779"
FT                   /db_xref="GOA:A5V3B3"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3B3"
FT                   /protein_id="ABQ66779.1"
FT                   /translation="MKKPILFLLATTLPLPFAAAPLRAQSIATPPAGPPLQGDAPTPAN
FT                   EEEVTFAADTLTYDDNAEIVTATGNVRMMRQGDRLRADKVQWNQKTGVVRAEGNVAVVN
FT                   SGNDTLYGDSVELTDSLRDGVIQNLLLVLNDGGRLAAVHGVRRNEVTTLDKAVYTPCAV
FT                   LDSKGCPKEPIWKISAVRVVHDPAKHRISYDGARISFLGTPILWLPGLSHPDGSGGGGS
FT                   GLLLPDVKYSRTNGAELGLPYYFQLAPNRDLTITPHVYSKVLPAIEAQYRALTGNGAWQ
FT                   AAGMLTYSSRFAATTGTTPAPDGNRDIRGYIDANGRFQLDPYWTLSGSIRGTSDRTFLR
FT                   RYDISRDDRLRNQIQAERITPNSYLSIKGWAVQTLRTNDKQGQQPIALPAIDYRLRLTD
FT                   PWVGGTFTVQANSLALIRTAGQDTQRAFAAVQWDMRRYTPLGQEFTLTGYARGDIYHTD
FT                   QVGQTSTIVYRGDPGWTPRGIAAVAADMRWPFVGEFLGGSQRITPRVQIVASPKTRNLS
FT                   IPNEDARAIDLEDSNLFALNRFSGYDRWEDGSRITYGAEWAVDLPGISFNTVIGQSYRL
FT                   SNKSTLLPVGTGLSDRLSDIVGRTTIKYGRFLELTHRFRLDKDNFAVRRNEIDATIGTQ
FT                   RTYATIGYLKLNRDIAATIEDLRDREEVRLGARIQIARYWSVFGSTVIDLTGRREDPLT
FT                   LSDGYQPIRHRLGILYDDDCIELGVTWRREYDAIGDARRGNTFLLRLALKNLGR"
FT   sig_peptide     complement(439533..439607)
FT                   /locus_tag="Swit_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.914 at
FT                   residue 25"
FT   gene            439764..441233
FT                   /locus_tag="Swit_0412"
FT   CDS_pept        439764..441233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0412"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17, leucyl aminopeptidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66780"
FT                   /db_xref="GOA:A5V3B4"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3B4"
FT                   /protein_id="ABQ66780.1"
FT                   /translation="MRISFVDSRPARPHALAIAVAPAMIGGAGLAALPDAAQALARIAA
FT                   QANRFDGESGAVVEFFGETDAANRRLLLAGVGSKNDFERAGAALVAKLLTSGETALVVD
FT                   ISAVAGDKPADAAAALAFGAVLRAWRHDAYRTRLDAKQRPSLEEIVIVGGGAGAAEAWK
FT                   DREAVAEGVMFTRELVAEPANIVYPESFVERCRPLADLGVKIEVLDRDAMAKLGMGALL
FT                   GVAQGSVREPRLLVMTWDGTGGAEPPIALVGKGVTFDTGGISLKPPAGMEDMKWDMGGA
FT                   GAVAGTMKALALRKAKAHVIGVCGLVENMPDGNAQRPGDVVTSMSGQTIEVINTDAEGR
FT                   LVLCDALTWVQKTRNPKTIIDLATLTGAMIISLGHEYGGMFANDDALADQLSAAGGAVG
FT                   DKLWRMPLGDAFDKLIDSPIADMKNVGPREGGSITAAQFLKRYIEDGVRWAHLDIAGMV
FT                   WASKPGATWDKGATGYGVRLLDRFVADNFEK"
FT   sig_peptide     439764..439859
FT                   /locus_tag="Swit_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.961) with cleavage site probability 0.738 at
FT                   residue 32"
FT   gene            complement(441235..441816)
FT                   /locus_tag="Swit_0413"
FT   CDS_pept        complement(441235..441816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66781"
FT                   /db_xref="GOA:A5V3B5"
FT                   /db_xref="InterPro:IPR002835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3B5"
FT                   /protein_id="ABQ66781.1"
FT                   /translation="MDTHLVLAVRPPEEGKSRLAATIDSDQRSALNYKMFRHVLKIGSE
FT                   LFPPGQIILVSRSAALRDEVAALGGHALEESGDDLNAALEQGAAFAMGHGAGSLLSLSS
FT                   DLPSLTVDDVRAMLDAPAPVAIATDRLRTGTNALRMRPAGAIPFRYGVDSLAAHLAAAT
FT                   AAKLEAVVIERPGLAGDIDTPADLAEWRRR"
FT   gene            complement(441818..442741)
FT                   /locus_tag="Swit_0414"
FT   CDS_pept        complement(441818..442741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0414"
FT                   /product="LPPG:FO 2-phospho-L-lactate transferase"
FT                   /EC_number="2.7.1.-"
FT                   /note="TIGRFAM: LPPG domain containing protein; PFAM:
FT                   protein of unknown function UPF0052 and CofD"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66782"
FT                   /db_xref="GOA:A5V3B6"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010115"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3B6"
FT                   /protein_id="ABQ66782.1"
FT                   /translation="MILALAGGVGGARLARGLAAILPPGKLTIAVNTGDDFEHLGLLVC
FT                   PDIDTVCYTLAGINNAAQGWGLEGESWAFMDALGKLGGESWFNLGDRDLATHVLRTGMI
FT                   GRQSLSEITALLAGRMGIAHRIVPMSDDRVRTMVDTDEGELPFQQYFVRRRAEPRFRAI
FT                   RFDGIETARPSAGLLDAVADPALEAVILCPSNPVLSITPILALSGVRAALAARGVPIVA
FT                   VSPFIGGQAVKGPAAKIMGEIGLATTPAGLAAYYDGLLDGIVIDRVDTGADAGTAALHV
FT                   TATLMRDLDDQRRLADETIAFARRLR"
FT   gene            complement(442738..443508)
FT                   /locus_tag="Swit_0415"
FT   CDS_pept        complement(442738..443508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0415"
FT                   /product="coenzyme F420-0 gamma-glutamyl ligase"
FT                   /EC_number="6.3.2.-"
FT                   /note="TIGRFAM: F420-dependent oxidoreductase, putative;
FT                   PFAM: protein of unknown function DUF129"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66783"
FT                   /db_xref="GOA:A5V3B7"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3B7"
FT                   /protein_id="ABQ66783.1"
FT                   /translation="MVTEASLSLFPLAGVPLIEAGADLAAVVLAALETSGRSLVDGDIV
FT                   VLAQKIVSKAEGRLVELAGVTASAQAIDIARQVDKDPRLVELILSEAQEVMRVRKGVLI
FT                   VRHRLGLVLANAGIDQSNIDHDGQPRALLLPVDPDASARALRAALAERCGVDVAVLIID
FT                   SLGRAWRTGTTGTAIGVAGMPALLDLRGREDLHGRRLETSELGLADEVAAAASLVMGQA
FT                   DEGRPIVIVRGVDHDRRDGSAADLIRPRHMDLFA"
FT   gene            443708..445114
FT                   /locus_tag="Swit_0416"
FT   CDS_pept        443708..445114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0416"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66784"
FT                   /db_xref="GOA:A5V3B8"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3B8"
FT                   /protein_id="ABQ66784.1"
FT                   /translation="MLDAFDPVVLARIQFAFTVSFHFIFPSFSIGLASYLMVLEALWLK
FT                   TGNAIYANLYRYWLKIFAIAFAMGVVSGIVMSYQFGTNWSVFSDKAGAVIGPLMAYEVL
FT                   TAFFLEAGFLGVMLFGINKVGKGLHFAATCAVAIGTFISAFWILSANSWMQTPVGYEIA
FT                   ANGQFVPGPSWAAIIFNPSFPYRLVHTVIAAYLTTALVVGGVGAWHLLRDGANRGARTM
FT                   FSMAMWMAALVAPIQILAGDMHGLNTLEHQPAKVMAMEGHYQSHPHGAPLILFGIPNSA
FT                   EQRVDLAVEIPKMSSLILKHDPDAPLAGLDTVPERDHPPVGIVFWSFRIMVGIGFAIFA
FT                   LGLFSLIARARGRLYDWPLLHRLAILLGPAGFVAVIAGWVTTEVGRQPYVVYGLLRTAD
FT                   AASPLAAPAVGASLLAFIIVYFAVFGVGVWYILKLMAKPPQRGESAEPVEGPIRSAGIT
FT                   PAPAVEGERP"
FT   gene            445111..446115
FT                   /locus_tag="Swit_0417"
FT   CDS_pept        445111..446115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0417"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66785"
FT                   /db_xref="GOA:A5V3B9"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3B9"
FT                   /protein_id="ABQ66785.1"
FT                   /translation="MIGFDLTLAWAAIIAFAVAAYVVMDGFDLGIGILFPGFRVGGERD
FT                   MAMNSIAPVWDGNETWLVLGGGGLMAAFPLAYAIILPALYAPLTAMLLGLVFRGVAFEF
FT                   RWRDPGHRAFWDAAFCGGSLVATLAQGITLGALLQGIEVGGRAYAGGWWDWLTPFSLLT
FT                   GVSLAIGYALLGAGWLIWKTEGALQADARRFARPLCLALLVAIAAVSLYTPFLEGKYHE
FT                   RWFGYPGLFVTIPVPLLVAVVALLLWRSIGGRRDGMPFLLTLGLFGLSMLGLAISIYPD
FT                   VVPGRVTIWEAAAPERSQAFMLVGAVVLVPIILGYTIWAYWVFRGKVDEAGYH"
FT   sig_peptide     445111..445173
FT                   /locus_tag="Swit_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.909) with cleavage site probability 0.652 at
FT                   residue 21"
FT   gene            446344..447693
FT                   /locus_tag="Swit_0418"
FT   CDS_pept        446344..447693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0418"
FT                   /product="glutamate dehydrogenase (NADP)"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, C terminal;
FT                   Glu/Leu/Phe/Val dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66786"
FT                   /db_xref="GOA:A5V3C0"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3C0"
FT                   /protein_id="ABQ66786.1"
FT                   /translation="MSNIDEKLQPVLEEVLRRNAGEAEFHQAVREVLESLGRVVAKHPD
FT                   YADHALIERICEPERQIIFRVPWVDDSGQVQINRGFRVQFNSALGPYKGGIRFHPSVNL
FT                   GIVKFLGFEQIFKNALTGMPIGGGKGGSDFNPRGRSDGEVMRFCQAFMTELQRHLGEYT
FT                   DVPAGDIGVGGREIGYMFGQYKRLNNRYEAGVLTGKGLVYGGSRARTEATGYGLVYFVQ
FT                   RMLGTKDQAFDGKRVVVSGSGNVAIYAIEKVRQFGGKVIACSDSNGYILDEEGIDLDLL
FT                   KEIKEVRRERLSEYARAAGARAHYIENGSIWDVPCDIALPCATQNELTAKDANTLIRNG
FT                   VIAVGEGANMPSTPEAVDLFQRAGVLFAPGKAANAGGVATSALEMQQNASRDSWSFEQT
FT                   EERLAQIMRNIHDNCAETAEEYAAPGNYVLGANIAGFVRVAEAMRSLGVI"
FT   gene            complement(447745..448857)
FT                   /locus_tag="Swit_0419"
FT   CDS_pept        complement(447745..448857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66787"
FT                   /db_xref="GOA:A5V3C1"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3C1"
FT                   /protein_id="ABQ66787.1"
FT                   /translation="MTRDIPFSRRWGIRLGTILWFVAGLGFLLALPILVQATGWALPVV
FT                   ALLAALIALPLAWLFRKLLRSRRPLLQSWIGWAVALFFLLSILLAAPIYYLAAVTQMRP
FT                   ALVPQVTLTNGRKTIVFQGMQHVGIERFYKSVVYDLEDALSRGYVLYYEGVRPATPEAD
FT                   AWLDRTVTGGRDLSETYRALGDLCGLQFQNDYFQLLGRDAQVHPASHVVADVSTLDLKR
FT                   EYDRLMATDPGFAKAMAAKPKSDAASPDRMEAAIRFLRQGTEGQRAIAGILCRGFMTLS
FT                   LTRASGPPSGDPLDRVLIDFRNRQLAARLIAEPRPRIYLTYGAMHLPGLFALLRKNDPQ
FT                   WHVASVKWMRTIDAPEDHDGQMPALPAAGR"
FT   sig_peptide     complement(448744..448857)
FT                   /locus_tag="Swit_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.710 at
FT                   residue 38"
FT   gene            complement(448854..449528)
FT                   /locus_tag="Swit_0420"
FT   CDS_pept        complement(448854..449528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66788"
FT                   /db_xref="GOA:A5V3C2"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3C2"
FT                   /protein_id="ABQ66788.1"
FT                   /translation="MDFLRLFQSIEELLYEVMSWLIFYPRTLWRSVRHPMEMLLYSERE
FT                   LRDPAEDQFTDMLSPPLFLLLTILLSHLIEIGSHSSLPKATSPIGQQIMTSDQNLLLLR
FT                   FVLFSIYPLMFAARRLKAQGLPLDRETLRQPFFAQCYIAGPAALILGIAAILVRAQHPA
FT                   VVLSGFAIALLGIAWYLRIETIWLHRHSHMTRSAAIRSVLGTWLAAAIFNGIASILIVG
FT                   AP"
FT   gene            complement(449551..450474)
FT                   /locus_tag="Swit_0421"
FT   CDS_pept        complement(449551..450474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66789"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3C3"
FT                   /protein_id="ABQ66789.1"
FT                   /translation="MQSFVTLRPQFRQKKALAPNRAATHSGWTVVTNCEGMPVTIRHLS
FT                   IIAACGPLLLPSIASAQAPRDLGDLVGARAAGGETQLEERGYVHIKTQKGDDRAWSYWW
FT                   QPKHRACVSVAVFDGRFDAITTTPAADCNQGNAKADGKGGSGAAAAAAIGVALVGVAAL
FT                   AHNSHNHDNGKHLDDEAADSQFERGYRDGLYAQSYHNYDRADAYSDGYSKGVAQRGNET
FT                   RHRDGHADDAGGYRASVNVNDLVTQRAASADVELQKRGFRTVNAYQAGDSAYTIRSNER
FT                   TGQCVQVAVKDGRIRYIAAIKPSACR"
FT   gene            complement(450513..450589)
FT                   /locus_tag="Swit_R0007"
FT                   /note="tRNA-Arg3"
FT   tRNA            complement(450513..450589)
FT                   /locus_tag="Swit_R0007"
FT                   /product="tRNA-Arg"
FT   gene            450649..451395
FT                   /locus_tag="Swit_0422"
FT   CDS_pept        450649..451395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0422"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66790"
FT                   /db_xref="GOA:A5V3C4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3C4"
FT                   /protein_id="ABQ66790.1"
FT                   /translation="MNDSSAAPVASDAEAIRGRHFRYFDFVMAAFVTILLLSNVLGAGK
FT                   VAVVHIPGIGPWPFGAGILFFPVGYVIGDIMTEVYGYGRARRCIWAGTAALLFMVVMSL
FT                   VVVALPPDKNWTGQAAYEQVFGQVPRIVVASITAFWAGEFVNSYVLAKMKLWTGGKHLW
FT                   TRTIGSTVAGQGVDSLIFYPLAFLGAEGWTSNLVFKVLVTQWVLKVSWEVILTPATYVV
FT                   VNFLKKREGIDVFDEGTDFTPFRTRV"
FT   gene            complement(451400..451732)
FT                   /locus_tag="Swit_0423"
FT   CDS_pept        complement(451400..451732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0423"
FT                   /product="protein of unknown function UPF0060"
FT                   /note="PFAM: protein of unknown function UPF0060"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66791"
FT                   /db_xref="GOA:A5V3C5"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3C5"
FT                   /protein_id="ABQ66791.1"
FT                   /translation="MPGAGLFIFVAAALCEIGGCFAFWAWLRLGKSPLWAVGGVGLLIL
FT                   FAWLLTRVDSAAAGRAFAAYGGIYICASLGWMWAVEGGRPDRWDLIGVLLCAVGSAVIL
FT                   LGPRTA"
FT   sig_peptide     complement(451664..451732)
FT                   /locus_tag="Swit_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.648) with cleavage site probability 0.648 at
FT                   residue 23"
FT   gene            complement(451732..452151)
FT                   /locus_tag="Swit_0424"
FT   CDS_pept        complement(451732..452151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0424"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66792"
FT                   /db_xref="GOA:A5V3C6"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3C6"
FT                   /protein_id="ABQ66792.1"
FT                   /translation="MTAPHGAGCLCGAVRFTIDAEPMAARTCWCRLCQYLGGGTATANI
FT                   CFPADKVRWTGEIRYHDSVAESGNAMRRGFCPTCGTPLTSEALSRPHLIFLRIGALDDP
FT                   NLMGPQATIWTSQAPDWACISTEIPSLESQPPPVA"
FT   gene            complement(452148..452813)
FT                   /locus_tag="Swit_0425"
FT   CDS_pept        complement(452148..452813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0425"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66793"
FT                   /db_xref="GOA:A5V3C7"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3C7"
FT                   /protein_id="ABQ66793.1"
FT                   /translation="MKSAVIVFPGSNCDRDLAVAIRDVTGKAPDMLWHQETALPDGIGL
FT                   IAVPGGFSYGDYLRSGAMAARSPIMRAIVEAAGRGVPVLGICNGFQILTEAGLLPGALM
FT                   RNEGLDFVCREVALTVENSQSTFTARYDKGEKVHFPVAHHDGNFTADRETLDRIEGEGR
FT                   VAFRYAEAVNGSARGIAGILNDAGNVLGMMPHPERVIEAAHGNDDGRRLFEGLLETVA"
FT   gene            complement(452827..453057)
FT                   /locus_tag="Swit_0426"
FT   CDS_pept        complement(452827..453057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0426"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66794"
FT                   /db_xref="GOA:A5V3C8"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3C8"
FT                   /protein_id="ABQ66794.1"
FT                   /translation="MKTRVYVTLKGGVLDPQGKAIHHALGSLGFSGVNDVRAGKLIELD
FT                   HDDGVSDAEIEAMCKKLLANTVIENFRIERA"
FT   gene            complement(453127..453990)
FT                   /locus_tag="Swit_0427"
FT   CDS_pept        complement(453127..453990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0427"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66795"
FT                   /db_xref="GOA:A5V3C9"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3C9"
FT                   /protein_id="ABQ66795.1"
FT                   /translation="MGTSWSVRFAAPAGCDPAAVEAAILARLDTIIAEMSHWRADSLIS
FT                   AYNRAEAGSWHSLPDDFAAVIATALDVAARSGGAFDPAIGRLVDLAGFGPDPALRSDAA
FT                   TALALARQNAGWRRLRFRDGRLLQPGGLTLDLSGIAKGHAVDAVADALGALGIAHALVE
FT                   IGGELVGRGVRPDGDPWWVDLENPPGNPLPPLRIALHGIAVATSGDYRRGAHSIDPRTG
FT                   RSTDNGVRSVSVIHKSAMLADAWATALTVAGPEAGLDLARREGIAARIVGDREWLSPAL
FT                   VEMLEY"
FT   gene            complement(454086..454913)
FT                   /locus_tag="Swit_0428"
FT   CDS_pept        complement(454086..454913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66796"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3D0"
FT                   /protein_id="ABQ66796.1"
FT                   /translation="MKRFSTRLLAAAAILALPAAASAHRQWMVPNATVFSGTNSWVTVD
FT                   AAASNDLFFADHQPMRLDGVKVWAPDGSEGAIANGSTGRYRSTFDVKLDKPGTWKIGTF
FT                   TSAVMGSFKANGEERRIGGRPGGGTPPLSVADIPADATDVKLTEVIGRNELYITADAPS
FT                   STVFTPTGKGIEFQPVTHPDELVVGEPASFRFLVDGKPAGGLKVTVVPGGKRYRNDDGA
FT                   RDFTTGADGVAKIDWPTPGMYWINASLTDDKPSAPRATQRRMNYVTTVEVLLP"
FT   sig_peptide     complement(454842..454913)
FT                   /locus_tag="Swit_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            complement(454925..455422)
FT                   /locus_tag="Swit_0429"
FT   CDS_pept        complement(454925..455422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0429"
FT                   /product="periplasmic-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66797"
FT                   /db_xref="InterPro:IPR014469"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3D1"
FT                   /protein_id="ABQ66797.1"
FT                   /translation="MREIAMRTTPFLLIGGMIAAPASAAGTINVTIPQLKVAEYHRPYV
FT                   AVWLEPAGGGAARTLAVWYDVKKGGNEPGTKWLSDLRAWWRKGGKSAKMPADGISGATR
FT                   APGTHAIPLPADLKPGNYVLAVEAARETGGREHVTLPISVPAKPAKAAGKTELGAVTLS
FT                   AR"
FT   sig_peptide     complement(455348..455422)
FT                   /locus_tag="Swit_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.934 at
FT                   residue 25"
FT   gene            complement(455419..456054)
FT                   /locus_tag="Swit_0430"
FT   CDS_pept        complement(455419..456054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0430"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66798"
FT                   /db_xref="GOA:A5V3D2"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3D2"
FT                   /protein_id="ABQ66798.1"
FT                   /translation="MKRKPQHKPWYRSRGWWLKQLHNWHWMSAAISLIGMLLFAATGIT
FT                   LNHAATIAASPHVQNLSAKLPAPLLAQLAKPASDSAPLPPAIVAELDTRLELNAGGKPG
FT                   EWSDDEVYVALPRPGGDAWISIDRASGAVTAEITDRGWISYLNDLHKGRNAGGAWGWFI
FT                   DVFAGACILFTLTGLFLLYMHSKPRPLTWPLVGLGLVVPMLIVVLFVH"
FT   sig_peptide     complement(455905..456054)
FT                   /locus_tag="Swit_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.665 at
FT                   residue 50"
FT   gene            complement(456336..458360)
FT                   /locus_tag="Swit_0431"
FT   CDS_pept        complement(456336..458360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0431"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma-70; PFAM: sigma-70 1.1 domain protein;
FT                   sigma-70 region 3 domain protein; sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; sigma-70,
FT                   non-essential domain protein; sigma-70 region 1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66799"
FT                   /db_xref="GOA:A5V3D3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3D3"
FT                   /protein_id="ABQ66799.1"
FT                   /translation="MAKTNGSEGGDRIDGDAPLIDLNEGSLKKLIARAKRKGYITYEQL
FT                   NEALPQDQMTSDQLEDVMSALNEMGVNIVENEDAGEDEQPEEDGIDEVAGSEEGDTGPA
FT                   LTTTAKKETVDRTDDPVRMYLREMGAVELLSREGEIAIAKRIEAGRDTMILGLCESPIT
FT                   FNAIIEWSNALNEGTMQLREILDLDAMLSKGPTAEQVENEDADAEISAETAGPTFKEEE
FT                   EPEEEASADEDEDSMTERRAPRPQEDDDEDNTLSLAQMEEQLKPMALERFAAITDLYKT
FT                   FSQVQSARVAALGVGDDFPAAEEERYQGLREQLTAEVESVQFHGAKIEYLVDQLYSFNR
FT                   RLTTLGGQMLRLAERHKVPRRDFLEAYVNHEMEDGWLDRVGRIDKKWANFAANEADAVD
FT                   RIRNEIGEIAQATGMALSEFRRIVNMVQKGEREARIAKKEMVEANLRLVISIAKKYTNR
FT                   GLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHM
FT                   IETINKLVRTSRQILHEIGREPTPEELAERLSMPLEKVRKVMKIAKEPISLETPIGDEE
FT                   DSHLGDFIEDKNAIIPVDAAIQSNLKETVTRVLASLTPREERVLRMRFGIGMNTDHTLE
FT                   EVGQQFSVTRERIRQIEAKALRKLKHPSRSRKMRSFLDQ"
FT   gene            complement(458412..460283)
FT                   /locus_tag="Swit_0432"
FT   CDS_pept        complement(458412..460283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0432"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="TIGRFAM: DNA primase; PFAM: zinc finger, CHC2-family
FT                   protein; TOPRIM domain protein; DNA primase catalytic core,
FT                   N-terminal domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66800"
FT                   /db_xref="GOA:A5V3D4"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3D4"
FT                   /protein_id="ABQ66800.1"
FT                   /translation="MSLSPQFLDELRARVTLSTLIGRSVKLVKAGREFKACCPFHNEKS
FT                   PSFYVNDDKGFYHCFGCGAHGDAIRFLTEAKGLTFIDAVKELAQGAGMEVPAPDPRAAQ
FT                   RNEMQAGLHDVMAAAASWFQEQLGGIAGAEARAYLQRRGIDERLVKKFGIGFAPDSRGK
FT                   LRTALKSFGDAKLIETGLLILVEDKEPYDRFRGRVMIPIQDQRGRVIAFGGRILDKGEP
FT                   KYLNSPDTPLFDKGRTLFNIERASAASRKANRVIAVEGYMDVIALAKAGIDEAVAANGT
FT                   ALTEAQLERMWRMTEIPLLCFDGDKAGQKAAVRAAQRALPMIAPGRTLRFALLPGGQDP
FT                   DDLVKSGGVRAVEQVLDEAISLDELLWRAEYEAQPLSTPEARAGLRKRLGDLAGSIQDR
FT                   DVRELYQAEFRRRFDELFGSAQRRPFERNFQPFQPRQQRRPGQPWKPEPLPPSRAAHAV
FT                   NKSGVNPMVTRAVMAGLLRFPALFSSHMEAIGQLQLGDERLDRLRAEAFEAGFSGGPLE
FT                   KEGLETILAEAGLGAVVEELKATNALAFSFLRGNADPDRAMRDLSAAIEAMAARPLLDA
FT                   ALREATERLGMAADDAGLEEQRRLLAAREAADRALTDLALGEDGGGA"
FT   gene            complement(460294..460692)
FT                   /locus_tag="Swit_0433"
FT   CDS_pept        complement(460294..460692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0433"
FT                   /product="protein of unknown function DUF559"
FT                   /note="PFAM: protein of unknown function DUF559"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66801"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3D5"
FT                   /protein_id="ABQ66801.1"
FT                   /translation="MGSPAFKPRPTRLARRLRNNATNTERKLWHHLRGSRLNGFKFSRQ
FT                   MPVAGFICDFLCRSAHLVIELDGGQHGWQAAEDEARTRRIEAEGYRVLRFWNNDVNERL
FT                   EGVLARIAEALAEGAEAHPQPLPHAGGE"
FT   gene            complement(460753..461205)
FT                   /locus_tag="Swit_0434"
FT   CDS_pept        complement(460753..461205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0434"
FT                   /product="GatB/Yqey domain protein"
FT                   /note="PFAM: GatB/Yqey domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66802"
FT                   /db_xref="GOA:A5V3D6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3D6"
FT                   /protein_id="ABQ66802.1"
FT                   /translation="MIRDEIKTALVAAMKARDATTTAAIRLIQSAIKNRDIELRTATQQ
FT                   PDDDLLVTEVLQKMIKQRRESIEMYEKGNRPELAAAEAAEVTVIERFLPQQMSEDEARA
FT                   AIDALATELGAASIKDMGRVMAALKERFAGQMDMAKASGLVKARLG"
FT   gene            461340..462518
FT                   /locus_tag="Swit_0435"
FT   CDS_pept        461340..462518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0435"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase, small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66803"
FT                   /db_xref="GOA:A5V3D7"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3D7"
FT                   /protein_id="ABQ66803.1"
FT                   /translation="MAETDHARLTPPEGATGVLVLGDGTLIWGRGFGAEGDAVGEVCFN
FT                   TAMTGYQEVMTDPSYAGQIITFTFPHIGNVGTNAEDVEATNPHALGMVVREDVTDPANF
FT                   RSSQHLDAWLKANGRIGVSGVDTRALTRAIRINGAPNGVIAHNAQGRFDIEALRRKARE
FT                   WPGLEGMDLAKEVSATQTYKWSDGLWALGEGYDLDAAPADAPHVVAIDYGLKRNILRNL
FT                   VAAGARVTVVPATASFDEVMAHRPDGVFLSNGPGDPAATGAYAVPVIRKLLDVGTPLFG
FT                   ICLGHQMLGLAVGAKTYKMHQGHRGANHPVKRTDDGQVEITSMNHGFAVDTDSLPANAE
FT                   ATHVSLFDGSLAGLRLTDKPAFSVQYHPEASPGPQDSHYLFEQFVAQLKAKA"
FT   gene            462515..462928
FT                   /locus_tag="Swit_0436"
FT   CDS_pept        462515..462928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66804"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3D8"
FT                   /protein_id="ABQ66804.1"
FT                   /translation="MTAVSIILLHAMALTSTAATPSECERSIAKLATAAAPATRIVATF
FT                   TGTQRSLLPLDEASSSQAEAGRPIEPTLFPIGADSFVLTIQFRPQNWGTSQSAAFAESI
FT                   CSVGLSGGGRFNGVMSFVGGRMTDAEFARIPER"
FT   sig_peptide     462515..462571
FT                   /locus_tag="Swit_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.816) with cleavage site probability 0.801 at
FT                   residue 19"
FT   gene            463002..463364
FT                   /locus_tag="Swit_0437"
FT   CDS_pept        463002..463364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0437"
FT                   /product="protein of unknown function DUF1260"
FT                   /note="PFAM: protein of unknown function DUF1260"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66805"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3D9"
FT                   /protein_id="ABQ66805.1"
FT                   /translation="MTLPAIDPQRLEEECEADAEVLANLRENGDQPELVRPVDVSFRGS
FT                   PEALVRLTDRAEEFGFEYIEIEEGEDGEPCLFLAKDQAADAASIKELTITCLQIEQIFG
FT                   VEYDGWGCELQDGKTE"
FT   gene            463364..466696
FT                   /locus_tag="Swit_0438"
FT   CDS_pept        463364..466696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0438"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; MGS domain protein; RimK domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66806"
FT                   /db_xref="GOA:A5V3E0"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3E0"
FT                   /protein_id="ABQ66806.1"
FT                   /translation="MPKRTDISSILIIGAGPIVIGQACEFDYSGTQACKALREEGYRIV
FT                   LVNSNPATIMTDPEMADATYVEPITPEIVARIIEKERPDAVLPTMGGQTALNTALALFN
FT                   DGTLEKYGCQMIGADAEAIDKAEDRLKFRQAMDKIGLESPRSDVAHTLDEALRVLDYVG
FT                   LPAIIRPSFTMGGTGGGIAYNKDEFVKIVTGGLDASPTTEVLIEESVLGWKEYEMEVVR
FT                   DRADNCIIICSIENVDPMGVHTGDSITVAPALTLTDKEYQIMRNASIAVLREIGVETGG
FT                   SNVQFAVNPADGRLVVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDEIMNDIT
FT                   GATPASFEPTIDYVVTKIPRFAFEKFKGAEPLLSTAMKSVGETMAIGRNIHESMQKALR
FT                   GLETGLAGFNVVENLKGAARSVIEEELARPTPDRLLVAAQALREGFSVDDIHRIAKYEP
FT                   WFLDRLAEIVAAEEEVCREGLPQDAAGMRRLKAMGFSDKRLAWLALQSANLAGMAREQA
FT                   RGSGIVHDAAKAMTGGITEKEVRAHRHKLGVRPVFKRIDTCAAEFEAKTPYMYSTYEAP
FT                   SFGEPECESNPSDREKIVILGGGPNRIGQGIEFDYCCCHACFALADAGYETIMVNCNPE
FT                   TVSTDYDTSDRLYFEPLTAEDVLEILHVEQSKGTLKGVIVQFGGQTPLKLAQELEDAGI
FT                   PILGTSPDAIDLAEDRERFAALVGELGLSQPRNGIARSREEALAVAERVGYPVLMRPSY
FT                   VLGGRAMEIVEDPSQLDQYISTAVQVSGDSPVLIDQYLRDAIEVDVDAICDGDDVVVAG
FT                   VLQHIEEAGVHSGDSACTLPPYSLPKEIIAEIERQTDALARALKVRGLMNVQYAVKDGE
FT                   VYLIEVNPRASRTVPFVAKAIGQPIAKIAARVMAGERLKALPRIRLDVDYIAVKEAVFP
FT                   FARFPGVDPVLSPEMKSTGEVMGIDSDFATAFAKAQLGAGTRLPLGGTAFVSVKDSDKG
FT                   HILPAVRQLIAMDFTILATSGTATFLREQGLEVETVLKKREGRPNIVDRIVDGDVDLIF
FT                   NTTEGWQSLLDSKAIRTSALYGRVPYFTTAAASVAAAQAIGALRERKLEVRALQSYYSH
FT                   SHA"
FT   gene            466780..467256
FT                   /locus_tag="Swit_0439"
FT   CDS_pept        466780..467256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0439"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66807"
FT                   /db_xref="GOA:A5V3E1"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3E1"
FT                   /protein_id="ABQ66807.1"
FT                   /translation="MASIEKLPMLAEGQKMLTEELARLKAERPLIIDAIEEARAHGDLS
FT                   ENAEYHAAKERQGQIEASIADIEDRLSRAQVIDPSMLSGDKIVFGATVTLLDDDEKPVR
FT                   YQIVGQTEADAKTGKISYNSPLGRALIGKKVDDEVEVTVPSGDRFYLVSKIEFI"
FT   gene            467274..467903
FT                   /locus_tag="Swit_0440"
FT   CDS_pept        467274..467903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0440"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66808"
FT                   /db_xref="GOA:A5V3E2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3E2"
FT                   /protein_id="ABQ66808.1"
FT                   /translation="MRLPPSRCTNAIAIGTTAIYLLLVLLGWSDAADIAGGFVPARLTG
FT                   MEIPGALPAWITPLTATLLHGGMLHLGFNMLMLVFCGRMVEAVIGPLGLAILYVVGAYA
FT                   AAGMQFLVNPADGAPMIGASGAISALFAGYALLFGRPRGFASHPTLGVAINTLWLAAAW
FT                   IGVQFLMGFAFADYGMAIATGAHVGGFLAGLLLIRPLLAWRRRSLP"
FT   gene            complement(468012..468227)
FT                   /locus_tag="Swit_0441"
FT   CDS_pept        complement(468012..468227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66809"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3E3"
FT                   /protein_id="ABQ66809.1"
FT                   /translation="MSKIHLVFGGRVKDPQGLDFEDLSQIDVVGFYQDYKSAEKAWRGA
FT                   AQRTVDDAEMRYVVVHLHKLLEPELG"
FT   gene            complement(468364..468960)
FT                   /locus_tag="Swit_0442"
FT   CDS_pept        complement(468364..468960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0442"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66810"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3E4"
FT                   /protein_id="ABQ66810.1"
FT                   /translation="MNGFTKITAALMLAGTALAAPVASAQAAVVANQDAAAFISSLGTE
FT                   AFAVLKTGNKTTVRAKFRELLSQHFAIDAIGERLIRRWNNQITPQQKAAYKAAIPNFII
FT                   GTYSDNLYDYANASMKVIRTAPAGSGFNVVTQVQKPGAQPISAVWSVAKVGGAFKVTNL
FT                   TVANINLAVTQGQDFDAIIQRKGIDGLIAMMKARG"
FT   sig_peptide     complement(468877..468960)
FT                   /locus_tag="Swit_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.752 at
FT                   residue 28"
FT   gene            complement(469062..469493)
FT                   /locus_tag="Swit_0443"
FT   CDS_pept        complement(469062..469493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66811"
FT                   /db_xref="GOA:A5V3E5"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3E5"
FT                   /protein_id="ABQ66811.1"
FT                   /translation="MTIKSKAEAAGVGIKQRAARAGDYAGEKIRTGGEAARTAGRRAAE
FT                   GVESFPVAALLGGLAVGAAIGALLPRTRQEEELLGSIGGAINDRAKDAVSAARDAGQAK
FT                   LGELGISSDAAGKQVGKLIDSLAKAAESAGTAAVGAVRS"
FT   gene            complement(469490..470230)
FT                   /locus_tag="Swit_0444"
FT   CDS_pept        complement(469490..470230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66812"
FT                   /db_xref="GOA:A5V3E6"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3E6"
FT                   /protein_id="ABQ66812.1"
FT                   /translation="MTAGRPEEQEPLGALMARLIEDGRALAKAELALFRTDFYRRIGRA
FT                   RTGALLCLIGAIMGQAAAVTFLVTLSFVLTPWIGRLGGAAVSVLLGVGVAVLLIRIGVR
FT                   KLMLVVEDADDDDEADGIAPVHPSPIDELFERVRRRSQDARNQLVETVGEAQARLHPQA
FT                   LVADLAEIVVDQAQEMSHKAIDAIRRRPGRAALAVAALVMLVLRPPLYRIARGIARATR
FT                   SGPTSFSSDRRQPPSARDDEETSA"
FT   gene            complement(470234..470866)
FT                   /locus_tag="Swit_0445"
FT   CDS_pept        complement(470234..470866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66813"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3E7"
FT                   /protein_id="ABQ66813.1"
FT                   /translation="MSWPLLMETIDMATENQDSGPRAGKAFDSARKAFNDTAAGFTGQA
FT                   EARARDYASQGKDRAVEALDNVAGLVGDAASQVSEKLGDQYGGYVQQAADAVSGFAATL
FT                   RDKDADELIDDARNVVRSSPAVAIAAAAAVGFLLARVVKSGLTPKGETADDGVASPAPK
FT                   PAARKSAPRTAPKAAAKPKPKAAPKPKAAKAPSAATPATSDDTPPAA"
FT   gene            470988..472271
FT                   /locus_tag="Swit_0446"
FT   CDS_pept        470988..472271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0446"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66814"
FT                   /db_xref="GOA:A5V3E8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3E8"
FT                   /protein_id="ABQ66814.1"
FT                   /translation="MTAIVDVHARQIIDSRGNPTVEVDITLEDGSFGRAAVPSGASTGA
FT                   YEAVEKRDGDKSRWLGKGVQDAVDAVNDEIADAIIGMEAEDQSEIDARLIELDGTPNKG
FT                   RLGANAILGASLSVARAAAEARALPLYRYVGGVSAQVLPVPMMNIINGGAHADNPIDFQ
FT                   EFMIMPVGAPTLFDAVRAGSEIFHTLKKALHDKGLATAVGDEGGFAPNLASAPDALDFI
FT                   MQSIEKAGYKPGDDVVLALDCAATEFFKDGVYDFHGEGVKRSPAEMADYLADLCARYPI
FT                   VSVEDGMGEDDFEGWKILTDKIGHKVQLVGDDLFVTNPKRLAQGIKDGLANSLLVKVNQ
FT                   IGTLSETLEAVNMAQRAGYTAVMSHRSGETEDSTIADLAVATNCGQIKTGSLARSDRLA
FT                   KYNQLIRIEEELGPVAVYAGRSAIKALG"
FT   gene            472481..474082
FT                   /locus_tag="Swit_0447"
FT   CDS_pept        472481..474082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0447"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme, formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66815"
FT                   /db_xref="GOA:A5V3E9"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3E9"
FT                   /protein_id="ABQ66815.1"
FT                   /translation="MKTPTTPAPDKVAIKRALLSVSDKSGLVELGRALAGWGVELVSTG
FT                   GTAKALRDAGLDVKDISDITGFPEMMDGRVKTLHPMVHGGLLSVRDDPEHAKAMTDHGI
FT                   GAIDLVVVNLYPFAQTVAKGAGRDEIIENIDIGGPSMVRSAAKNHAYVTIATDPADYAE
FT                   IIASGGTTDFALRKRFAAKAFAATATYDAMISSWFAHADQGQFFPEALSIPVRKAEELR
FT                   YGENPHQQAALYLPVGPSARGIAQATQVQGKELSYNNYNDADAALELVSEFRDGPPTVV
FT                   IVKHANPCGVASADTLIEAYEAALACDSVSAFGGIIAVNRPLDGKTAEAISGIFTEVVA
FT                   APDADDDAKAVFAKKKNLRLLLTGELPDPARAGMTMKSIAGGVLLQSRDNGRIGLDDLK
FT                   VVTKRAPTDQELKDCLFAWTVAKHVKSNAIVYARGGSTAGVGAGQMNRLESARIAAWKA
FT                   KDAAEKAGWATPRTIGSAVASDAFFPFADGLLAAVEAGATAVIQPGGSIRDAEVIAAAD
FT                   EAGLAMVFTGMRHFRH"
FT   gene            474138..475805
FT                   /locus_tag="Swit_0448"
FT   CDS_pept        474138..475805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0448"
FT                   /product="protein of unknown function DUF894, DitE"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66816"
FT                   /db_xref="GOA:A5V3F0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3F0"
FT                   /protein_id="ABQ66816.1"
FT                   /translation="MADGGGEAAGRVGPFDPLRHGLFRRIWTASLFSNFGQLIQGVGAA
FT                   WAMTQLTGRADMVALVQSATFAPLMLLSLFAGAIADSYDRRKIALVALSIALLGALGLS
FT                   LVTALGLLTPGWILFFCFVVGTGTALFGPAWQSSVGEQVPSRELAQAIALNSISYNIAR
FT                   SFGPAIGGLLVALAGVLAAFAFNALAYVPLIVVMIFWRRLPETSRLPPEALGRAVISGA
FT                   RYVVYSPPIRAVLVRTLLIAFAGVAASALMPLVARELLHGDATLYGVLLGCFGGGAVLG
FT                   ALFLTPIKERLSDEVSVGLASALMGLCMIGTGLSRHGVLTGLLVMGAGSGWMISMALCN
FT                   INIQMSSPRWVTGRALAACVTAVCGGMTIGGWAWGRIAASEGTGLALVASGTALILTIA
FT                   ASLVWRMPAVEEQRDRDTPLSEPETNLDLNGRSGPIVVTIEYRVPLDQARGFYTAMMPV
FT                   EAIRHRTGGYGWSISRDVGDPELWTERYHTPTWHDYLRQRSRLTIADLETWQIAIDFHR
FT                   DKDPIRVRRKLERPYGSVRWREDVPDRGVIVPLPSPGS"
FT   gene            complement(475809..477317)
FT                   /locus_tag="Swit_0449"
FT   CDS_pept        complement(475809..477317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0449"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66817"
FT                   /db_xref="GOA:A5V3F1"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3F1"
FT                   /protein_id="ABQ66817.1"
FT                   /translation="MSLPPETAPPTADTLQEGDDIKALAKGGRTNFFGFLLRLAARLPF
FT                   LFIAGRWYGAEALGRFAYAVIIVEFVATLATLGLKRGLAEQLSATDRPHVHVVWDGLLM
FT                   GAIASAVAATVLGAVPELMFPNSGINGLEWLLPLTIFALAWSDIALAALAYRLDIGATV
FT                   RARSVIEPWTISIAAFGLAFYSLRDGLIIAYVVSMVAALVASIWPLLKSFGWPHGWRPR
FT                   PAALFMLARRNVPLAAADAIEWGSRRLDIAILGLFFSPVIVGIYYVAQQVASLPQKLKT
FT                   SFDPILGPVITRNLEAGNRLAVAKQVAQVGFWIIAAQTAVGLALGIPGEGVMGLVGPNF
FT                   VAGNTALAFLLIAEVVAATAAVSEAALIYVARHLNLWISMGMIGIQIMLSFAIVMIMRD
FT                   QFALPVLWQAAGPAIALAMALGIASIMKAKLLSRLLGAPVSGWRWPLVWAALAAGVVGY
FT                   LATRLPEWLELLLGIPAILLVFGAIIWRFGFTSEDRTLFRLKEA"
FT   gene            complement(477314..480139)
FT                   /locus_tag="Swit_0450"
FT   CDS_pept        complement(477314..480139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0450"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase I; PFAM: DNA-directed DNA
FT                   polymerase; 5'-3' exonuclease; 3'-5' exonuclease; SMART:
FT                   Helix-hairpin-helix domain protein, class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66818"
FT                   /db_xref="GOA:A5V3F2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3F2"
FT                   /protein_id="ABQ66818.1"
FT                   /translation="MFPPAPTPAIHPGMSSKHLYLVDGSGYIFRAYHRLPPLTNRHGIP
FT                   AGAVYGFTTMLWKLINELHQADGPTHLAVILDASSKTFRNEMYDQYKAHRPPPPEDLVP
FT                   QFPLIRDAVRAFSVPCIEELGLEADDIIACYAEAALAQDWQVTIVSSDKDLMQLIRPGL
FT                   DLLDTMNNRRLGREHVLEKFGVEPEALGDVLALMGDSVDNVPGVPGIGPKTASQLIQQF
FT                   GTLDAVLASTDQITKPKLKQSLIDHADNARLSRELVRLKCDAPLPEPLDGLELKGLPPE
FT                   PLRAFLEDQGFKSLLAKVQGDGPATLPTGGPTMLALAPGAEEKPAPVIAQVPFNHKDYE
FT                   TVVDEAALDRWIADGFACGRIAVDTETDNVDPVRANLVGVSLSTAPGKACYIPLAHIGD
FT                   GLLSETPRQIAMDAALAKLKPLLEAAHILKIGQNIKYDMVVLAKYGVDVAPYDDTMLLS
FT                   YDLDAGLGGHGMDELAQRHLDHGCIEFKTVCGTGKSQISFDKVTLDVATEYAAEDADVT
FT                   LRLWQLLKGRLAPEAATRVYELIDRPLVPVLTGMERAGIKVDREELARLSAEFSGEATR
FT                   LEAAIHAEAGTPFTVGSPKQLGDILFDKMGLKGGRKGKTGVYSTDVTELERLAGDGVAI
FT                   ARLVLDWRQLTKLRSTYTDALQQQINPATGRVHTCFSMAVAQTGRLSSTDPNLQNIPIR
FT                   SDHGRRIRDAFVAEPGKLILSADYSQIELRLAAHMADVPALKDAFARGDDIHALTAQEV
FT                   FGEVNRDTRARAKTINFSILYGISAWGLAGRLEVSREEAQGMIDRYFSRFPGINHYIAA
FT                   TLGQVRDQGYVSTLFGRKTHLPWIRSAKQGERQSAERQAINAPIQGTSADIIKRAMVRM
FT                   NPALAAAGLGDVKMLLQVHDELVFELAPEQVEPASAVIRAVMAGAAEPIVRLSVPLGVE
FT                   IGTGPSWGAAH"
FT   gene            complement(480167..481546)
FT                   /locus_tag="Swit_0451"
FT   CDS_pept        complement(480167..481546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0451"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66819"
FT                   /db_xref="GOA:A5V3F3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3F3"
FT                   /protein_id="ABQ66819.1"
FT                   /translation="MRRGSLLLPLLLGGCAAGHIKPVAVPPVDAPAAWRTAAPLSAVER
FT                   DWWTGFGDPALTALVDRALANNSDIGIAAGRVREARANLAAARATLLPTLDANLTGGRT
FT                   RSISPFGTAEVQNAAQPQVQAAYEIDLFGRLADQRSAARSAYLASEAARDAVRLAIASA
FT                   TASGYVTLLGLDTRLDIARHTLAARGTSLKIARSRVSNGYSPKLELQQAQAEYDATAAI
FT                   VPQIELAVARTEHGLNLLTGDTPQAIGRGATLATLAQPPLAGGLPSELLRRRPDIAQAE
FT                   RQLAAADSSLAVARKRFLPQLRLSASAGAAFSSLLDDPITLWQVGGSILAPIFQGGRLT
FT                   AQAEAAAGQRDQAAFAYRKAVLTGFREVEDALASVRRIDEQVALAIHQRDTLAEALRLA
FT                   TNRYREGYSPYLEQLDAQRQLLAAELNLAQLQSDGFAARIQLYQALGGGWTAADEESGR
FT                   P"
FT   sig_peptide     complement(481490..481546)
FT                   /locus_tag="Swit_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.946) with cleavage site probability 0.828 at
FT                   residue 19"
FT   gene            complement(481546..482673)
FT                   /locus_tag="Swit_0452"
FT   CDS_pept        complement(481546..482673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0452"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66820"
FT                   /db_xref="GOA:A5V3F4"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3F4"
FT                   /protein_id="ABQ66820.1"
FT                   /translation="MSDRDPATEATSSTTDVADTLQSPPSGWAPPPRSRSVTIAIVAIA
FT                   VVAILAILYAWQLPPFAGFSERTDNAYVRGRVTIISPQVSGYVTSVPVQDFAEVKAGQV
FT                   LATIDDRIYRARVAQAEANVAAQEASLANSTQAQRSREVATASQDAAIVNARAQLVRAE
FT                   ADMRRADALIADGSISARERDQTRAALLAAQAGVRQAEAARAIGTQDVRTVLVGRGGLT
FT                   AAVEGARAQLRLARIDLDNTVIRAPVAGQLSEIGVRNGAFVTAGTQLMFLVPHDAWVVA
FT                   NFKEAQTRDMRVGQSASFKVDALGGAKLTGHVENIAPAAGSEFAVLKADNATGNFVKVA
FT                   QRISVRIRIDPGQELARRLRPGMSVEAKIHTSGSL"
FT   gene            complement(482675..484360)
FT                   /locus_tag="Swit_0453"
FT   CDS_pept        complement(482675..484360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66821"
FT                   /db_xref="GOA:A5V3F5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3F5"
FT                   /protein_id="ABQ66821.1"
FT                   /translation="MSGVFLSGSRMAESTDYVFKPHERPTLPGSPANPDHPSRRRMGYF
FT                   AIGCLIGVTGGLGNALVTVNLNFAQGTLGLNSDEATWLTAAYFMTNVTANLLLVKFRQQ
FT                   FGLQMFIRYMLAAYAVTALAHLLVHDFWTSVAVRAASGIAASGLSTLTVLYLSQGMSAP
FT                   KRLAGIMIGISIPQLATPLARVLSPGLLIWGDWHMLYWFELGMTLAMLAAVMSLPLPPS
FT                   ERVHAFEKLDFLTFALLAPGLWLLVAVLSEGRIQWWAERPWIGWSLAGSIALIAAALVV
FT                   EHHRVNPLINTRWLGTREMVRLIAVASSIRILLSEQAFGSVGLLTTLGMLNDQMVTLNL
FT                   VIIVASVAGIAAAVLTFRPANVARPLTIAVILIAIGSFMDADTTNLTRPSSFYVSQAII
FT                   GFASLLFMAQAIVIGIARTLLAGTKHFISFIVLFSLSQSIGGLVGSALLGTFQVVREKY
FT                   HSHELVQSIVMNDPQVAARIGAGARSLGGVIGDPVLQGAQGAALLARTVTREANILAYN
FT                   DVFLLIGVLAVATVIWSYGIRLSMRRRGEISPVLELQRRMAQGK"
FT   gene            complement(484418..486202)
FT                   /locus_tag="Swit_0454"
FT   CDS_pept        complement(484418..486202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0454"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: TrkA-N domain protein; sodium/hydrogen
FT                   exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66822"
FT                   /db_xref="GOA:A5V3F6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3F6"
FT                   /protein_id="ABQ66822.1"
FT                   /translation="MALPIHSAAFSDSLVVLGTAGLVIPAFARFRITPVIGFILVGMLV
FT                   GPNGLGRLIDEVPWLYYVTIGNPRSIEPFAEFGIVLLLFSIGLELSFKRLWGLRRTVFG
FT                   LGSSKLALSALLIGGGLWLFGQTPNGSFGLGLALALSSTALVLPMVGTSGAVGQRAFGI
FT                   LLFEDLALVPIVFILGAMAPYGETDGWDGLLFTVASGIGVIAVMMVGGRLILPRLFAQA
FT                   ARAKNPELFLSASLLVVILASIATTAVGLSPIVGALVAGLLIAETDYHAEVDLVTAPFK
FT                   GLALGIFLITVGMSVDPLMILANWDSVALAVVAIVAAKALVTAFLLRFWGAKRAVAAET
FT                   GLLMSSPSETTLIVLATAAQARLIDPGTAGFWQVVTAIGLTITPILAKIGHDIARRVDE
FT                   RETAADPDLSDTIQARAIIAGFGRVGRLVAQMLDAHNKPYIAVDADIDTVINARRRGYK
FT                   AMFGDVAKPGMLDHLDLSRSTALILTMDDPVQVVRITRLARQNYPELTIVARARDPNHA
FT                   AELYRAGATDAVPETIESSLQLSEAVLVDLAVPMGPVIASIHEKRAELRAKIMEMGQID
FT                   REPAFGRRRLRDAVPEQE"
FT   gene            486327..487952
FT                   /locus_tag="Swit_0455"
FT   CDS_pept        486327..487952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0455"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   TrkA-N domain protein; sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66823"
FT                   /db_xref="GOA:A5V3F7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3F7"
FT                   /protein_id="ABQ66823.1"
FT                   /translation="MPHATPLIATIVGGLTLAFIFGAVAQRLRIPPLVGYLMAGVAAGP
FT                   FTPGYVADQHLANELAELGVILLMFGVGLHFSVRDLMAVRKIAIPGAVTQIAVATLMGM
FT                   GLAALLGWSLAGGIVFGLALSVASTVVLLRALQERKILDTERGKIAVGWLIVEDLAMVL
FT                   ALVLLPALAQGGSGGGSAIWAVLALTVGKVIAFIAFMMIVGRRVIPWALHYVAHTGSRE
FT                   LFRLAVLAIALGVAFGAAMLFGVSFALGAFFAGMILAESPLSQRAANETLPLRDAFAVL
FT                   FFVSVGMLFNPHVVTDEPLPLLGTVAIIIVGKSIAALAIVMAFRHSAATALTIAASLAQ
FT                   IGEFSFILATMGHELKLIPAVARDLILAGAIISILLNPLIFAIVGRYGRKWMPEKVADE
FT                   AATPPPPRGHVVLIGYGRVGSLVGRKLLEAGEQVTIIEAQPDATGLPEHPNATVLIGNA
FT                   CEASPLDQARLEKARLLCIAIAEGFEVGQIVERARKANPAIRIIARAQDEAEVEHFSKM
FT                   GADVAITGEREIARSMVDYAFKPR"
FT   sig_peptide     486327..486404
FT                   /locus_tag="Swit_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.958) with cleavage site probability 0.943 at
FT                   residue 26"
FT   gene            487969..489171
FT                   /locus_tag="Swit_0456"
FT   CDS_pept        487969..489171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0456"
FT                   /product="monooxygenase, FAD-binding"
FT                   /note="PFAM: monooxygenase, FAD-binding; tryptophan
FT                   halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66824"
FT                   /db_xref="GOA:A5V3F8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3F8"
FT                   /protein_id="ABQ66824.1"
FT                   /translation="MGSRLVVAGGGPAGMMAGLLFARAGVETLVVEKHGDFLRDFRGDT
FT                   VHPSTIELFDELGLAEALLAREHDMVTDVSASVGGRRYRVADLTHLPVRHKFMMMMPQW
FT                   HFLDFVRDAASRWPAFALRMESEVVGLTETGGRVDGVRLADGETIPADLVIAADGRGSI
FT                   LREAAGLPREDLGAPIDVFWFRVPKPRTAHNETMGRFAPGTVIAMIDRGDYWQCAFVFA
FT                   KGGADRIRAEGLDAFRTRVALAEPEIAGSLEAIASWDDVKLLSVSLDRLTRWHRPGLLA
FT                   IGDAAHAMSPVGGVGINLAIQDAVAAANILAGPMARGAPVDGLLGKVQARRMLPVRVIQ
FT                   GLQRAVHAGVLGPTLDATAQMEAPFALRLIGRCPLLQRIPARIVGLGVRREHVRSPAVN
FT                   V"
FT   sig_peptide     487969..488043
FT                   /locus_tag="Swit_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.969) with cleavage site probability 0.495 at
FT                   residue 25"
FT   gene            complement(489235..490455)
FT                   /locus_tag="Swit_0457"
FT   CDS_pept        complement(489235..490455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0457"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="TIGRFAM: isocitrate dehydrogenase, NADP-dependent;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66825"
FT                   /db_xref="GOA:A5V3F9"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3F9"
FT                   /protein_id="ABQ66825.1"
FT                   /translation="MAKIKVKTPVVELDGDEMTRIIWQWIRERLILPYLDIGLEYYDLS
FT                   VEKRDETNDQITIDSAKAIQKYGVGVKCATITPDEARVEEFKLKKMWKSPNGTIRNILG
FT                   GVVFREPIVIKNVPRLVPGWTDPIVVGRHAFGDQYRATDFLVPGPGKLRMIWEGDNGET
FT                   IEHEVFQYPSAGVAMGMYNLDESIRDFARASMNYAVDRGWPLYLSTKNTILKAYDGRFK
FT                   DLFQDVFDAEFADKFKARNIVYEHRLIDDMVASALKWSGKFVWACKNYDGDVQSDTVAQ
FT                   GFGSLGLMTSVLMSPDGKTIEAEAAHGTVTRHYRMHQAGKQTSTNPIASIFAWTQGLQF
FT                   RGKFDGTPDVVKFAETLERVCIQTVEKGGMTKDLAILIGPDQPWMTTEQFFEQIRVNLE
FT                   AEMANWK"
FT   gene            490581..491354
FT                   /locus_tag="Swit_0458"
FT   CDS_pept        490581..491354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0458"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase related
FT                   protein; PFAM: phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66826"
FT                   /db_xref="GOA:A5V3G0"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3G0"
FT                   /protein_id="ABQ66826.1"
FT                   /translation="MIVSPIRHPYTAAMTSLDKPDIGTTSIKWRWPSVHPEGRKFVLLS
FT                   AVICLIFALLAWETLAWPMAGITIWVAAFFRDPVRSTPTGEGLVIAPADGLVTMITTVP
FT                   PPRELAGEDGLGDAPMTRVSIFMSVFDVHINRTPIAGTIKRVAYIAGSFLNADLDKASE
FT                   ENERQHFLVEGADGTRIGFTQIAGLVARRIVPFVKAGDVVGLGQRVGLIRFGSRVDVYL
FT                   PAGTGHRVALGQRTIAGETVIARLGEADRSIGAAQ"
FT   gene            491392..492189
FT                   /locus_tag="Swit_0459"
FT   CDS_pept        491392..492189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0459"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66827"
FT                   /db_xref="GOA:A5V3G1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3G1"
FT                   /protein_id="ABQ66827.1"
FT                   /translation="MRGRRQNIRRGIPARAVAPNAVTALALCSGLTGVRFAIAGDWEKA
FT                   LIAIAIAGVLDGLDGRIARLLKGESRFGAELDSLSDVIAFGVSPAIIMFLWSLNEIPRF
FT                   GWIFALGYAVCAALRLARFNASIDTAEHPRKVAGFLTGVPAPLGAGLMLVPVAMWLWSD
FT                   LWWFRDPYFICGWAALVGCLMISDIATYSWSSLHISRAWRLPALLLVAMLGAALFNAPW
FT                   HTLSVFMLGYLATVPFSAASYRRIRRRRATPAPTPPADPAPAE"
FT   sig_peptide     491392..491511
FT                   /locus_tag="Swit_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.864 at
FT                   residue 40"
FT   gene            492597..493349
FT                   /locus_tag="Swit_0460"
FT   CDS_pept        492597..493349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0460"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="PFAM: ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66828"
FT                   /db_xref="GOA:A5V3G2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3G2"
FT                   /protein_id="ABQ66828.1"
FT                   /translation="MAAPTVSMQALLDAGAHFGHQTHRWNPKMKPYLFGDRNGIHIIDL
FT                   SQTVPLMARALDLISQTVQHGGKVLFVGTKRQAQEPIAEAARRSGQHYVNHRWLGGMLT
FT                   NWKTISNSIKRFKALEEQLSGDTHGLTKKEVLQLTRERDKFELSLGGIRDMGGIPDVMF
FT                   VIDANKEELAIKEANTLGIPVVAILDSNVSPDGIAFPVPANDDAARAIRLYCEAVAEAA
FT                   TRGAQGGRQARGEDLGAAVEAPSEDALA"
FT   gene            493465..494388
FT                   /locus_tag="Swit_0461"
FT   CDS_pept        493465..494388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0461"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   ubiquitin-associated- domain-containing protein;
FT                   Translation elongation factor EFTs/EF1B, dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66829"
FT                   /db_xref="GOA:A5V3G3"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3G3"
FT                   /protein_id="ABQ66829.1"
FT                   /translation="MAEITAAAVKELREKSGAGMMDCKKALTETNGDMEAAVDWLRTKG
FT                   LATAAKKSSRTAAEGLVGVSVEGTKGAAVEVNSETDFVAKNDQFQDFVRTVTQLALTAG
FT                   DDVAALAGAGYPGGGTVAEKLTSNIATIGENQTLRRAKVVEVSKGTVVPYVHNAAVPGL
FT                   GKIGVLVALEGDAPVAEMETVGKQIAMHIAAAFPQALTEDGLDPVVIERERAIAAEKAA
FT                   ESGKPAEIVEKMVQGAVAKFRKENALLSQVFVIDNKTPIAQVVANAAKAAGGSITLKDY
FT                   VRFQLGEGIEKETSDFAAEVAAAVKG"
FT   gene            494519..495232
FT                   /locus_tag="Swit_0462"
FT   CDS_pept        494519..495232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0462"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66830"
FT                   /db_xref="GOA:A5V3G4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3G4"
FT                   /protein_id="ABQ66830.1"
FT                   /translation="MDRPRFKRILLKLSGEVLMGQGQFGIDPETVARVAREIADVATHY
FT                   ELCLVVGGGNIFRGLAAAAKGFDRTSADYMGMLATVMNALAVQNALEQIGVDTRVQSAI
FT                   PMSTVCEPFIRRRAERHLEKGRIVIFAAGTGNPYFTTDSAAALRAAEMGCDALFKGTSV
FT                   DGVYNADPKKDPTAIRYETVTFNRVLADDLKVMDASAVALCRDNNIPIVVFNIREQGNL
FT                   ARVLAGSGTATTVQN"
FT   gene            495245..495802
FT                   /locus_tag="Swit_0463"
FT   CDS_pept        495245..495802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0463"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66831"
FT                   /db_xref="GOA:A5V3G5"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3G5"
FT                   /protein_id="ABQ66831.1"
FT                   /translation="MPAYDKADLERRMHGAVEALKSDLTGLRTGRASVNLLDPVTVEIY
FT                   GAHMPLNQAATVTAPEPRMLSVQVWDRSNVGPVDKAIRSAGLGLNPIVDGQTLRIPIPD
FT                   LTEERRKELAKLASQYAEKARVAVRNVRRDGMDSLKTDEKKGEIGEDDRKRRETEVQKL
FT                   TDATISDVDAAAAAKEKEILGK"
FT   gene            495799..496545
FT                   /locus_tag="Swit_0464"
FT   CDS_pept        495799..496545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0464"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66832"
FT                   /db_xref="GOA:A5V3G6"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3G6"
FT                   /protein_id="ABQ66832.1"
FT                   /translation="MSGLSASSASSTLADAGTAPRHVAIIMDGNGRWAKRRFLPRVAGH
FT                   RAGAEAVRTTVKAAADMGLQALTLYAFSSENWRRSTEEVSDLMGLLRHYLRKEVAELDR
FT                   NGIRLRTIGDINGLEGDLVDLVREGVERTKHNRRLDFVLALNYGAQDEMVRAVREIAAD
FT                   VRDGRLAPEDICSAVIDGRLDTQDLPPLDLLIRTSGERRLSNFLLWQAAYAELLFVDTL
FT                   WPDFDGAALAAAIADFGARERRFGGR"
FT   sig_peptide     495799..495849
FT                   /locus_tag="Swit_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.878) with cleavage site probability 0.856 at
FT                   residue 17"
FT   gene            496550..497356
FT                   /locus_tag="Swit_0465"
FT   CDS_pept        496550..497356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0465"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66833"
FT                   /db_xref="GOA:A5V3G7"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3G7"
FT                   /protein_id="ABQ66833.1"
FT                   /translation="MAQAAASELRLRILSGIAMIAVALGALWLGGTAFWALASLLAVLM
FT                   MLEWSAMAKAAKWQAAVGAAIVAALMVTALPFIDPAAMARYSGRLIAQTIDLAGLGAIL
FT                   LAVIGFRARLGAGVLYTALPAIALVFLREQAGQGLVLALWTLVIVWATDIGAFFAGRAI
FT                   GGPKLAPALSPNKTWAGLIGGMIAAAIVGALVARAGGLPAFCLFAAAPLAVAAQAGDLF
FT                   ESWLKRRSGVKDSGKLLPGHGGVLDRLDGVVPVAVLVAAAVAGGWL"
FT   gene            497353..498516
FT                   /locus_tag="Swit_0466"
FT   CDS_pept        497353..498516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0466"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /note="TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: Semialdehyde dehydrogenase, NAD -
FT                   binding; 1-deoxy-D-xylulose 5-phosphate reductoisomerase,
FT                   N-terminal domain protein; 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase, C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66834"
FT                   /db_xref="GOA:A5V3G8"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3G8"
FT                   /protein_id="ABQ66834.1"
FT                   /translation="MTARSIAILGATGSIGTSTLDLVEREPDRFRVTTLTAQRDVDGLA
FT                   AAARRTGAELAVIGDPARYDDLKAALAGTGIRAAAGVEAIVEAAAAGADWTMAAIVGIA
FT                   GLRPTLAALAAGGTVALANKESLVSAGALMTDAARAHGATLLPVDSEHNAVFQCFDHAA
FT                   PGSIRKVTLTASGGPFRDWSIEAMRAATPAQAVRHPNWSMGAKISVDSATLMNKGLELI
FT                   EAFHLFPLPPEAFDAIIHPQSVVHALVDYIDGSVLAQLGTPDMRTPIAHSLAWPQRMAT
FT                   PCRRLDLATVGRLDFLAPDLERFPALAIALDVLAAGGARPAILNAANEVAVAAFLDGRI
FT                   GFLDIALIVRKALERYDPPAPASLDDIFAIDAGARRAAQATMEVMTA"
FT   gene            498513..499646
FT                   /locus_tag="Swit_0467"
FT   CDS_pept        498513..499646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0467"
FT                   /product="putative membrane-associated zinc
FT                   metalloprotease"
FT                   /note="TIGRFAM: putative membrane-associated zinc
FT                   metalloprotease; PFAM: peptidase M50; SMART: PDZ/DHR/GLGF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66835"
FT                   /db_xref="GOA:A5V3G9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3G9"
FT                   /protein_id="ABQ66835.1"
FT                   /translation="MTDSPGILFTILAFLLVIGPLIFVHELGHYLAGRWCGVKADVFSI
FT                   GFGREIAGYTDSRGTRWKLGWMPMGGYVKFAGDMNPASVPTPEWLALPPEERARTFQAK
FT                   PVWQRFLIVFAGPFTNFVVAIGIFMAFFAAYGAPRTPSVVSAVIEGSPAARAGMQPGDR
FT                   VVAIEGRPIERFDDLADMIRFRPDERLRIDLVRGSETRTLFVVPVANVERDRFGNEFRK
FT                   GTIGVLSGPQIVVPVPLHELPVEATRQTFGIVRMMVDTLGQIVTGRRSVKELGGPIKIA
FT                   QVSGQQASLGLLNFVMLMALISINLGFINLLPIPMLDGGHLVFYLFEGIARRPVPERAM
FT                   EWAFRSGLAVLLSFMIFVTLNDILSLGALERLAGLIG"
FT   gene            499717..502449
FT                   /locus_tag="Swit_0468"
FT   CDS_pept        499717..502449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0468"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66836"
FT                   /db_xref="GOA:A5V3H0"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3H0"
FT                   /protein_id="ABQ66836.1"
FT                   /translation="MTATTTNIHRARLLSALLVGTMLGGLAQPAMAQQAPAPEPAAPAA
FT                   QPVVLGPAQTLGTIKSVNVAGSERLEADTVRSYVKLAPGESYTREALDQALKDLYETEL
FT                   FADVQVRDDGQGNITLQVRENPVVNRIVLEGNKRLKADKINPEIKLAPRQIFTRSKVRA
FT                   DVNRIIELYRRQGRFAATVEPKMVQLDQNRVDIIFEIHEGDKSKVRKINIIGNEKFSDG
FT                   RLRGEMATKQTGLTKIFSSGTSYDPDRMSYDQQKLRQYYLTQGYADFRVVSAVAELTPD
FT                   KKDFIITYVVEEGSRYKFGDVDLESEIRDIKASTFKYLLPMKKGDWYNAKQVEDTVDAI
FT                   TEATGVFGFTPDVRPDFNRDKDDLTMGVVFKINQSPRVYVERIDINGNTHTKDKVVRRE
FT                   FRLSEGDAFNSFKVKRSRDRIQSLGFFQDKFEVEQKPGSAPDRVVLEANVEEKSTGELQ
FT                   VSAGYSSLERFIVDLSIRERNFMGKGQELRAGVSYSTYSKSIELGFTEPYVFDKNIAVG
FT                   VDLFRRDYNSFNFAGNDRNTTYEQTTTGFQLRAGVPLTEFITLATRYGLSYDQVSLNKF
FT                   TYYTDTNGDGIRDACDPVVAGRYLCDAIGNRVTSSVGYSLVFDNLNNRIRPSRGQRAVF
FT                   SQDFAGLGGKVRYIKTSVQATKYWGIGGGFIFSAGGEGGYIKGLGQDVRLIDRFYLGEP
FT                   DMRGFGIRGVGPRVIRRYIDPNTGQFAAVNDKNYTNDDALGGKAYYRGRLEMEIPLGNG
FT                   ARELGLRPSIFMDVGAVFGVSKPSLIAPENPGYPFQQDEDGNYLPVLRPLLDSKGRQLF
FT                   ITAEGNDNAGTYTLCEIGYSSSSKKPCVGSVMNTKAQNTISPFREDFYGDSAKPRLSVG
FT                   FGVNWNSPFGPFRIDIAKALLKEPGDNTKLFTFNVGTQF"
FT   sig_peptide     499717..499815
FT                   /locus_tag="Swit_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 33"
FT   gene            502449..503084
FT                   /locus_tag="Swit_0469"
FT   CDS_pept        502449..503084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0469"
FT                   /product="outer membrane chaperone Skp (OmpH)"
FT                   /note="PFAM: outer membrane chaperone Skp (OmpH)"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66837"
FT                   /db_xref="GOA:A5V3H1"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3H1"
FT                   /protein_id="ABQ66837.1"
FT                   /translation="MKSFLKTAASVAALALLPVAANAQAAAAPAAAAVNTGVAVVDLEG
FT                   AVANSAAYRSAMTQIETTYKAQFTALQTRQTALQGELGPLRTEIENLQKNPATPKATLD
FT                   AKIGAFQQKGQAAQAELQRLAAPIARPQAYVKEQIGAKVEQALKAAMTAKKVGVVIGPE
FT                   AVVAVQGGSDLTPDVVTQLNALVPSVSITPPANWQPGQAEQAGAPAGR"
FT   sig_peptide     502449..502526
FT                   /locus_tag="Swit_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.810 at
FT                   residue 26"
FT   gene            503095..503568
FT                   /locus_tag="Swit_0470"
FT   CDS_pept        503095..503568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0470"
FT                   /product="3-hydroxyacyl-[acyl-carrier-protein] dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase,
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66838"
FT                   /db_xref="GOA:A5V3H2"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3H2"
FT                   /protein_id="ABQ66838.1"
FT                   /translation="MSEDAPKILGPLDVRRVMAALPHRYPLLLVDRVEELVVDERITAI
FT                   KAVTINENFFQGHFPGRPIMPGVLIVEAMAQAAGVLAVESLGLAGSGKLVYFMTIDEVK
FT                   FRTPVEPGVLLRLEVAFAQKRGSVCKFEGKAYIGDKLAAQANFTAMIADPPTD"
FT   gene            503669..503899
FT                   /locus_tag="Swit_0471"
FT   CDS_pept        503669..503899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0471"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="PFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66839"
FT                   /db_xref="GOA:A5V3H3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3H3"
FT                   /protein_id="ABQ66839.1"
FT                   /translation="MKKDIHPDYHSITVQLVDGTTYQTRSTYGSAGDTLQLDIDPSVHP
FT                   AWTGGKSHMLDAGGQVARFNKRFGGLTLGKK"
FT   gene            503970..504329
FT                   /locus_tag="Swit_0472"
FT   CDS_pept        503970..504329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66840"
FT                   /db_xref="GOA:A5V3H4"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3H4"
FT                   /protein_id="ABQ66840.1"
FT                   /translation="MALIDLYRRFKIPVFWTTLLIVYGLAIMPADRAPDLGAGDKVNHM
FT                   AAFFVLTLLGRVAYRPVAAWRLATGLSLFGILIELTQAIPAVRRDASVWDWVADSAAIL
FT                   IALGAALIVERLRRR"
FT   gene            complement(504387..505313)
FT                   /locus_tag="Swit_0473"
FT   CDS_pept        complement(504387..505313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0473"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66841"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3H5"
FT                   /protein_id="ABQ66841.1"
FT                   /translation="MPHDPALARAIAQVEAPAPHRPAIRSFFDPATSTISHVVHDPVSR
FT                   EAAVVDPVIGYDPASGRTDNRPADAIAAYVEAEGLRVAWLLETHVHADHLSGAPYLQER
FT                   VGGRIAIGEHISAVQTSFGRLFRPGREFAADGSDFDRLFADGDRFRIGGLEATVLHVPG
FT                   HTPACVAYVVGDVAFVGDTMFMPDYGTARADFPGGDARQLFRSLRRILKLPGHTRLFMC
FT                   HDYLPEGRDSYQWETTVEAERRGNVHARDGIGEDAFVAMREGRDAGLAVPRLLLPSIQV
FT                   NMRAGHPPAPEDNGIRYLRIPLDAFPD"
FT   gene            complement(505334..506269)
FT                   /locus_tag="Swit_0474"
FT   CDS_pept        complement(505334..506269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0474"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66842"
FT                   /db_xref="GOA:A5V3H6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3H6"
FT                   /protein_id="ABQ66842.1"
FT                   /translation="MNTRFLETFIWLARLKSFSRTAEKLHASQPAVSGRIVALEELLGV
FT                   TLYERNSKGFELTAAGRRVLDRCERIVELSNELKSIATEDNVLGRPVRIGASDVITLSW
FT                   MSDLVAVLGSKYVDYQFDIVTDSANNLSRMLMADEIDIALIANGIDANRIVNAPLCNYR
FT                   IEWLANPRRFDVTKPINIEQLCELPIIMPPPGTPGYTWQVEYLKRHNPNYSPDRPSPLR
FT                   ISCGYSPATGIQMVAQGFGVLPVPVLLARPWIASGEVAPLKVKESFPAWAMNACYKSPP
FT                   TIPIIVSLVETAQAVAKAYADRRGGSDFWP"
FT   gene            506584..508626
FT                   /locus_tag="Swit_0475"
FT   CDS_pept        506584..508626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0475"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66843"
FT                   /db_xref="GOA:A5V3H7"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3H7"
FT                   /protein_id="ABQ66843.1"
FT                   /translation="MYRIGFDVGGTFTDFTMLDEGRGSVHYFKVPSTPHDPSEAIGTGL
FT                   SALIADHGIDPALIRHLGHGTTVATNMVIERRGALTGLITTRGFRDTLEIGRQTRPHLY
FT                   DYSVSRPTPLVPRDLRLEVDERTLSDGTVELPLDEEQVAEAARKLGEAGVGAVVICFLH
FT                   SYRRPDHERRAGEIVRAILPDAYISLSSNVLPEFREYERMSTTVLNAYMGPRMGTYLER
FT                   LLGRVGDLGITGELDTVHSNGGLMSVPTVREIPVRTCVSGPAAGVIGAAEIGRFANFPN
FT                   LVTFDVGGTSTDVSVIVGGKPLFASDRLVADYPVKTPMIDIHVIGAGGGSIAAIDDAGA
FT                   LKVGPRSAGAAPGPVAYGRGGTEPTITDANIVLGRLDPVALLEGRLPVDAAAARAVIEE
FT                   RIARPLGLSVEEAAYGILRIANANMSRAIRSVSTERGHDIRDFALFAYGGAGPLHACDL
FT                   AQDCGIRTVLVPQEPGTLCARGILLSDINMDFVRSELSLAADASWRRVCAVLGEMRDEA
FT                   TAWLVREGVAEEDRQLRIMVDARYDGQNFEVSVPLDDVREDGLDDMVQRFRRQHVQEYG
FT                   YDVSDRPVEIVNCRIQAIGRVARVPVSAPVPVPGLDAVKGRRPVYFGKDAGWVETSIYR
FT                   RGQLPIGRTFAGPAIIEEMSSTLIVQPGQTITVDPVGNLIVSIFE"
FT   gene            508639..510378
FT                   /locus_tag="Swit_0476"
FT   CDS_pept        508639..510378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0476"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66844"
FT                   /db_xref="GOA:A5V3H8"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3H8"
FT                   /protein_id="ABQ66844.1"
FT                   /translation="MADRDSPISKAEGQLFDPIAMEVFSNRLLSITEDMGNRLVRASFS
FT                   PNIKERKDCSVAMFDGKGRLIAQAAHIPMHLGSLSGGVETVLGDYGVDNVREGDVFICN
FT                   DAYLAGGTHAPDITIVTPIFWEGRCRFFAANIGHHSDVGGTYPGSVSPTARTVFEEGIR
FT                   IPLVRIVREGELDTGLLTLLAQNSREPADRVADLKVQIAANERGAQLMLELVRQLGIDA
FT                   VEQSIEDILAYTARRLRNRIAALKDGTGSHVCHLDDDGFGGDPVAIRATLTVEGENLTV
FT                   DFDGSGPQCRGSYNMPKSAMLASVYYAVKTMLDPELMANEGMFASITMHAPEGTITNPT
FT                   FPAAVGMRSNTAQRVAASVIGAFAHFLPRERVMAASNDAMPAMVFSGRSRRRPGTYVYV
FT                   ETIGGGAGGRAGHDGADGTHVHITNSSNLPAEALENEYPLVVDEYSLVADSGGAGQWRG
FT                   GMGIARQIRALDDDTFCYASSEGTIVPADGVFGGGKGAVAHIIRNRGTPGEHEIPANQP
FT                   RLVLAPGQSVRIETPGGGGFGDPEARDAAAIAADLRQGRVTPAAARAAYGAEKAAEAER
FT                   LSA"
FT   gene            510406..511737
FT                   /locus_tag="Swit_0477"
FT   CDS_pept        510406..511737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0477"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66845"
FT                   /db_xref="GOA:A5V3H9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3H9"
FT                   /protein_id="ABQ66845.1"
FT                   /translation="MHMEKGRIRDWLVVLLLMAALILSFVDRIGLSLLVDPIRADLGIS
FT                   DAEIGLLQGIAFGLFFAVMGLPLGWLADRWSRKGTIMLGVGMWSVATAACGLAANFPQL
FT                   LLARIGVGAGEAGLAPASYSIVHDRFPREQLGRAISLFQVGGVLGAGLALLITGYVYRY
FT                   FTGGGGADLPLIGGLRPWQQTFLAIATPGLLFLILIAMIREPERVAGPADAAGAGEPRG
FT                   FAAMVAAVRARIGLYLPLFVGMSGVIMTSYALVSWMPAVLGREFHWPAEVIGVRYGLVV
FT                   LSASPVGLLTGGWLADALLRSGSVNAHVRVVALAALLGLPFALALALPSGPVGLLLVVG
FT                   GLHFAASMPMGVVPAFLQLATPPAARAQVSGLYVLFINVVGLGLGPTLVGLLSTGMGPD
FT                   AASLRLSMALVIGPAMLVATAVLAWLARSTRHESVADVRPAYGS"
FT   gene            511850..514012
FT                   /locus_tag="Swit_0478"
FT   CDS_pept        511850..514012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0478"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66846"
FT                   /db_xref="GOA:A5V3I0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3I0"
FT                   /protein_id="ABQ66846.1"
FT                   /translation="MKKIISGSSIKVLGVILCMAPAHAVFAAEAGADSEVSSVDSGEIV
FT                   VTARRRAESLQDVPVSVTAFDQAQLETAGIKSLRDMSRLMPGVQFTERGSLSTQLTIRG
FT                   VGGDSRNIGIEAGVGMYLDGVYIPRTSGYNADLAEIAQVEVLRGPQGTLFGKNTIGGVI
FT                   NITTKEPGDTVEGSVYASYGNYNAFRTQASISGPLSDTLSAKLTVATYDRDGYIHNIFN
FT                   DQDVNDENRRGARAQIVFKPSDALKVKLNADFTRDRRTVLQTQMDSPVGAAAPYYTGNR
FT                   FEANSDQPNGDKRNMWGTDLTAEYSLPNDMVLASISAYRKIDVTVSSDIDQLPINLFNS
FT                   NPLTDFVQMASQEFRITSPSDGPFRYVGGLYYYHQKGTALRKIYIGGSLANGALNRAKA
FT                   ITNSYAAYINADYDLLPQLTLNGGLRYTYEKKTGDYLQVRGPVLSYDFDDLRRTDKNVS
FT                   WTGSLTYKPTRELTIYGTVSKGFKSGGFNLDTIGAANLISRDLIFGPESVINYEAGIKG
FT                   QLFGRLLRYSLAAFRMDYSDKQVAQIVPTGASTVSSVQVTNAGKARIKGFEVEATLRPF
FT                   EGLSLSGNASYLDAKYTRFDYSTIGSTVAVSYAGNRIEFTPDWMIGGQAEYRFPAGPGE
FT                   VFLVGSATYTGDMYLQPEKLPKYRESGYTLIDARIGYEVGDLMIALWGKNLTKQDYRTY
FT                   ARVFGGLDQAVWGEPRTYGVEMRYRF"
FT   sig_peptide     511850..511933
FT                   /locus_tag="Swit_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            514084..514788
FT                   /locus_tag="Swit_0479"
FT   CDS_pept        514084..514788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0479"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66847"
FT                   /db_xref="GOA:A5V3I1"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3I1"
FT                   /protein_id="ABQ66847.1"
FT                   /translation="MAMLPERRIYVVNPMPEQMRADQRAALLELDTGTVGHHLEAGFMD
FT                   GGMIPRIPGSKIVGTAVTVRITVPDSVMAHYALKFTRPGDVLLIDRGQDQRTCNWGGAT
FT                   IHAAAATGLEGVIVDGAVNDMDDAREAGLPIWARSISPVTTKYRGMGGEMNVPISCGGV
FT                   AVAPGDAILADDNGVVVIPRDQLDEAIEGSLKWLAAERAFMERFRAEPGLCYPDVTGAT
FT                   EIVEAALRAQSA"
FT   gene            complement(514780..515640)
FT                   /locus_tag="Swit_0480"
FT   CDS_pept        complement(514780..515640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66848"
FT                   /db_xref="GOA:A5V3I2"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3I2"
FT                   /protein_id="ABQ66848.1"
FT                   /translation="MSFQPFGYKFEIHSPVSSTLLKTRLRARKKGWFHRQAGARGWIVG
FT                   PFVCLWFRASDRYGPLLVGVLSDDGSGCRIRGRAGSDLNGMAAFVLMLPFLIGLTGLGM
FT                   AHQEPGAGRFAFIAVIVVLVSPFMLWVAHSNRKDAEPLVRFLRDVADERAGPGRSRPDR
FT                   VSLSGNLGLFISGEPAPHPLNSDMLYDALLRTGTDEFIVLERSEHDYLQIASRAGEFRI
FT                   EMRDGSHLRHYLARRVGKTTAKRRTANFDFEFEEALGAAFGYATGGDLPKIIAWEKMDM
FT                   PPPSG"
FT   gene            complement(515675..515764)
FT                   /locus_tag="Swit_R0008"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(515675..515764)
FT                   /locus_tag="Swit_R0008"
FT                   /product="tRNA-Ser"
FT   gene            515889..517007
FT                   /locus_tag="Swit_0481"
FT   CDS_pept        515889..517007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0481"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66849"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3I3"
FT                   /protein_id="ABQ66849.1"
FT                   /translation="MRSSVLRRAVAALALMAAAAGVVPAVAQPALEEGQAPDDAARLTD
FT                   APAAAVPTEDSRMRAFIATLRPRALAMGISPTLFDATLPTLSFNARVVRLDRGQPGASP
FT                   TSTAAPPPFAPYLASHVDRVRINMGRSRYGSLRPLLLRIEQETGVPEQIMLAIYGHETG
FT                   YGTFTGNFDLLNALGTLAYEGRRRELFADEFLKTLLLMNRGVPRSQLKGSWAGATGYPQ
FT                   FLPSVYLRLAIDGDNDGKADIWRSEPDALASIGNYLRDAGWKKGVPWGVAVRVPEGIDR
FT                   AAIRSPLSSPRCPRVFARQSRWLTIAEWRDKGLMMLSGRVPAENELATLIEPDGNGNTG
FT                   YLLTTNYRSILDYNCSNFYALSVGLLGDAIVE"
FT   sig_peptide     515889..515972
FT                   /locus_tag="Swit_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            517004..517915
FT                   /locus_tag="Swit_0482"
FT   CDS_pept        517004..517915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0482"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; Sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66850"
FT                   /db_xref="GOA:A5V3I4"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3I4"
FT                   /protein_id="ABQ66850.1"
FT                   /translation="MMRASHSAALLGLALLLASCGVPRPGRPGPAHRPTPQGPASDTPV
FT                   KVGKPYQVAGVWYYPSDEAGYDEVGLASWYGAQFHGGQTANGEQFDMDRVGAAHKTLPL
FT                   PSYVEVTALDTGRTIVVRINDRGPFVTNRIIDLSRRSAQLLGIERAGVSRVRVRRVYPS
FT                   DADRLALRWGRPASDRPYASSSELAALNRRFATRPAEPRAPARVAAAVPDEAVPVGGWF
FT                   IQVTAVGNRARAEEIAEIVAGRVEPVGNLWRVRMGPYKNEMEATTALAQARSYGYQDAR
FT                   LVRIAGGAGSVDMQGSEGISRQ"
FT   sig_peptide     517004..517069
FT                   /locus_tag="Swit_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.940) with cleavage site probability 0.912 at
FT                   residue 22"
FT   gene            517912..519090
FT                   /locus_tag="Swit_0483"
FT   CDS_pept        517912..519090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0483"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; peptidase S11,
FT                   D-alanyl-D-alanine carboxypeptidase 1; Penicillin-binding
FT                   protein 5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66851"
FT                   /db_xref="GOA:A5V3I5"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3I5"
FT                   /protein_id="ABQ66851.1"
FT                   /translation="MTRSKIALLSAVFLMAAIPAEAAAPPFDTPAPVAFLKDLSSGAIL
FT                   YAKNPDLRMPPASMAKMMTVYVAFDLIQKGELKLDAMATVRPETWKQWHGPAAGSTMFL
FT                   SPGEQVSVANLLFGIVTLSGNDACVVLAEHISGTEQAFVALMNRRAKEMGLTNSHFGTS
FT                   NGWPDGGATYVTARDLATLAEKTIEEHPKLYKTFYSRPSFTWGKTMGGGQDITQANRDP
FT                   LLGRVAGADGLKTGHTEEAGFGFTGSAEQNGRRLVMVLSGLTSFNQRIDQSVSFMNWGF
FT                   RSWQSKPVVPKGRKVQTAEVQLGDEREVGLVAPKDLVVTVPAGLGSDLKTKVVYQGPIK
FT                   APFKKGDHIADLVVSGPDMVPQKLPLVADQDVGTAGFFNRMMAGLRWLFGLA"
FT   sig_peptide     517912..517980
FT                   /locus_tag="Swit_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            519095..519721
FT                   /locus_tag="Swit_0484"
FT   CDS_pept        519095..519721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0484"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66852"
FT                   /db_xref="GOA:A5V3I6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3I6"
FT                   /protein_id="ABQ66852.1"
FT                   /translation="MPGRFITLEGGEGVGKSTQAKALAAALRARGLDVVETREPGGSDG
FT                   AEAIRRLLLEGAADRWNARAEALLFAAARADHVARTIRPAIEAGRWVVCDRFLDSSIAY
FT                   QGGADGLGDEAIRTLHAIGSAGYLPDRTLLLDMPVFDAAFRQAEAGIANSDRFEKRDEA
FT                   FHDRVADSFRRIAAQEPARIRTINAQGSPQEVTARLIEALADLLP"
FT   gene            519718..520695
FT                   /locus_tag="Swit_0485"
FT   CDS_pept        519718..520695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0485"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66853"
FT                   /db_xref="GOA:A5V3I7"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3I7"
FT                   /protein_id="ABQ66853.1"
FT                   /translation="MSLVGHDEQVAAFREAADSGRLHHAWLLTGPEGVGKASFALAAAT
FT                   RLLADAAGPRVGLPGIETPDDHPIVNYIRAGSHPDIRILARLTKDKSEDLARSISIEQV
FT                   RSLQSLFATTPSLSPRRVVIIDAIDDLERPAANALLKNLEEPPAGTTFFLISHAPGRLL
FT                   PTIRSRCRQLRFAPLGDADMRLALRRALPEEPGDEIDSLVSVGNGSPGRALGFAGLEIA
FT                   ALDAAMDRLVGQGDPTNAVRAILSKQLGTKAAQARYEAYLERVPARIAAEARGRQGPAL
FT                   AEAIALWEDARRIGESAVHLSLDQSTTVFELATMLAKLAPAPAR"
FT   gene            520753..522324
FT                   /locus_tag="Swit_0486"
FT   CDS_pept        520753..522324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0486"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66854"
FT                   /db_xref="GOA:A5V3I8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3I8"
FT                   /protein_id="ABQ66854.1"
FT                   /translation="MAEPMSEPYYITTAISYPNGRPHIGHAYEAIAADAIARFQRSMGR
FT                   DVRFQTGTDEHGLKMAQAARARDITPRALADEMSSYFKEMCETLNISCDRFIRTSDADH
FT                   YAASQAIWQAMEANGDLYLDRYEGWYSVRDEAFYDEKELTDGEGGQKLSPQGTPVEWTK
FT                   EESWFFRLSRYQEPLLQLYRDQPDFIRPETRRNEIVSFVSGGLSDLSVSRTSFDWGVPV
FT                   PGSPGHVMYVWVDALTNYLTGIGYPDRDAALGRYWPANLHLIGKDIVRFHTVYWPAFLM
FT                   SAKIPLPKQVFGHGFLLNKGEKMSKSVGNVVDPMTMAERYGVDQLRYFLLREVSFGQDG
FT                   SYGHEAIVNRANAELANSFGNLAQRTLSMIFKNLDGELPALDRTEDDAALVRAVATACL
FT                   DETPRAFEQLAFSIGIEAWMKAVFACNQYVDAQAPWTLRKTDPERMKTVLGTLFAVIRD
FT                   LAITILPIIPDSAGKLLDQMGVAADARDFAAIESQAWYDELRASGYRVAQPVPLFPRLE
FT                   LETADA"
FT   gene            522324..523100
FT                   /locus_tag="Swit_0487"
FT   CDS_pept        522324..523100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0487"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66855"
FT                   /db_xref="GOA:A5V3I9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3I9"
FT                   /protein_id="ABQ66855.1"
FT                   /translation="MFVDSHCHLNYSGLADRQQEVLSAARAAGVSTMLNISTRASEWSA
FT                   VLATAEHEPDVWASVGIHPHDADTHADVETALLVERAEHPRVIGIGETGLDFYYDKSDR
FT                   DRQRASFRRHIAAARQTGLPLIVHTREAEEDTKAIMAEELGKGAFTAVIHCFTGSADLA
FT                   RAMLDLGFFISLSGIVTFKNAGDLRRTAHLIPRDRLLIETDSPFLAPVPHRGKPCEPAF
FT                   VVDTARLLASELSWDIEDLAARTSDNFFNLFTKATR"
FT   gene            523097..523861
FT                   /locus_tag="Swit_0488"
FT   CDS_pept        523097..523861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0488"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66856"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3J0"
FT                   /protein_id="ABQ66856.1"
FT                   /translation="MKLRVLGCGTSSGVPRIGNDWGDCDPAEPRNRRSRASILVESATT
FT                   RLLVDTTPDMRQQLLDADVIAIDAILWTHDHADHCHGIDDVRQIYHARRAPVPGYAYAE
FT                   AMQQLRRRFDYVFTGRDGYPPTVEPGVLEPDMTIGDIRIRCVAQPHGSIFSAGLRFDHD
FT                   GKSIGYSTDFHVFTDEMIGLFSGVDIWVVDALRARPHPTHAHLAMTLDAIRTCAPGRAL
FT                   LTHMDQSMDYARLGESLPDGVEPAYDGLEVQP"
FT   gene            complement(524244..524774)
FT                   /locus_tag="Swit_0489"
FT   CDS_pept        complement(524244..524774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0489"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66857"
FT                   /db_xref="GOA:A5V3J1"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3J1"
FT                   /protein_id="ABQ66857.1"
FT                   /translation="MAKLIFALNMSLDGYVDHMEFAPDPVLFRHWIDDMRGLTGSLYGR
FT                   RMYEVMRYWDEEHPEWDAERHAYAAAWRSKPKWVVSRSLTSVGPNAILVDGEVEAVVRD
FT                   LKARLDGVIEVSGPELAHGLADLGLVDEYRLYVHPVVLGGGKPFFAGPRSRLRLVASDR
FT                   IGESVIRLSYVPV"
FT   gene            524919..526637
FT                   /locus_tag="Swit_0490"
FT   CDS_pept        524919..526637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0490"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66858"
FT                   /db_xref="GOA:A5V3J2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3J2"
FT                   /protein_id="ABQ66858.1"
FT                   /translation="MSGVAVHLPAIERAACLPVRSGWTVARQSAAPAQGRLPDEDKIDR
FT                   HVDGHGADAQRLRQHAEKRGGRDRRAAAAAARRRSRQRRRRSRRRRDRRRLLFGRRHLS
FT                   PEPAAGPAAASPAADPPRGTGLIAHFGGMRRVRIPQLALLLLAGLACTTVSAEAAKPKI
FT                   AARAKPVAGQRAIALAIRDQGRGQIASFYATRGFWPLWASSGRIGPEADTLIAMLKTAD
FT                   LDGLDPSSYRIDRLRALVAKGRSADPQAIAEAELALSAAFADYVADVRKPRGVRIKYLD
FT                   PELKPRPATARTALRGAALQPSLGSYIATMGWMSPHYVRLRALLAQARERKSPRETVQR
FT                   LRLNLDRARLLPGPWTRHVVVDAASARLWYYEGGKQRAMMRVVVGAPETETPMLAGMVR
FT                   YAVLNPYWNVPDYLIQRRLAPKIVAGATPASLRMEVLSDWSASPRRLAGDEVDWPAVAA
FT                   GRKLVRMRQLPGRDNAMGRVKFIFPNDLGIYLHDTPDKGLLSKADRHLSNGCIRLQDAP
FT                   GLYRLMFGRPLPAASKQPERDVALPAPIPVYLTYITATPTERGIGFLKDVYGRDE"
FT   gene            complement(526645..528429)
FT                   /locus_tag="Swit_0491"
FT   CDS_pept        complement(526645..528429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0491"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   DNA mismatch repair protein, C-terminal domain protein;
FT                   MutL, C-terminal, dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66859"
FT                   /db_xref="GOA:A5V3J3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3J3"
FT                   /protein_id="ABQ66859.1"
FT                   /translation="MSIRRLPEHLVNRIAAGEVVERPASALKELVENSIDAGARRISVS
FT                   LSEGGLSAIDVADDGCGMTPDEIALALERHATSKLPDDAIEAVTTLGFRGEALPSIGSV
FT                   ADLTIESRVRGADGWHRRVDHGELVGEGPAALPPGTRIRVSNLFAKVPARRKFLRSARA
FT                   EYAACVDVIKRLAMARPDIGFTLEHEGRRAILVAPDEQRVDRVAALTDRDLAQNSVAVD
FT                   FRREAVSLTGVAGLPTFNRGVADHQFLFVNGRPVKDRLLIGAVRGAYQDMLARDRHPVI
FT                   ALFVELPGDQVDVNVHPAKTEVRFRDPGLVRGMIVGGLRAALDEAGHRSVQRPSVAALG
FT                   NWQAGGLPTASSTAPAIPNGFAFGAAAERSGQGSVWDRVADFAPAPMARAEPAYSPPPQ
FT                   QASYPMGVARGQVAATYIVAEAEDGLVIVDQHAAHERLVLERMRRAMADGGVARQALLL
FT                   PEVVELDEVGCDRLETRIAELAEMGLELERFGPKAMLVRATPALLGQGDVHGLIVDLAD
FT                   ELAAYDEALSLKERLDHVAATMACHGSVRAGRTLSVAEMNALLREMEVTPHSGQCNHGR
FT                   PTWIKLGHGDIEKLFGRK"
FT   gene            528559..529599
FT                   /locus_tag="Swit_0492"
FT   CDS_pept        528559..529599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0492"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66860"
FT                   /db_xref="GOA:A5V3J4"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3J4"
FT                   /protein_id="ABQ66860.1"
FT                   /translation="MFLQRYFKFMSHDMAIDLGTANTVVYVRGRGIVLNEPSVVAIETT
FT                   NGVKRVRAVGDDAKLMMGKTPGSIDAIRPLRDGVIADIDVAEQMIKHFIQKVHGRRNFM
FT                   RWPEIVICVPSGSTSVERRAIRDAASNAGASQVWLIEEPMAAAIGAGMPVTEPIGSMVV
FT                   DIGGGTTEVAVLSLRGLAYTTSVRVGGDKMDEAISSYVRRNHNLLIGEATAERIKQEVG
FT                   VAKMPADGKGETIHIKGRDLVNGVPKEITITQAQIAEALTEPVSAIVEGVRIALENTAP
FT                   ELAADIVDQGIVLTGGGALLQGIDEVLREATGLPVSIADDPLTCVALGTGRALEDSVFR
FT                   GVLQTA"
FT   gene            529616..530491
FT                   /locus_tag="Swit_0493"
FT   CDS_pept        529616..530491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0493"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="PFAM: Rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66861"
FT                   /db_xref="GOA:A5V3J5"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3J5"
FT                   /protein_id="ABQ66861.1"
FT                   /translation="MAAPRHRRRGFSRRVQYGLFAGYVVAIVGILIGAALLLVARLDPR
FT                   AFGTLRGVVVDAGAIFTGAGRVGVDAAHDLGDGIAAYLDAANQNRALKEELARERRRVI
FT                   AARAVALENARLKKLVRLTEHLPAPILSARLIGSTPTGQRRFATLAAGTAEGVRPGMTV
FT                   RSPEGLVGRVYESGLFASRVLLLTDGETTVPIKIVRSGQAALATGQGDGTMEVRALIAG
FT                   GRPFRRGDLAVTSGTGGVYSPNMPVAVVTAVNGDRATARPLADPGRADFAAVYPIFQAP
FT                   VADPPAQPKP"
FT   gene            530488..531000
FT                   /locus_tag="Swit_0494"
FT   CDS_pept        530488..531000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66862"
FT                   /db_xref="GOA:A5V3J6"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3J6"
FT                   /protein_id="ABQ66862.1"
FT                   /translation="MIAPRDNPFLERTPLRVTIVPILSTLAGSAMALLPIVATEPIVPP
FT                   FGLMMLLAWRLLRPEIWPVWAALPLGLADDLLSGHYLGTAMILWTIAFLALEWVDQALR
FT                   WRDSWIEWGVASVGIVAIGIGSWALSQPGGSHSPVLTILPQTIGAILLFPAILRITAAL
FT                   DNWRLKR"
FT   sig_peptide     530488..530586
FT                   /locus_tag="Swit_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.746) with cleavage site probability 0.686 at
FT                   residue 33"
FT   gene            530997..532985
FT                   /locus_tag="Swit_0495"
FT   CDS_pept        530997..532985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0495"
FT                   /product="peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66863"
FT                   /db_xref="GOA:A5V3J7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3J7"
FT                   /protein_id="ABQ66863.1"
FT                   /translation="MKRNRIITEQTQAFTFTRRAFVLGAAQAGVGVVLAGRMAWLSIAQ
FT                   NERYTSLSESNRVQLTLVPPRRGWIIDRAGKPIAINRTTFRVDIIPNQLKDVDAVLGRL
FT                   SQLLALTADDLDRIRSDLAEAHGFRPVPVVENIDYEHFAAVSVHQPSLPGVAPSSGYGR
FT                   YYPAGPAVAHLVGYVGPASAADYEKTRDPLLIAPGFKIGKEGLEKTMEKWLRGKPGAKR
FT                   SEVTAHGKVVRELTTRPEVVGNALQLTIDAGLQRYAAARLGPESASAVVIDTKTGGILA
FT                   MASMPAYDPNSFSDGISHAEWDFLSGDDHLPLTNKVMQGLYPPGSTVKPMVALALLEAG
FT                   VDPSQTVVCTGRYRLGNSYFHCWRHGGHGSVDMHRAIAASCDIYFYTMARLVGIDRIAA
FT                   TARMLGMGQEFDLPMPSQRYGTVPDIAWKARRYKGARWATADTLNATIGQGYMLSNPLQ
FT                   LAMMAARIASGTALAPRLIVNKRYPPQGGPLDIAPEHLDIVRQAMSGVINGPYGTGRSG
FT                   QLNIGDLLMAGKTGTAQVRRITMAMRRAGLTGTEGMPWKYRDHGLFVGFAPVQDPRYAV
FT                   SVVIEHGLHGAAGAPIARDLITWLYDRKRAEDRLATLEQGWGGTIEQRMARKAAIWAHR
FT                   NDPKPVAAPPSAEASPPPPPTGEADPE"
FT   sig_peptide     530997..531104
FT                   /locus_tag="Swit_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.688) with cleavage site probability 0.548 at
FT                   residue 36"
FT   gene            532982..534082
FT                   /locus_tag="Swit_0496"
FT   CDS_pept        532982..534082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0496"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66864"
FT                   /db_xref="GOA:A5V3J8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3J8"
FT                   /protein_id="ABQ66864.1"
FT                   /translation="MNRDSIVPTPLRHVPWRLLALVVAIGGFGLVVLYSAAGGNIRPWA
FT                   MSQGTRFAMFIGLAILISWAGEERLKRAAMPTYGILVFLLLLVELFGFVGGGSRRWLDL
FT                   GFIRLQPSELMKPVIVLAVARFYDMLPAGEIRRFSAIWPPALLIGVPAALVLVQPDLGT
FT                   ALMICGGGVTVAFLAGVPLRLFGGAALALAAAFPIALSFMHDYQRDRIEIFLNPESDPL
FT                   GTGYHIIQSKIAIGSGGLFGKGFLAGTQSHLDYLPERHTDFVFATMAEEWGLVGGVALI
FT                   LAFLLVIRWGMRVAGRAKGRFARLTAAGLATTIFFYVAINLAMVMGLAPVVGIPLPLVS
FT                   FGGSAMMTVLICIGMLMAIDRSAQRP"
FT   sig_peptide     532982..533095
FT                   /locus_tag="Swit_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.720) with cleavage site probability 0.475 at
FT                   residue 38"
FT   gene            534208..534283
FT                   /locus_tag="Swit_R0009"
FT                   /note="tRNA-Lys1"
FT   tRNA            534208..534283
FT                   /locus_tag="Swit_R0009"
FT                   /product="tRNA-Lys"
FT   gene            534451..535470
FT                   /locus_tag="Swit_0497"
FT   CDS_pept        534451..535470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0497"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66865"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3J9"
FT                   /protein_id="ABQ66865.1"
FT                   /translation="MLHNRRMTTAPLTIEAIRATRAALGTRVVTTPTLDWQCDEIVDRL
FT                   GPDARVNLKLELFQRTGTFKARGALNVMLGLSPEQRARGVTAVSAGNHAIATAYAARSL
FT                   GLSAKVVMLASANPARVERCRKLGAEVEIAPDGASAFERARRIEAEEGRSFIHPFEGPL
FT                   TALGTATIGLEWVKQAGPLDAVICPIGGGGLIAGLATAIKLLSPDCKVYGVEPEGADNM
FT                   RRSFEQGEPVANARIATIADSLAPPYSLPYSFDLCRRSVDEIVLVSDDQLRAGMNLLFR
FT                   EAKLAVEPAAAAATAAMLGPLAERLRGKRVGVIVCGANIDIAGFAAHIETGRTFTGLQ"
FT   gene            535643..536431
FT                   /locus_tag="Swit_0498"
FT   CDS_pept        535643..536431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0498"
FT                   /product="molybdopterin dehydrogenase, FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66866"
FT                   /db_xref="GOA:A5V3K0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3K0"
FT                   /protein_id="ABQ66866.1"
FT                   /translation="MDDPVPVLAAPDYFLPTTIAEVGDLLIHYDGRARLLAGGQTLIPE
FT                   LDRPGGAPDALIDLRRIAELGRIEWRADHVEIGAMVTIAAARAELARAFPVVAACLGHV
FT                   ANSAVRNRATLGGSLALADPASEISTFLLAYDAEVMLAGGEARPVDRLITGQAREPAFI
FT                   RAIRLPFPAEREHVGFAEILRRRSGGRSLAMALARLDAGRARLTVSGGTCQPFRIEATD
FT                   GPALLETLAARSPAFDAPSTRSWALAAARRAIATAEDAAC"
FT   gene            536425..536892
FT                   /locus_tag="Swit_0499"
FT   CDS_pept        536425..536892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0499"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66867"
FT                   /db_xref="GOA:A5V3K1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3K1"
FT                   /protein_id="ABQ66867.1"
FT                   /translation="MLINCTLNGRAVTVEAAATTRLSALLRETLGLTGTHVACDEGVCG
FT                   ACTVLLDGGAARACLTLAGQCDGMAIETVEGIATGEAFERIADAFLRHNALQCGFCTPG
FT                   FVTTVAALLRDEARERLSDAEVEARISSVACRCTGYLPIVAAVRDLLGRGR"
FT   gene            536889..539210
FT                   /locus_tag="Swit_0500"
FT   CDS_pept        536889..539210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0500"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66868"
FT                   /db_xref="GOA:A5V3K2"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3K2"
FT                   /protein_id="ABQ66868.1"
FT                   /translation="MTAAMPGHARPSARRFLEGRGRYVADLSMPGMLHAVVVRSAEAHA
FT                   DIAVDADPARAVAGVRLVLDGADILASIQPPPIIWDVPGQRRSGLRALAHGRVRYVGEP
FT                   VAIVVAESEAIARHAAALVRIAYAQRPVVASIDQALAADAPRLYDDWPDNVVASAEWSG
FT                   GDPDAAFADAPVHVAGRYVSGRVSAHSLETRGVLAAYDPAQDGVTVHSSTQGPHQVREA
FT                   IAWCLGIAEHRIRVIVPDVGGAFGSKSCPYGEEILLAHLALRLRAPVRWIESRAEAFVA
FT                   CVPGRDEVVDIELALSDDGAILGLKALITLDKGAEPYAASVGAAWAGAMMVTGAYRIAN
FT                   VHVATRVVVTNKTPTGAYRGYGTPEVNFALERALDDAARRIGLDPAELRRRNLVPAEAM
FT                   PAPSATGLLLLDSGRYEEMLDLALDAFGYRARVDRARAARADGRAVGIGLAFYVEPTNL
FT                   GPSALCGMIGINSGGFDIATLRMEPSGQVVVFTGQTPMGQGVERVLQQLCAAELTMPDE
FT                   DVTVVHGDTQACPYTAYGSGGSRGTGIGGSAVMLAAGRLREKLCAIGAHLVGAAPDEVE
FT                   LSQGGVQVRGDSARRVSIARVARAAYLAHDLPAGMEPGLDARASFDPAALAITYGIALA
FT                   EVEVDRETGLVEVRDILFGHDCGRQINPALVEAQVIGGIVQGIGATLYEGLDHDAAGQP
FT                   AIRCMRDYPLPFAADVPPIALVHLETPSPFFPNGAKGVGESGAIPIPAAIANAIRDALG
FT                   DAAADAVDRLPIRPENLLPS"
FT   gene            539227..539661
FT                   /locus_tag="Swit_0501"
FT   CDS_pept        539227..539661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66869"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3K3"
FT                   /protein_id="ABQ66869.1"
FT                   /translation="MADYAKDEARIREIVEQMFEAINWSADKAPDFTAFAAAVRKDALL
FT                   APSARPVSPTDIETFVGRMRGQYESGGMKTFDERANKTIVKVFGNLAVAIGSYRAQIDG
FT                   GPIGRGANGFLLVRNDGDWQIAAMGWDSEGEDKPMPAELA"
FT   gene            539821..542406
FT                   /locus_tag="Swit_0502"
FT   CDS_pept        539821..542406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0502"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR; Sigma-70, region 4
FT                   type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66870"
FT                   /db_xref="GOA:A5V3K4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3K4"
FT                   /protein_id="ABQ66870.1"
FT                   /translation="MTINAGDGWSRRIDDLAPRIARHHVTLLRAPAGHGKSVALDRLRA
FT                   AIEAGGERCAALLLDKRDADLSRFFRRVAQALGVDPAQPDAAGVAEAVEVGAADDRPAL
FT                   LFLDGIDEAGDVLPPALSDLILFAPGLRFVIASRESNLPGLAKLRAQDRVAVIGPDQLG
FT                   FTRAEALAFLGASEDADVLRLVDRCEGWPILLKFVRDGLDAGDPPTLAGDMGSVSAGLI
FT                   ADFLDEQILAPLLPEDADFLERTAVVSRFTLDLARLLAPEAAVEQSVERLGRAAGLLQA
FT                   RRLNGLWYHVNPMLRATLMRRFQARIGSDVRRVHRMIEAWMIEHDAVDEAVLHACLAQD
FT                   YDECVQLVRRFGPANLSMRYGLRTLRSVLAALPRHYLDHEPALGISEALVLSKEGRVSD
FT                   ARRLIHRLRDKAGGHAAAAGALGDLDLLDIMLACHADQPLMPGLADRLSAVAAALPHDD
FT                   VIHQGWVQNLICRVHLSLGNFTHAAAAGIAAEHYYARSDSRYGQFFVHLHLASTRSWQG
FT                   LYDQVGSHIDSAESIAVQHFPEDPAMATLCRLLRAELLFDQGQADLGIDLLPALQSAEN
FT                   NDGWLDLFVSGYRTAALHAFRGGGLEAALAVTRRGDEAALRIGLPRLALVMQILRAELL
FT                   SLAGHRNQAGAALRAIRVPSNGEDDARWRERLALGIANARLLIHSRQFRRATVLLDTLE
FT                   GECERRGIGRLVAKVGLLRALLLACSGSPQRAIATLVELLQSAQQPSMQAFIEEGELMA
FT                   RLCSLVAHHSQRHALGPEASRFLAELSERLGQSYEHVIDRDAGGSYLSAREREILLSLA
FT                   QGESNKSTAERLNVSEATVKFHLQRIYRKLGAHNRVKAIAVAQQQGLLY"
FT   gene            542637..543593
FT                   /locus_tag="Swit_0503"
FT   CDS_pept        542637..543593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0503"
FT                   /product="Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66871"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3K5"
FT                   /protein_id="ABQ66871.1"
FT                   /translation="MAVATPALPALAEIEAARERIAGIADPTPLVRLQADGRADIHLKL
FT                   ETLQPVGSFKVRCAANALLRRVEAGARDVSTASAGNFAQGLAYAGRERGVKVTAYVPET
FT                   AAESKLDGLRRLGAAIVALPYDRWWAMLAEGSDDAGFIHPVADPDVLAGNGTIGLELLD
FT                   ARPDLAAVIVPYGGGGLISGIAAALKARGSNARVIACETEAGAPLRAALAAGRPVTIPF
FT                   DSGSFVTGMGGPAVIPAMWPHVRALVDDTALVSLAETAAAVRLLVERHHLIAEGAGAAP
FT                   VAAALARQEAAGPVACIVSGGHLDLGHLVTILGGAVP"
FT   gene            543641..544654
FT                   /locus_tag="Swit_0504"
FT   CDS_pept        543641..544654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0504"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66872"
FT                   /db_xref="GOA:A5V3K6"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3K6"
FT                   /protein_id="ABQ66872.1"
FT                   /translation="MSTTIMNRPTAGNPTSRAQGEKILLEGEDGLFTQSWFPICLSSDV
FT                   PVGTVKGYGFLDGRIIVFRGEDGIANVTSAFCPHLGADLRSGDVVGNTVRCAFHHWNYD
FT                   GQGRCVATKIGDTPPPSARLYKFVSQERYGIIWAFNGDDPHYDLPDFPYPEEELVFRTV
FT                   VNGEPNDVDPWIQCANTPDMQHIKALHNITFTQDDPEDIAWTDHSMVYSFSGIHTDGSP
FT                   VDNVVGIYGTSLYYQTTDYAGRWFGFLNPMGMPRAGSSQNYMVLAARRDMGTPEEVERF
FT                   LDFVEELERGVVSEDLMVMSSIKFRPGTLTRSDKTLARFFDYMRAYPRAHPSRDFI"
FT   gene            544704..546845
FT                   /locus_tag="Swit_0505"
FT   CDS_pept        544704..546845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0505"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66873"
FT                   /db_xref="GOA:A5V3K7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3K7"
FT                   /protein_id="ABQ66873.1"
FT                   /translation="MTGKLRIGRWAIGTAIFSIATMAMAQRPETAGPAIGAEEAPDQIV
FT                   VTGRKREERLQDVPEAITAFTSASIEAAAIDNIRDVALNVPNFSISSAEQPGIVLINIR
FT                   GVGQVRNGEPPIAVVIDGVQLNNVNQFTQDLFDIERIEVLKGPQGAVYGRNAIAGALNI
FT                   VTRQPTNELEGMVEGTIGTGSDLRARAAISGPIVEDKLLFRLSGAVRDFDGDIRNVTVG
FT                   KDINNDKSYSFRGSLIAHPSEALTIDIRGSRTENHSGAAWYSFVPPGARRTDLLPITAD
FT                   IPGKVDRYLHDASVKIDYEFPGATLTSVSAYTRTKFFLNEDFDFLPFDYLSGTQGFKSD
FT                   AWSQELRLTSDPGRFNWMAGAYLIKTDQKLDSVLYVRPGAGGVLFPFPISAPTVFTATR
FT                   STDDNFAYAFFGQANYSATDALDLSLGLRYDIDERKQTDRALPGLPRYDKTFKAFQPKL
FT                   AITYKLTPDANLYASAGKGFRSGGFNPNARITRVYKAEENWSFETGFKSTWLDRKLTLN
FT                   GALFYTRVKDRQIYLFDQLTGSQIITNPIPRSRIFGAELEMTARPADGLDISLSGGFLD
FT                   TKVTRYDTTVFAGLPAAGDFTGNDLPQVPRWSYSAAVQYRIPLGADTDLTPRIEANGKG
FT                   GHYYWEVDNRDRLNFVNLVNARLSLRTGPVTLTAYVENLFDKEYLIDVVAQRFSGAPLG
FT                   DYNQRSWGRRYGLTGRFNF"
FT   sig_peptide     544704..544781
FT                   /locus_tag="Swit_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.984 at
FT                   residue 26"
FT   gene            546850..547695
FT                   /locus_tag="Swit_0506"
FT   CDS_pept        546850..547695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0506"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66874"
FT                   /db_xref="GOA:A5V3K8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3K8"
FT                   /protein_id="ABQ66874.1"
FT                   /translation="MRAAVVTGASSGIGRATAALLVERGWRVFGSVRTEAQAEELSVAL
FT                   GPALVPLRFDLRDGPAIARAAKQVAAALEGSRLAGLVNNAGLAHFGPLAVQPIADWQAQ
FT                   VDVNLTGTLRVVQAFLPLLGADRARSGPPGRIVNISSVSGRITLPFTSGYAASKHGLEA
FT                   LSDAMRRELAIYGIRTIVIQPGAVRTPIWDKVDRPEDERFADGDFGPPFARFKIAFAAA
FT                   GEAALPPERFAALIHRVLTIRHPRPRYALMRGRLAHWTLPRLLPDRMLDRILAGQLGPS
FT                   "
FT   sig_peptide     546850..546906
FT                   /locus_tag="Swit_0506"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.813) with cleavage site probability 0.800 at
FT                   residue 19"
FT   gene            547709..548152
FT                   /locus_tag="Swit_0507"
FT   CDS_pept        547709..548152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66875"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3K9"
FT                   /protein_id="ABQ66875.1"
FT                   /translation="MITVEKATRVAATADRLWHLLSSREGQCRLERGIVASIEFEGDGV
FT                   GMVRHMRLEGHPPEIIVRERLDHCDPVAREMRLSIVDTGDIVPFACHSGHARVIPAGPA
FT                   ASILYLRTSFVPVDMEDEAARAIAERNHDMLIANVRAALAEPA"
FT   gene            complement(548149..550812)
FT                   /locus_tag="Swit_0508"
FT   CDS_pept        complement(548149..550812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0508"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="TIGRFAM: alanyl-tRNA synthetase; PFAM: alanyl-tRNA
FT                   synthetase, class IIc; phosphoesterase, DHHA1;
FT                   Threonyl/alanyl tRNA synthetase, SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66876"
FT                   /db_xref="GOA:A5V3L0"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3L0"
FT                   /protein_id="ABQ66876.1"
FT                   /translation="MTSTNDIRRSFLDHFAKEGHELVPSAPLVPHNDPTLMFVNAGMVP
FT                   FKNVFTGLEKRPYSTATSSQKCVRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKE
FT                   RAISLAWSLITGTWGIPADRLTVTVFHTDDEAFDLWKKIGMPDSRIIRIPTSDNFWSMG
FT                   DTGPCGPCSEIFYDHGAHIPGGPPGSPDEDGDRFVEIWNLVFMQYEQVDKETRIDLPRP
FT                   SIDTGMGLERIAAVLQGVHDNYDTDTFKALIAASGELTRTATNGDFKASHRVIADHLRA
FT                   SGFLVADGVLPANEGRGYVLRRIMRRAMRHAHLLGAAEPLMHRLVPSLVAEMGAAYPEL
FT                   VRAQPLIEETLKLEETRFRQTLANGLRLLDEATGAMKPGDVLPGAVAFKLYDTFGFPYD
FT                   LTEDALRAQDLGVDRSGFDAAMAEQKAAARAAWKGSGEKASDEVWFDIAEEFGGTEFTG
FT                   YVSEEGDGQLLAIVKDGQRVAEAKAGDEVVLVTNQTPFYGESGGQMGDAGRITGDDGLE
FT                   IAVEDTAKPLGRVHAHRGTVVSGSVRTGDALHLVVDGDRRTRIRANHSATHLLHAALRN
FT                   RLGSHVTQKGSLVAADRFRFDFSHPKALTPEDIAAIEAEVNRHIRENDEVTTRLMTPDA
FT                   AIEAGAMALFGEKYGDEVRVLSMGKAGRDLGAKSYSVELCGGTHVSALGDIALFKIISE
FT                   SAVSSGVRRIEALTGEAARQWLTQRDEKLKEAAAALKTAPDDVPARIAVLVEERRKLER
FT                   ELAEAKKALALGGGSKAEAAGPEDVAGVKFLPQVVDGLDPKGLRGLVDDAKASLGSGVS
FT                   VIVAVNDGRASVAAGVTADLVDRISAVDLVKAAVAALGGQGGGGRPDMAQGGGPDGDKA
FT                   ADAVAAVRDALAKVPA"
FT   gene            550934..551293
FT                   /locus_tag="Swit_0509"
FT   CDS_pept        550934..551293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66877"
FT                   /db_xref="GOA:A5V3L1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3L1"
FT                   /protein_id="ABQ66877.1"
FT                   /translation="MMSSPSKRSVAVLLGLSCLFASQAATARPDRLAREGHALAVKRCG
FT                   ACHATEKTGASPLPIAPPFRSLGYRYPVETLDEALAEGIVAGHPDMPSDPWEPADIKRF
FT                   IAYLESIGPKPAKAR"
FT   sig_peptide     550934..551017
FT                   /locus_tag="Swit_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.443 at
FT                   residue 28"
FT   gene            complement(551303..551929)
FT                   /locus_tag="Swit_0510"
FT   CDS_pept        complement(551303..551929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0510"
FT                   /product="Glutathione S-transferase, N-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66878"
FT                   /db_xref="GOA:A5V3L2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3L2"
FT                   /protein_id="ABQ66878.1"
FT                   /translation="MAIIVHHLENSRSQRVLWMLEELGLAYEVRRYERDPKTMLAPPAL
FT                   KQVHPLGKSPVVEHDGRVVAETATILEYLVALSAGRLGPPEDPDGALRWRYFLDYAEGS
FT                   LMPPLLLSLVIGRMGPFGWPARGFVTRMAMTHIDYVESELSQRPWFAGAEFSAADVMMS
FT                   FPLEAGRQRLKLDGRRPSILAWLDRIHARPAYQAALEKGGPYAYA"
FT   gene            complement(551964..552311)
FT                   /locus_tag="Swit_0511"
FT   CDS_pept        complement(551964..552311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0511"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66879"
FT                   /db_xref="GOA:A5V3L3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3L3"
FT                   /protein_id="ABQ66879.1"
FT                   /translation="MTARLNYVELPVGDTAASRAFFEQAFGWSLTAFGPDYAATTGQAG
FT                   SDIGLNGDAGDATRAPLAVIETDDLEAALASVEAAGGTVSRPIFAFPGGRRFHFREPSG
FT                   NELAVYVNEPG"
FT   gene            complement(552476..553549)
FT                   /locus_tag="Swit_0512"
FT   CDS_pept        complement(552476..553549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0512"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="TIGRFAM: recA protein; PFAM: RecA domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66880"
FT                   /db_xref="GOA:A5V3L4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3L4"
FT                   /protein_id="ABQ66880.1"
FT                   /translation="MSAQLKLIGSEREAANMDRQKALEAALAQIDRAFGKGSAMKLGSR
FT                   ETMQVEAISTGSLGLDIALGIGGLPKGRVVEVFGPESSGKTTLALHAIAEAQKVGGTAA
FT                   FIDAEHALDPVYAKKLGVNIDELIVSQPDTGEQALEIADTLVRSNAIDVLVIDSVAALV
FT                   PRAEIEGEMGDSHVGLQARLMSQALRKITGSISRSKCLVIFINQIRMKIGVMYGSPETT
FT                   TGGNALKFYASVRLDIRRTGAIKDRDEVVGNATRVKVVKNKVAPPFKQVEFDIMYGEGV
FT                   SKVGELLDLGVKAGLVEKSGAWFSYDSIRIGQGRENSKVYLRENPEVAAKLEAAIRGNA
FT                   DGVGEAMMAGPSEDDDI"
FT   gene            complement(553697..556108)
FT                   /locus_tag="Swit_0513"
FT   CDS_pept        complement(553697..556108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0513"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; PAS fold-4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66881"
FT                   /db_xref="GOA:A5V3L5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3L5"
FT                   /protein_id="ABQ66881.1"
FT                   /translation="MATLFSAAPISASSGRFALNLLLAVLAFIASIGMAGMIWGATDNL
FT                   LVAGLFMLAFCLGIGMILLVATVRARIHSRPVRLLDTELLLGTIEDSASGVAITGPGGE
FT                   LLCANRQYETWFGGLPTPPGLPLDAATRMQLSSAALAARRDGLAQIAGLSTDRGLIDVI
FT                   VRRAGNGDDHLVWRFHRSSEFDGLGDIMRMLGSEIGRRIGSAGVMTALVDGNGIGLVAN
FT                   RVFLQRALGSADAPSAGWAFAELLRSDGDMIRLAADPATADPVRLIQIPLDNQGGADAT
FT                   LFLLLDEPTGHGAEARAVATGDLHALLGMLPIGLAVAERDGRVLFMNSSFRRAAGLGPE
FT                   ATIVYPSDLVVEEDKAAVSDAVRRFSAGRGSASDLSVRLKERPEENVSLTIAAAKGLGK
FT                   ASVLLSLKDNSEESRLKRQVAQAMKMQAVGQLAGGVAHDFNNILTAIIGHCDLMTMRHI
FT                   PGDSDYDDIQQIKHNSNRAAALTRQLLAFSRQQTLRPQILQIPDVISEISNLLNRLLGE
FT                   TVRLEVSHGRNLGTVRADPGQLEQVIVNLAVNARDAMPDGGMLTIHTYAVSQADVRRLG
FT                   IEIMPVTEYTAMKVTDTGSGISAENLNKIFEPFFTTKEVGKGTGLGLSTVYGIVKQTGG
FT                   FIFAESEVGAGTSFVIYLPVHEAPAKAAAARAPVKEASTELWGTGTILLVEDEAMVRAV
FT                   AERALARQGYKVLTATNGEEGLEILEAGEEPIDLVISDVVMPTMDGPSMARAAREKRPD
FT                   LPIIFMSGYAEEQLRRSIDLDNIGFLPKPFSVQQIGQAAREALADHARLG"
FT   sig_peptide     complement(555986..556108)
FT                   /locus_tag="Swit_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.969) with cleavage site probability 0.706 at
FT                   residue 41"
FT   gene            complement(556154..558199)
FT                   /locus_tag="Swit_0514"
FT   CDS_pept        complement(556154..558199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0514"
FT                   /product="Endothelin-converting enzyme 1"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13, neprilysin; peptidase M13"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66882"
FT                   /db_xref="GOA:A5V3L6"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3L6"
FT                   /protein_id="ABQ66882.1"
FT                   /translation="MKIFLIALAASSMLVPVAAPIAGDAARAAPAKATAKPTYGDFGFD
FT                   AAGMDRSVRPGDDFYAYANGDWAKDTPIPADRSNFGMFTVLDELSMARSHDILERVAKT
FT                   RGTRIGDLYASFMDEAAVDAAGIAPLKPLLDAVKAIDDRSAVAAKMGDYLRLGIRTPFR
FT                   AFVDQDDKYPESYIAIVRQSGLGLPDRDYYLKPDTDMAKTRAAYQAYVAQLLTLAGEPR
FT                   ADERAAAILAFETELAKVQWTRVDSRDSTKTYNKWTRGDFARNAPGFDWDAYLKAAGLD
FT                   GQADYLVGQPSAFAGMARAIAAAPVELLKDYLLLAAINAEAPYLSKPFVDAEFAFNQTV
FT                   LSGTPQNSERWKRGVTLVKEQVGEDLGQEYVKLYFTPETKAAADELVRNVIAAMGRRID
FT                   GLSWMSPETKVKARAKLAAFTPKIGYPSKWRDYSALEIRRGDLLGNVLRASAFEWRRNL
FT                   NKLGRPIDRTEWGMTPMEINAYANFAMNEIVFPAAILQPPFFDPHADPAVNYGGIGAVI
FT                   GHEISHHFDDQGAKYDMHGRLSDWWTADDVKRFGVLTDRIVKQYDAYEPLPGLHIQGAL
FT                   TQGENIADLAGLTVAYEAYQMALKGRKAPVIDGFTGDQRFYLGWAQVWRRNYREANLRQ
FT                   RLLTDPHSPSIQRAWVVRNLDPFYEAYDVKADEKMYLAPADRLHIW"
FT   sig_peptide     complement(558131..558199)
FT                   /locus_tag="Swit_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.526 at
FT                   residue 23"
FT   gene            complement(558258..558833)
FT                   /locus_tag="Swit_0515"
FT   CDS_pept        complement(558258..558833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0515"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66883"
FT                   /db_xref="GOA:A5V3L7"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3L7"
FT                   /protein_id="ABQ66883.1"
FT                   /translation="MFDSIGRWWRKNAPTRESLEEVRWLRPFAHRVLEPALWRFTRRSV
FT                   PRGVALGLIVGLFLMIPGLQIIGAALLALPCRANVPIAVAMTFLSNPATTPFILYLSII
FT                   VGNRFIHSTVDVGTVMTMINQGASLAEWAAWLASAAAPALVIGLFVISVITAAVGYLAS
FT                   GCIWRAWTSHKWNLRERHRAERAVEERG"
FT   gene            complement(558845..559327)
FT                   /locus_tag="Swit_0516"
FT   CDS_pept        complement(558845..559327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0516"
FT                   /product="SsrA-binding protein"
FT                   /note="TIGRFAM: SsrA-binding protein; PFAM: SmpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66884"
FT                   /db_xref="GOA:A5V3L8"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3L8"
FT                   /protein_id="ABQ66884.1"
FT                   /translation="MARPRPAEFEKKKVVAENRRARFDYFLEQFFEAGIALTGTEVKSL
FT                   RFGEGSIAESYAEVKDDQVWLVNSNVPEFSHGNRFNHEPKRPRKLLLHAREIDKMRNGV
FT                   SREGMTLIPLSIYFNGRGRAKVELALAKGKKLHDKRDTEKERDWKREQQRLLRDRG"
FT   gene            complement(559389..560267)
FT                   /locus_tag="Swit_0517"
FT   CDS_pept        complement(559389..560267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0517"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66885"
FT                   /db_xref="GOA:A5V3L9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3L9"
FT                   /protein_id="ABQ66885.1"
FT                   /translation="MMFSGSIPALVTPFRDGAFDEKLFRGFVDWQIAEGSSALVPCGTT
FT                   GESATMSIEEHNHVVRVCIEQAQGRVPVIAGCGSNDTAVALEHMKAAQAAGADAALVVL
FT                   PYYNRPNQDGLIAHFRHLTDNCTLPIIVYNVPARTVTDILPETLGALAGIKTIVGIKDA
FT                   SGKVERVSAQRQHCGPDFCQLSGNDDMALGFMAMGGVGCISVTANVAPGLCAEFQTACA
FT                   DGRWADALALQDKLFPLHAALFSDASPGPVKYALTRTYRDFPADLRLPMTWPSEASRAA
FT                   VDAALAHAGIA"
FT   gene            560311..562359
FT                   /locus_tag="Swit_0518"
FT   CDS_pept        560311..562359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0518"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66886"
FT                   /db_xref="GOA:A5V3M0"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3M0"
FT                   /protein_id="ABQ66886.1"
FT                   /translation="MKLVRETNAPNRFGYPNLSSRSRRLFTGLTLLASTAAIAATVAPE
FT                   PAPAPAVQSPAPGAPAWRSDVLQGVIGEWRRLQQSDSLPFQDYAAFLIAHPGWPGESAM
FT                   RRAAERRIDPNSYDRGLVVTFFTRFPPLTAAGQTRNAEALAATGRMAEARSNAAAAWVT
FT                   KGLSQDDEARLLARFGAGMTPADHDRRMERLLLDRATTAAGRQVANVSPARRALYAARL
FT                   ALLRNDADVDARIAAAGDAVNHDPGYMIERARYLRDRGDSMGARIWLGQSRDLSGPPFD
FT                   SAAFLDDLLSFARAANADGQYDLALAIAKHAEQAFPPGTRIRDRPFAERDDYTSLMWLA
FT                   GTAALQKLGRYDDAVTMFDRYSRAAQTPGTQTKGWYWAGRAAERGGKPDWAKSYLNQAA
FT                   VHIDQFYGQLAAERLGRELMIPPEPPRTMVPPTERASFEASEVVRAARLLGQSGQWQDQ
FT                   TAFIRLIAANAKTDSDHILAGELARSMNRPDLGVMVSRAARTSGTPDPLRIGFPEVPVP
FT                   QAMNGHWTLIHAISRQESQFDRQATSRTGARGLMQLMPATAREQAGKLGLAYDPARLAD
FT                   IDYNVMLGSAFFDRMLTYYGGSYVLAVASYNAGPGNVNKFIKANGDPRMPGVDVVDWIE
FT                   AIPFAETRGYVQKVLENAVVYDLLNPSRARSATKNRLSSYLGKAKPG"
FT   sig_peptide     560311..560430
FT                   /locus_tag="Swit_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 40"
FT   gene            562655..564100
FT                   /locus_tag="Swit_0519"
FT   CDS_pept        562655..564100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0519"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66887"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3M1"
FT                   /protein_id="ABQ66887.1"
FT                   /translation="MAGADAFDEIRGKPGDPAGRPEFAQLLDWIETTPPAELDRRQKAA
FT                   EAAFRQLGITFAVYGEEESAERIIPFDIVPRIFTAREWASLSEGLVQRVEAINAFLADI
FT                   YGPRRILADGILPEELVLANPQFRPVLAGAKPPHGVFAHICGIDLVRTGPDQFWVLEDN
FT                   ARTPSGVSYMLENREAMLRLCPELFEQFDVAPIDSYPDALLETLQSVSPRGRGADATCV
FT                   LLTPGHFNSAFYEHSFLADSMGIELVEAADLEVDDDKVWMRTIEGRVQVDVIYRRIDDD
FT                   YLDPLVFRPDSLLGVPGIVAAYMAGNVALVNAPGTGIADDKAIYSYMPEIVKYYSGGDA
FT                   KLPNVETYRCREPQALRYTLDNLDKLVVKLVDGSGGYGMLVGPTATRAQIEEFRAALVA
FT                   EPHRYIAQPTLALSTVPTLTEKGVAPRHVDFRPFVLSGGKGVTITPGGLTRVALREGSL
FT                   VVNSSQGGGTKDSLILTGRGERA"
FT   gene            564100..565035
FT                   /locus_tag="Swit_0520"
FT   CDS_pept        564100..565035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0520"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66888"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3M2"
FT                   /protein_id="ABQ66888.1"
FT                   /translation="MLSRTANSLYWIGRYVERAEFTARLIEATIRLDALSARPAGQGAW
FT                   DSALLVAAADYDFGLTGETRSPLAISRYLTLAAANPNSIRSCLDAARSNAKSVRTALSR
FT                   DAWEAINRAWLGLRGRASTGGSQTTLSLVEQIRAETRGFEGALHRMLRNEAYSFLGLGA
FT                   AMERADNTARLIDVKYHLLLPEGEKVGGLIDRDQWTTILHTVSANTAYRWLYSQGLKPW
FT                   LVAELLCLKPELPRSLIASSEEVIMHLNAIGKRTGLQGEADRLSRLRHNALERTTIDTI
FT                   FAQGLHEWLTGFIYENTRIHSAIGQQFRFG"
FT   gene            565037..565864
FT                   /locus_tag="Swit_0521"
FT   CDS_pept        565037..565864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0521"
FT                   /product="transglutaminase, N-terminal domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66889"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3M3"
FT                   /protein_id="ABQ66889.1"
FT                   /translation="MRLLIQHQTEYRYTEPQARVVQLLRMTPSSHIGQNIVDWRIDVDC
FT                   DARLKHSTDGFGNIVSMLYLAGPVERIGLRVTGEVLTEDRAGAVSGAIDPLPSAVYRRA
FT                   TELTAPCDALLDLLRDHDGANGDALSRIHDLNSAVCRLFPCKEHRSTEVRSVGEVLDVR
FT                   SGCSMDMAHVLIAAARASGFPARFVTGYIYRDDPDCGHREAPHFWAEIDVPEFGWIGFD
FT                   PANDMCPNDHYVRIAQGLDFRDAAPISGARVGGGHEVLAIGVDVSLSQEQYQA"
FT   gene            565939..567819
FT                   /locus_tag="Swit_0522"
FT   CDS_pept        565939..567819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0522"
FT                   /product="signal peptide peptidase SppA, 67K type"
FT                   /EC_number="3.1.3.2"
FT                   /note="TIGRFAM: signal peptide peptidase SppA, 67K type;
FT                   signal peptide peptidase SppA, 36K type; PFAM: peptidase
FT                   S49"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66890"
FT                   /db_xref="GOA:A5V3M4"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3M4"
FT                   /protein_id="ABQ66890.1"
FT                   /translation="MKLVRGLWKLLVGIKDGLVLIAMLIFFGTLFLALSIKPNSTLPSS
FT                   GALVIDLDGTLVEQPAETDPLTLLAGNGGIARETRLRDLERALQAAAESNGVKAIVLDL
FT                   DSFAGGEQATIAAAGRALDKARAAGKPILAYATGYGDDGYQLASHATEVWLNPLGGVIL
FT                   TGPGGSRLYYKGLMDRLGITAKIYRVGAFKSAVEPYMRSDQSPEAREANQALANALWST
FT                   WTAEVGKARPKAKLAAYVERPTAIIGEAGGRMSQAALNAGLVDRLGDRNAFDSRVAAIA
FT                   GSAGGSSLNGFKAIPLDRWASAHPEKSGGTPIGVLTVAGDIVDGDAPPGAAGGTTISDL
FT                   LLDELGRKRTKALVVRVDSPGGSVTGAETIRSAILQAKGLGLPVVVSMGGLAASGGYWI
FT                   STPADRIIADPATITGSIGVFGILPTFQGSLAKLGLSADGVKTTPLSGEPDVFRGTSPQ
FT                   FDAMMQGSIEDVYRRFTGLVAQSRKLPIERVREIAEGRVWAGATARQIGLVDGFGSVDD
FT                   AIAEAAKLAKLDPAKVRPLYIEKPLNPWKEMIRSLIDPDNDSSEAGSRTFWGGVANGPD
FT                   QALVVALANARRVLGGPAIQVRCLECASAATPPRPADIRAARSLLAWAVR"
FT   gene            567804..568352
FT                   /locus_tag="Swit_0523"
FT   CDS_pept        567804..568352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0523"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66891"
FT                   /db_xref="GOA:A5V3M5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3M5"
FT                   /protein_id="ABQ66891.1"
FT                   /translation="MGGPLRIRAARPADAEAIAAIYAYYVLTGPITFEVDPPSAAEMAR
FT                   RMTDILPHHPYLVAELDGGIAGYAYATRLYERAAYRWAVEATVYVAPGSHRQGIGAALY
FT                   RALIASLGEQGFRTVIGKITLPNPASVRLHESLGFVCAGVLAKIGFKQGGWHDVGIYQL
FT                   DLGGHPVPPPEPRPFLPAG"
FT   gene            complement(568357..569004)
FT                   /locus_tag="Swit_0524"
FT   CDS_pept        complement(568357..569004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66892"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3M6"
FT                   /protein_id="ABQ66892.1"
FT                   /translation="MMRGGIFAASAMALLLAGCGPKQLALPGDPIDRAATCAVVSAASA
FT                   RADAPDVKGDLGFDAQTRILHYAMLAATADDHFSAKKASEVVGRMGEVEKAVTDGKWQA
FT                   LVTPCDQAYPEVRKTAGIELPKGKFDAELGCYSLGDFLVKTVSTSDPKAQEQLSGLTKM
FT                   RRELDGTVGRQLKARGASGYERTLELKQAALGRMTKLGAPAETARMCRSRFA"
FT   sig_peptide     complement(568927..569004)
FT                   /locus_tag="Swit_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.963 at
FT                   residue 26"
FT   gene            complement(569118..569744)
FT                   /locus_tag="Swit_0525"
FT   CDS_pept        complement(569118..569744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0525"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66893"
FT                   /db_xref="GOA:A5V3M7"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3M7"
FT                   /protein_id="ABQ66893.1"
FT                   /translation="MELPDLMMVRTVLPWLDIAGIAIFAISGALAAARREQTIVTFTFF
FT                   AAVTGTGGGTVRDLLIGAPVFWIHDNRALAVCLFAALAVWMTPRRIWPVKALEWFDGVG
FT                   LAAYAVFGSWKALAYGVPPLGAAAMGVFTACLGGIIRDVLAGEPSILLRPELYVTAAAL
FT                   SAGLFVVLTLLGAPLLPAAGMAALAGFALRALAIHRGIALPSYRD"
FT   gene            569759..570832
FT                   /locus_tag="Swit_0526"
FT   CDS_pept        569759..570832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0526"
FT                   /product="arginine succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /note="PFAM: arginine N-succinyltransferase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66894"
FT                   /db_xref="GOA:A5V3M8"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3M8"
FT                   /protein_id="ABQ66894.1"
FT                   /translation="MLSAPVQPTLESAPGRMEHRCMSEPDSIRIRPVRNDDVDALLALA
FT                   RGSGPGFTNLPADRDILRERIERSDALLAGEELGGAIILGLEVGGRVRGCGMVFPRIGV
FT                   DWPFYSYRISYTTQRSSIDGRMVRFPVLTLTNDLEDCAEVGGLIVDPTLRRGGYGRMIA
FT                   RSRYLFIGCHRADFGKRVIADLRGWLDQGRSPFWDAVGGRFYAMNFAEADHINATTGNQ
FT                   FIADLGPRAPIYVNMLSEEAQQAIGRVHDDGRGAHALLVEEGFRDDGYVDIFDAGPTMI
FT                   AMIDDLKAIRTLHHASYAGSRDGDPLHDHLIAHGKGAGFRCAPGSIEAAGGQAVTDPAS
FT                   AALLGLSEGDPIGYLAI"
FT   gene            570829..572103
FT                   /locus_tag="Swit_0527"
FT   CDS_pept        570829..572103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0527"
FT                   /product="succinylarginine dihydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /note="PFAM: Succinylarginine dihydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66895"
FT                   /db_xref="GOA:A5V3M9"
FT                   /db_xref="InterPro:IPR007079"
FT                   /db_xref="InterPro:IPR037031"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3M9"
FT                   /protein_id="ABQ66895.1"
FT                   /translation="MTATEINFDGLIGPMHNYAGLSPGNIASATNAGAISQPRAAALQG
FT                   LAKMKRLMDRGLVQGFIPPPRRPAVAALRALGFGGDDRSVIARAAAEDPVLFNNACSAS
FT                   AMWAANAATVIAAPDSGDGRVHLVTANLATMLHRSFEAPDTFATLRTIFADQRHFAVHP
FT                   ALPGTQHFSDEGAANHMRITPRHGERGLDIFVHGAARGSRFPERQAKRAGEAVARLAGA
FT                   DAFHTLQSQAAIEAGAFHNDVVAVANEHVLLAHAAAFEDRDGLFAAAGRAVPDFVAVEV
FT                   DSIGLDDAISSYLFNSQLLTLPEGGMALVLPSETRENPRVWAAVETILAGNNPINEAIV
FT                   VDVRESMRNGGGPACLRLRVPVGEEALRAIDPRFLLDERRWEALCALVERHWPERIDAA
FT                   ELADPALWAAAGAAHDALDTLLARV"
FT   gene            572173..573177
FT                   /locus_tag="Swit_0528"
FT   CDS_pept        572173..573177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0528"
FT                   /product="arginine succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /note="PFAM: arginine N-succinyltransferase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66896"
FT                   /db_xref="GOA:A5V3N0"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3N0"
FT                   /protein_id="ABQ66896.1"
FT                   /translation="MLIVRPAGPSDLASLMELAVLSGRGFTSLPEDEATLLNRLTLSEA
FT                   SFSGAIAPREAWYTLMLEDSETGRIEGLGGVRAAVGVARPHFSFRVMTLAQFSSAINTR
FT                   FDHKALVLVNECAGWTEVGSLYLRPERRSGGAGSLLARSRYMLIGTERQRFSETVMAEL
FT                   RGYFAPDGTCPFWDGVASKFFRLPFDEADHMVMSTDGQFILDLAPRHPIYVELIDTAAQ
FT                   EAIGRVHIEGEAARAMLEHEGFRGSGLIDIFDGGPTYSVPRDSIRTIERTEVLAAMKGD
FT                   PADAPERLVSTASLGGFRAIRAKVRIEEGVATLDGGAIDALRLKSGEMVRVRQ"
FT   gene            573177..574577
FT                   /locus_tag="Swit_0529"
FT   CDS_pept        573177..574577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0529"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.-"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66897"
FT                   /db_xref="GOA:A5V3N1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3N1"
FT                   /protein_id="ABQ66897.1"
FT                   /translation="MRSIDPATGQAIWEGEEVAVAAIPAMVERARAALPGWADRPVEER
FT                   VAIVERYAALLKERTDDIARDMARETGKPLWETRAELGSMVNKVAVSIAAQAERAGSRR
FT                   ADTAFGRAVLRHKPHGVMAVLGPYNFPGHLPNGHIVPALLAGNAVLFKPSEEAPLTGEN
FT                   MTRALHDAGVPEAVFQLVQGGRDQGAALIAADIDGLLFTGAASTGAHFRRAMIDRPHVI
FT                   LALELGGNNPLIAWGDAETSAAAIVQSAFITTGQRCSCARRLILPDGGEGDATIEAVHT
FT                   LAARLRIGAWDDPEEPYMGPLISARAAQTAIDAVAGLKAKGARTLLPFERLERSDAFVT
FT                   PGMYDVTGLAVPDAEIFAPVLQVVRVPDFDAAIAAANDTSFGLSAGLLADDPELWQRFL
FT                   ARSRAGVVNWNRPTTGAAANMPFGGLGQSGNHRPSAYYAADYCAYPVASFEADTIADLT
FT                   GELGGRLL"
FT   gene            574574..575779
FT                   /locus_tag="Swit_0530"
FT   CDS_pept        574574..575779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0530"
FT                   /product="peptidase M20"
FT                   /note="PFAM: peptidase M20; peptidase dimerisation domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66898"
FT                   /db_xref="GOA:A5V3N2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3N2"
FT                   /protein_id="ABQ66898.1"
FT                   /translation="MIEAHRPALEAAAAAPMLAQVRQWSLVNSGSRNLDGLAVMAGLLA
FT                   DAFAALPGEVALRDAVPGEAVDAAGNVQPLDYGRNLHVRVRPGAPVQLLLTGHMDTVYA
FT                   PDHPFQTLTDMDGGAVLNGPGVADMKGGIALMLAALAALEASPLGSRIGYEVVINSDEE
FT                   IASPGSAALIAEAARGKLAALTYEPSSLPDGTLAGARPGSGNFSIIVTGRSAHAGRNPE
FT                   EGRNAIVAAADLALRLSRARRSGLAINPARIDGGGPNNVVPDRAILRVNLRPALPEDQA
FT                   IAQALIDDLAKAVAAEHDVAIHVHGGFGRPPKPIDDKAARLFALVEESAALLGRPITHK
FT                   ASGGVCDGNNIAACGVPVVDTMGARGGAIHSPDEYLIVESLPERAQLSTLVMLRLAERG
FT                   SL"
FT   gene            complement(575873..576934)
FT                   /locus_tag="Swit_0531"
FT   CDS_pept        complement(575873..576934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0531"
FT                   /product="3-phytase"
FT                   /EC_number="3.1.3.8"
FT                   /note="PFAM: phytase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66899"
FT                   /db_xref="GOA:A5V3N3"
FT                   /db_xref="InterPro:IPR003431"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3N3"
FT                   /protein_id="ABQ66899.1"
FT                   /translation="MRRVLTIAAFASLGACAAKEMPVEQRIALASPAATVTARGETAPV
FT                   GTANADAADDPAIWRNAADPAASLVVGTDKKAGLYLYGLDGKVRDFLDAGRVNNVDLKD
FT                   GVAIGGGTGVLVVASDRNDVANAKLALFRLDTASAKLTALGTVPAGAGEAYGVCLYRDV
FT                   AGLYAFIVLKDGTINQVALDASGATPSGRIVRTMKLGTQSEGCAADDRTGVLYVAEEDV
FT                   GLWKFDAKAGGSVSPVKIAAADGRNIVADAEGVAIAMVGEKDGYVLVSSQGDNAYAVYR
FT                   IADDAYVGRFRIAAGTVGATEETDGIEVMTGDFGPGFPGGLFVAQDGQNGAGAQNFKLV
FT                   AWDDIVRALGLPR"
FT   sig_peptide     complement(576878..576934)
FT                   /locus_tag="Swit_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.575 at
FT                   residue 19"
FT   gene            complement(576934..579744)
FT                   /locus_tag="Swit_0532"
FT   CDS_pept        complement(576934..579744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0532"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66900"
FT                   /db_xref="GOA:A5V3N4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3N4"
FT                   /protein_id="ABQ66900.1"
FT                   /translation="MTFFGASRAAIALGLLFSTSAMAGTIVGTVSDASGTRALESAEVR
FT                   IVELGRTVEASRDGRYRFPDVPAGTYTVEARYIGADTVRTTVKVAESGDSYADIAMGGR
FT                   ESNSIIVIGQAANQASTLSRQRAADGVESVLTRDAIGQFPDQNVAESLRRLPGINILND
FT                   QGEGRFVSIRGLDPELNASTVNGVRLPAPESDVRSVALDVISSDIIESIEVRKSLTPDM
FT                   DADTIGGSIDIKTTSAFDRKKDLFKVSAEGSYNDLTDKLSPKGSFDFSTKLTDAVGVSG
FT                   GLSYYRRRFATDNMEMDGWDIDDNGNAYADTVEYRDYDVTRKRLSASLSFDFKVGESTK
FT                   LYARGLYSQFDDQEYRRRLTFEMDEAPTSSTANTASFASDDGEISVQRDLKDRFESQKI
FT                   RSLVLGGETETGPWKATYSASWAKSSERENGSIDPVNFERKFEDPGEFGVTFDYSRPKL
FT                   TSYAVTTGQARFLDPSEYEFDKVERTTLSDARDEEFAIKADVSREYVMDGGVFTVQAGA
FT                   KQRWRKKTYNAQFDIYKGFNGDLTLADFLGKQDYGLASIDPVLAKKSFRPFFRTNMADF
FT                   ELDPFDTDQASNESDFRVDEDISAGYLLGRWDSDKVRIIGGVRVEHTRNKIRGNQVELV
FT                   EEGDEHDGVEVDEDTVFVTPQSFKRSYTDWLPSFTVRYEPVRNLVLRAAGYKSLVRPKL
FT                   SNLAPRAVIEDNEGEFGNPALKPYKAWNADLAVEYYFGRNAAISAGLFYKDIKNYVVEV
FT                   TNQDVAYNGVILDEATTYANGPKAKVKGFEFSYSQVYDFLPAPFDGLLTQVNYTYTDAK
FT                   GRVFTDGDITDPRRIPLPASSKHTLNLVLGYEKGPLSLRAAGTFRDKYLDELGGDPTED
FT                   RYVSSHFQLDLSGKYRITDNIRVFAEWVNVTDRPYFAYQNLDGRRRLLQYEEYSWTAKF
FT                   GVTANF"
FT   sig_peptide     complement(579673..579744)
FT                   /locus_tag="Swit_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(579887..581221)
FT                   /locus_tag="Swit_0533"
FT   CDS_pept        complement(579887..581221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0533"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66901"
FT                   /db_xref="GOA:A5V3N5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3N5"
FT                   /protein_id="ABQ66901.1"
FT                   /translation="MRGAWMAGAAMLLIGGGQAQAQERTVAIKAGRLIDTARGIVLTDQ
FT                   VIIVTGDRITSVGPASGTAIPAGAALIDLSGKTVLPGLIDTHTHITGDPTVSPYESYHL
FT                   SVPRQAVTGVANARRTLLAGFTTIRDVGSSGYADVALKDGINAGEIAGPHIFASGPALG
FT                   ITGGHCDDNHLAPEYHHEGEGVANGTDAVRAAVRRNIKYGADHIKYCGTGGVFSRGDKP
FT                   GAQQYTQEEANAIVAEAHLHDRPVAVHAHGADGIKVAIRAGVDSVEHASLIDDEGLRMA
FT                   KAAGTVLSMDIYNTDYTQAEGKKNGVPEESLQKDRDVGDIQRENFRKAVKMGIKLSFGT
FT                   DAGVYPNGDNAKQFAIMVRYGMTPMQAIQAATVTGAGLIRRPKDLGQVAPGFYADIVAV
FT                   DGDPLADVRSLEKPAFVMKQGAVYRADAQQCAAAPSSWGCADPAR"
FT   sig_peptide     complement(581156..581221)
FT                   /locus_tag="Swit_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            581358..583079
FT                   /locus_tag="Swit_0534"
FT   CDS_pept        581358..583079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0534"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66902"
FT                   /db_xref="GOA:A5V3N6"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3N6"
FT                   /protein_id="ABQ66902.1"
FT                   /translation="MGSGGHAPTDILHTASSHAYDLLPGQLATEAETARALAAAAKDPR
FT                   LARAGHALVTGRISEAETLLRQALRDDPFDIAAIRMLAEVAGRIGRYRDAEALLRRALE
FT                   LAPEFEGARHNLALVLVRQTRHADALVEIERLLDRNPADRAARNLKAAALGQIGEHEAS
FT                   IALYEELIAEQDGHPWLWMSYGHGLKTIGRTAEAIVAYRRAVELRPETGEAWWSLANLK
FT                   TFRFADADVSAMERARAGDGLSIDDRAQIGFALGKAREDRGEDDEAFDRYAEANAMRRR
FT                   MVPYHAGDNVEHVDRSAAFFDAAFFAERAGWGCPDPAPIFVLGMPRSGSTLVEQILSSH
FT                   PEVEGTGELHDIGQIARRLSGHSRRDQRSPYPEALADLSAADVRALGEDYLARTRVHRH
FT                   SDRPRFIDKMPNNWAHVGLIRLILPNATIIDTRRHPIGCCWSVFKQNFARGQAYSYDLA
FT                   DLGGYYADYVRAMAAFDAAQPGAVHRVFYEAMVDDPEAGIRALLAAAGLAFDPACLAFH
FT                   ATERAVRTPSSEQVRRPIFRDAVDHWQRFEHRLSPLVEALGSALSDYPSMKSTEDA"
FT   gene            583114..585540
FT                   /locus_tag="Swit_0535"
FT   CDS_pept        583114..585540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0535"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66903"
FT                   /db_xref="GOA:A5V3N7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3N7"
FT                   /protein_id="ABQ66903.1"
FT                   /translation="MRTRMTKLSGAVALIMAGTAMTPALAQGATDSDANYRDEIIVTAQ
FT                   KREENMQKVPIPMQALGTAKLEQYNVSNFNDYTKLLPSLSFQSGQPGNAKVYFRGVTSG
FT                   GDGNHSGSLPSVGIYLDEQPITTIDGALDIHIYDIARIEALSGPQGTLYGASSQAGTIR
FT                   IITNKPDPSGFAAGFDADINKVSHGAVGGKLEGFVNQPLSDAAALRVVGWYQRDAGFID
FT                   NVPGTRTFGTGVTINNAADVKKNYNRSTVIGGRAALGIEIDDNWTVTPTIFYQDQVNNG
FT                   FFGYDPSVGDLKVQHFGRERFHDRYWQAALTVQGKIADFDITYAGAYLDRHIDAVSDYT
FT                   DYAVTYDNLYAGGFSGYFTDNAGNYIDPSQHIAGRDHFTKNSQELRISSPSDKRFRVLA
FT                   GLFYQRQTHDILQDYQIFGLADATSVNGRPGTIWLTKQFRVDKDYAAFGEASFDIVPDK
FT                   LTLTGGLRAFKYNNSLVGFFGFGDGYSSRTGVAACFTDANGNYVGTLLPGAPCNNLGVV
FT                   SGNNVLPKRVKGNGTTHRLNLTWKPTDDLMVYATWSRGFRPGGINRRGTIPPYSPDYLT
FT                   NYELGWKTTWLDGKLRINGALFWEEWKKFQFSFLGANSFTEIHNGPNARSKGIELDFTF
FT                   RPIEGLTLIGSGAYTDAKTRQNLCGIDDPTYSCAGAGNFISAPKGTRLPITSKWRYGGT
FT                   ARYDFDMGGKYQPYVQGTMTYASSASSDIRTLIFDPNGNPVNPAALTGKLRSYAIFDFS
FT                   AGAKFGRWTWEAYVENAFDKRAQKTRLVTCGQCFDRPYVFPNTPQTIGMRIGWKY"
FT   sig_peptide     583114..583194
FT                   /locus_tag="Swit_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.979 at
FT                   residue 27"
FT   gene            585537..586844
FT                   /locus_tag="Swit_0536"
FT   CDS_pept        585537..586844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0536"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66904"
FT                   /db_xref="GOA:A5V3N8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3N8"
FT                   /protein_id="ABQ66904.1"
FT                   /translation="MSDGPKVGGGTTAAARPLGLVMATALVVGNMIGSGVYMLPASLAP
FT                   YGWNVIPAWGITIAGSLAIAAVFAGLCRAHPKTGGPYVYVREAFGRDLAFYVAWAYWIS
FT                   LFVGNGAIAVAAISYLSAFMPVFATDARLSTAATITLVWTMTAINISGTRNAGWVQLIA
FT                   TVLKVIPLAAVVMIAAMAAPHGDLAFPDPHKPEIGLAAITTAGTLTLWAFLGLESATVP
FT                   AGKVHQPEKTIPRATLGGTALTGLIYLLACSAVVLLLAPEVAAHSAAPFAEVIGRYWGP
FT                   DAAHVVAAFAMISAIGALNGWVLLQGEMPAAMAAGGVFPAVLGKLSARGVPVRAHLLSS
FT                   SLVTILLLLNASRTTVSLFTFVAVLATTASLVMYVAVAAAAIKLRAVRPWIAVAAAIYA
FT                   LWALYGAGPVANLWGAVLILAGVPVWWIMRGQKLAS"
FT   gene            complement(586883..588484)
FT                   /locus_tag="Swit_0537"
FT   CDS_pept        complement(586883..588484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0537"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66905"
FT                   /db_xref="GOA:A5V3N9"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3N9"
FT                   /protein_id="ABQ66905.1"
FT                   /translation="MTTRQDVVIIGGGHNGLVCAFYLAVRGLKVRVLERRKVVGGAAVT
FT                   EEFHPGFRNSVASYTVSLLQPRVIADMKLHERGLRIVERPISNFLPLQDGGYLKLGGGL
FT                   ERTQAEFRRFSARDAETLPAYYDALDGVADVLRDLALRIPPNAGGGIAELFKAASQGRR
FT                   IAMAGLPAQRDMLDLFVKSARTFLDGWFEHDAIKAAFGFDAVVGNYASPDTPGSAYVLL
FT                   HHVFGEVNGKKGAWGHAIGGMGAITQAMKAACEDYGVVIETDTAVEKVLVDNGRAVGVR
FT                   TGDGVEHMARAVASNVGPGLLYRKLVDQADLDADFKRRMKGFKAGSGTFRMNVALSELP
FT                   SFSALPGEGEHHRSGIIIAPTLDYMDRAFTDARAHGWSKQPIVEMLIPSTVDDSLAPKG
FT                   QHVASLFCQQFAPELPDGRSWDDEREAAADHIIATVDAHAPGFARSVLGRQILSPLDLE
FT                   RTFGLVGGDIMHGHMSLDQLWSARPILGHGDYRAPVKGLYMCGAGSHPGGGVTGAPGHN
FT                   AAQAILADRGLGRFFG"
FT   gene            complement(588481..589779)
FT                   /locus_tag="Swit_0538"
FT   CDS_pept        complement(588481..589779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0538"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66906"
FT                   /db_xref="GOA:A5V3P0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3P0"
FT                   /protein_id="ABQ66906.1"
FT                   /translation="MARLVVQRLSFALRARSGQSADSDVRGGGRVKECRTMTLRVVKEV
FT                   GSAIDPDANFGLPGWIYHDPEIFALEQERIFRRSWQLVCHLNDIPARGDWQSLEIGHEA
FT                   IIVVRGEDGEVRALSNTCRHRASRLVDGAEGCARKLICPYHAWTYELDGRLSGVPGKRD
FT                   YPAFDMADYGLHSFPVEVWRGFIFVNIEGEGPSVAEMMAPYEEEVAPYRFEEMKALGRV
FT                   VMRPRTVNWKNIADNYSDGLHIPVAHPGLKRLFGPGYGIEAKAWADKMWGPLLEGVPGS
FT                   SSEALYRKYLPQVAHLPADRQRLWIYFKLWPNTAFDIYPDQIDFMQFIPVSPTETMIRE
FT                   IAYVLPDERREMKAARYLNWRINRMVNAEDTKLVARVQDGMATQSYTQGPLGTGEVCLR
FT                   SFARKMRTLIPETRLPTRPPAGWSTKSVAGRLA"
FT   gene            589862..591493
FT                   /locus_tag="Swit_0539"
FT   CDS_pept        589862..591493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0539"
FT                   /product="phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66907"
FT                   /db_xref="GOA:A5V3P1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3P1"
FT                   /protein_id="ABQ66907.1"
FT                   /translation="MTIREVATTPFPDQKPGTSGLRKKVPVFQQPGYAENFIQSIFDSL
FT                   EGFAGRALVIGGDGRYHNRAVIQTAIRMAAANGFGTILVGRGGILSTPAASHLIRLHGA
FT                   FGGIILSASHNPGGPTEDFGIKYNIANGGPAPERNTDAIFARSRTIDRYRTLDTPDVDL
FT                   DRDGETRVGDAVVRIIDPVADYAALMEALFDFAAIRDLIGSGFRIAFDAMSAVTGPYAI
FT                   EILEHRLGAAKGTVRNGVPLPDFGGHHPDPNLVHARALYEEMMGLDAPDFGAASDGDGD
FT                   RNLIIGKGIFVTPSDSLAMLAANAHLAPGYARGLAGIARSMPTSGAADRVAEALGIPLF
FT                   ETPTGWKFFGNLLDAGQATICGEESAGTGSDHVREKDGLWAVLLWLNILAARREGVQAI
FT                   AAGHWARFGRNYYARHDYEDVDTAAADAVIADLRGRLANLPGTTIGALGIEAADDFAYH
FT                   DPVDGSQSHGQGIRILFEGGSRIVFRLSGTGTSGATIRVYIERYEPAGGNLGRATGDAI
FT                   ADLVVAAETIAGIARHTGRTAPDVIT"
FT   gene            591692..593791
FT                   /locus_tag="Swit_0540"
FT   CDS_pept        591692..593791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0540"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66908"
FT                   /db_xref="GOA:A5V3P2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3P2"
FT                   /protein_id="ABQ66908.1"
FT                   /translation="MSFKGRLSFSISMFALMASPAFADERDNDYHRPESADIIVTAPLQ
FT                   RDRMDVLAGTSVLTGAQLTTALRPTIGETIEHTPGVSATSFGPNASRPILRGLQGERVR
FT                   VLTDGIGSVDVSNTSVDHAVAINPLLAERIEVLRGPEALLYGSAAIGGVVNVIDKRIPR
FT                   AIPDEPVHVDAILTYGSAANERSGGAALDAPIGGGFVAHLDGSYQKTGNLRIGGYALSP
FT                   AARAQALASAQLPADPDEEIDFAANAAVKGKLPNSQSETWVAGGGLSYIDGDSHYGIAY
FT                   SHYDSRYGVPIRFATEPGQEQEAPRIDLVQNRFDARAEIAAGGSVIQTIRARLAYAKYR
FT                   HFELEEDGSVGTAFYNNGFEGRVELVQADHGAWHGATGAQFFIRDFNVVGDEAFLPRNQ
FT                   TQQIGLFTLQQLDYGVVKLEGGLRYEKSWLSANPFEDQPQFPKGSRNFDTLSGSIGASY
FT                   RVTDDWRLGVNLSRTERAPAAEELFANGPHAGTEAFEIGSPDFKTERSWGLEGVLHGKG
FT                   PGFTIHASIYHNWFDNFIYDSPDGTLEDGLPVFRYAQAKARFYGAELEATADLAQLGGF
FT                   AIKADALGDFVHAKITGFGPAPRIPPLRLLGGLSAESARVDGRVEVEWTDKAQRLASFE
FT                   TPTAGYTLVNASLTLRPFADRPETSIVLAAHNIFDVNARRHASYLKDFAPLAGRDFRVT
FT                   ARVGF"
FT   sig_peptide     591692..591763
FT                   /locus_tag="Swit_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            593845..595392
FT                   /locus_tag="Swit_0541"
FT   CDS_pept        593845..595392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0541"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: Alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66909"
FT                   /db_xref="GOA:A5V3P3"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3P3"
FT                   /protein_id="ABQ66909.1"
FT                   /translation="MFSRRQILAGAGVGLVAAPAILRAQQLLTAFPFRLGIASGDPSHD
FT                   GFVIWTRLCPDPVDEHGGMPMGPVDVDWFVYEDVGMKRVAQKGSATAWPELGHSIHVEL
FT                   AGLQPDRPYWYRFVLGRDKTQLGRTRTLPAPGAAFDRLRFAAAGCQHYEDGLFTAYAHL
FT                   AREDVAFIWHYGDYIYEDRARQVNYERDGRARVHVRDHVGTECYTIGDYRRRYAQYKMD
FT                   PDLQAAHRVAPWFTTFDDHEVVDNWTSTVSPYQPDPALFAIRRAAAMQAYYEHMPLRRA
FT                   SMPSNGAMQLYRRSRIGDLLTTHFLDTRQYRSPLPCKGGFEPTCPAVADPKQTVLGGAQ
FT                   QQWLERGLSDGGSRWNLVAQQVMMMPLDRQSEPGGGEIRNLDSWAGYDAARERMAARFA
FT                   GRGDVIVMTGDEHQNFAGELRRQGGKGEVAAPEFVVTSISSGGDGWVRPEVQAQLRAHN
FT                   PALQYVSDQRGYAVCEVTRDLWQTRFRGVDQVTTPGGAIATLATASVERGKPAINLS"
FT   sig_peptide     593845..593919
FT                   /locus_tag="Swit_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.986 at
FT                   residue 25"
FT   gene            complement(595563..597623)
FT                   /locus_tag="Swit_0542"
FT   CDS_pept        complement(595563..597623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0542"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66910"
FT                   /db_xref="GOA:A5V3P4"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3P4"
FT                   /protein_id="ABQ66910.1"
FT                   /translation="MTSIGRLIPLFVALLLAVAGAGAAPAAHIRAVLEAETLRPAAGSR
FT                   ITLALGMTPERDWHGYWLNPGDAGAPADIAWTLPRGATVGPLRYPVPQRLIVQGLMNYV
FT                   YERPYALLMTLTVPKGLAPGTPLRIAGKARWLACSPTICVPEQGPVAIDLTVGDGAVTA
FT                   ASRARFDAWRAKLPMPLGQTASFEAKPGKLRLAIPFPKGRPVTAPYFYPATDGVADYAA
FT                   PQAISRRGDRLIVEIKAARNPQPVQAIEGLIAIGPDRGLMVTARPGPVPAAGVPIAGAG
FT                   DEAGEGGGWRTFLLALGGALLGGLLLNAMPCVFPILSLKALSLARSGETDRHARVEALA
FT                   YTAGIVLSCVALGLLLLGLRAGGAAAGWGFQLQDPRMVFVLLLLVTAISLNLAGLFELR
FT                   VVGIGEAMTKGRGALPAFWTGVLAALVATPCSGPFMAGAVGAALLLPPAAALAVFAGLG
FT                   LGLALPFLLVGFVPALRRLLPKPGAWMDRLRRILSVPMFLTALGLAWVLGQQAGVDRLV
FT                   QGVGAALLLGLALWWVGARQAQGKRYSWIPVAPVLAAALALLLVTPSGGSPAAAAPAGE
FT                   AGAEPFSEARLAALQAQKKPVFLYFTADWCLTCKVNEKAAIERPAVREAFDRAGVVVMV
FT                   GDWTNGDPAIGRFLEAQGRSGVPLYLFYDKDGRQETLPQLLTPATLTALAA"
FT   sig_peptide     complement(597552..597623)
FT                   /locus_tag="Swit_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.936 at
FT                   residue 24"
FT   gene            complement(597665..598369)
FT                   /locus_tag="Swit_0543"
FT   CDS_pept        complement(597665..598369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66911"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3P5"
FT                   /protein_id="ABQ66911.1"
FT                   /translation="MRTILLFLLVVAAAVVAIPFIPLKTAIGLMQLDRVGFEAAQVEGN
FT                   LWEGQLYDARLAKIQLGDVTSRMSLADAAKGRIRLDVEGTDEVSRLKGVFSYGLGGAGI
FT                   DDFSVGMPVVAGPQPIGNVTLIVDALKARFPGGDCEDGSGQVRAYLSGALPMVGLPGEM
FT                   SGPALCRDGKLTFDMASPSGREQEQVTILSPTKFKVRLFIKPTAPRVEQILQSHGFQRA
FT                   DDGYAYEEERSI"
FT   sig_peptide     complement(598316..598369)
FT                   /locus_tag="Swit_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.715 at
FT                   residue 18"
FT   gene            complement(598407..598793)
FT                   /locus_tag="Swit_0544"
FT   CDS_pept        complement(598407..598793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0544"
FT                   /product="protein of unknown function DUF983"
FT                   /note="PFAM: protein of unknown function DUF983"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66912"
FT                   /db_xref="GOA:A5V3P6"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3P6"
FT                   /protein_id="ABQ66912.1"
FT                   /translation="MNQPSSFGERDLRSALLRGLRGECPACGDAKLFGRFLKPVPHCPS
FT                   CGQDWTVHSADDMPAYLVVLILGHVLVPILVAVNMRYDLPMWLDMTLWPGLAVILALLM
FT                   IQPAKGVVIGFQWARRMHGFARGR"
FT   gene            598899..598972
FT                   /locus_tag="Swit_R0010"
FT                   /note="tRNA-Gly1"
FT   tRNA            598899..598972
FT                   /locus_tag="Swit_R0010"
FT                   /product="tRNA-Gly"
FT   gene            complement(599226..599405)
FT                   /locus_tag="Swit_0545"
FT   CDS_pept        complement(599226..599405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66913"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3P7"
FT                   /protein_id="ABQ66913.1"
FT                   /translation="MGEYTDKAKGAVNEAIGKAKQSIGKEANKPGLVAKGIAQEAKGAA
FT                   QKLKGAAEGVAKKL"
FT   gene            599628..601748
FT                   /locus_tag="Swit_0546"
FT   CDS_pept        599628..601748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66914"
FT                   /db_xref="GOA:A5V3P8"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3P8"
FT                   /protein_id="ABQ66914.1"
FT                   /translation="MRRPVSELDQFLIGLLITNDAQAVAGIDGFLPLRFGSLGFPRPVG
FT                   FIAHPLHAAPQQGHRDEGKQHRPKDENGFHPSIHRPLPKIPAISSARYSQADKPLGPIR
FT                   CENRDASDQIRAHVFREAGRGRYEPVMALNIIGRAFGWLGRRLLLYALLVCAIGFATFA
FT                   LPWIKREIEGDRQAQQRYEALDLSRRQLDREIATARDAIGTSVAATRQQGVAALDTRIA
FT                   LAEREKAALEQVGRNAPSTFVLALQGRDALLAAKRRELRVLMLDREIGALRAARSLALA
FT                   DRASIAAATDLQAQRAAAQAAIHGCDGAREDLAAFEQRWRWRVRSWLDNDEHRALAART
FT                   ATACAEARRQVGRHNLLAATSREAALARTRAEALLAGSETEAGARLDAWQERFAADVDR
FT                   ARTEWAGNWSERARLWADRLGLRPILIAAAWALLAILLTPYAIRLAFFFLLAPMAMRRA
FT                   AIRLSVPGGGGTAIPLPGPSTTSVAIRLDRGEELLVRQDYLQSTSHGGAKATRWLLDYR
FT                   HPLSSMVSGLAFLTRIRGDGETTTISAVRDPFAETVILSLPEGAACVLQPRALAAVAQP
FT                   IGRPLRISSHWRLFSLNAWLTLQLRYLVFHGPARLALKGGRGVRVERAEQGRVFGQDQL
FT                   VGFSADLAYSVARTETFWPYFLGREQLFKDRVEAGDGLLIVEEAPMAGRGRGEARHGLE
FT                   GTADAMLKLVGL"
FT   gene            601940..602578
FT                   /locus_tag="Swit_0547"
FT   CDS_pept        601940..602578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0547"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /note="PFAM: HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66915"
FT                   /db_xref="GOA:A5V3P9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3P9"
FT                   /protein_id="ABQ66915.1"
FT                   /translation="MDDPRYAESMDFLKSVGPDWARLIERVGPCRHDPKAAREPYEALV
FT                   RSIAYQQLTARAGDAIIDRLKTRLGGHGFPSPKQLADADPDALRACGFSAAKAATIQAI
FT                   AGAALSGFVPGRDAAAAMEDEALIDRLTAIRGIGRWTVEMLLIYSLERLDVLPADDFGA
FT                   REGYRLLKALPAPPTARALRGIASAWAPHRTVATWYLWRIPRDRAPAGT"
FT   gene            602585..603202
FT                   /locus_tag="Swit_0548"
FT   CDS_pept        602585..603202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66916"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3Q0"
FT                   /protein_id="ABQ66916.1"
FT                   /translation="MPLQNRVTPFGDIVAIDQRGLFTGNRGILHDPATRTLGKRRWTSK
FT                   AWLICTCDYRDRRRAVMGGRSWTELFFLDEAVALAAGHRPCFLCRRPAALRFREAWAAG
FT                   QELPQPSAGAMDAVLHAERIGRRAHPAPGRPIDLPDGTMVANAGAAFLLHGGLARRWTD
FT                   RGYGPPEPLPRAERLLTPPSTVAALRAGYRVAVHPSVETGHA"
FT   gene            603195..603839
FT                   /locus_tag="Swit_0549"
FT   CDS_pept        603195..603839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0549"
FT                   /product="DNA-N1-methyladenine dioxygenase"
FT                   /EC_number="1.14.11.-"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66917"
FT                   /db_xref="GOA:A5V3Q1"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3Q1"
FT                   /protein_id="ABQ66917.1"
FT                   /translation="MRDLFDGEAEPPVVTMAAGAVLLRGFARPYEAELLAALRDVLAIS
FT                   PFRHMTTPGGHVMSVAMTNCGAAGWLTDRSGYRYDGIDPKTASPWPAMPDCFAALARAA
FT                   AEAAGHGGFQPDACLINRYIPGARLSLHQDRNERDVAHPIISVSLGLPATFLFGGARRY
FT                   DRPRRFALEHCDIAAWGGPSRLHFHGVAELKDGEHDMLGRQRINLTFRKAL"
FT   gene            604144..604905
FT                   /locus_tag="Swit_0550"
FT   CDS_pept        604144..604905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0550"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66918"
FT                   /db_xref="GOA:A5V3Q2"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3Q2"
FT                   /protein_id="ABQ66918.1"
FT                   /translation="MNDAASRLPASATLPAEVRAAEDRAAAYDWPAITGELDGFGCAIL
FT                   PSLLAADECRAIAALYPDESRFRSRVVMGRHGFGKGEYRYFNYPLPDPVGALRTAIYPR
FT                   LAGLANRWNERMGIGERYPVDHASYLARCREAGQTRPTPLLLQYGPDDYNCLHQDLYGD
FT                   LVFPIQVAILLSEPGEDFTGGEFVLTEQRPRMQSRAEVVPLRQGDALAFAVHHRPVQGT
FT                   RGVYRVNMRHGVSRLRSGRRHCLGIIFHDAP"
FT   gene            604919..605428
FT                   /locus_tag="Swit_0551"
FT   CDS_pept        604919..605428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0551"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA--protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase, DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66919"
FT                   /db_xref="GOA:A5V3Q3"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3Q3"
FT                   /protein_id="ABQ66919.1"
FT                   /translation="MQEMIRFAWGTSYLGDVMVAVSDRGIVAIEFGDQRPAVEQVLRAR
FT                   FPEAVVHERPDELAPIAAKAVRAIEEPGYDPGLPLDLRGTPYEVMVWTMLRDIPSGETT
FT                   SYGALAARLGTRDARDVTAAIANNAVAVLVPCHRVIRKDGSISGYRWGFRRKRSLLARE
FT                   RKAIDR"
FT   gene            complement(605479..605555)
FT                   /locus_tag="Swit_R0011"
FT                   /note="tRNA-Arg2"
FT   tRNA            complement(605479..605555)
FT                   /locus_tag="Swit_R0011"
FT                   /product="tRNA-Arg"
FT   gene            complement(605642..606406)
FT                   /locus_tag="Swit_0552"
FT   CDS_pept        complement(605642..606406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0552"
FT                   /product="PEP phosphonomutase and related enzyme-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66920"
FT                   /db_xref="GOA:A5V3Q4"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3Q4"
FT                   /protein_id="ABQ66920.1"
FT                   /translation="MSIADRFALFSKLHVAGDPLRLVNVWDAGSARAVAEAGAPALATS
FT                   SWAVAAAAGYPDGEALPFDALLATASAILRATDLPVSVDFEGGYADAPDEVQGHARTLL
FT                   GLGLVGCNFEDRKVRGEGLHGVEDQAARLRAIVAAAAGLDRPIFINARTDLFLGTDPAT
FT                   HAGRVDEALVRAEAYAAAGAGSFFVPGLGDPALIARICGASPLPVNVMVLDPTADLAAL
FT                   ARLGVARISFGPAPYVAAMQSLAALAGQLLGH"
FT   gene            complement(606511..607683)
FT                   /locus_tag="Swit_0553"
FT   CDS_pept        complement(606511..607683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0553"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66921"
FT                   /db_xref="GOA:A5V3Q5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3Q5"
FT                   /protein_id="ABQ66921.1"
FT                   /translation="MKFNPPLLALAAGAFGIGVTEFAPMGLLPVIARDLDVSIPAAGLL
FT                   ISAYALGVLLGAPLMTLTTGRVPRRTLLILLAAIFTVGNLLAAVSNGYGMLLVARLITS
FT                   LNHGAFFGVGSVVAASLVPAERRAGAVAAMFMGLTIATVVGVPLATWAGDQLGWRASFW
FT                   GIAGLGLLIMAALRLTLPAMPAPSGGDALAELRVLRRGPVLAALGLTVIASSAMFTVFT
FT                   YIAPILREETHASLGFVTAMLLTYGVGMTVGNWIGGRFADRSVDRTLIVTLASLVAVLA
FT                   ALALLMPYAVPTAILVFLWGAVNFALVPPLQIRVMSAAAEAPNLASAVNIGAFNLGNAI
FT                   GAALGGAVIAGGLGYPAVALAGAAVSALGLLAILLGRSGEGAPALAEARR"
FT   sig_peptide     complement(607585..607683)
FT                   /locus_tag="Swit_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.829) with cleavage site probability 0.539 at
FT                   residue 33"
FT   gene            607807..608712
FT                   /locus_tag="Swit_0554"
FT   CDS_pept        607807..608712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0554"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66922"
FT                   /db_xref="GOA:A5V3Q6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3Q6"
FT                   /protein_id="ABQ66922.1"
FT                   /translation="MDAKIGGDTDRARALELFAAVAAEGSFSAAGRKLGLTPSAVSRAI
FT                   DRIEARLGVRLLLRTTRALTLTVEGQAYLGAARRILADLDDAEQAIADQGAPRGRLRVS
FT                   VSLAHGRQCVVPLLGDFVRLHPHILVDVGLTDRVVDVAGGQADVAIRFGPLADSALTAR
FT                   KLGETRRVIVASPDYLARHGTPSVPEDLHDHVCLNFNFRRVEPVWPFRKDGRDYALGVR
FT                   GSIEANNGETLAQLATAGVGITRVGAFSVVERIAAGRLVPILEEYNPGDVEAIHAVFVG
FT                   GANTPARVRVFVDFLAERLR"
FT   gene            608771..609181
FT                   /locus_tag="Swit_0555"
FT   CDS_pept        608771..609181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0555"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66923"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3Q7"
FT                   /protein_id="ABQ66923.1"
FT                   /translation="MKMIPGLAALALASVPVAAGAARADQSFGTWRNPQNSVHVRAEPC
FT                   GQRMCGVVVWANDKARADAARGGTDKLVGATLFKDFRLQKPGLWRGKVFVPDIGKTFSG
FT                   TIEVVDETHLKGSGCLVGRIGCKSQSWTRIAE"
FT   sig_peptide     608771..608845
FT                   /locus_tag="Swit_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.727 at
FT                   residue 25"
FT   gene            complement(609187..609657)
FT                   /locus_tag="Swit_0556"
FT   CDS_pept        complement(609187..609657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0556"
FT                   /product="protein of unknown function DUF1178"
FT                   /note="PFAM: protein of unknown function DUF1178"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66924"
FT                   /db_xref="InterPro:IPR009562"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3Q8"
FT                   /protein_id="ABQ66924.1"
FT                   /translation="MIVFDLACNNAGHVFEIWFGSSADYEDQKARGLVMCPYCGSTDVD
FT                   KAVMAPNVAAKGNQRSEPSATAPVPAAANVPSPEAFKAMVGKLAEVQARMLEGSDYVGS
FT                   RFADEARSMHLGEQESRPIHGQTSPEEAKALIDEGVPVAPLLLPVRPPKSEN"
FT   gene            complement(609654..610481)
FT                   /locus_tag="Swit_0557"
FT   CDS_pept        complement(609654..610481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0557"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66925"
FT                   /db_xref="GOA:A5V3Q9"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3Q9"
FT                   /protein_id="ABQ66925.1"
FT                   /translation="MRVAVLQSRTGIDPAANAAILVDAVAQAKAGGADMLFTPEMSGLL
FT                   DQDRARAAGHLRDEGGDPVLAAVRAAAAEQGIWVDLGSLALTGGADGRLVNRGFVIDDT
FT                   GAIRARYDKIHLFDVDLPTGESWRESRAYAPGERSVIATTPWARIGLSICYDMRFPDLY
FT                   RALSNAGAEILSVPAAFTVPTGRAHWHVLLRARAIEAGAFVVAAAQCGEHEDGRATYGH
FT                   SLVVDPWGEVLLDMGEGQGVGFADLDMARLADIRLRVPALKNRRPIGAVEVSA"
FT   gene            complement(610485..610751)
FT                   /locus_tag="Swit_0558"
FT   CDS_pept        complement(610485..610751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0558"
FT                   /product="glutaredoxin 3"
FT                   /note="TIGRFAM: glutaredoxin 3; PFAM: glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66926"
FT                   /db_xref="GOA:A5V3R0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3R0"
FT                   /protein_id="ABQ66926.1"
FT                   /translation="MDRMPKVEIYTKAFCPYCSRAKALLETKGVGFEEYDISMGGPKRA
FT                   EMIERARGGSTVPQIFIDDRHIGGCDDMFALDRQGKLDPLLAA"
FT   gene            complement(610792..611538)
FT                   /locus_tag="Swit_0559"
FT   CDS_pept        complement(610792..611538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0559"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66927"
FT                   /db_xref="GOA:A5V3R1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3R1"
FT                   /protein_id="ABQ66927.1"
FT                   /translation="MRLLVGGLRGIAGAGLRFALPPRCPGCGVITPDMHQFCLDCWSAL
FT                   DFLGDPQCARCGAPFEVDPGPGALCGGCHADPPAFDSMRAAVAYGPIARALALKLKYGR
FT                   RPGIAHTVAAQLRRHLPEGELRLVVPVPLHRWRIWTRGYNQSALMARAVVRGTGHLLAL
FT                   DALVRTRATPSLRGLGPDQRAKAVRGAFAVRDRGAVKGRAVLLVDDVYTTGATADACAR
FT                   ALRRAGASRVDLICWARVVRDEDVAR"
FT   gene            611551..612468
FT                   /locus_tag="Swit_0560"
FT   CDS_pept        611551..612468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0560"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66928"
FT                   /db_xref="GOA:A5V3R2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3R2"
FT                   /protein_id="ABQ66928.1"
FT                   /translation="MTPPMPSCHASAPAAQARAMDQPAIFDRSLRRLRRDRAAARFADH
FT                   AFLIDHMADELAERLAMVTRDFGRALILGCHDGRIARRFAAPGRRIVNADPGFAFARAT
FT                   GGVQCDEDRLPFADASFDLVVAVGTLDTVNDLPGALTLIRRVLRPDGLFLGAFAGAGSL
FT                   AWLKRATLAADSATHGGAAARIHPQVDVRAAGDLLSRAGFALQVADGERLDVGYGDPIR
FT                   LIHDLRGMAATNILAQRARTAPGRAWLAELFGRFQAEAGPDGRLRESFDLVYLSGWSPS
FT                   PDQPKPAKRGSATASMIEALRPKG"
FT   gene            612800..614341
FT                   /locus_tag="Swit_0561"
FT   CDS_pept        612800..614341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0561"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66929"
FT                   /db_xref="GOA:A5V3R3"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3R3"
FT                   /protein_id="ABQ66929.1"
FT                   /translation="MTKTIRIFDTTLRDGEQSPGCSMNLEEKLQVAAQLETLGVDIIEA
FT                   GFAIASPGDFEAVSEVARQCKTATVASLARAAAADIDRAWEAVQHAVAPRIHTFIATSP
FT                   LHMRVKLNKSPDEVLEAIDRTVRHARNICPDVEWSAEDATRTEPDFLARAIETAIAAGA
FT                   RTINLPDTVGYATPQTYGAMFRDMIERVPNADLAVFSTHCHNDLGLAVANTLAAIMNGA
FT                   GQVESTINGIGERAGNAAIEEIAMALKVRQDVMPYATNVVSTEITRASRLISGITGFQV
FT                   QPNKAIVGANAFAHESGIHQDGMIKDSSTYEIMTPESVGLTHSSLVMGKHSGRAAFRQK
FT                   LEELGYALGDNAFQDAFGRFKALADAKKAVYDEDIVALVDDEVLRGHDSIQVKEVEVYC
FT                   GSNGPQRAILTLEVDGEEKTVTARGNGPVDALFNAIRMIVPHDSSVLERYEVHAVTGGT
FT                   DAQAEVSVLLSENGRTTRGRGAHQDTMVASVRAYVNALNKMMVKRGRAPVDAQAG"
FT   gene            614480..615466
FT                   /locus_tag="Swit_0562"
FT   CDS_pept        614480..615466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0562"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66930"
FT                   /db_xref="GOA:A5V3R4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3R4"
FT                   /protein_id="ABQ66930.1"
FT                   /translation="MSQATAHTARWRLIGFLLSAVGSMLFAIKGVLIKLIYVYQIDTTA
FT                   LLAVRMMLSLPVFFGVGLLEWRRRPAAQRPDARSVGLAALVGILGYHVSSWLDFAGLQS
FT                   VEAQAERLILFTYPFLVILFGRLIFGHRLRFHALAGAGLSYAGLLVMFGSDPARLTPAM
FT                   IGGAGMILAAAGTFALYQLFARELILRCGPALFTAIAMSAAGLSVIAHFALTHGIALPS
FT                   APPRAWALMIGLAVFSTIVPTFMMSAGTARIGAQGTAIISTISPVVTIALAIVVLGEPF
FT                   GIGEAAGTLLVIGGVGLFTWIESRPGRRRSKSVMPAEAGISGEGRRG"
FT   gene            complement(615519..616274)
FT                   /locus_tag="Swit_0563"
FT   CDS_pept        complement(615519..616274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0563"
FT                   /product="oxidoreductase, molybdopterin binding"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66931"
FT                   /db_xref="GOA:A5V3R5"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3R5"
FT                   /protein_id="ABQ66931.1"
FT                   /translation="MISRRKLIGSLAAGAGGLILSGCNRINADPRVRSVLQSAEGLTMR
FT                   AQRLITDRTALAREFGAADLSPLFRSNGTRKPVGTAYETHLRAGFADWRLVVDGLVARP
FT                   LSLSMAQLRALPRRTQITRHDCVEGWSAIGQWTGAPLKLLLDMAGLRTSARYLIFHCAD
FT                   RYAQGDYYESIDLIDAFHPQTILAWGLNGQPLPVGNGAPLRLRVERQLGYKHAKYVQRI
FT                   EAVESLSAHGRGKGGYWEDYYDYAWYAGI"
FT   sig_peptide     complement(616188..616274)
FT                   /locus_tag="Swit_0563"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.903 at
FT                   residue 29"
FT   gene            complement(616271..617113)
FT                   /locus_tag="Swit_0564"
FT   CDS_pept        complement(616271..617113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0564"
FT                   /product="Thiosulfate reductase cytochrome B subunit
FT                   (membrane anchoring protein)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66932"
FT                   /db_xref="GOA:A5V3R6"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3R6"
FT                   /protein_id="ABQ66932.1"
FT                   /translation="MTDEAQESGVAPHGGDLVRRHRVSTRLWHWINAVTIFTMLMSGLM
FT                   IFNAHPRLYWGQYGANSDRAWLQIGSSGGRGVLVVGGEAYDTTGVLGVWKDRDGIERRR
FT                   AFPWWATIPSSYSLADARIWHFFFAWVLVLSAAAYLVASLLNRHLQRDLLPRGAELRPG
FT                   HVWRDVRDHLRLRFPRGAAAARYGILQKLAYVGVILGLIPLLILTGLTMSPGVNAAWPW
FT                   LLDLFGGRQSARSIHFLCAAAMLVFILVHLLMVLLSGPFNQLRAMITGAYRLPREKDR"
FT   gene            617245..617565
FT                   /locus_tag="Swit_0565"
FT   CDS_pept        617245..617565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0565"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66933"
FT                   /db_xref="GOA:A5V3R7"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3R7"
FT                   /protein_id="ABQ66933.1"
FT                   /translation="MAVASEQEESDARRHGRHRIMLAATLYSVHGECNGVLLDLSQGGA
FT                   MVSASPPLPVGCRLLLERQNFEVPGVVRWVEGNRFGIQFEEPLAEAVIMGLVSRSAHQN
FT                   DR"
FT   gene            complement(617590..618618)
FT                   /locus_tag="Swit_0566"
FT   CDS_pept        complement(617590..618618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0566"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66934"
FT                   /db_xref="GOA:A5V3R8"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3R8"
FT                   /protein_id="ABQ66934.1"
FT                   /translation="MSEMSTRAREVFRVVVESYLGSGQPIGSRTISKLAGLNLSPASIR
FT                   NVMQDLEELGLLEAPHTSAGRMPTQSGLRLFVDGMMQTAEPSIEERAAIEARAARGSPV
FT                   EEALAQTSAVLSGLSACAGIVLVPPHEMVLRQFSFVPLSRQQAVAVLVGHDGSVENRVV
FT                   DLPPGLPPSALVEAGNFISERLGGLTLAEARARIEAELGRERAALDAAAASLVQQGLAV
FT                   WSEDGSARPVLIVRGQANLIDPSAAADLERVRQLLDEIEGKEEIARLLDSARSGQGMKI
FT                   FIGSENKLFSLSGSSVIAAPYRGGDGRVVGVVGVIGPTRLNYARIVPMVDFTAQALTRM
FT                   MA"
FT   gene            618733..619449
FT                   /locus_tag="Swit_0567"
FT   CDS_pept        618733..619449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0567"
FT                   /product="RNAse PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="TIGRFAM: ribonuclease PH; PFAM: 3' exoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66935"
FT                   /db_xref="GOA:A5V3R9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3R9"
FT                   /protein_id="ABQ66935.1"
FT                   /translation="MRPSGRAPDQMRAISIETGFTVHAEGSVLISFGDTRVLVTASVEE
FT                   KVPPFLRGKGQGWVTAEYGMLPRATHTRGSREAAKGKQSGRTQEIQRLIGRSLRAVVDM
FT                   AKLGERQIVIDCDVLQADGGTRTASISGGWVALRLAVDKLLASGAIAEDPITAQVAAIS
FT                   CGIHEGTPVLDLDYIEDSNAHADANFVLLDNGNIAEAQATAEGATYDEEALLRLLRLAR
FT                   IGCGEIFAAQRKATGR"
FT   gene            619446..620075
FT                   /locus_tag="Swit_0568"
FT   CDS_pept        619446..620075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0568"
FT                   /product="Ham1 family protein"
FT                   /note="PFAM: Ham1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66936"
FT                   /db_xref="GOA:A5V3S0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3S0"
FT                   /protein_id="ABQ66936.1"
FT                   /translation="MSDDGLLHRKLAPGKLVIASHNKGKLREIAELLAPHGIETVSAGA
FT                   LGVPEPEETGTSFVANAELKARFSADLTGLPALADDSGLCVEALGGEPGIFSARWAELD
FT                   DGSRDFAEGMRRVHARMVEAGDEAGHDAHFICALSIAWPDGHVETFEGRVDGLITWPPR
FT                   GDKGFGYDPIFQPLGHAASFGEMDPEAKHAMSHRADAFAKLVAAVF"
FT   gene            620169..621362
FT                   /locus_tag="Swit_0569"
FT   CDS_pept        620169..621362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0569"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="TIGRFAM: putative oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66937"
FT                   /db_xref="GOA:A5V3S1"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3S1"
FT                   /protein_id="ABQ66937.1"
FT                   /translation="MEGSLPLATHPPAPSLEREGGLALYIHWPFCVSKCPYCDFNSHVR
FT                   ESVDQQAWRDALLRDLAHEAAALPGRRLGSIFFGGGTPSLMPPATVAALIDAATRHWPA
FT                   ADDIEITLEANPSSVEAARFADLARAGINRVSLGLQALDDAVLGWLGRAHGVTEGLAAL
FT                   DTAQTSFGRVSFDLIYARPGQTPEAWAAELGRALSFGTEHLSLYQLTIEPGTQFATRVA
FT                   KGEFVPLDPDAGAELFEQTRAATAAAGLPAYEISNHARPGAESRHNLTYWRYGNYAGIG
FT                   PGAHGRRDGRATVRRKKPENWLARVEANGHGIEREDDLPSEARAQEALLMGLRLAEGVD
FT                   LARIAAMSGLPVGRLVDAIAIDRLARQGLLARDGDRLTVSDAGMLLLDAILAEIVTA"
FT   gene            complement(621807..622991)
FT                   /locus_tag="Swit_0570"
FT   CDS_pept        complement(621807..622991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0570"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66938"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3S2"
FT                   /protein_id="ABQ66938.1"
FT                   /translation="MAEAPTYRQPLHSMARWSLLGLTALLASCAGMVPKGRPGPATPPP
FT                   ATEAPVESGFPGDKARHRVALLVPLSGPNAAVGQSIANAATMALIDTGNKSVRMTTYDT
FT                   AAGAAAAANRAVADGNRLFLGPLLSEDAAAVAPAARKAGIPVVSYSNDAAVAGNGVFVM
FT                   GFSPTQSIDRVVHFARSKGIKRFAALVPVGVYGRNASTAVIRSVENADANLVAMKSYER
FT                   NSKSLQKAIADLGRSQAYEGVLIADNARLAISAVPLIRKISSQQARVLGTELWAAEPSA
FT                   LTAPALNGAWYASVSDSRYRQLAASYRRQFGKAPFRLASLGYDSMLLVVKIARDWKVGE
FT                   RFPADRLRDEDGFVGVDGAFRFGPTGVAQRALEVGEATPSGVKTVSPAPSSFKE"
FT   gene            623004..623885
FT                   /locus_tag="Swit_0571"
FT   CDS_pept        623004..623885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0571"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66939"
FT                   /db_xref="GOA:A5V3S3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3S3"
FT                   /protein_id="ABQ66939.1"
FT                   /translation="MNQITEPGATDAQASEAPLPPGLYIVATPIGNLGDLSPRAASVLT
FT                   RAETIAVEDSRVTAKLLQRLGVKRPMTPYHDHNADKVRPGLIARMATQAVALVSDAGTP
FT                   LISDPGYKLVRDARAAGITVTTLPGPCAAIAALTLAGLPTDRFFFLGFLPAKDKARAEA
FT                   IAEVADVRATLILYEAGPRLGATLQALADGLGDREAAVVREISKTFEESVLGPLSDLAE
FT                   RYRESGPKGEIVIVVGPPGPRAAASPEDADALLRAALAHLPAAKAAGEVARATGLNRRE
FT                   LYARAMAIKDGD"
FT   gene            623882..624238
FT                   /locus_tag="Swit_0572"
FT   CDS_pept        623882..624238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0572"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66940"
FT                   /db_xref="GOA:A5V3S4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3S4"
FT                   /protein_id="ABQ66940.1"
FT                   /translation="MNRRAAAERQGRTGERIAAWWLRLHGWRIVGSRVKTRRGEVDLIA
FT                   RRGRTLAFVEVKTRGDAAGLATAIDEYRLRRVAAAAEALLPRYGVGVENVRIDVMLVRP
FT                   WRRPVHLTNVWHGQ"
FT   gene            624338..625285
FT                   /locus_tag="Swit_0573"
FT   CDS_pept        624338..625285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0573"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutathione synthetase; PFAM: glutathione
FT                   synthetase domain protein; glutathione synthetase,
FT                   ATP-binding; RimK domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66941"
FT                   /db_xref="GOA:A5V3S5"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3S5"
FT                   /protein_id="ABQ66941.1"
FT                   /translation="MSLRVAVQMDPLETINIAGDSTFAIMLDALRRGHRLWHYQAGDLC
FT                   YRDGRVTAPARPIQKLQRVAGDHFAVGDPVVIDLADDVDVVLMRQDPPFDLAYITATHL
FT                   LERVQHATLVVNDPASVRNAPEKLFVLDYAEFMPPTMITRRLDDARAFHAEHGEVVVKP
FT                   LYGNAGSAVFHVGRNDANLAALTELFGQVWREPFMVQAFLPDVSKGDKRIVLIDGKVAG
FT                   AINRLPKEGEIRSNLAAGGRADATELSPREVEICDKLGPDLAARGLLFVGIDVIAGHLT
FT                   EINVTSPTGIVAIDRFNGTDTPAMIWDAIEAKLR"
FT   gene            625290..625889
FT                   /locus_tag="Swit_0574"
FT   CDS_pept        625290..625889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0574"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66942"
FT                   /db_xref="GOA:A5V3S6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3S6"
FT                   /protein_id="ABQ66942.1"
FT                   /translation="MTGWVQQLIADGGYLGLFLLMFGETVFPPIPSEVIMSMAGLQAAK
FT                   GTMLLPAAILAGTAGAMLGNIVWYLAARRLGLDRLRPLIERHGRWLTMDWAEVDRGERW
FT                   FMRHGHLFVCIGRMLPTARSLVSVPAGLMRMRFLPFLLWSSVGTLGWSTMLAVGGWVLG
FT                   TRFAAMEAWLGVASTVLLAVLGGFYIWRVLTWKPSR"
FT   gene            complement(625896..626360)
FT                   /locus_tag="Swit_0575"
FT   CDS_pept        complement(625896..626360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0575"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66943"
FT                   /db_xref="InterPro:IPR010848"
FT                   /db_xref="InterPro:IPR038301"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3S7"
FT                   /protein_id="ABQ66943.1"
FT                   /translation="MGEGPKEIRLRGRLVNSLYTEAMLLADEARGYFEHRGRDDREALD
FT                   PLARVTLSCESLKVTSRLMHVLAWLLTERAIELGQMSDEEAAAAARRLGDATPSDAIST
FT                   AGLPPAAIALIDASQDLYARVRRLEVEPPVDVAPAASPALSLLDRLEKAF"
FT   gene            complement(626409..626813)
FT                   /locus_tag="Swit_0576"
FT   CDS_pept        complement(626409..626813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0576"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; Transcription
FT                   regulator MerR, DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66944"
FT                   /db_xref="GOA:A5V3S8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3S8"
FT                   /protein_id="ABQ66944.1"
FT                   /translation="MASDCAPIVDIASTDAQSFGIAELSKEFGITPRALRFYEEEGLIA
FT                   PIRDGATRVYSRRDRFRVAWILQGKAMGFGLDEIAELLDLYDVGDGGATQRTVTALRCR
FT                   AKADHLRRRMVELQTMIDHLGRFADRIEAG"
FT   gene            complement(626968..627342)
FT                   /locus_tag="Swit_0577"
FT   CDS_pept        complement(626968..627342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0577"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66945"
FT                   /db_xref="GOA:A5V3S9"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3S9"
FT                   /protein_id="ABQ66945.1"
FT                   /translation="MDQDREQGSALDPRYDAAGLVTAVVTDHRSGEVLMLAHMNAEALA
FT                   ATLESGEATFFSRSRGRLWKKGESSGNVMRVVEARIDCDQDAIWLRCEPAGPACHTGER
FT                   SCFYRRIDRDGPTLVRTIEV"
FT   gene            627486..628946
FT                   /locus_tag="Swit_0578"
FT   CDS_pept        627486..628946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0578"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase, class-II;
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66946"
FT                   /db_xref="GOA:A5V3T0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3T0"
FT                   /protein_id="ABQ66946.1"
FT                   /translation="MLTTHPFDDDKLREECGVFGIWGAETAAAMVALGLHALQHRGQEA
FT                   AGITSWDGHAFHTHRAMGHVAGNFDKDEVIRGLPGHVACGHVRYSTTGETALRNVQPLF
FT                   AELSSGGFAIAHNGNISNAMKLRRELVRGGSIFQSTSDTETIIHLVAMSKYRTLLDRFI
FT                   DALKQVEGAYSLICMTPEGMIACRDPLGIRPLVLGRVGDAYIFASETVALDVVGATFIR
FT                   QVEPGELVIVSEGGLRSIRPFADVRARPCIFEHVYFSRPDSIVDGSSVYSVRKRIGAQL
FT                   AIENGVDADLVVPVPDSGTPAAIGYAQQSGIPFELGIIRSHYVGRTFIQPGDQVRHLGV
FT                   KLKHNANRALIDGQRLVLIDDSIVRGTTSVKILQMLRDAGAREVHLRIASPPTRHSCFY
FT                   GVDTPERAKLLAAQMNVAEMAAYIGADSLAFLSIDGLYKALGDEGRVDRAPTFCDACFT
FT                   GDYPTHLTDHEELTPTDQLALHGERVVA"
FT   gene            628969..629679
FT                   /locus_tag="Swit_0579"
FT   CDS_pept        628969..629679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0579"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66947"
FT                   /db_xref="GOA:A5V3T1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3T1"
FT                   /protein_id="ABQ66947.1"
FT                   /translation="MDKPFSGKLALVTGASRGIGAATAEALGAAGAHVILTARTSGGLE
FT                   EVEERIHAAGGSATIAPLDLAENDSIARLAEAIGGRWQALDILVLNAAMLGTLAPVPAI
FT                   DAKEFARLLTLNIMAQQQLIAAFDPMLRASAAGRVIGLTSTVAQAPRAYWGAYGASKAA
FT                   LETLLLAYAEEVGKISPIRVAVVNPGATATAMRQKAYPGEDQTTLRSPANVGAALVELI
FT                   AQDFETGLRTRIEG"
FT   sig_peptide     628969..629043
FT                   /locus_tag="Swit_0579"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.863) with cleavage site probability 0.722 at
FT                   residue 25"
FT   gene            complement(629738..631018)
FT                   /locus_tag="Swit_0580"
FT   CDS_pept        complement(629738..631018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0580"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66948"
FT                   /db_xref="GOA:A5V3T2"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3T2"
FT                   /protein_id="ABQ66948.1"
FT                   /translation="MNAQPPVRGQHLLLADRRFATGSSWVARLLAPGFQRLLDRIDLGL
FT                   EEGAIEATLPDGSFRVLGGRKPGPVAIVELRNWNPLIRLVTTGSVGWYRSWADGEWTSP
FT                   DPVPIFDLFMRNRHPLGELGRAQGPLRFFNLIWHAFRRNSRTNARRNIAFHYDLGNDFY
FT                   ELWLDRTMSYSSALFAEPIDAAEPIERAQHRKITALLDRLDLKPGAKLLEIGCGWGGLA
FT                   EVAAADYGADVTGITLSVEQKAFADARLAAGGLSDHAHFEIRDYRDVPGQYDAVASVEM
FT                   VEAVGEKYWPTYMEAIARALKPGGRAAIQYIEIDDDIFESYRTDADFIQTYIFPGGMLI
FT                   SESRFRAAAEKAGLRWEASSRHRFGLHYAETLRRWRESFDGAIAEGRLPTGFDEAFVKL
FT                   WRFYLMYCEGGFAGGGIDVAQVTLVKA"
FT   gene            complement(631147..631620)
FT                   /locus_tag="Swit_0581"
FT   CDS_pept        complement(631147..631620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66949"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3T3"
FT                   /protein_id="ABQ66949.1"
FT                   /translation="MMRGTMSIALLLAAPAAAIAAPTTAKPAAAATAGGALAPTPGVPV
FT                   RRITLSPEGRAIAARIIGTPDPRLKEIQAEMTTIRQQKAQLIAGATVDVEKLEPLLRRE
FT                   EALQGEMRTRQNDRLLSLLRALPEADRVALLHSMANPARPDGAKAPAPATPGH"
FT   sig_peptide     complement(631558..631620)
FT                   /locus_tag="Swit_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.817 at
FT                   residue 21"
FT   gene            complement(631644..632264)
FT                   /locus_tag="Swit_0582"
FT   CDS_pept        complement(631644..632264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0582"
FT                   /product="GTP cyclohydrolase"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66950"
FT                   /db_xref="GOA:A5V3T4"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3T4"
FT                   /protein_id="ABQ66950.1"
FT                   /translation="MSILGDDDEALHGTPKGKIAVPEHVQEAIRTLIRWSGDNPDREGL
FT                   LDTPSRVGRAWKEYCQGYDEDPSVHLSRTFEEVGGYDEIVLLRDIPFQSHCEHHMAPII
FT                   GHAHIAYLPHSRVVGISKLARVLHGFARRLQIQERLTAEIADCIWTNLEPLGVAVVIHA
FT                   THACMTARGVRTPGVGMTTSRMMGVFRDDDRSRKEVLSLMGLG"
FT   gene            complement(632325..632900)
FT                   /locus_tag="Swit_0583"
FT   CDS_pept        complement(632325..632900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0583"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66951"
FT                   /db_xref="GOA:A5V3T5"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3T5"
FT                   /protein_id="ABQ66951.1"
FT                   /translation="MADERPLTRRYTSFAIVMHWLIAVLMIGNLLLGLLAEKLPDEDIR
FT                   FAIDTHKSIGITVLGLVLLRILWRLGHRPPPFSTGMAAWERGLAHLAHFGLYLFMLWMP
FT                   LTGWLHDSAWKAAPEIPLRLFGLFDVPRAGFVMALPADRKEMLHGLFGEMHEIGGYLLI
FT                   ALLLLHIAGALKHQFIDGEPEFRRMWPR"
FT   gene            633024..634469
FT                   /locus_tag="Swit_0584"
FT   CDS_pept        633024..634469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0584"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66952"
FT                   /db_xref="GOA:A5V3T6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3T6"
FT                   /protein_id="ABQ66952.1"
FT                   /translation="MTLSTSIEARFNAFSPRLNRRPLTLPALLLHGGALLVLVVLTAQA
FT                   WQWTGILAWSVGLVYLAYDTALLLFVGVQTLPLRHFAPAQDGGGARPTLAVLVAAHNEA
FT                   AVLEQTVHALLAQQDPPDIILIADDGSTDPTPRAMERAFGMAPPPLGEMAASPSVPSLR
FT                   WLRLPHGGKARALNAALEAIDSDIVLTVDADTILAPDAIAAMRAAFHREPALVAATGLL
FT                   RPICDRSAAGRLFEWFQTYEYVRNFISRFAWMRVDGLLLISGAFAGFRREAVVTVGGFD
FT                   PECLVEDYELIHRLHRWSADHGCGWKVRVLGEARAQTDAPGHVAAFLRQRRRWFGGFLQ
FT                   TQYWNRDMVGNPRFGRLGTMMLPVKAFDTVQPLFGLVAFTLLLGFAMEGRLPVVGPILI
FT                   AMLAKVAIDLGFHIWSIMLYRRWSGGMLPEGWGRVLAASFIEPFSFQLLRHLGAAWGWV
FT                   AFLTRSSTWSKARRGGILARAAS"
FT   sig_peptide     633024..633161
FT                   /locus_tag="Swit_0584"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.836 at
FT                   residue 46"
FT   gene            634540..634839
FT                   /locus_tag="Swit_0585"
FT   CDS_pept        634540..634839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0585"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="TIGRFAM: alkylphosphonate utilization operon protein
FT                   PhnA; PFAM: PhnA protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66953"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3T7"
FT                   /protein_id="ABQ66953.1"
FT                   /translation="MSDDDYIYDEATGEWISAADAGAAGATSQVEVRDSVGNLLADGDS
FT                   VTLIKDLKVKGTSQTLKRGTVIKSIRLTGDDQEIDCRFEGIKGLVLRAEFVRKR"
FT   gene            complement(634953..635906)
FT                   /locus_tag="Swit_0586"
FT   CDS_pept        complement(634953..635906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0586"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="PFAM: homoserine O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66954"
FT                   /db_xref="GOA:A5V3T8"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3T8"
FT                   /protein_id="ABQ66954.1"
FT                   /translation="MPIKIPDDLPARPILEQEGVVVMRRTDAVRQDIRPLRIGLLNLMP
FT                   NKISTETQLARLLGATPLQVELTLVRMTDHVARHTPADHMAAFYRPWAEVRDERFDGFV
FT                   ITGAPVEHLPFEEVGYWPELCRVLDWTQTHVHSSFTICWAAQAALHHFHGVPKHLLPAK
FT                   AFGLFRHRNLAPASPYLRGFSDDPHIPVSRWAEIRQADIPAGSGLETLLDSAETGPCLL
FT                   DDPAHRSLHMFNHVEYDTRSLADEYFRDGQGPLPAGYFPGDDPARPPENRWRGHAHLLF
FT                   GNWINEIYRTTPFDIAAIGGGRPPANDAGPIEAAAG"
FT   gene            complement(636099..636968)
FT                   /locus_tag="Swit_0587"
FT   CDS_pept        complement(636099..636968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0587"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66955"
FT                   /db_xref="GOA:A5V3T9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR042281"
FT                   /db_xref="InterPro:IPR042283"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3T9"
FT                   /protein_id="ABQ66955.1"
FT                   /translation="MLIAQLTDLHIGFDLENPDELNFHRVAAAIDYVMGLSVVPDRLFL
FT                   TGDLTDHGDVASYERLKGLIDGCGFPVHLCVGNHDDRAAMKQVFPDLPVEDGFVQYVID
FT                   EPEVRIIVLDTLDPGHHGGAFGHRRAGWLKARLAEVPGKPVLIVLHHPPIETGIPWMTA
FT                   HQTEPWVVMLDKAIGDRPGVTMISGHIHRSITTSWRGRMLAVAPSTAPQVALEMAPIDP
FT                   ERPDERPMIVAEQPGVALHLWTGEGFVTHHAQVGAPDVLARYDRRLQPLVQALAEEHDT
FT                   IRPGAAAA"
FT   gene            complement(637097..638920)
FT                   /locus_tag="Swit_0588"
FT   CDS_pept        complement(637097..638920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66956"
FT                   /db_xref="GOA:A5V3U0"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR012286"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3U0"
FT                   /protein_id="ABQ66956.1"
FT                   /translation="MSFIVRTVARTADGRDIVRPKSFDKAELSIGRSPSSDIHLPDLAV
FT                   ALNHAVIRSAAGGAVEIVATAGMPFLVDGKSTEHERFSASPGANIRIGSHSLSVEPGEG
FT                   DEKGAVVITVERVGAISNASEEKEEARVFSLASVLPGRRIMAWAGVLLVLAIFLAWPLV
FT                   SIHTQPTDNSRKVAFHADELWTSGKLSQVHRSLENNCQACHVKAGEAVRDTACVACHTK
FT                   VHDHADKAKLLEAKGSPGIIDGTKQFVGGIFGIQPGRCVECHTEHQGQTAMPVTDERFC
FT                   TNCHGDMSKRIDTALKDADDFGDHHPQFEPTIRFVGENGLPSFRRVSLDANPKEDNGLK
FT                   FPHDLHLSTTNGVAQMAKTLGKAEGYGAPLDCANCHIRDATGSSFVAVKMEPACGACHS
FT                   LAFDQVGGTIRTLRHGDPAQVVADIRAFYRAGAPRNPALQGMDRRRPGDFASAAQRASF
FT                   AQTSAMHIGNADQAIRAVFSKGGACFDCHTVRATGNPTTPFAVTPVALSRRYMMKGWFD
FT                   HASHDTESCASCHAVKGSKLSSDVNLPKLAKCQECHGGQDAHKEVPSACAMCHDYHRND
FT                   FAPLMVRDNRARGKAVEHIREKALKQAGTGI"
FT   gene            complement(638931..639809)
FT                   /locus_tag="Swit_0589"
FT   CDS_pept        complement(638931..639809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66957"
FT                   /db_xref="GOA:A5V3U1"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3U1"
FT                   /protein_id="ABQ66957.1"
FT                   /translation="MASKSLRQATTGRERASEHEGFLRYQGYKWLKIALAISAVALLIY
FT                   AFNDVQPKPNGGSIYGYTTGTIGVLLILWLTMLGVRKRAITPGRWSLKSWTSAHVYLGL
FT                   SLIVIATLHTGFDFGWNVHTLAYALMMIVIASGVFGIATYAMLPQALSANRGETTQVQM
FT                   LDNLRMIDRQLNEAAQPLDAEGAAIVRMALDDDPFGGGLVARLTGHYRNCGTRAALAAV
FT                   RAHAGRKEAAADPYDHVEVLLERKRSSLSRIRKHLRLKALLEVWLYLHIPLTFALIAAL
FT                   FVHIVSVFYYW"
FT   gene            complement(639809..642214)
FT                   /locus_tag="Swit_0590"
FT   CDS_pept        complement(639809..642214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0590"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66958"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3U2"
FT                   /protein_id="ABQ66958.1"
FT                   /translation="MSAAAHAAKLGIPHVLLEKTDHLSDTIFKYQKGKHVMATPSQLVL
FT                   RSDVDFDAGKREKILGIWDEQTAGHKVNVRFKSEVKAITGQKGAFVLTLADKTEIHAET
FT                   VILAIGTQGNPNLLRAPGIESSGIHVQYQLDDPGEYVDEHITVVGSGDAGIENALGLAQ
FT                   DAAQGNIVTILNRGADFSRAKGANVKLLMQARDEGRMNVMTDTSPNRLEAGHLVLDTRD
FT                   GEARIRCDRVIARMGSAAPRKFIEECGIEFTSPDREAFPTLSPQFETTNAGIYVIGALA
FT                   GYPLIKHCMNQGYDVVEFINGNTGLKPADEPILEGKFVNLPVKKSVDEWLEFIRTNVQI
FT                   LNDLSPLQMREFMLDSEVRYYGKNDIIFEKNAPGSSLFCIAQGSVDIPLPDGRSTGIVI
FT                   PEGSIFGEVGLVSGRRRGSTIRSVAETIVVEIPRNAILKLMASVPGVKRAVTRISTERQ
FT                   LLQMWQSGLQPADLAEVLETAEIKGIRAGEAIFREGEEGNDVYVIRSGSVVVEKAIGGK
FT                   PVFLSYVPAGNYVGELELFDNGIRKQTVRAAVKSEVIKLGGDAFRRLLEAKPEFFARAK
FT                   VAIGEREDLASFIEAKKDSFATVVDMYSSVANFLVDNGVGEATDVLLIDENLCVGCDNC
FT                   EKACADSHEGISRLDREAGRTFAHLHVPTSCRHCEHPHCMADCPPTAIHRGQDGEVYID
FT                   DTCIGCGNCQRNCPYGVIRMEKEPPQKPSLWKWFLFGQGPGPGEPSHDWAYANATPGVE
FT                   KAKRAVKCDMCSGIEGGPSCVRACPTGAAIRVAPEEFLTVARLQRDDA"
FT   gene            642456..643430
FT                   /locus_tag="Swit_0591"
FT   CDS_pept        642456..643430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0591"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_3; Tetratricopeptide TPR_2 repeat
FT                   protein; SMART: Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3U3"
FT                   /protein_id="ABQ66959.1"
FT                   /translation="MTKDTTANKGLSLPFARIALILAALIALAAVVLAVTRSRSGLDET
FT                   AAPGQGAGQAGDVGSMIAGLEKRLKDNPDDFKGWATLGWSYYNLGRYADAAQAYARATK
FT                   IDPSNAEIWSALGEVQLLSGPGGVTPAAEASFRKAVSIDPTDHRARYFLAVKKDQDGDH
FT                   KGAIDDWIAILKDSPAGAPWEGPVRELIAKVSAEHKIDVAGRVPPPSVPQQSSSAAPTA
FT                   GGDSVATAGIPGPSAADLKAATAMTPSQQDELARSMVARLAARLEQNPRDADRWIMLMR
FT                   SRMMLNDPAGAKDALARAKTVFKGDAGQIARFDEAAKTLGVER"
FT   sig_peptide     642456..642560
FT                   /locus_tag="Swit_0591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.808 at
FT                   residue 35"
FT   gene            complement(643597..644871)
FT                   /locus_tag="Swit_0592"
FT   CDS_pept        complement(643597..644871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0592"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, ATP-binding
FT                   subunit ClpX; PFAM: AAA ATPase, central domain protein;
FT                   zinc finger, C4 domain protein; ATPase AAA-2 domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66960"
FT                   /db_xref="GOA:A5V3U4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3U4"
FT                   /protein_id="ABQ66960.1"
FT                   /translation="MTKLTGGDSKSTLYCSFCGKSQHEVRKLIAGPTVFICDECVELCN
FT                   DIIREETKGALVSKKDGGVPTPHEICEHLDQYVIGQAKAKRVLSVAVHNHYKRLNHGAK
FT                   GADVELAKSNILLVGPTGSGKTLLAQTMARLLDVPFTMADATTLTEAGYVGEDVENIIL
FT                   KLLQASDYNVERAQRGIVYIDEIDKISRKADNPSITRDVSGEGVQQALLKLMEGTTASV
FT                   PPQGGRKHPQQEFLQVDTTNILFICGGAFAGLEKIIGDRLQGKSIGFGAYVAAPEERRT
FT                   GETLQQCEPEDLLKFGLIPEFVGRLPVIATLMDLDEAALVEILTAPKNALVKQYQKLFD
FT                   MEGVKLGFTDDALVAIARKAITRKTGARGLRSILEGLLLDTMFDLPSMDGVDEIMVDKD
FT                   VVEGRKDPVRVFTKKNKEKAGGDAA"
FT   gene            complement(645156..645812)
FT                   /locus_tag="Swit_0593"
FT   CDS_pept        complement(645156..645812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0593"
FT                   /product="Endopeptidase Clp"
FT                   /EC_number="3.4.21.92"
FT                   /note="PFAM: peptidase S14, ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66961"
FT                   /db_xref="GOA:A5V3U5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3U5"
FT                   /protein_id="ABQ66961.1"
FT                   /translation="MHNPFETGEFLNPETGALVPVVIEQSNRGERSFDIYSRLLRERII
FT                   FVTGQVEDHMASLITAQLLFLESENPKKDIFMYINSPGGVVTAGLAIHDTMQYIRPRVG
FT                   TVCIGQAASMGSFLLAAGEPGMRVALTNSRIMVHQPSGGAQGMAADIEIQAREILRMRH
FT                   RLNSLYAKYTKQPIEAIEAAMDRDKFLEADEAKAFGLIDEVFDKRPSPADEAIAA"
FT   gene            complement(645996..647651)
FT                   /locus_tag="Swit_0594"
FT   CDS_pept        complement(645996..647651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0594"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase, FKBP-type; trigger factor, C-terminal domain
FT                   protein; trigger factor, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66962"
FT                   /db_xref="GOA:A5V3U6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3U6"
FT                   /protein_id="ABQ66962.1"
FT                   /translation="MQTVETLNEGLKRAYTVTIPANDVAQRVEAEIKSIAPQVRMPGFR
FT                   PGKVPANLIKKMHGPAIEQDVLNKTVQDGVQQLLAEQKLRPAMQPSVELVGGDYEPGKD
FT                   VALKVELEVLPDVPPPAIEGLKLERLSVEAPTDEIDAQIKRIADQQKRYDDAKDGHPAV
FT                   EGDLVVLDFAGSVDGVAFEGGTGTGMSVELGSGRLIPGFEDQLEGIKKGESRSLNVTFP
FT                   KDYGEKSLAGKAAVFEVTATDVRVPGETKVDDEFAQSLGLQGLDQLRELIKGQVEQELN
FT                   GLTRTHMKRKLLDQLAAGHDFPVPPSMVEAEFGQIWAQLEHEATHEEDPEAARAEMEKD
FT                   RDDYRAIAERRVRLGLLLSEIGQQNGVEVSAQEMQRLVQQAAMQYQPADRDRFVQYLQQ
FT                   DPMAAAQLRAPLYEDKVVDFLFDKAEVSDRTVTRDELEAAIEADDDTIGKGHVHGPGCG
FT                   HDHHDHDHDHDHAAPAKKPAAKKAAAKPAAEEAPAAEDKPAAKKKAAVKTEEAAEAAPA
FT                   PKKAPAKKAAAAKAEEAPAAAPKKAPAKKKAAAE"
FT   gene            complement(647721..647805)
FT                   /locus_tag="Swit_R0012"
FT                   /note="tRNA-Leu4"
FT   tRNA            complement(647721..647805)
FT                   /locus_tag="Swit_R0012"
FT                   /product="tRNA-Leu"
FT   gene            complement(648127..651267)
FT                   /locus_tag="Swit_0595"
FT   CDS_pept        complement(648127..651267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66963"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3U7"
FT                   /protein_id="ABQ66963.1"
FT                   /translation="MIYGDPGSIVPLNLPAGEGEYRFSVPSGLAIARRVEAVEYRPTGA
FT                   VWRFPPQATTATSEGDGLAGRISLAVAGPGKPTGKGVLLDRSSYLQSQALGIDFGTSAD
FT                   PLRTQTPRRLRCSFRGIVPPRADGALLFYLTGWTVGTIALMTRYGSNRLECVIGRGDRT
FT                   QAGFASTVDRTPGVEQLLEVEWRDDPAGAGGTLAFLIDGKPAGGPFRTPFKPRITPEMG
FT                   FSVNAALGNLRQAIDGLLVREVAIGFDRPVVKESYSPVADGMVAGADLPRLVVDARAVA
FT                   APQPARTLAWRGPDGSVGTLDVTIGPLDVPPGQPWKAVLVDWSSGTGVPHPNELVMARP
FT                   AVQNCRFEDAWLGAAQPAWIECLPRGPVPVIDGIAYRCEAIRAGDYVQFQFGYDWDASV
FT                   MPDNPFGDPSGRNAYMVPHKWLIYDREDRLLATVERPDGGPLNGADVPAHFQGPFDGRG
FT                   CAVTSREHRWYPHGTVRSGIIWRNRDPGNHDQAGIRRTVPLFDLSVPFGCHLDYSVNGY
FT                   DLRVFGGGAGNEGQANGFGNVRVMPWKQSDYRTMVDRAGRTRDPYGALLYSANSMAANA
FT                   ALWLEYTPFNVQGRSPITGSGGMRDDRQTIPEPVVWHMNLPDGARPHDGTPWRAIALDY
FT                   LTGYVSDPVHAFEKGRNRPVFKGAPQRPVAARNHYYGPGNMALPPAQAWYQQGGRTYAW
FT                   VRGTNPLRVAVPYAGDAPERPYFGTFQIDKLHGHQFPGWGSLLFRTPEFAFLGHRFWDQ
FT                   NRLYSNDIIGDAALDLWAAREGAWAFLHAALAWKTASATSQRLYSRREVLDFVVFDFEL
FT                   FHDRHYAATPGFLNPPANLMPGGQLNLTHAVYAAARHFGVVAKGGWGVYQHEFSIGYWL
FT                   SALATGEKLGFNAALRAASPRAGAVLDWLIAMHRKRIVGRIVGGATLPPLDHVPYMQGI
FT                   WGPDHIAAAGGEVARLPHGYADLERLWGRAPGWDRFDDHGRSVTRDGQAMDQLIAGPSL
FT                   LRYLLGQSGEDLVAAQAIANRWREQKKAEELAKGERAGEGWFVYLQASNNPARPVQS"
FT   gene            648679..651969
FT                   /locus_tag="Swit_0596"
FT   CDS_pept        648679..651969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66964"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3U8"
FT                   /protein_id="ABQ66964.1"
FT                   /translation="MLVDSPPALGDHPKVARGGIDGVGEVQLPARHQVGGRVQEAGRRG
FT                   VMPVVEQLEVEDDEVEHLAPAVEPLRRRARRLPGERRVQEGPGPLARGPQVERGVADDV
FT                   VRIEPVLVPEAMAEKGEFGCAEQQAAPARKLVPVQLVDLEGAEIGPLWRVAGIGHRHPQ
FT                   RIGAAHPGIGAAALLIPGLRRRQRHVAGAVIMVARRDGPLRRALEDGPVAPLLEGVDRI
FT                   GDIAGQIVEGDGAPRRAVVRPRAVGQVHVPDDGLGDGLAIVAHAARSGDRRAALDVERR
FT                   IFEPQRRIGRHRIGRIEQRAIGIAGAPGPVDHRPIVALLPRHDADIAEAVRLPLIARAA
FT                   AEDAQVVAVDRIVEVAAERHAQVEQRHRSADAGLVVVAGIAVAPDDARADRAVRIPAML
FT                   AAGDRAAAPVERPLEMGRDVGAVERAAVGPLDGREQPVLAVVDQPFVRDHIGVAAARIA
FT                   ERIVGHDARVPVIAELELDIVARADRLAAIGDAVDHGNGPPRQAFDPGRLRGAQPGVLE
FT                   TAVLHRRPGHNQFVRVRHARPARPVDQHRLPGLARRHVERADGDVERADRSVRPAPRQR
FT                   PRRLRRRHGARVDDEARQVGARDHAVRDRRIALLHHRPVEADRDLTDEQPVDRLPQIAE
FT                   RGVDREAHLGRDPGLERRPERSARRLAVDQEGERPARPRRIVAPFDLQQLLDAGGAVDR
FT                   AGEPGLGPIATPDHAFEPVAAIAGHQCDRADRPARQVEEQRPVRARRHDPPERTAQPPG
FT                   RLGPQRIGAGAEIDAERLRLEVAAPVEQHALPGRLAGPGDGEADPAGQPVALARRGGGL
FT                   RRKAPDGAGRPILDGFDPPRDRQPRRYRETILALARRQVERNDAAGIAVDHGLGIADCP
FT                   LGVPPNSRHPSEGWGPCLSSARWHLRRKQTWMPAFAGMTKKVCWLDGEGQPNVFLSSSL
FT                   TTPGLALPPIAFIVWPTKKPNSLSLPPRYSATLSALAAITSAITASIAPVSLVCLRPRS
FT                   STILAGSSPVSSMISNTCLASVPDNVPSATSASSSAPCLGLTGLSSIALPSRLSAPNRS
FT                   EISQLDAARATSAPGLPAASSSASNQRAVSTSEVSTAALYAGSPSSPS"
FT   gene            complement(651438..652922)
FT                   /locus_tag="Swit_0597"
FT   CDS_pept        complement(651438..652922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0597"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB N-terminal
FT                   region; GatB, central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66965"
FT                   /db_xref="GOA:A5V3U9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3U9"
FT                   /protein_id="ABQ66965.1"
FT                   /translation="MSSYRIQGATGEWEVVIGLEVHAQVVSNAKLFSGASAAFGAEPNQ
FT                   SVSLVDAAMPGMLPVPNEECIRQAVKTGMALGAEINRWSRFDRKNYFYADLPQGYQISQ
FT                   LYHPLVGEGTITIDADEKAGIAEARTIGVERLHVEQDAGKLMHDQHPTRSYVDLNRSGV
FT                   ALMEIVSKPDMRSPSEAGAYLRKLRSILRYVGSCDGNMEEGSMRADVNVSVRKAGDPFG
FT                   TRTETKNVNSIRFVMAAIESEANRQVDVIEGGGKIVQETRLYDPDRNETRSMRSKEDAH
FT                   DYRYFPDPDLLPLELSEEFVAQCRAELPELPDAKRARYEGELGLPAYNAAVLTSDVETA
FT                   RWFEALLDAAGKPGAEVARAASNWLISDLFGALNRLGKAIDESPVSPRQGAELLALVAD
FT                   GTLSGTLAKQVFEIMLETGDDPARIVEERGLKQTSDTGAIEAVIAEVMAANADKVAEYR
FT                   GGKDKLFGFFVGQTMKAMGGKANPGVVNELLKKTLG"
FT   gene            complement(652919..654406)
FT                   /locus_tag="Swit_0598"
FT   CDS_pept        complement(652919..654406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0598"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66966"
FT                   /db_xref="GOA:A5V3V0"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3V0"
FT                   /protein_id="ABQ66966.1"
FT                   /translation="MTAITDLGLAGLRDGFRAGDFSAREIADAFNGAVAGAKALNAFII
FT                   ETPDHATAAAEAADRARAAGELLPLSGVPLGIKDLFCTAGHQTTAASHMLGGFTPTYES
FT                   TVTGKLFAAGAGMLGKLNLDQFAMGSSNETSAYGNVVSPWRRNDGGNAPLAPGGSSGGS
FT                   SSAIAARIVPAATGTDTGGSIRQPAAFTGIAGIKPTYGRCSRFGIVAFASSLDQAGAMA
FT                   QDVRDSAILLEAMSGFDPKDSTSLDVAVPKWEANLSSDLKGKKVGIPKEYRVDNMPAEI
FT                   DALWRQGIEWLRDAGAEIVDVSLPHTRYALPTYYIIAPAEASSNLARYDGVRYGLRDLP
FT                   EGANLQEMYAATRAAGFGPEVKRRILIGTYVLSAGYYDAYYTKAQKVRALIARDFEEAF
FT                   RQVDVLLTPTAPSAAFALGEKSADPLEMYLNDVFTVPASLAGVPAMSVPAGLDGQGLPL
FT                   GLQIIGRPLDEQGVLNAGLAIEQRAGFTAKPQNWWAK"
FT   gene            complement(654406..654693)
FT                   /locus_tag="Swit_0599"
FT   CDS_pept        complement(654406..654693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0599"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66967"
FT                   /db_xref="GOA:A5V3V1"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3V1"
FT                   /protein_id="ABQ66967.1"
FT                   /translation="MSVDAATVRKIASLARIAVTDGDVEAMVPELNNILGWIEQLGEVD
FT                   TDGVAPLAAVIPNHQRLRDDVVTDGNIRDKVLANAPQAEHGFFAVPKVIE"
FT   gene            654977..656092
FT                   /locus_tag="Swit_0600"
FT   CDS_pept        654977..656092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66968"
FT                   /db_xref="GOA:A5V3V2"
FT                   /db_xref="InterPro:IPR021440"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3V2"
FT                   /protein_id="ABQ66968.1"
FT                   /translation="MLARRFLYIIAGLIVLTLAAGIGWTLFQDQLMRFAFVPGVRFDAD
FT                   AAGPAPDYARPASWLARPDLPDDPSRWLPKGVARAGGKPEVAVFYVAPTTYYGKASWNA
FT                   GLDDRESRKWLTVFGWSEASAFNQAGAVWAPRYRSAALGAFLSSAPDSAKALDLAYGDV
FT                   ARAFDAFLAQIPASRPIILAGHSQGTVHLMRLMRERVAGKPVAKRIVAAYLVGWPISTT
FT                   ADVPALGLPACTGPGQAQCLLSWQSFAEPADPRMIREIYEAAPGFTGAPRKGTPMLCIN
FT                   PLTGAPGTAALPAANLGSLAPGADFMDAELKPGAISARCDPSGLLLIGGPPKGFDRFVM
FT                   PGNNYHVFDYALFWANIRADAAARAGTFLKR"
FT   sig_peptide     654977..655039
FT                   /locus_tag="Swit_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.766) with cleavage site probability 0.282 at
FT                   residue 21"
FT   gene            656089..656544
FT                   /locus_tag="Swit_0601"
FT   CDS_pept        656089..656544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0601"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase, RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66969"
FT                   /db_xref="GOA:A5V3V3"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3V3"
FT                   /protein_id="ABQ66969.1"
FT                   /translation="MISASTLDFRDALPDRGRLAGLDVGTRTIGVALCDAGWTIASPAE
FT                   TILRAKFSVDAAKLRALVAAQLVKGLVIGLPLNLDGSDSPRTQSVRAFARNVEPFGLPI
FT                   LLWDERWSTQAVTRTLLDADASRARRAELVDKLAAAYILQGAIDAMI"
FT   gene            656656..657606
FT                   /locus_tag="Swit_0602"
FT   CDS_pept        656656..657606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0602"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66970"
FT                   /db_xref="GOA:A5V3V4"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3V4"
FT                   /protein_id="ABQ66970.1"
FT                   /translation="MSASFPHRHLTGIYGLQPHEILFLLDEAEQWIALNRATSKHDDRL
FT                   AGLTLINAFFENSTRTLLSFEIAGKRLGADVVNMQVGASSVKKGETLIDTAMTLNAMRA
FT                   DMIVIRHQSSGAVQLIADKVDCPVLNAGDGRHEHPTQALLDALTIRRRKGRIAGLVVAI
FT                   CGDILHSRVARSNILALTTLGAEVRVVAPPTLMPAAIERMGAVPFHDFDAGLDGADVVM
FT                   MLRLQNERMDGAYLPSPREFHALYGLTPERLERAAPDALVMHPGPMNRGVEITSSVADH
FT                   PSRSAITEQVEMGVAVRMACLDVLTRRRRGVEGWA"
FT   gene            657603..658832
FT                   /locus_tag="Swit_0603"
FT   CDS_pept        657603..658832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0603"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66971"
FT                   /db_xref="GOA:A5V3V5"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3V5"
FT                   /protein_id="ABQ66971.1"
FT                   /translation="MTGALAIVDARLVDPAAGTITRGNLLIRDRRIAATGQFDLPPDAE
FT                   TIDAGGAHVAPGLVDLGIFAIDMPAFTAGGITRAVLMPDQSPPLDHAALVQRAAAAGKP
FT                   DVWVHPLAAATKGLDGRELAEIGLMKAGGACAVATGRGWIADSGVMLRVLSYARSLGLT
FT                   VVSHAEDGGVTTGAVATEGEYATRMGLPAAPAIAEAMAVARDLMLAEQTGARLHFRQLS
FT                   TARAFDLVRDAKRRGVPVTCGISPAHLLLSDIAVGGFRTFARLSPPLRSEDDRQAALAA
FT                   LADGTIDLICSSHDPQGPEAKRLPFADAEPGMAGAETLLTLSLSLVRDGVVTLPRLIDL
FT                   LSAAPATLLGLPGGSLAVGAEADLVLFDPDMPWRIDSDHMASRAGNTPFDGLPVQGKVI
FT                   QTIKGGVLLR"
FT   gene            complement(658835..660028)
FT                   /locus_tag="Swit_0604"
FT   CDS_pept        complement(658835..660028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0604"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; Tetratricopeptide
FT                   TPR_4; Tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66972"
FT                   /db_xref="GOA:A5V3V6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3V6"
FT                   /protein_id="ABQ66972.1"
FT                   /translation="MRMNWTGLTATAIGLVLVSGASAATHKRADRLIAGAREAMARGVP
FT                   AAAVRQAEAAVREAPRDPQARATLGRAYLAAGRFRSAETAFGDALALDPAQARVAINRA
FT                   LAQIALGRADEAMALLDGLRGGGNDSDVGLALALLGRPDEARPLLIAAARAPGADARIR
FT                   QNLAFAYALEGRWNEAAAIAAQDVPADLVAERLRRWAMVGQLRADPAMQVGAMLGVLPS
FT                   ADAGQPEALALIAEPVPASAPVLLAHVPTPPAPPPPLIAPPPVPPSEPVASAFAGPPRM
FT                   RAARPVLLAAHVVPVRPALAWAVQVGAYSTVERTEVAWAALGRRATFLADHMPTGSAFR
FT                   RRGVVLHRLSISGLASRADASKLCRRIQSAGAQCFVRMDGGDRPMQWALRAKAAEPA"
FT   sig_peptide     complement(659957..660028)
FT                   /locus_tag="Swit_0604"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.854 at
FT                   residue 24"
FT   gene            660201..661295
FT                   /locus_tag="Swit_0605"
FT   CDS_pept        660201..661295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0605"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   Sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66973"
FT                   /db_xref="GOA:A5V3V7"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3V7"
FT                   /protein_id="ABQ66973.1"
FT                   /translation="MRSFVLGCALAAATVAAPAIAGVKEGVEAWAKGDYPTAIAEWRGP
FT                   AAAGDPDAQFNLGQAYKLGRGVPMEPATALDWYRKAAASGHEQAQATLGLLLFQNGQRP
FT                   EAMTWLKKAADQGEARAQYVVGTAYFNGDLLPRDWPRAYALMTRAKAANIGAATTSLQQ
FT                   MDQIIPQEQREAGLALSREMERTAQLRTNDVATPGMPLTMRNSVTPPVGQTSVPPSTTS
FT                   TPVMAPAPAPTAAPTIMAQAGGTPWRAPTTAPAASPPPAPKPTAPKSVAPTPAPAPAPA
FT                   PAIVASPSGGWKIQLGAFSSADAARNAWTSLSARAGLKALTPSFSAVGALTRLQAGPLA
FT                   SRTAANQACAAVKAAGTTCFPVAP"
FT   sig_peptide     660201..660266
FT                   /locus_tag="Swit_0605"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.983 at
FT                   residue 22"
FT   gene            661416..661700
FT                   /locus_tag="Swit_0606"
FT   CDS_pept        661416..661700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66974"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3V8"
FT                   /protein_id="ABQ66974.1"
FT                   /translation="MASPWRRRRVCQLIIDGIPLPVALRQIDAGGARLDIGTPLPLGST
FT                   VELRHPEAGSIRARISEIGENSLRIAFDRSEAAVAYALAAITADMTSGN"
FT   gene            complement(661702..662580)
FT                   /locus_tag="Swit_0607"
FT   CDS_pept        complement(661702..662580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0607"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="TIGRFAM: phosphoserine phosphatase SerB;
FT                   HAD-superfamily hydrolase, subfamily IB (PSPase-like);
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66975"
FT                   /db_xref="GOA:A5V3V9"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3V9"
FT                   /protein_id="ABQ66975.1"
FT                   /translation="MFIATLIASDRIEAGDISTAADRLAAAGLRTGDSAWIEPGIACDL
FT                   GFDGDPAAARAALEGAFAGVDVVVQAAAGRRRRMLVADMDSTMITIECIDELADYAGIK
FT                   PQIAEITERAMRGELDFEGALDARVALLAGLDASVIDRCHAERVVIMAGARELVRTMRA
FT                   NDVDCYLVSGGFTLFADRVATEIGFTRALSNVLEFADGKLSGTVARPIVGAETKRRTLL
FT                   DEAAAHGLSPDQCLAVGDGANDIPMIQAAGLGVAYHAKPKTAAAAGARIDHGDLTALLY
FT                   AQGYARKDWVI"
FT   gene            662645..663517
FT                   /locus_tag="Swit_0608"
FT   CDS_pept        662645..663517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0608"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="TIGRFAM: tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase; PFAM: tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66976"
FT                   /db_xref="GOA:A5V3W0"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3W0"
FT                   /protein_id="ABQ66976.1"
FT                   /translation="MAIRLAEIADGVVINADASQVYADLRVLSARPDPAEEARAPHRLF
FT                   GYRDAAEPCSAADWAADAKRAIAAAREAGKLPILVGGTGLYLRTLIFGIAPVPEIDPAI
FT                   RAEVRALPVEAAHAALAAEDPAMGHLRPQDATRIARALEVIRSTGRSLSHWQAELTGGI
FT                   GGEIAVAAAIVLPPRDWLRARCDARFEAMLDQGAVEEVKKLRARGLDPMLPAMQAIGVR
FT                   EIAAWQDGLIDRETMVAKAQAATRQYAKRQYTWFRHQPPAAWQRIDTQLNDNEIGKIAI
FT                   KLRNDALTE"
FT   gene            663580..665334
FT                   /locus_tag="Swit_0609"
FT   CDS_pept        663580..665334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0609"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate enzyme
FT                   domain protein TPP-binding; thiamine pyrophosphate enzyme,
FT                   central region; thiamine pyrophosphate enzyme TPP binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66977"
FT                   /db_xref="GOA:A5V3W1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3W1"
FT                   /protein_id="ABQ66977.1"
FT                   /translation="MTAEMTGADILIQALNDLGVEVVFGYPGGAVLPIYDALFKQNRIR
FT                   HILVRHEAGAVHAAEGYARSTGKPGVVLVTSGPGATNAVTGIADALLDSIPLVVLTGQV
FT                   GTPLIGSDAFQECDTVGITRHCTKHNYLVKDPALLGDVIHEAFHIATSGRPGPVVVDLP
FT                   KDVQVASAAYRKPSVQALPHKGYRPQVKADPTLIEQAVAMIAAAERPILYTGGGIINAG
FT                   PLASQVLRELARVTGAPVTSTLMGLGAFPASSGQWLGMLGMHGTYEANMAMNKADLIVC
FT                   LGARFDDRVTGRLDAFAPHSKKIHVDIDRSSINKIVRADIGIVGDVGRAMEDMVKIWKA
FT                   GQHQARDLAAWYEQIDAWRARKSLKFPASTKEIMPQLAIRKLWEATHALKPIITTEVGQ
FT                   HQMWAAQHFDFEGPNKWLTSGGLGTMGYGLPAAIGAQLGNPNALVIDIAGEASIQMNIQ
FT                   ELGTATQYRLPVKVFILNNEYMGMVRQWQDLTYAGRYSQSYSDALPDFVKLAEAYGWKG
FT                   VLIEKPEELDAGIAAMLEHDGPVIVDCRVAKLANCFPMIPSGAAHTDMILEADEVVGEM
FT                   DDEAKALV"
FT   gene            665377..665892
FT                   /locus_tag="Swit_0610"
FT   CDS_pept        665377..665892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0610"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66978"
FT                   /db_xref="GOA:A5V3W2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3W2"
FT                   /protein_id="ABQ66978.1"
FT                   /translation="MHIKQEATERHTLSVTVDNESGILARIAGLFSSRGYNIDSLTVAD
FT                   VTEDEKISRITIVTTGTPQVIEQVVAQLDRMVPVHKVTDLTALAPHVERELALVKVAGT
FT                   GDHRIEALRLAEVYRARVVDATISSFIFEVTGGTEKIDKFLELMREVGLVEVARTGVAA
FT                   IGRGKEAL"
FT   gene            666017..667036
FT                   /locus_tag="Swit_0611"
FT   CDS_pept        666017..667036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0611"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; PFAM:
FT                   acetohydroxy acid isomeroreductase; CoA-binding domain
FT                   protein; Acetohydroxy acid isomeroreductase, catalytic
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66979"
FT                   /db_xref="GOA:A5V3W3"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5V3W3"
FT                   /protein_id="ABQ66979.1"
FT                   /translation="MRVYYDRDADIGLIKTKKVAIVGYGSQGHAHAQNLQDSGVADVAI
FT                   ALRPGSATAKKAEGAGFKVLSNADAAKWADIVMILAPDEHQAAIYNDDLRDNLKPGAAL
FT                   AFAHGLNVHFGLIEPRADIDVFMIAPKGPGHTVRSEYQRGGGVPCLIAIAQDASGNAHD
FT                   VALSYASAIGGGRSGVIETTFKEECETDLFGEQAVLCGGLSHLIMAGFETLVEAGYAPE
FT                   MAYFECLHEVKLIVDLMYEGGIANMRYSISNTAEYGDIHTGPRVITSETKAEMKRVLDD
FT                   IQKGKFVKRFVLDNRAGQPELKASRKLVAEHPIEKVGAELRAMMPWISKNQLVDKAKN"
FT   gene            667138..667755
FT                   /locus_tag="Swit_0612"
FT   CDS_pept        667138..667755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0612"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66980"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3W4"
FT                   /protein_id="ABQ66980.1"
FT                   /translation="MVRSAAALLLGFSLVALPVVAQVPTTPPGISDVRRVTAGTYTVDP
FT                   GHSQVTFTVNHLGFSTYRGFFGSPTGSMTIDPKAPAKAKVAIDIPMSGITTTVKELDEH
FT                   LKAADFFDAAKYPTARFESTSVRVTGPKTAKIAGNLTVKGVTKPVVLDTVFVGAGTMMG
FT                   KRTIGFDATTTVKRSDFGVSYGIPLVPDTVPLQISVAFEKAE"
FT   sig_peptide     667138..667203
FT                   /locus_tag="Swit_0612"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            667818..668837
FT                   /locus_tag="Swit_0613"
FT   CDS_pept        667818..668837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66981"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3W5"
FT                   /protein_id="ABQ66981.1"
FT                   /translation="MAGPLTFYGTLFGAAVLCLVSPGASAAEEAPTAAEAPPDAASRLD
FT                   REIAMIRKGRLDEAERLLSRDMAAERSPRVRADLLAAFATQLFLNAPKLDDPTSALVLD
FT                   YLERAVDAYRLVLGAGDPEVATALIRRAEVERLLHPDDPALWTDSAYQQAYRIRFERLG
FT                   ATSPVTLGTLIPMAELAALPSRTQGDPAKIEAAAAMLRQAAEGTAAAQDDGARAVHAET
FT                   LETLQRFEAAYGAGRSDGPRPQIMTAGAARQCVGVNLDDAILFSGEPAQFAMLRDRFAR
FT                   AGLALLPCGSMLAFPLGPGIDPTPVLDLLTDISAGRIKGLYMGLRNPDETPAPSPEAP"
FT   sig_peptide     667818..667898
FT                   /locus_tag="Swit_0613"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.789 at
FT                   residue 27"
FT   gene            complement(668842..669249)
FT                   /locus_tag="Swit_0614"
FT   CDS_pept        complement(668842..669249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Swit_0614"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Swit_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ66982"
FT                   /db_xref="GOA:A5V3W6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A5V3W6"
FT                   /protein_id="ABQ66982.1"
FT                   /translation="MDKGKPLIVVAAALVDGDGRLLVQQRPADKSMGGLWEFPGGKVEE
FT                   GETPEAALIRELHEELGIGVEQACLAPACFASEPLGGRHMILLVYICRKWRGIP