(data stored in SCRATCH3701 zone)

EMBL: CP000705

ID   CP000705; SV 1; circular; genomic DNA; STD; PRO; 1999618 BP.
XX
AC   CP000705; AAOV01000000-AAOV01000097;
XX
PR   Project:PRJNA15766;
XX
DT   04-JUN-2007 (Rel. 92, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Lactobacillus reuteri DSM 20016, complete genome.
XX
KW   .
XX
OS   Lactobacillus reuteri DSM 20016
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae;
OC   Lactobacillus.
XX
RN   [1]
RP   1-1999618
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Goltsman E., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E., Walter J., Heng N.C.K., Tannock G.W., Richardson P.;
RT   "Complete sequence of chromosome of Lactobacillus reuteri DSM 20016";
RL   Unpublished.
XX
RN   [2]
RP   1-1999618
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Goltsman E., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Kim E., Walter J., Heng N.C.K., Tannock G.W., Richardson P.;
RT   ;
RL   Submitted (17-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 9d3fe9a3308fab2d5d77424ec7def07d.
DR   BioSample; SAMN02598351.
DR   CABRI; DSM 20016.
DR   EnsemblGenomes-Gn; EBG00001187281.
DR   EnsemblGenomes-Gn; EBG00001187282.
DR   EnsemblGenomes-Gn; EBG00001187283.
DR   EnsemblGenomes-Gn; EBG00001187284.
DR   EnsemblGenomes-Gn; EBG00001187285.
DR   EnsemblGenomes-Gn; EBG00001187286.
DR   EnsemblGenomes-Gn; EBG00001187287.
DR   EnsemblGenomes-Gn; EBG00001187288.
DR   EnsemblGenomes-Gn; EBG00001187289.
DR   EnsemblGenomes-Gn; EBG00001187290.
DR   EnsemblGenomes-Gn; EBG00001187291.
DR   EnsemblGenomes-Gn; EBG00001187292.
DR   EnsemblGenomes-Gn; EBG00001187293.
DR   EnsemblGenomes-Gn; EBG00001187294.
DR   EnsemblGenomes-Gn; EBG00001187295.
DR   EnsemblGenomes-Gn; EBG00001187296.
DR   EnsemblGenomes-Gn; EBG00001187297.
DR   EnsemblGenomes-Gn; EBG00001187298.
DR   EnsemblGenomes-Gn; EBG00001187299.
DR   EnsemblGenomes-Gn; EBG00001187300.
DR   EnsemblGenomes-Gn; EBG00001187301.
DR   EnsemblGenomes-Gn; EBG00001187302.
DR   EnsemblGenomes-Gn; EBG00001187303.
DR   EnsemblGenomes-Gn; EBG00001187304.
DR   EnsemblGenomes-Gn; EBG00001187305.
DR   EnsemblGenomes-Gn; EBG00001187306.
DR   EnsemblGenomes-Gn; EBG00001187307.
DR   EnsemblGenomes-Gn; EBG00001187308.
DR   EnsemblGenomes-Gn; EBG00001187309.
DR   EnsemblGenomes-Gn; EBG00001187310.
DR   EnsemblGenomes-Gn; EBG00001187311.
DR   EnsemblGenomes-Gn; EBG00001187312.
DR   EnsemblGenomes-Gn; EBG00001187313.
DR   EnsemblGenomes-Gn; EBG00001187314.
DR   EnsemblGenomes-Gn; EBG00001187315.
DR   EnsemblGenomes-Gn; EBG00001187316.
DR   EnsemblGenomes-Gn; EBG00001187317.
DR   EnsemblGenomes-Gn; EBG00001187318.
DR   EnsemblGenomes-Gn; EBG00001187319.
DR   EnsemblGenomes-Gn; EBG00001187320.
DR   EnsemblGenomes-Gn; EBG00001187321.
DR   EnsemblGenomes-Gn; EBG00001187322.
DR   EnsemblGenomes-Gn; EBG00001187323.
DR   EnsemblGenomes-Gn; EBG00001187324.
DR   EnsemblGenomes-Gn; EBG00001187325.
DR   EnsemblGenomes-Gn; EBG00001187326.
DR   EnsemblGenomes-Gn; EBG00001187327.
DR   EnsemblGenomes-Gn; EBG00001187328.
DR   EnsemblGenomes-Gn; EBG00001187329.
DR   EnsemblGenomes-Gn; EBG00001187330.
DR   EnsemblGenomes-Gn; EBG00001187331.
DR   EnsemblGenomes-Gn; EBG00001187332.
DR   EnsemblGenomes-Gn; EBG00001187333.
DR   EnsemblGenomes-Gn; EBG00001187334.
DR   EnsemblGenomes-Gn; EBG00001187335.
DR   EnsemblGenomes-Gn; EBG00001187336.
DR   EnsemblGenomes-Gn; EBG00001187337.
DR   EnsemblGenomes-Gn; EBG00001187338.
DR   EnsemblGenomes-Gn; EBG00001187339.
DR   EnsemblGenomes-Gn; EBG00001187340.
DR   EnsemblGenomes-Gn; EBG00001187341.
DR   EnsemblGenomes-Gn; EBG00001187342.
DR   EnsemblGenomes-Gn; EBG00001187343.
DR   EnsemblGenomes-Gn; EBG00001187344.
DR   EnsemblGenomes-Gn; EBG00001187345.
DR   EnsemblGenomes-Gn; EBG00001187346.
DR   EnsemblGenomes-Gn; EBG00001187347.
DR   EnsemblGenomes-Gn; EBG00001187348.
DR   EnsemblGenomes-Gn; EBG00001187349.
DR   EnsemblGenomes-Gn; EBG00001187350.
DR   EnsemblGenomes-Gn; EBG00001187351.
DR   EnsemblGenomes-Gn; EBG00001187352.
DR   EnsemblGenomes-Gn; EBG00001187353.
DR   EnsemblGenomes-Gn; EBG00001187354.
DR   EnsemblGenomes-Gn; EBG00001187355.
DR   EnsemblGenomes-Gn; EBG00001187356.
DR   EnsemblGenomes-Gn; EBG00001187357.
DR   EnsemblGenomes-Gn; EBG00001187358.
DR   EnsemblGenomes-Gn; EBG00001187359.
DR   EnsemblGenomes-Gn; EBG00001187360.
DR   EnsemblGenomes-Gn; EBG00001187361.
DR   EnsemblGenomes-Gn; EBG00001187362.
DR   EnsemblGenomes-Gn; EBG00001187363.
DR   EnsemblGenomes-Gn; EBG00001187364.
DR   EnsemblGenomes-Gn; EBG00001187365.
DR   EnsemblGenomes-Gn; EBG00001187366.
DR   EnsemblGenomes-Gn; EBG00001187367.
DR   EnsemblGenomes-Gn; EBG00001187368.
DR   EnsemblGenomes-Gn; EBG00001187369.
DR   EnsemblGenomes-Gn; EBG00001187370.
DR   EnsemblGenomes-Gn; EBG00001187371.
DR   EnsemblGenomes-Gn; EBG00001187372.
DR   EnsemblGenomes-Gn; EBG00001187373.
DR   EnsemblGenomes-Gn; EBG00001187374.
DR   EnsemblGenomes-Gn; EBG00001187375.
DR   EnsemblGenomes-Gn; EBG00001187376.
DR   EnsemblGenomes-Gn; Lreu_R0001.
DR   EnsemblGenomes-Gn; Lreu_R0002.
DR   EnsemblGenomes-Gn; Lreu_R0003.
DR   EnsemblGenomes-Gn; Lreu_R0004.
DR   EnsemblGenomes-Gn; Lreu_R0005.
DR   EnsemblGenomes-Gn; Lreu_R0006.
DR   EnsemblGenomes-Gn; Lreu_R0007.
DR   EnsemblGenomes-Gn; Lreu_R0008.
DR   EnsemblGenomes-Gn; Lreu_R0009.
DR   EnsemblGenomes-Gn; Lreu_R0010.
DR   EnsemblGenomes-Gn; Lreu_R0011.
DR   EnsemblGenomes-Gn; Lreu_R0012.
DR   EnsemblGenomes-Gn; Lreu_R0013.
DR   EnsemblGenomes-Gn; Lreu_R0014.
DR   EnsemblGenomes-Gn; Lreu_R0015.
DR   EnsemblGenomes-Gn; Lreu_R0016.
DR   EnsemblGenomes-Gn; Lreu_R0017.
DR   EnsemblGenomes-Gn; Lreu_R0019.
DR   EnsemblGenomes-Gn; Lreu_R0020.
DR   EnsemblGenomes-Gn; Lreu_R0021.
DR   EnsemblGenomes-Gn; Lreu_R0022.
DR   EnsemblGenomes-Gn; Lreu_R0023.
DR   EnsemblGenomes-Gn; Lreu_R0024.
DR   EnsemblGenomes-Gn; Lreu_R0025.
DR   EnsemblGenomes-Gn; Lreu_R0026.
DR   EnsemblGenomes-Gn; Lreu_R0027.
DR   EnsemblGenomes-Gn; Lreu_R0028.
DR   EnsemblGenomes-Gn; Lreu_R0029.
DR   EnsemblGenomes-Gn; Lreu_R0030.
DR   EnsemblGenomes-Gn; Lreu_R0031.
DR   EnsemblGenomes-Gn; Lreu_R0032.
DR   EnsemblGenomes-Gn; Lreu_R0033.
DR   EnsemblGenomes-Gn; Lreu_R0034.
DR   EnsemblGenomes-Gn; Lreu_R0035.
DR   EnsemblGenomes-Gn; Lreu_R0036.
DR   EnsemblGenomes-Gn; Lreu_R0037.
DR   EnsemblGenomes-Gn; Lreu_R0038.
DR   EnsemblGenomes-Gn; Lreu_R0039.
DR   EnsemblGenomes-Gn; Lreu_R0040.
DR   EnsemblGenomes-Gn; Lreu_R0041.
DR   EnsemblGenomes-Gn; Lreu_R0042.
DR   EnsemblGenomes-Gn; Lreu_R0043.
DR   EnsemblGenomes-Gn; Lreu_R0044.
DR   EnsemblGenomes-Gn; Lreu_R0045.
DR   EnsemblGenomes-Gn; Lreu_R0046.
DR   EnsemblGenomes-Gn; Lreu_R0047.
DR   EnsemblGenomes-Gn; Lreu_R0048.
DR   EnsemblGenomes-Gn; Lreu_R0049.
DR   EnsemblGenomes-Gn; Lreu_R0050.
DR   EnsemblGenomes-Gn; Lreu_R0051.
DR   EnsemblGenomes-Gn; Lreu_R0052.
DR   EnsemblGenomes-Gn; Lreu_R0053.
DR   EnsemblGenomes-Gn; Lreu_R0054.
DR   EnsemblGenomes-Gn; Lreu_R0055.
DR   EnsemblGenomes-Gn; Lreu_R0056.
DR   EnsemblGenomes-Gn; Lreu_R0057.
DR   EnsemblGenomes-Gn; Lreu_R0058.
DR   EnsemblGenomes-Gn; Lreu_R0059.
DR   EnsemblGenomes-Gn; Lreu_R0060.
DR   EnsemblGenomes-Gn; Lreu_R0061.
DR   EnsemblGenomes-Gn; Lreu_R0062.
DR   EnsemblGenomes-Gn; Lreu_R0063.
DR   EnsemblGenomes-Gn; Lreu_R0064.
DR   EnsemblGenomes-Gn; Lreu_R0065.
DR   EnsemblGenomes-Gn; Lreu_R0066.
DR   EnsemblGenomes-Gn; Lreu_R0067.
DR   EnsemblGenomes-Gn; Lreu_R0068.
DR   EnsemblGenomes-Gn; Lreu_R0069.
DR   EnsemblGenomes-Gn; Lreu_R0070.
DR   EnsemblGenomes-Gn; Lreu_R0071.
DR   EnsemblGenomes-Gn; Lreu_R0072.
DR   EnsemblGenomes-Gn; Lreu_R0073.
DR   EnsemblGenomes-Gn; Lreu_R0074.
DR   EnsemblGenomes-Gn; Lreu_R0075.
DR   EnsemblGenomes-Gn; Lreu_R0076.
DR   EnsemblGenomes-Gn; Lreu_R0077.
DR   EnsemblGenomes-Gn; Lreu_R0078.
DR   EnsemblGenomes-Gn; Lreu_R0079.
DR   EnsemblGenomes-Gn; Lreu_R0080.
DR   EnsemblGenomes-Gn; Lreu_R0081.
DR   EnsemblGenomes-Gn; Lreu_R0082.
DR   EnsemblGenomes-Gn; Lreu_R0083.
DR   EnsemblGenomes-Gn; Lreu_R0084.
DR   EnsemblGenomes-Gn; Lreu_R0085.
DR   EnsemblGenomes-Gn; Lreu_R0086.
DR   EnsemblGenomes-Gn; Lreu_R0087.
DR   EnsemblGenomes-Gn; Lreu_R0088.
DR   EnsemblGenomes-Tr; EBT00001765734.
DR   EnsemblGenomes-Tr; EBT00001765735.
DR   EnsemblGenomes-Tr; EBT00001765736.
DR   EnsemblGenomes-Tr; EBT00001765737.
DR   EnsemblGenomes-Tr; EBT00001765738.
DR   EnsemblGenomes-Tr; EBT00001765739.
DR   EnsemblGenomes-Tr; EBT00001765740.
DR   EnsemblGenomes-Tr; EBT00001765741.
DR   EnsemblGenomes-Tr; EBT00001765742.
DR   EnsemblGenomes-Tr; EBT00001765743.
DR   EnsemblGenomes-Tr; EBT00001765744.
DR   EnsemblGenomes-Tr; EBT00001765745.
DR   EnsemblGenomes-Tr; EBT00001765746.
DR   EnsemblGenomes-Tr; EBT00001765747.
DR   EnsemblGenomes-Tr; EBT00001765748.
DR   EnsemblGenomes-Tr; EBT00001765749.
DR   EnsemblGenomes-Tr; EBT00001765750.
DR   EnsemblGenomes-Tr; EBT00001765751.
DR   EnsemblGenomes-Tr; EBT00001765752.
DR   EnsemblGenomes-Tr; EBT00001765753.
DR   EnsemblGenomes-Tr; EBT00001765754.
DR   EnsemblGenomes-Tr; EBT00001765755.
DR   EnsemblGenomes-Tr; EBT00001765756.
DR   EnsemblGenomes-Tr; EBT00001765757.
DR   EnsemblGenomes-Tr; EBT00001765758.
DR   EnsemblGenomes-Tr; EBT00001765759.
DR   EnsemblGenomes-Tr; EBT00001765760.
DR   EnsemblGenomes-Tr; EBT00001765761.
DR   EnsemblGenomes-Tr; EBT00001765762.
DR   EnsemblGenomes-Tr; EBT00001765763.
DR   EnsemblGenomes-Tr; EBT00001765764.
DR   EnsemblGenomes-Tr; EBT00001765765.
DR   EnsemblGenomes-Tr; EBT00001765766.
DR   EnsemblGenomes-Tr; EBT00001765767.
DR   EnsemblGenomes-Tr; EBT00001765768.
DR   EnsemblGenomes-Tr; EBT00001765769.
DR   EnsemblGenomes-Tr; EBT00001765770.
DR   EnsemblGenomes-Tr; EBT00001765771.
DR   EnsemblGenomes-Tr; EBT00001765772.
DR   EnsemblGenomes-Tr; EBT00001765773.
DR   EnsemblGenomes-Tr; EBT00001765774.
DR   EnsemblGenomes-Tr; EBT00001765775.
DR   EnsemblGenomes-Tr; EBT00001765776.
DR   EnsemblGenomes-Tr; EBT00001765777.
DR   EnsemblGenomes-Tr; EBT00001765778.
DR   EnsemblGenomes-Tr; EBT00001765779.
DR   EnsemblGenomes-Tr; EBT00001765780.
DR   EnsemblGenomes-Tr; EBT00001765781.
DR   EnsemblGenomes-Tr; EBT00001765782.
DR   EnsemblGenomes-Tr; EBT00001765783.
DR   EnsemblGenomes-Tr; EBT00001765784.
DR   EnsemblGenomes-Tr; EBT00001765785.
DR   EnsemblGenomes-Tr; EBT00001765786.
DR   EnsemblGenomes-Tr; EBT00001765787.
DR   EnsemblGenomes-Tr; EBT00001765788.
DR   EnsemblGenomes-Tr; EBT00001765789.
DR   EnsemblGenomes-Tr; EBT00001765790.
DR   EnsemblGenomes-Tr; EBT00001765791.
DR   EnsemblGenomes-Tr; EBT00001765792.
DR   EnsemblGenomes-Tr; EBT00001765793.
DR   EnsemblGenomes-Tr; EBT00001765794.
DR   EnsemblGenomes-Tr; EBT00001765795.
DR   EnsemblGenomes-Tr; EBT00001765796.
DR   EnsemblGenomes-Tr; EBT00001765797.
DR   EnsemblGenomes-Tr; EBT00001765798.
DR   EnsemblGenomes-Tr; EBT00001765799.
DR   EnsemblGenomes-Tr; EBT00001765800.
DR   EnsemblGenomes-Tr; EBT00001765801.
DR   EnsemblGenomes-Tr; EBT00001765802.
DR   EnsemblGenomes-Tr; EBT00001765803.
DR   EnsemblGenomes-Tr; EBT00001765804.
DR   EnsemblGenomes-Tr; EBT00001765805.
DR   EnsemblGenomes-Tr; EBT00001765806.
DR   EnsemblGenomes-Tr; EBT00001765807.
DR   EnsemblGenomes-Tr; EBT00001765808.
DR   EnsemblGenomes-Tr; EBT00001765809.
DR   EnsemblGenomes-Tr; EBT00001765810.
DR   EnsemblGenomes-Tr; EBT00001765811.
DR   EnsemblGenomes-Tr; EBT00001765812.
DR   EnsemblGenomes-Tr; EBT00001765813.
DR   EnsemblGenomes-Tr; EBT00001765814.
DR   EnsemblGenomes-Tr; EBT00001765815.
DR   EnsemblGenomes-Tr; EBT00001765816.
DR   EnsemblGenomes-Tr; EBT00001765817.
DR   EnsemblGenomes-Tr; EBT00001765818.
DR   EnsemblGenomes-Tr; EBT00001765819.
DR   EnsemblGenomes-Tr; EBT00001765820.
DR   EnsemblGenomes-Tr; EBT00001765821.
DR   EnsemblGenomes-Tr; EBT00001765822.
DR   EnsemblGenomes-Tr; EBT00001765823.
DR   EnsemblGenomes-Tr; EBT00001765824.
DR   EnsemblGenomes-Tr; EBT00001765825.
DR   EnsemblGenomes-Tr; EBT00001765826.
DR   EnsemblGenomes-Tr; EBT00001765827.
DR   EnsemblGenomes-Tr; EBT00001765828.
DR   EnsemblGenomes-Tr; EBT00001765829.
DR   EnsemblGenomes-Tr; Lreu_R0001-1.
DR   EnsemblGenomes-Tr; Lreu_R0002-1.
DR   EnsemblGenomes-Tr; Lreu_R0003-1.
DR   EnsemblGenomes-Tr; Lreu_R0004-1.
DR   EnsemblGenomes-Tr; Lreu_R0005-1.
DR   EnsemblGenomes-Tr; Lreu_R0006-1.
DR   EnsemblGenomes-Tr; Lreu_R0007-1.
DR   EnsemblGenomes-Tr; Lreu_R0008-1.
DR   EnsemblGenomes-Tr; Lreu_R0009-1.
DR   EnsemblGenomes-Tr; Lreu_R0010-1.
DR   EnsemblGenomes-Tr; Lreu_R0011-1.
DR   EnsemblGenomes-Tr; Lreu_R0012-1.
DR   EnsemblGenomes-Tr; Lreu_R0013-1.
DR   EnsemblGenomes-Tr; Lreu_R0014-1.
DR   EnsemblGenomes-Tr; Lreu_R0015-1.
DR   EnsemblGenomes-Tr; Lreu_R0016-1.
DR   EnsemblGenomes-Tr; Lreu_R0017-1.
DR   EnsemblGenomes-Tr; Lreu_R0019-1.
DR   EnsemblGenomes-Tr; Lreu_R0020-1.
DR   EnsemblGenomes-Tr; Lreu_R0021-1.
DR   EnsemblGenomes-Tr; Lreu_R0022-1.
DR   EnsemblGenomes-Tr; Lreu_R0023-1.
DR   EnsemblGenomes-Tr; Lreu_R0024-1.
DR   EnsemblGenomes-Tr; Lreu_R0025-1.
DR   EnsemblGenomes-Tr; Lreu_R0026-1.
DR   EnsemblGenomes-Tr; Lreu_R0027-1.
DR   EnsemblGenomes-Tr; Lreu_R0028-1.
DR   EnsemblGenomes-Tr; Lreu_R0029-1.
DR   EnsemblGenomes-Tr; Lreu_R0030-1.
DR   EnsemblGenomes-Tr; Lreu_R0031-1.
DR   EnsemblGenomes-Tr; Lreu_R0032-1.
DR   EnsemblGenomes-Tr; Lreu_R0033-1.
DR   EnsemblGenomes-Tr; Lreu_R0034-1.
DR   EnsemblGenomes-Tr; Lreu_R0035-1.
DR   EnsemblGenomes-Tr; Lreu_R0036-1.
DR   EnsemblGenomes-Tr; Lreu_R0037-1.
DR   EnsemblGenomes-Tr; Lreu_R0038-1.
DR   EnsemblGenomes-Tr; Lreu_R0039-1.
DR   EnsemblGenomes-Tr; Lreu_R0040-1.
DR   EnsemblGenomes-Tr; Lreu_R0041-1.
DR   EnsemblGenomes-Tr; Lreu_R0042-1.
DR   EnsemblGenomes-Tr; Lreu_R0043-1.
DR   EnsemblGenomes-Tr; Lreu_R0044-1.
DR   EnsemblGenomes-Tr; Lreu_R0045-1.
DR   EnsemblGenomes-Tr; Lreu_R0046-1.
DR   EnsemblGenomes-Tr; Lreu_R0047-1.
DR   EnsemblGenomes-Tr; Lreu_R0048-1.
DR   EnsemblGenomes-Tr; Lreu_R0049-1.
DR   EnsemblGenomes-Tr; Lreu_R0050-1.
DR   EnsemblGenomes-Tr; Lreu_R0051-1.
DR   EnsemblGenomes-Tr; Lreu_R0052-1.
DR   EnsemblGenomes-Tr; Lreu_R0053-1.
DR   EnsemblGenomes-Tr; Lreu_R0054-1.
DR   EnsemblGenomes-Tr; Lreu_R0055-1.
DR   EnsemblGenomes-Tr; Lreu_R0056-1.
DR   EnsemblGenomes-Tr; Lreu_R0057-1.
DR   EnsemblGenomes-Tr; Lreu_R0058-1.
DR   EnsemblGenomes-Tr; Lreu_R0059-1.
DR   EnsemblGenomes-Tr; Lreu_R0060-1.
DR   EnsemblGenomes-Tr; Lreu_R0061-1.
DR   EnsemblGenomes-Tr; Lreu_R0062-1.
DR   EnsemblGenomes-Tr; Lreu_R0063-1.
DR   EnsemblGenomes-Tr; Lreu_R0064-1.
DR   EnsemblGenomes-Tr; Lreu_R0065-1.
DR   EnsemblGenomes-Tr; Lreu_R0066-1.
DR   EnsemblGenomes-Tr; Lreu_R0067-1.
DR   EnsemblGenomes-Tr; Lreu_R0068-1.
DR   EnsemblGenomes-Tr; Lreu_R0069-1.
DR   EnsemblGenomes-Tr; Lreu_R0070-1.
DR   EnsemblGenomes-Tr; Lreu_R0071-1.
DR   EnsemblGenomes-Tr; Lreu_R0072-1.
DR   EnsemblGenomes-Tr; Lreu_R0073-1.
DR   EnsemblGenomes-Tr; Lreu_R0074-1.
DR   EnsemblGenomes-Tr; Lreu_R0075-1.
DR   EnsemblGenomes-Tr; Lreu_R0076-1.
DR   EnsemblGenomes-Tr; Lreu_R0077-1.
DR   EnsemblGenomes-Tr; Lreu_R0078-1.
DR   EnsemblGenomes-Tr; Lreu_R0079-1.
DR   EnsemblGenomes-Tr; Lreu_R0080-1.
DR   EnsemblGenomes-Tr; Lreu_R0081-1.
DR   EnsemblGenomes-Tr; Lreu_R0082-1.
DR   EnsemblGenomes-Tr; Lreu_R0083-1.
DR   EnsemblGenomes-Tr; Lreu_R0084-1.
DR   EnsemblGenomes-Tr; Lreu_R0085-1.
DR   EnsemblGenomes-Tr; Lreu_R0086-1.
DR   EnsemblGenomes-Tr; Lreu_R0087-1.
DR   EnsemblGenomes-Tr; Lreu_R0088-1.
DR   EuropePMC; PMC2394963; 18344331.
DR   EuropePMC; PMC2519355; 18539796.
DR   EuropePMC; PMC2519358; 18539802.
DR   EuropePMC; PMC2613232; 18707622.
DR   EuropePMC; PMC2650639; 18487258.
DR   EuropePMC; PMC2827410; 20078865.
DR   EuropePMC; PMC2963342; 20720016.
DR   EuropePMC; PMC4204948; 25477944.
DR   EuropePMC; PMC4415890; 25481036.
DR   EuropePMC; PMC5665532; 29091926.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01065; 23S-methyl.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01708; L17DE.
DR   RFAM; RF01709; Lacto-rpoB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01767; SMK_box_riboswitch.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP000705.
DR   SILVA-SSU; CP000705.
DR   StrainInfo; 38415; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000135
CC   Source DNA available from Gerald Tannock
CC   (gerald.tannock@stonebow.otago.ac.nz)
CC   Bacteria available from DSMZ: DSM 20016
CC   Contacts: Gerald Tannock (gerald.tannock@stonebow.otago.ac.nz)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1999618
FT                   /organism="Lactobacillus reuteri DSM 20016"
FT                   /strain="DSM 20016"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:557436"
FT   gene            381..1703
FT                   /locus_tag="Lreu_0001"
FT   CDS_pept        381..1703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82277"
FT                   /db_xref="GOA:A5VHF3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHF3"
FT                   /protein_id="ABQ82277.1"
FT                   /translation="MTELDSLWEAIQNSFRQDTTPVTFDTLIAPAKAISLSQNQLEIEV
FT                   PTPVHRDFWRKNLNTQLKEFAQRELGRNIEPHYVLEGEFTYTNKKTEDDPTPSFEMDTP
FT                   LNPHYNFGTFVVGEGNKMAHAAAFAVAESPGSLYNPLFIYGGVGLGKTHLMEAIGNHML
FT                   QVNPNSRVKYVTSEDFTNDYINAIRNNTTEQLREEYRNLDLLLIDDIQFLANKEGTQLE
FT                   FFNTFNALHDRKKQIVMTSDRIPNEIPELQDRLVSRFRWGLTVEITPPDLETRIAILRS
FT                   KVEEDHIDIGNDTLNYIAGQIDTNIRELEGALTKVQAFANLSGERITPSLASQALKGLH
FT                   RVAKNEISIATIQKQVADFYNITQGDILGKKRVKQIVMPRQIAMYLSRELTDSSLPKIG
FT                   NEFGGKDHTTVLHAIDKIETELKKDTDLQNDITKLKAKLRS"
FT   gene            1879..3021
FT                   /locus_tag="Lreu_0002"
FT   CDS_pept        1879..3021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82278"
FT                   /db_xref="GOA:A5VHF4"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHF4"
FT                   /protein_id="ABQ82278.1"
FT                   /translation="MNFTINRSAFISQLNNVLRAISSKTTIPILTGLKMVVNEDNIVLT
FT                   GSNSDITIESVINANDADNDLTIEETGAIVLPARFFSDIVKKLPDKKVTIEVTSGFQAD
FT                   ITSGSAKFQINGQDAENFPHLPEIETNKSVTLPNDILKEVIRQTVIAVSKQESRPILAG
FT                   VHMMLKDGVLTAVATDSHRLAQRKVVLENIDNGIDFDVIIPGKSMEELSGMISDVHEDV
FT                   QMQVTENQVLFIFGNTHFYSRLLEGNYPETSQLIPQTADTTVELEAGTFLSSIERASLL
FT                   SHESRNDVVKLSLKPSENLVRISGDSPDIGTVEEEVVTSALDGNDLEISFNPNYMKDAL
FT                   RSFGQATIKISFTSPLRPFTLVPTEDQENFVHLITPVRTF"
FT   gene            3268..3489
FT                   /locus_tag="Lreu_0003"
FT   CDS_pept        3268..3489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0003"
FT                   /product="S4 region, YaaA"
FT                   /note="TIGRFAM: S4 region, YaaA"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82279"
FT                   /db_xref="GOA:A5VHF5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHF5"
FT                   /protein_id="ABQ82279.1"
FT                   /translation="MEEKSVLIDSPFITLGQLLKEEGIIPTGGAAKWFLKENTVLVNDE
FT                   PDDRRGRKLYPEDKIQIPDHQLLVIKSK"
FT   gene            3498..4622
FT                   /locus_tag="Lreu_0004"
FT   CDS_pept        3498..4622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82280"
FT                   /db_xref="GOA:A5VHF6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHF6"
FT                   /protein_id="ABQ82280.1"
FT                   /translation="MILTELHLHHFRNYQDLTVHFNPGVNVLIGHNAQGKTNMLEAIYV
FT                   LSLTKSHRTSNDHELINWQEKSALISGTVEKSIGKIPLELQFSSKGKKAKVNHLEQARL
FT                   SQYVGQLNAILFAPEDLSLVKGSPALRRHFMDREFSQMSSKYLYNAGQYRTLLRQKNKY
FT                   LKQLKYRQQTDRVLLGVLSDQLAAFGAEVIIARQHFLKHLEGWAADLHQEISLNKESLR
FT                   LEYVNQLKVSDDTTVEEAYQALFKLYQDNEQREIEQGTTIYGPHRDDIRFLVNDKNVQA
FT                   FGSQGQQRTTALSVKLAEIDLMKEQTGEYPLLLLDDVLSELDTIRQTHLLTAIQNKVQT
FT                   FLTTTSLSDVARQLINEPTIFEIEHGTLNKEEVK"
FT   gene            4619..6568
FT                   /locus_tag="Lreu_0005"
FT   CDS_pept        4619..6568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase,
FT                   subunit B domain protein; ATP-binding region, ATPase domain
FT                   protein domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase, type IIA, subunit B, region 2 domain
FT                   protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82281"
FT                   /db_xref="GOA:A5VHF7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHF7"
FT                   /protein_id="ABQ82281.1"
FT                   /translation="MSNEQQKETKMELASEYDASQIQVLKGLDAVRKRPGMYIGSTSAQ
FT                   GLHHLVWEIVDNGIDEALAGFCDEINVVVNPDNSITVKDNGRGIPVDTQKETGKSALET
FT                   VFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELDVKVARQGKRYYMDFDHGHVKS
FT                   AMKVIEEGLPETEHGTTVHFKPDPEIFRETTTYNIKTLTDRLRELAFLNKGLKITIEDL
FT                   RQADHERKEFHYEGGIRHYVEYLNEDQNVLFDPPIYVEGKENDITVEVSLQYTDSYRSN
FT                   LLTFTNNIHTYEGGTHETGFKMALTRVINDYGHKAGILKSNETLSGDDVREGLTAVVSI
FT                   KHPDPQFEGQTKTKLGNSDARTATDHVFAATFNRFLLEHPDEARQIIEKGQLASKARVA
FT                   AKRAREVTRKKSGLEISNLPGKLADNTSKDPEISELFIVEGDSAGGSAKQGRSRLTQAI
FT                   LPIRGKILNVEKATLDRVLANDEIRSLFTALGTGFGDDFDITKANYHKLIIMTDADVDG
FT                   AHIRTLLLTLFYRFMKPMITHGYVYIAQPPLYQVRQGKFVKYIDSDEELEQVVSSLQPS
FT                   PKPVIQRYKGLGEMDAEQLWETTMDPENRHLLRVKLDDAEQADKIFPMLMGTKVGPRRD
FT                   FIEQNAKFVENLDL"
FT   gene            6611..9115
FT                   /locus_tag="Lreu_0006"
FT   CDS_pept        6611..9115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0006"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82282"
FT                   /db_xref="GOA:A5VHF8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHF8"
FT                   /protein_id="ABQ82282.1"
FT                   /translation="MAEQDMPNRITDVNLTSQMKNSFLDYAMSVIVSRALPDVRDGLKP
FT                   VQRRILYGMNELGVTPDKPYKKSARIVGDVMGKFHPHGDSSIYEGLVRMAQDFSYRYML
FT                   VDGHGNFGSVDGDGAAAMRYTEAKMSKIAVEMLRDINKDTVDFHDNYDGTEKEPDVLPA
FT                   RFPNLLVNGASGIAVGMATNIPTHNLGEVINGLHMLMNDPDITTEGLMKAIPGPDFPTG
FT                   GVVMGKSGIRKAYETGRGTIIVRAKVDIEEQKNGKQRIIVHEIPYMVNKAKLIERIAEL
FT                   ARNKDIDGITDVNDETDRDGMRIVIDVRRDASAEVILNNLYKMTLMQTTFNFNMLAIVN
FT                   GAPKILSLKQILQYYLEHQESVVRRRTEFELKKAQNRAHIVAGLRIALDHIDEIINIIR
FT                   NSQTSEVAKNELMNNYGLSDRQAQAILDMRLVRLTGLEREKIEDEYQKLMAAIADYKDI
FT                   LAHRERINQIIYDELMEIQKRFGDERRTELQVGDITNIEDEDLIEEEDIIVALTHNGYI
FT                   KRLPVDEFKSQHRGGRGVKGMGVHKDDFIEQLISSSTHDMLLFFTNSGKVYSMKGYEVP
FT                   EYGRAAQGIPIINLLGINNKEKISAVINVSHETNDDDKYLFFTTKLGTVKRTAVTEFKN
FT                   IRSNGLKALNLHENDELIDVEVISEDQPMIIGTHNGYALSFKSSVVRSMGRSAAGVRGI
FT                   RLRDEDYVIGAAPLNSDSKVLVISENGFGKQTSASEYPIKGRGGLGVKTVNVTAKNGPL
FT                   VGLTTVNGDEDIMLVTDQGVIIRFGIESVSQTGRSAVGVHLIKMDNGARVATIAKVDKE
FT                   VDEETEEATNNSSQEESQPTEN"
FT   gene            9318..9614
FT                   /locus_tag="Lreu_0007"
FT   CDS_pept        9318..9614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0007"
FT                   /product="SSU ribosomal protein S6P"
FT                   /note="PFAM: ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82283"
FT                   /db_xref="GOA:A5VHF9"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHF9"
FT                   /protein_id="ABQ82283.1"
FT                   /translation="METRKYEITYIIRPDIEESAKSELVDRFDKILADNGATIADSKDW
FT                   STRRFAYPIAKYTEGTYHVVNLTTDSDQALNEFDRLAKFSDDILRHMIVKLDA"
FT   gene            9652..10215
FT                   /locus_tag="Lreu_0008"
FT   CDS_pept        9652..10215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0008"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82284"
FT                   /db_xref="GOA:A5VHG0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHG0"
FT                   /protein_id="ABQ82284.1"
FT                   /translation="MLNRAVLTGRLTRDPELRYTTSGTAVVSFTLAVDRQFRNQNGDRD
FT                   ADFINCVIWRKSAENFSNFTHKGSLVGIEGRIQTRNYENQQGNRVYVTEVVVDNFALLE
FT                   PRQNGGMNQSGVQQPFNSNQQSFGAQAPQYGSQPQPGNNAPQSNPSPSMDNGFDPNQNA
FT                   GNQFPGSSDDGGQSIDLADDELPF"
FT   gene            10249..10485
FT                   /locus_tag="Lreu_0009"
FT   CDS_pept        10249..10485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0009"
FT                   /product="SSU ribosomal protein S18P"
FT                   /note="PFAM: ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82285"
FT                   /db_xref="GOA:A5VHG1"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHG1"
FT                   /protein_id="ABQ82285.1"
FT                   /translation="MAQQRRGGRRRRKVDFIAANHIEYIDYKDTDLLRRFISERGKILP
FT                   RRVTGTSAKNQRKLTIAIKRARIMGLLPFVAED"
FT   gene            10702..12720
FT                   /locus_tag="Lreu_0010"
FT   CDS_pept        10702..12720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0010"
FT                   /product="phosphoesterase, RecJ domain protein"
FT                   /note="PFAM: phosphoesterase, RecJ domain protein;
FT                   phosphoesterase, DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82286"
FT                   /db_xref="GOA:A5VHG2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHG2"
FT                   /protein_id="ABQ82286.1"
FT                   /translation="MRKIFSRENWEFYFEHPAVRWNVCYIVLLTIIGLILGFMDNWIIG
FT                   LIVLVIAVIGGAISIRRLRKLVVDAHEYLNELTYKVQRGQQEALLEMPMGMIMLNKRHE
FT                   VEWINPYMARYFNLEIVVGKPIADVDAKLAELIKDHADDKQTQVVTWRDHQFEFLVQHH
FT                   GQVVYLLDITKYEQISAQYKDEQIFIGNIYLDNYDELIQGMSDSDVSNLHNYVTSQISD
FT                   WAVANHLLMKIIDDDNYLIIGHQASLKELEKQKFKILDVIRENTSKQNSPVTLSVGIAY
FT                   GENNLIKLADTAQNNLDLALGRGGDQVVVRAQDQEARFYGGKTNPMEKRTRVRARMISQ
FT                   ALQELMAQSDQLFVMGHTNPDMDSIGACLGIRRIAEMNGKECWIVIDDEHPHSDIQRLM
FT                   HEIDNYQTIKDHIISPVEALEKATNNSLLVMVDHAKRGITIAPELYDKMQNRLVIIDHH
FT                   RRGEDFPENPLLVYIEPYASSTCELITEMFEYQPREGKGLNKLEATAMLTGIQVDTKSF
FT                   TKSAGTRTFDAASYLRSAGADGLMIQSFMKENPETFMMRNHLISRAEINDKIALCTGEE
FT                   GQVYDPVTAAQAADMLLQMSGIEASFVIFERADNKIGISARSMGNVNVQVIMEKMGGGG
FT                   HLANAATQISDKDITQVKQELVDILTKPDKEQDDTEE"
FT   gene            12726..13178
FT                   /locus_tag="Lreu_0011"
FT   CDS_pept        12726..13178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0011"
FT                   /product="LSU ribosomal protein L9P"
FT                   /note="PFAM: ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82287"
FT                   /db_xref="GOA:A5VHG3"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHG3"
FT                   /protein_id="ABQ82287.1"
FT                   /translation="MKVIFTQDVRGRGQRGQIKEVPDGYAQNYLIKRGLAKQATKAAMS
FT                   QLKGQQRAEEKHAAEELADAKRMKKILEDDNTVVELSGKAGTDGRMFGSISTKQIATAL
FT                   QKQFDLKIDKRKIELAAPIKALGYVNVPIKLHPEVEAQIRVHIAEK"
FT   gene            13212..14603
FT                   /locus_tag="Lreu_0012"
FT   CDS_pept        13212..14603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0012"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase, N-terminal domain protein; DnaB domain
FT                   protein helicase, C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82288"
FT                   /db_xref="GOA:A5VHG4"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHG4"
FT                   /protein_id="ABQ82288.1"
FT                   /translation="MDNAPVQEEPRDIEAEKAVLGAAFLSKNALADAMEYLEPQDFYRK
FT                   AHQIIFEKMVQLNDADQPIDPLTMKNVLDQDNQTENVGGVAYIAELATAVPTAANVVYY
FT                   SKIVHDKAISRRLINTATKIINDSYAGNDKIEDQLDRAEQEIMSVSENSRQTGFKSISD
FT                   VLQESINHVSELSSQDSEITGLSTGYAQLDEMTTGLHKDELVIIAARPAVGKTAFVLNI
FT                   AQNVATRTDNTVAIFSLEMGAESLANRMLCAEGNINANHLRTGQLTQDEWQSLFIATGA
FT                   LSNASIYIDDTPGIKVAEIRARCRRLAKEKGNLGLIVIDYLQLIEGSNPDNRQQEVSEI
FT                   SRQLKKLAKELEVPVIALSQLSRGVEQRQDKRPVLSDIRESGSIEQDADIVSFLYRDDY
FT                   YEHDEDSEDNNNPGNNQDDDGSNASEVEVIIEKNRSGPRGTVKLLFAKSYNKFTSISYI
FT                   PEDNN"
FT   gene            14725..15927
FT                   /locus_tag="Lreu_0013"
FT   CDS_pept        14725..15927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0013"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82289"
FT                   /db_xref="GOA:A5VHG5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHG5"
FT                   /protein_id="ABQ82289.1"
FT                   /translation="MNHQGVELKWLLFGMFLGSIGNSFVWPLTTIYIHDQLHESLTVSG
FT                   IVLLFYSGANVVGSYISGMLFDRANPRKLMIGGTLLATIVMTIMIFFNGWPIYGILLTV
FT                   IGFFNGWIITMVNSFATRSGRDGRYVFNMLYFANNLGMVIGTTIVGPLYQYADGNVSPM
FT                   FLITTILYTMFSLVVIFFFKDSQQTVAKTEDVEDEEENKTVNIKMPQANLWINWIFFIA
FT                   LVVIWTMYEQWASNLSVFMTDQGISMTKYSLLWTLNGILIVVFQLGITWLNRWVNRPYA
FT                   QVFIGMFTIGFSFVLLLYAHSYSWFVAAMVVLTIGEATALPTMPAIVNSLSPVAVKGKY
FT                   QGILNAFSSLGKAIGPLFGGLMIEATSYHILFIICAISIFVMEIIVVFVIKIKRAKAVE
FT                   Y"
FT   gene            15940..16266
FT                   /locus_tag="Lreu_0014"
FT   CDS_pept        15940..16266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82290"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHG6"
FT                   /protein_id="ABQ82290.1"
FT                   /translation="MFYNNFDNVHGEDRYGMVGKTGDPFREECKLGISCYQCHEQPLVI
FT                   AERNWMDTNNDDSQRYQIVVVCEHCGAVDEFIVNNGREHQISKLKRSKYQPTEKNIINN
FT                   GTVN"
FT   gene            16371..17249
FT                   /locus_tag="Lreu_0015"
FT   CDS_pept        16371..17249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0015"
FT                   /product="Polyphosphate:AMP phosphotransferase"
FT                   /EC_number="2.7.4.-"
FT                   /note="PFAM: protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82291"
FT                   /db_xref="GOA:A5VHG7"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHG7"
FT                   /protein_id="ABQ82291.1"
FT                   /translation="MKTKKYRYTGKDFDIKTAPTKVKDSADDLKKIKKKIRKNVKSIKN
FT                   AQKMMYARRHYGVLVVFQAMDAAGKDSMISHIFAGVNPVGFKVANFKQPTGRELRHDYL
FT                   WRINRELPMRGDIGVFNRSYYEDVLVSRVHPALILQSNIPGIESVHDVNNKFFDSRYED
FT                   IRQYESYLTRNGYLIVKFFLHVSKEEQKKRFLARIDTPEKNWKFSAADIRERQYWDDYQ
FT                   KAYEKAINATATKENPWYVIPADDKWYSRLIVSDILTKKINSLPLAYPEVSPEQEMSLR
FT                   QARKELIAEDK"
FT   gene            complement(17279..17836)
FT                   /locus_tag="Lreu_0016"
FT   CDS_pept        complement(17279..17836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0016"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82292"
FT                   /db_xref="GOA:A5VHG8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHG8"
FT                   /protein_id="ABQ82292.1"
FT                   /translation="MSFGEQILSRCKELGLTQQNVADELHITRQTLSKWENNKSYPDLK
FT                   LLLALSEIYHVSVDSLLRENKDLTSFLNRDKASQAFNIIRGLFWLLIGFYFWSPSNYWS
FT                   NILIPILFCILLEYLYYKECFFLGKYWYKQSHYTLLGYIWTALMIIIVIYGLINKHLNM
FT                   LLYCFILAIYSFFHQYIYKPRK"
FT   gene            complement(18213..18288)
FT                   /locus_tag="Lreu_R0001"
FT                   /note="tRNA-Lys3"
FT   tRNA            complement(18213..18288)
FT                   /locus_tag="Lreu_R0001"
FT                   /product="tRNA-Lys"
FT   gene            18438..18872
FT                   /locus_tag="Lreu_0017"
FT   CDS_pept        18438..18872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0017"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82293"
FT                   /db_xref="GOA:A5VHG9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHG9"
FT                   /protein_id="ABQ82293.1"
FT                   /translation="MALKKDKFEQMNRLLRNYMINMKHFYTELAPELDVTPQQAHTLFY
FT                   IEKHAGLIQRELGDHFHLRNASVTSMVKNLERDGYIIRKADQESARIKRIFLTKKGEEK
FT                   TNEVKEIFDQAYLQIIARLDERDIDAIVKGMTNINNNLKK"
FT   gene            18960..20681
FT                   /locus_tag="Lreu_0018"
FT   CDS_pept        18960..20681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0018"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82294"
FT                   /db_xref="GOA:A5VHH0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHH0"
FT                   /protein_id="ABQ82294.1"
FT                   /translation="MNRNKFSFRSFFSLINQLHPRYIKLFVGILLGFISTGANLFVPQL
FT                   AQKLINNFKSISPTLAILTVVIFIAGLITSALSELLLGIFGENVVSKLRKQLWQKLLKM
FT                   PVKYFDDVKTGEISSRLVNDTSQVKDLLASTLPNAMTSLLQFVGALVIMLAMDWRMTLL
FT                   MFVAVPLVILVMLPVMNQSRKIGRVRQDELAKFASDSTDVLGEVRLVKSSNGEEHELAK
FT                   GNRRIDNLYHVGRKEALINSVTQPITNMLMMIMFLGILGYGAIRVMNGAMTMGALVSFL
FT                   MYLFQIISPVVVISQLFNNMAKTSGATERIQQILTEPEEFAADKAEKDIASAPLKFENV
FT                   DFAYEEGKPVLRDVSFETKPNAVVAFAGPSGGGKSTIFSLIERFYQPTGGKILIGEENI
FT                   ENVDLAKWREQIGLVSQDAAVMPGTIRDNLTYGLRREVSDEELWDALRMAYADGFVSEM
FT                   EDQLETEIGERGIKLSGGQRQRIAIARAFLRDPKILMLDEATASLDAESEAMVQKALGD
FT                   LMQGRTTLVIAHRLSTIVDADKIYFIENGTVSGAGTHQELLKTTPLYAQYVKDQFK"
FT   sig_peptide     18960..19082
FT                   /locus_tag="Lreu_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.934) with cleavage site probability 0.685 at
FT                   residue 41"
FT   gene            complement(20774..20849)
FT                   /locus_tag="Lreu_R0002"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(20774..20849)
FT                   /locus_tag="Lreu_R0002"
FT                   /product="tRNA-Lys"
FT   gene            21025..21732
FT                   /locus_tag="Lreu_0019"
FT   CDS_pept        21025..21732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0019"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82295"
FT                   /db_xref="GOA:A5VHH1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHH1"
FT                   /protein_id="ABQ82295.1"
FT                   /translation="MAKKILVVDDEKPISDIIKFNLEKEGYEVVVAYDGEAALEQVEAE
FT                   NPDLIILDLMLPKIDGLEVAKRVRAKHTMPIIMVTAKDSELDKVLGLELGADDYVTKPF
FT                   SNRELVARVKANLRRQATLKAPAEEENNTDIQIGDLTIHPEAYTVTKRGENINLTHREF
FT                   ELLHYLAQHIGQVINREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPQWLITR
FT                   RGVGYYLANPDQN"
FT   gene            21746..23611
FT                   /locus_tag="Lreu_0020"
FT   CDS_pept        21746..23611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0020"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein domain protein; PAS fold domain protein;
FT                   SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82296"
FT                   /db_xref="GOA:A5VHH2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHH2"
FT                   /protein_id="ABQ82296.1"
FT                   /translation="MNSKLKFYQSIRFKIALVFVLILMLTLECVGAVFVRQLEHQNLNT
FT                   FKQTIELPSYVDNSLAEQLSRSNTKKANKQINQILSEVNNNNISEIRVVDSKSIVRGTS
FT                   NADNRSAIGQKTTDQAIKATLLNNRSHTENLYDNSNHTRYYVNVIPLVDNSNNNVVGAV
FT                   YLRASLESVYSNINNITLVYLSAAMITIVLSLILAIIISQEITRPIEEMRKQTLRIARG
FT                   DYSGQVKVLGNDELGQLAGAVNNLSVRVEEAQESSDSERRRLDSILSHMSDGVLATDRR
FT                   GNVTIVNNMALQLLGVENEDDLIGKSIIDVLDIRHDYTVRQLVNGEQREMIIDMSNSGN
FT                   NLILNAYFSPIQRESGFVSGLVCVLHDVTSQQKEERERKQFVSNVSHELRTPLTSVRSY
FT                   VEALSDGAWQDKEIAPQFLKVVQDETDRMIRMINDLLSLSRMDAGTTKLNLEYVNINEL
FT                   FNYILDRFDMIIKKEEDPKKKKYTIERYFTKKDLWVEIDTDKFTQVIDNIMNNAIKYSP
FT                   DGGVITTRLLETHNHVILSISDQGLGIPRKDLGRIFDRFFRVDKARSRKQGGTGLGLAI
FT                   SKEVINMLGGQIWVDSVEGKGSTFYISLPYVPYEEEDWDDEEAEK"
FT   sig_peptide     21746..21841
FT                   /locus_tag="Lreu_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.942) with cleavage site probability 0.789 at
FT                   residue 32"
FT   gene            23589..24884
FT                   /locus_tag="Lreu_0021"
FT   CDS_pept        23589..24884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0021"
FT                   /product="YycH family protein"
FT                   /note="PFAM: YycH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82297"
FT                   /db_xref="InterPro:IPR009996"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHH3"
FT                   /protein_id="ABQ82297.1"
FT                   /translation="MMKKLKSNWQAIALTVVVLLSLFISWIVWTNPFPFEGARHENFNN
FT                   NQSQQYTPQSMGDVYLPTKAVETNEKGTQNQLYSPKANLILSVKKELEDWKLGRTNVVK
FT                   QNNSDVYLSYLRRRNSLMLTYPDEVPSSVFNETFSQSIDTDRVNQINHIVIPLNGQHEI
FT                   YLLGDHHYSVYRVRVEKGKFNRIRQLLKSMDRIPVDHKIINGIAVMMYPRPFELPALGY
FT                   QITAQNIDTLSASLMSTNQHTTITANRNGNETTYTDGTNRRLIFNRQNGTLKYENYLSK
FT                   DDRESTSQIFPHFYNKLTTIGIPLDNLRYDEVSEHGRRLNYRAYVNSFPIFNSDGYGEV
FT                   TLESTSGGNERFWLSLYSLQVPLPIDHQMVKLPSSADVINQLHATNRMRDIKDLRVGYI
FT                   WKTDKDSHVVKLVPTYFIKYRGHWVEYTELEK"
FT   sig_peptide     23589..23681
FT                   /locus_tag="Lreu_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.989 at
FT                   residue 31"
FT   gene            24897..25739
FT                   /locus_tag="Lreu_0022"
FT   CDS_pept        24897..25739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0022"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82298"
FT                   /db_xref="GOA:A5VHH4"
FT                   /db_xref="InterPro:IPR018604"
FT                   /db_xref="InterPro:IPR042274"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHH4"
FT                   /protein_id="ABQ82298.1"
FT                   /translation="MNFKRIQWIFILAFLLFDIFVGSSLILETRFTVSNGQQNRQSTVL
FT                   KEMRNDSISYGELSNKQQTGYYIAGKKSSDGGDLEQETGKLRNQNFRLSSGTLTSEFDK
FT                   PIKITESNNIRRVDRLLKNKKMVSLGNHYRYNKELSDKNTLVYTQMLEGKPLFSNDGQI
FT                   RFRLNSDHEITGYTQTYLQDVEILRQRSNTISQRRAITWLYKHNQIPNNSRIRWSVLSY
FT                   SKLLNTTTDDKAVYVPTWTVEIKTKNSGAIQQLQVNAFNSTVMKETPDSVNTNSLNNK"
FT   gene            25757..26563
FT                   /locus_tag="Lreu_0023"
FT   CDS_pept        25757..26563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0023"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82299"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHH5"
FT                   /protein_id="ABQ82299.1"
FT                   /translation="MTETDPLRYSVLASGSTGNVTYLETRNHRILIDAGLSGKRIENLM
FT                   KKIDRSLKDVDAIFVTHEHSDHTHGVGVLARRYGMDVYANEGTWQAMADKVGKIPLAQK
FT                   HIIAPNTVKDLGDMDIESFAVSHDAAQPQFYQVHHNNKTFCIITDTGYVSDRVTGTIRN
FT                   ADAYVMECNHDTEMLRMGPYSWPLKQRILGDEGHLSNEEGADALMSVVGRRTKEIFLGH
FT                   RSQHNNMRSLAHLTVASLMEQHDFGVDHDFKLQDAEPEEPSKLMTL"
FT   gene            26665..27939
FT                   /locus_tag="Lreu_0024"
FT   CDS_pept        26665..27939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0024"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap; SMART:
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82300"
FT                   /db_xref="GOA:A5VHH6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHH6"
FT                   /protein_id="ABQ82300.1"
FT                   /translation="MNRIKQAFKDRLWLGVIIVGLFAGLIGGGIALGINNLVQHHEEVT
FT                   STRVPAGSNKSGGTKVNKNKADLNGEASQAYKSVQGAVVSVINKQKVQQSSGTLGIFGY
FT                   GNSSNSSSDSSSDNKLETASEGSGVIYKKSGNSAYVVTNNHVVKGSNALQVILSNGKKV
FT                   NADLVGADSATDLAVLKINATNVKTVASFGNSNSIVPGQDVLAIGSPMGSEYANTVTKG
FT                   IISAKDRTLKAGTDGTLTSVIQTDAAINSGNSGGPLINMAGQVIGINSMKLASDTQGSS
FT                   VEGIGFAIPSNEVVTIINQLIKNGKITRPSLGISMVDLSNVTSDQQQSVLKLPTSVSKG
FT                   VVIIDVNSGSVADTAGLKKYDVITKLGDTQVTDAGSLKAALYKYKVGQNAKVTYYRDGQ
FT                   RHTATLHLTKSADTTSTDDSQQDNN"
FT   sig_peptide     26665..26766
FT                   /locus_tag="Lreu_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.629) with cleavage site probability 0.500 at
FT                   residue 34"
FT   gene            28168..28665
FT                   /locus_tag="Lreu_0025"
FT   CDS_pept        28168..28665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0025"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="PFAM: phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82301"
FT                   /db_xref="GOA:A5VHH7"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026038"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHH7"
FT                   /protein_id="ABQ82301.1"
FT                   /translation="MNNPRFKYPDTKAYEFVVHRLEERGVNLEELAKIVYETQKGFEPD
FT                   LTLEICQKFLIDTMHKRELLNSAMVALELDRLTEEGKVDEPLAGIIRNDAGVFGVDETL
FT                   ALQIANIYGTIGTTNFGYFDRVKSGIIAKFDHDKVHVNTFIDDILAAIVAAVCGKIAHQ
FT                   YA"
FT   gene            28974..29960
FT                   /locus_tag="Lreu_0026"
FT   CDS_pept        28974..29960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0026"
FT                   /product="protein of unknown function DUF534"
FT                   /note="PFAM: protein of unknown function DUF534"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82302"
FT                   /db_xref="GOA:A5VHH8"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHH8"
FT                   /protein_id="ABQ82302.1"
FT                   /translation="MKRIMGYIIIGIVVIGGYFGLLRLHQQTTKPVVGILTMMHHPALD
FT                   QIQQGVVAGLAEEGYRNGKNIKIEYQNANGDQGNLNTMANKLVNDHAKVIVGITTPACQ
FT                   ALANATKDIPIVMGGIGDPVGAGLVKNEKHPEGNVTGVHDVNPSEQQIALVKKFIPNIK
FT                   TLGAIYTSSNTSSESQYRTMVKAAHKLHVNLKTYTIANANELNQTSQTMLSKVDAVIVP
FT                   SDNTIAGSMGVLVKNADAVNKPVFPSADTMVKDGGVAYISLSQYGQGKAAGKITARILK
FT                   GEKPGQMAVNNYHHGEPVLNLKQARKLGIKVPADFQREAEQHGTVFK"
FT   gene            30429..30908
FT                   /locus_tag="Lreu_0027"
FT   CDS_pept        30429..30908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0027"
FT                   /product="protein of unknown function DUF163"
FT                   /note="PFAM: protein of unknown function DUF163"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82303"
FT                   /db_xref="GOA:A5VHH9"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHH9"
FT                   /protein_id="ABQ82303.1"
FT                   /translation="MNIKIIGVGKLKEKYFKAGIAEYAKRLGRYCKFEIVEVPDEKAPE
FT                   SLSQAEMDEVMAKEGERILDKIKDREYVYALAIKGKERSSEEFAKEINKLTTYGHSDIT
FT                   FVIGGSLGLSPAVLKRADAQISFGRFTLPHQLMRLVLSEQIYRAFTIINGLPYHK"
FT   gene            31051..31269
FT                   /locus_tag="Lreu_0028"
FT   CDS_pept        31051..31269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82304"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHI0"
FT                   /protein_id="ABQ82304.1"
FT                   /translation="MAGICILVMQGKASAMIVNEARLTLPNEKRIEYDEFERYQFRAKQ
FT                   LRTWWQVKRPKYKIDWSFYHKKRGYWD"
FT   gene            31343..31879
FT                   /locus_tag="Lreu_0029"
FT   CDS_pept        31343..31879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0029"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82305"
FT                   /db_xref="GOA:A5VHI1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHI1"
FT                   /protein_id="ABQ82305.1"
FT                   /translation="MKKVGIIVGSVRPNRRSMQVANWLKVQLKKSTKVQFDIIDLKEVN
FT                   LPMMDEPKIPYLGLYVHEKTRKWSELVQSYDGFVLVFPQYNWGYPAVLKNAIDYLGKEW
FT                   QGKPVSLVTFGGHGGSQAQIAMKLVVTGLKMAALPVDLQVNLLPDDSTSTADRKLNTYN
FT                   TQAALLKTAFENELS"
FT   gene            32098..33270
FT                   /locus_tag="Lreu_0030"
FT   CDS_pept        32098..33270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0030"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82306"
FT                   /db_xref="GOA:A5VHI2"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHI2"
FT                   /protein_id="ABQ82306.1"
FT                   /translation="MNRQFDFLMPSVNFFGPGVIAKIGDRAKMLNMHKPLIVTTEGLSK
FT                   IDNGPVKQTVASLEKAGVDYAVFTGAEPNPKIRNVQAGKKMYQDENCDSIITVGGGSAH
FT                   DCGKGIGIVLTNGDDISKLAGIETLKNPLPPLMAVNTTAGTGSELTRHAVITNEKTHLK
FT                   FVVVSWRNIPLVSFNDPMLMLDIPKDITAATGCDAFVQAIEPYVSVDHNPITDSQCKEA
FT                   IQLIQTALPEVVANGHNIEARTKMVEAEMLAGMAFNNANLGYVHAMAHQLGGQYDAPHG
FT                   VCCALLLTTVEEYNLIACPERFAELAKVMGFDTTGLTLYEAAQKSIDGMREMCRLVGIP
FT                   SSIKEIGAKPEDFEMMAKNALKDGNAFSNPRKGTVEDIVKLYQKAYDGIY"
FT   gene            33514..34377
FT                   /locus_tag="Lreu_0031"
FT   CDS_pept        33514..34377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0031"
FT                   /product="sugar transport family protein"
FT                   /note="PFAM: sugar transport family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82307"
FT                   /db_xref="GOA:A5VHI3"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHI3"
FT                   /protein_id="ABQ82307.1"
FT                   /translation="MIYLLALIPAIGWGAMPLITGKIGGSPVNQMFGIGAGASIVGIIA
FT                   YLITKPTVSVTAFWFSLAIGCLWTIGQVGQFISFKHMGVSNTMPLSSAFVLVMTSFVGI
FT                   FFFDEWQGARALSIGLTACVVVIIGAVLTSISDGTSDKKVSTKWVLFLLVTTIGYCAYS
FT                   IFPKMPQVAHESSQGIFLPEVLGILLGSVIYTICSGNAKAFKQKEQYLNILGGLSWGIG
FT                   NFAYVFVGKALGVVTASIFGQMNVIISTFGGILLLHETKTKREMIYTVVGIILIVIGSI
FT                   LTVIAN"
FT   gene            complement(34492..35268)
FT                   /locus_tag="Lreu_0032"
FT   CDS_pept        complement(34492..35268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82308"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHI4"
FT                   /protein_id="ABQ82308.1"
FT                   /translation="MTETLNWDHTMVDVTNLQDAIDYFNSKGLAFTPGGHHEYWGTKNA
FT                   LDYFGLNYIELLTIANKEKAKAFPYENNSAIHDAVEDYFAGIQRITTIAIQTDNIEETH
FT                   QRLEGLGLNVGDITDGKRVDPAGKLIQWKIFYVNDELVNHLPAPFFIQWGNNDDQRRED
FT                   LKKQGLIKFHPAGDLFVKQAIFNVSDPEEAAKQWSALLQAEVVSEGDTYTINIGDKQLV
FT                   FKAGVENRLFKLIFHGAKQPEKLQLGQIRFDLLDKK"
FT   gene            complement(35270..36082)
FT                   /locus_tag="Lreu_0033"
FT   CDS_pept        complement(35270..36082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0033"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82309"
FT                   /db_xref="GOA:A5VHI5"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHI5"
FT                   /protein_id="ABQ82309.1"
FT                   /translation="MTLKIYSFGGGQMVEAMLRAALKKKVITPETTGITDISSDRVNYL
FT                   TDTYHIQASQQPDWTAVENADLVILGVRPQDNWQEIMKELVAHHYQKDVLSIIAGVTVA
FT                   QLSSQEDLFAITRIIPNTLTDVAMGYSGVVKNNRANQTVIEDFLNSFGKVDYIDESLLD
FT                   VFTGYGVAGPNYIYNFLISFTNAGVLAGMPRQQANKLALENLRAAAAFVEQSGKHPAEL
FT                   LDINNSAGGVGITAQHELDKSTFSAGIENAVLAAVKRTKELGKQNKGD"
FT   gene            36383..37756
FT                   /locus_tag="Lreu_0034"
FT   CDS_pept        36383..37756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0034"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82310"
FT                   /db_xref="GOA:A5VHI6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHI6"
FT                   /protein_id="ABQ82310.1"
FT                   /translation="MAYQSINPFTNQVEKTFENTTDEELEQTLTTAHQLYLDWRKYNDL
FT                   EERKRQILKLGQILRERRVEYATVMSKEMGKLISEAEGEVDLCASFCDYYAAHADEFLQ
FT                   PKIIATTSGRAKVLKQSLGILVAVEPWNFPFYQIARVFIPNFIAGNPMILKDASNCPAS
FT                   AQAFNDAVKEAGAPAGSLTNLFLSYDQVNKAIADKRVAGVCLTGSERGGATVAKEAGAN
FT                   LKKSTLELGGNDAFIILDDADWDLVEKVAPAARLYNAGQVCTSSKRFIVLEKDYDRFLK
FT                   MMKDAFSKVKMGDPLDPLTTLAPLSSKKAKEKLQQQVATAVENGAKVYYGNKPVDMEGQ
FT                   FFMPTILTDITPDNPIFDTEMFGPVASVYKVSSEEEAIELANNSSYGLGNTIFSNDSEH
FT                   AERVAAKIETGMSWINAGWASLPELPFGGVKNSGYGRELSSYGIDEFTNKHLIYEARQ"
FT   gene            37932..39014
FT                   /locus_tag="Lreu_0035"
FT   CDS_pept        37932..39014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0035"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82311"
FT                   /db_xref="GOA:A5VHI7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHI7"
FT                   /protein_id="ABQ82311.1"
FT                   /translation="MTAKRNSHHKSRLRQLFATRRRRWIGIGGLIVIIILVLVSIRHAS
FT                   EEKATEKNEYNILRVTEQSDFNLTGKIEPVQTQTLTLPSGTLQNLNVKNGDHVAQGEAL
FT                   LTMHNDSTQDSVTELQGDLSKSQRTMNAQQQTINNLRQQLNGMGQGDEGYNDLRNQLTE
FT                   AQNAYADAQASVAATQQRLNTASSKVNQTLTAPFAGYVTVDQSKQNAPVITLYSDTLQF
FT                   VGQISEYDYSKLHQSADLKVKALATNRTANTQVSYLSTIPTKNSGNNTKYEVTANVSAN
FT                   KFMAGQTAKASIKQDGVQISKSAVRHGKVFVVDSDNRVRETDVSGRAVNSSYIVTDGVD
FT                   AGDRIVTNPNSKLKNNAKVD"
FT   sig_peptide     37932..38066
FT                   /locus_tag="Lreu_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.991 at
FT                   residue 45"
FT   gene            39016..39714
FT                   /locus_tag="Lreu_0036"
FT   CDS_pept        39016..39714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0036"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82312"
FT                   /db_xref="GOA:A5VHI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHI8"
FT                   /protein_id="ABQ82312.1"
FT                   /translation="MIKLKNINKYYRQGSQRFHVLHDINVDIEQGELVAIIGESGSGKS
FT                   TLINIVGFLDDDFEGTYFYQNHPIHDYSRKQFSNLRNQNVGFVFQNFKLLRGSTVADNV
FT                   GLPLLYAGKRRREIGERVSEVLEQVGLAGYEDQFPKNMSGGQQQRVSIARAISTNPKFL
FT                   IADEPTGALDTETSQEVMNLFKRLNHEEGTTIIMVTHDPHVAEQCDRIIKIIDGRIVSD
FT                   SKGGEYHADN"
FT   gene            39701..40936
FT                   /locus_tag="Lreu_0037"
FT   CDS_pept        39701..40936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0037"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82313"
FT                   /db_xref="GOA:A5VHI9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHI9"
FT                   /protein_id="ABQ82313.1"
FT                   /translation="MQTIELIKSAIQSLKANKKRSFLTIIGIMIGIAAVIAILGIGDGI
FT                   TKTMYDKFGNNAKQGQQTIEIVYNPDNVNSTVNGFTQEQVADINTQFGGEIKKAEIEQE
FT                   SDNLSTHADIGDATKSVTLSLLKKPTRDVKFIAGHNFSKRTFELGDTNALMSEKVARRQ
FT                   YGSAQNALGTTVTVNNVTYKVTGVYKSQAQFTDDGNQNSYGVDLLLPKKVYYQGDSAKE
FT                   GNTLKLTFSQGVNASAISRRVAKYLKNNSSAATQGSYQYLDMEKALKQFSSQMSIITTF
FT                   ISFIAAISLFIAGIGVMNMMYISVSERTQEIGIRLAVGATPFNIMMQFLVEAVILTMTG
FT                   GLLGFLGGAGLAHLLAPLLSSAIGGGGIHIHAHISLNAFLLAFGTSAAVGLIFGILPAR
FT                   QAANKNLIDILR"
FT   gene            41186..41590
FT                   /locus_tag="Lreu_0038"
FT   CDS_pept        41186..41590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82314"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHJ0"
FT                   /protein_id="ABQ82314.1"
FT                   /translation="MKGLLRQRRLQVAHLKKHKAAKEDSSDKVKDDDSDDSSSVADTND
FT                   SEATSASTAATSGNQTAQPAQSQNTTQATAVSNSGQTASPKATTNNYKGNRSVANTNNR
FT                   RTVSRKTTQTVSTQQPVTVEDGMNFSYRAA"
FT   gene            41600..41737
FT                   /locus_tag="Lreu_0039"
FT   CDS_pept        41600..41737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82315"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHJ1"
FT                   /protein_id="ABQ82315.1"
FT                   /translation="MIDNNTSVEEFYKNAKEGNGSVTYKGQTIYYKAKGNNQYQVTTAK
FT                   "
FT   gene            41926..43320
FT                   /locus_tag="Lreu_0040"
FT   CDS_pept        41926..43320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0040"
FT                   /product="peptidoglycan transpeptidase precursor,
FT                   ErfK-YbiS-YhnG family"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82316"
FT                   /db_xref="GOA:A5VHJ2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR022029"
FT                   /db_xref="InterPro:IPR038054"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHJ2"
FT                   /protein_id="ABQ82316.1"
FT                   /translation="MQKLSIKQLIIITLCLLVLVVGCMTIHQRRHFNKNVKIDNVSVGG
FT                   LTAKQALKKLQDNPQSPKIYVNNELVFTDKQSVAKFSSADEQKIKNALHSQYTFFPSSK
FT                   AKNIAIKPQNVNQDEVSKIDQAVSQKVTELNNGRKAPVDAYAVYENGRVQVKPAVGGTQ
FT                   YSLDGLHNKVENEIAGGTIYLRPVYKAPLSANSKTVQNEKAKLEELSKRSVTYQVQNKK
FT                   YQLNCGEIITRATYQNGKYHFNTGAANSKIDEINNTQATLGKSFEFKTHDGSVIKTTDA
FT                   GSYGWKISKKQAGKTLTNALVANKQTVNAKNDIYGKGYNQQGTGYNTTSNNGIGDTYAE
FT                   VSLADQHAWFYKDGKCVLSTDIVSGTNDKGNETPKGVWYIMYQQTPSILRGLNDDGSKY
FT                   ASKVQYWSPFTDSGCGFHDASWRHDWSKQAYLAKGGGSHGCINMHPDVAGQAFHDLQKN
FT                   EPVIIY"
FT   gene            43610..44086
FT                   /locus_tag="Lreu_0041"
FT   CDS_pept        43610..44086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82317"
FT                   /db_xref="GOA:A5VHJ3"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHJ3"
FT                   /protein_id="ABQ82317.1"
FT                   /translation="MIDLTLPQAFVSDFLNVFELIIIYRLVTGYLNRKIILVDFLASLV
FT                   IICVPFLEGSLEFPLIMIHLWLFDRKHDRPQIIHNNIIAMCTIIVMISLTDLGDHYMYE
FT                   IFLEGRKNISLLGWILPITDLILTVIVGILVILFIAPKVREVSIQILNPVPLWK"
FT   gene            complement(44169..44597)
FT                   /locus_tag="Lreu_0042"
FT   CDS_pept        complement(44169..44597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0042"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82318"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHJ4"
FT                   /protein_id="ABQ82318.1"
FT                   /translation="MSKYKVTATKTTTGMQVSAGTRGFEITFDEPESTNTGMNPVEILL
FT                   ASFGACQAITAQALAKKRNFDLRAFWVTIEGDLGREDVADGKNVRKFTEIRYQPHLRSS
FT                   ESDEDIKKFLADVAAKCPVENTLTYGTKFVQDGFVKVD"
FT   gene            complement(44665..45660)
FT                   /locus_tag="Lreu_0043"
FT   CDS_pept        complement(44665..45660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0043"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82319"
FT                   /db_xref="GOA:A5VHJ5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHJ5"
FT                   /protein_id="ABQ82319.1"
FT                   /translation="MTKILMTSMRDDEQTAINEYAKEHNIEIITTPKLIDDAVELTADV
FT                   DGLVIQQRSKVPADIYEKLHANGLKQIATRTAGFDMVDIKKANENDLVVTNVPAYSPRS
FT                   VAEFALMQIFRLLRKTYRFDHQVAENDFRWFSDEQSTEIHTARIGIIGVGRIGGTLAKL
FT                   LNALGATVLGYDTNPRTDLDGIVQFVSKEELLKQADVVSLHVDLNPTSKGLLTANDFVM
FT                   MKPTAGLVNASRGPVVNTADLVTALKSGEIAAATLDTFEGEETVAAADRREKGLDDQPL
FT                   VKELHEMDNVILTPHIAFFTNLAVKNMVDISLDDVMTILNSEKSPHEITL"
FT   gene            complement(45662..46849)
FT                   /locus_tag="Lreu_0044"
FT   CDS_pept        complement(45662..46849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0044"
FT                   /product="aromatic amino acid aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.57"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82320"
FT                   /db_xref="GOA:A5VHJ6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHJ6"
FT                   /protein_id="ABQ82320.1"
FT                   /translation="MPATKKEILSRLNNNFAKLTPGGIREFDYQVSTIPGIIKLTLGEP
FT                   DFNVPAAMKQAAIESINANDSHYAPGNGTFALRQAIAHFMQDRYKLEYDPKNEIAVTVG
FT                   ATEGIFASLSTIINPGDEIIIPTPTFPFYMAVTKILGGIPIEVDTSGDDFVLTPARLQS
FT                   VLEEHPNAKGLVLNYPSNPTGVTYTQDQIKALADTVKSTNLIVIADEIYSELVYGATHT
FT                   SIANYIPEQTLILNGASKSHAMTGYRIGFIAGPQELMKSVSAIHAMLVTAASNPAMAAA
FT                   VAAFGTDEGKAATQEMKDAYEQRRDFVVNSLQKLGFELINPQGAFYVFAKIPEQYGNDD
FT                   LKFATDLANEGKVAVIPGSFFGAGGQGYVRISYATSMENLTGALDNIAAFINKED"
FT   gene            47696..49933
FT                   /locus_tag="Lreu_0045"
FT   CDS_pept        47696..49933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0045"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; ATPase
FT                   AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82321"
FT                   /db_xref="GOA:A5VHJ7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHJ7"
FT                   /protein_id="ABQ82321.1"
FT                   /translation="MAQNPMNPFDNDMNDIFNQLMGGMNGFNSDNRRYLINGREVTPEE
FT                   FAEYRRTGQLPGGANPQQGGQPGPQPNAGKDSILHKLGRNLTQEAREHELDPVIGRNKE
FT                   IQETAEILSRRTKNNPVLVGDAGVGKTAVVEGLAQAIVSGDVPAAIKDKEIISIDISGL
FT                   EAGTQYRGSFEENMQKLVDEVKKAGNIILFFDEIHQIIGAGSTGDSSGSKGMSDIIKPA
FT                   LSRGELTVIGATTQDEYRNTIMKDAALARRFNSVTVNAPSKADTVAILKGIRDLYERHH
FT                   NVKLPDDVLQAAVDYSVQYMPQRALPDKAIDLIDMTAAHLAAKHPARDAKAIEKDIEAE
FT                   EKKQKAAAKKEDYKAAQDAKEKIADLKKQLSENSESEKVTATPEDVAKAVEQMTGIPVS
FT                   KIGASDVERLKDMDKRLEGKVIGQDKAVEAVARAIRRNRAGFDEGDSPIGSFLFVGPTG
FT                   VGKTELAKQLALDMFGSKDDIIRLDMSEYSDRTAVSKMIGATAGYVGYEDNGNTLTEKV
FT                   RRHPYSIILLDEIEKANPQVITLLLQVLDDGRLTDGQGNTIDFKNTVIIATSNAGYSND
FT                   APVKMGRNEDEEDLIKKLTTYFRPEFLNRFNAIVEFHSLTKEDLKQIVDLMLAEVNRTL
FT                   AKKGMDVKVTDTAKQYLIDEGYDEAMGARPLRRVIEREIRDKVTDYYLDHLDAKNLVAE
FT                   MKDGQLVIVDAKDASKDDSKEYTSPSEKKDEEKDDKKEEDKKSDEDKKDEK"
FT   gene            50822..53677
FT                   /locus_tag="Lreu_0046"
FT   CDS_pept        50822..53677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82322"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHJ8"
FT                   /protein_id="ABQ82322.1"
FT                   /translation="MRNSNTNNWRSTALIAGAILTAGVVTTTSTTDVHADNSQNNAQVS
FT                   NDQVTYDQVRATADQQLAQLQSANDSKEAQQATANEQSNAADLAQINAQIDQLKASHAA
FT                   LEQEQAGAIAQAQASTAASIEAQTSAANAEYQQQINAQQQNEATQRAANDQQYAQAVSQ
FT                   AAENQQAIADINAQYQQALSDAANTQTSQAQAAVNNYNSAVAKENDAYQGKLSAQQATN
FT                   AENVKNAEASLATATANANKPYEVATTNDVAVTGRVAKPQTDVKVPDYVAKYGIHLEVR
FT                   GYNGAIPVSDYTYPEFANTYYGEYPDSAVITNKAADSTPHDISEMPLDFQPGLLSYDTK
FT                   NDHSEKVSADGLTAAQVQVLRALALSWENGFRNNVFQNYREFYNAVNKNDGFVNVAPVD
FT                   LVSTDFADNIANQVVANRTKYNVDNNSHTVISSGMPTEATYSSIINNATQNLQKSLTSE
FT                   FNGKTVYTDVNENLTTMQAGTPTLLNYAINLYNSMQGMYYGELVNPTHIGGHAVNLLRA
FT                   GVRTVGIGFQKLTDEMTAKNGSGVSDRKNPSYAVTFDHVGFNIDHDVNLTKEVQNRNVW
FT                   GTSTVDAQLNAIKTAQYHVNKVPGTKTVTPTATDVQKATASEQQKLANVKAQAQQSLDA
FT                   LASAHQANLNKLEQQYNDAKAQVKANYDTAVTKAASVRDAALKATGAVDLQAYKAQLDS
FT                   AYQNLVKADQVAAQKLAADRDAKIANIKKTENAKLDAKINELVPSIDPQIKQLQDQHQA
FT                   VITHGDAVLAELKAENKAAYNKLAEQFNVQLAAIQQREDAKRANEVRLANNTVVLPTAV
FT                   KAANDGNVDTVAFPTVTNRLQAETTGRVQPVSAPSIVKTATQTPIAVAPVVTQTAAVAA
FT                   TTNNGTQTRVASTADNKATKADNNEKSVVKADTVAKKQTPAKKSESSQKVDQSSMSIVA
FT                   LAATALLGTLGITYSSKKRHN"
FT   sig_peptide     50822..50929
FT                   /locus_tag="Lreu_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.705 at
FT                   residue 36"
FT   gene            complement(53759..54343)
FT                   /locus_tag="Lreu_0047"
FT   CDS_pept        complement(53759..54343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0047"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82323"
FT                   /db_xref="GOA:A5VHJ9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHJ9"
FT                   /protein_id="ABQ82323.1"
FT                   /translation="MAEIYLRRAQAQDLAAIMKIIDDAKNLLKKNGSPQWQNGYPNRET
FT                   FAQDIATQTNWVLINGNKVAATATLQLTPEPTYRNITQGQWQQPDEPYATIHRVAISSN
FT                   YRGQGLSKLLFSNLLTVGQMQGIKNFRIDTHRNNKAMQHIVENFNFKRRGIIKVNDQND
FT                   PERLAYELNLGSHHKLTRINNNFMQPLIDKL"
FT   gene            54483..55946
FT                   /locus_tag="Lreu_0048"
FT   CDS_pept        54483..55946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0048"
FT                   /product="cardiolipin synthetase 2"
FT                   /EC_number="2.7.8.-"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82324"
FT                   /db_xref="GOA:A5VHK0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="InterPro:IPR030874"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHK0"
FT                   /protein_id="ABQ82324.1"
FT                   /translation="MALTWTIIWWCLLLVILVNEIAAIYTVFREKRDIAATWAWLLVLM
FT                   LIPGIGFILYAFFGRKLPHKQLARIKSQTQLKLKQALEKQKQQFINMPKPKDQTVQIYR
FT                   RTIMLFQSIDDSFLTRHNTVNIFTNGNVLFKQMFDDIAAAKKSIHIEFYTIYNDQIGNE
FT                   LRTLLEQKAAEGVEVRVLYDSWGSMGVWPSFYDHLREVGGYAAPFLMSRSNFFDFRINY
FT                   RDHRKIVVLDGEIGYVGGFNVGDQYLGRVPKFGPWRDTHLRIVGGGVYGLQRRFIGDWN
FT                   ASMKKDKDKIVHYHPYFQPIRVHGDVALQTVSSGPEAPLEKIKMGYLRLINAAQDHIWI
FT                   QTPYLIPDDSILDALKVAAHSGIDVRIMIPSMPDHAFVYRATQYYARELANHGVTIYYY
FT                   QKGFLHAKTMMIDGRMASVGSANLDFRSFKLNFEINAFIYNQNTVDDLEQIFVNDIREC
FT                   RVITPAMFAEQPRWLRVKQTVSRLLSPIL"
FT   gene            56075..59857
FT                   /locus_tag="Lreu_0049"
FT   CDS_pept        56075..59857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0049"
FT                   /product="DNA helicase/exodeoxyribonuclease V, subunit B"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82325"
FT                   /db_xref="GOA:A5VHK1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014141"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHK1"
FT                   /protein_id="ABQ82325.1"
FT                   /translation="MGTLGFVLGTAAMDHQQVLIDQLVDQVKNTPADDTFYYLVPNHIK
FT                   FETEINVLAGLRDRQGLSGSDRFASSRVQVLSFSRLAWYLLRDTPAFQKQHLSKIGMAM
FT                   LTSQVVQEQASDLRLYASEVKQPGFIQKMTAQLEELKNANITADDLTDIIYRVKSANDP
FT                   AANQAWLAKMYDVETIYHAYEARLRDRYIGNSELYRQLVSYLQKSPEVAKMHFFIDRFA
FT                   QFTANEQQVVDALITNAASTTISLTLDRGYPDQNHPNPQELPPKNNLFYSSAMQFHRLW
FT                   KFGQMHQKEVKVLQNVAFATTPRVDAELQQVDSYFKRYASEPIGPGEREELLDPQNIQF
FT                   MTTTNRMTELNNVATQIRQLVASGKYRYRDFLILSRHLDGYQTMIEPVFAAHNIPVFND
FT                   HERLMDNHPLVTLLTTLLELPQRGYRTADIIQLLKTWLLVPRTGTGDLMGLSDFQAAVF
FT                   TTENWCLKQAIEGKNAWTTNDPEKIKQLWQAPGTNLTDPKYEQSRLEKLNDQLALVKDF
FT                   VANHLLPVFDQFKQAQTGQELATALYQFLAAMGVTDRLYAWQQYQSTRDLDLARQPQQV
FT                   WTTFCQILQEYVEILGQQELRDGTNEVLADFSELLQAGFAAAQYSQIPATLDQVVVSET
FT                   GIVQSENRKVVFMIGSTDDVMPEMQESDSLLTDQDKDILSAYLDEDFQYLPGTAIDQLI
FT                   DEPFVHYTGFMNAKEQLIFSAPQSDSDDKELSISPYMHDMARYFGQPVREYPLATSKAG
FT                   QDNAIDFVSAPLATINRLVEVSRQIRDEQGVGIDRQPVMPVGWQTVAESLVKLAKQWQQ
FT                   SADAKVQAEGISLGQRLSLVAAGFHYQNKIDSLGNKLAQALYLRAAPDDERGRVLYASI
FT                   SQLQDFYINQYEYFLKYGLRLQKRDELTLSNDRIGTFFHKAMETFVTTIRENNLSFADL
FT                   AHKDNQMQRDQLIDHALVTAQENQPTLLRLINSSAQAQFQYQQLTAIVKTMLITLCRQA
FT                   EYTGSQPVKTEVQFGRIGNQQPGNLGSLDYPLKDNHHIYLRGRIDRIDNLKQGNNNFLT
FT                   VVDYKSSNHLFDLTSAYYGLSLQLLTYLNGLQANLTELETNNPRLAGALYLRLNNPTIK
FT                   AAELKKSSLDDLKLKEHQYKGILLNDPQLLRELDKSLDKQAFLYPLKEYKNGKIKANKE
FT                   ALLVTPQQLDWLQNMNKELVINAGNQILSGDLKLNPYRLLTGSNRRTGLDYSDFLDVFQ
FT                   FDNMLDQQNYRDLNPNLAKEAFDNVVQDDDEEDKK"
FT   gene            59857..64035
FT                   /locus_tag="Lreu_0050"
FT   CDS_pept        59857..64035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0050"
FT                   /product="Recombination helicase AddA"
FT                   /note="TIGRFAM: Recombination helicase AddA; PFAM: UvrD/REP
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82326"
FT                   /db_xref="GOA:A5VHK2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHK2"
FT                   /protein_id="ABQ82326.1"
FT                   /translation="MAGFKPTPAQSKAINDRGENILVSASAGSGKTAVLVNRTIELIKE
FT                   GQSIDRMLLVTFTDAAAKNMRDKIRAALQKIVQDSANPKDLRDRMSNQINRLAAADIST
FT                   IHAFCLKLIKRYYYLIDLDPQFRLLTDETERLLLQEDVWHEVSEELYRNAEEKVSGKAS
FT                   FSELVLNFSSDRDDQGLDDLILRLYEIANAQPDPEKWLQKLPDNYDLGSGSLLESNFYQ
FT                   QQLKPLVIEKLNQFIQDYRELVTRASDNGLDQAAEVIKSDEELMHQLLSSLGGITVSDV
FT                   CQMMAQQKFGSFRGRPAADDPRIDVFKDIQKQRNQLKKQWEQMVSTYLGKQEAQEPIAK
FT                   EELLTELTTFSDQFTDLLSKATESQLDAKTVDSLQKDQQMMQELLDLLQPPTWNTIRDL
FT                   FANAKFARMGGKPKDDELAEEVYKSLGSARTGIKKQFDQLVDRFFNYREDQFRLISTHA
FT                   QELLRELSAVTINFRRRYQQTKLNRHVLEFSDLEHYAYAILTPPDDQPNWQTLVKDLQN
FT                   HYQEIMIDEYQDTNRLQESILMKLTSPERKNLFMVGDVKQSIYRFREADPTLFLGKYQN
FT                   YRQGSDGEAIVLGENFRSMTNVTSFTNILFEQLMDREVGEIDYDEDAHLKYAATYYEEN
FT                   QDNKVHPTEVLLYDANALDPEKEDVEHEDDKLAGEFRMIGMRIKQMVENQELIFHPEDG
FT                   QMHPIQYGDIVLLERTKAINNSLMEEFNKLNIPLTVHDVESYFQATEVRVMMSLLKIID
FT                   NPQQDIPLVAVLRSPIVGLTNQELAFIRLQNRSVDYYAALQTFMSNYQRKALRHQSLLT
FT                   SEQVNALYEKADHFLGLLRVFRQTAQQQTLVDLIWQIYDQTGYLDYVGAMPGGHQRQAN
FT                   LHALYQRAHSYEQSSFKGLYQFIRFIEKMQEHDKDLGVAPTQLTANTVNVMTIHGSKGL
FT                   QFPVVFLIDATHGFNKGAARENAVVDAVAGVGIRYMDDQRVIYDTPQRQAVIEEIQRGE
FT                   RAEDLRVLYVALTRAEQRLVITGSFNEEMRTQSLAGSWQRWQKAYQSKNLLIGPQPRIT
FT                   ANSFMDWVGLALARYPEFNAQQLSRGNVTLEESTLADTKVTGLAADPHFTAKTYTALDV
FT                   SDGLAKIGQNASANVTEKNNTVATDASEQKIEQILRYRYPHLVATKTTAYQSVTDVKRV
FT                   FEDPDTRDMARWDYDQQQKVKTQGIYLNNNFDVPAFIQQTTHEPVATEIGTATHLVFQK
FT                   LPLDEGLINVEFVDQEIQKLVGEKLINPVVAARINREGIVAFYQTAVGQKILKHPADYH
FT                   REVPFSMIMNGHELFKGVNVSDDERILIHGIIDGYLRTDEGIILVDYKNDHLNKDYRDF
FT                   DLARIKDRYRGQLELYKEALNLMEGIPVVQMGLYLLELGEFVLFTKEGD"
FT   gene            64036..64971
FT                   /locus_tag="Lreu_0051"
FT   CDS_pept        64036..64971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0051"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82327"
FT                   /db_xref="GOA:A5VHK3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHK3"
FT                   /protein_id="ABQ82327.1"
FT                   /translation="MATIKDIAQKAGVSVSTASRALNHNPRISEKTRQRIATIAKELGY
FT                   QPNYNAQNLTRGESNMVGIIFPVTSDTAPANPFHIDLLRGISMALKPIHYEMVVAIAPT
FT                   TTDLLQSVKSMVEQSKVHNFLVLYTVKDDPITNYLRQNNLNFVVIGHPDKVQDRFVDND
FT                   NVAAGQAATDYLMDHQEVSHPVFLQSASNWAFEQDRHQGYEQSMQNHQLPALSWRYSPT
FT                   GTAVKDFIKQHPQIDSIVCVDDLLLVRLIRQLQEFNLPTICFNNSRLMGMLINQEEKVD
FT                   LQPRKLGQQAVELLFNPEEQYRIVDFKINS"
FT   gene            65035..66213
FT                   /locus_tag="Lreu_0052"
FT   CDS_pept        65035..66213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0052"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82328"
FT                   /db_xref="GOA:A5VHK4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHK4"
FT                   /protein_id="ABQ82328.1"
FT                   /translation="MEKVYIVAAQRTPIGKFNGQLASKSAVELGAIAIKAAVEKAKLSE
FT                   NDIDQVLMGNVIQAGTGQNPARQASMAAGLGEQVPAITINDVCASGMSSVDLAASLIRA
FT                   GQANVIVAGGMESMSQAPYVLPKARNGYRFGNGTLLDAMQSDALNDVYGGYPMGITAEN
FT                   INDKYQITRHQQDEFALMSHQRAVKAQKAGYFDSEIVPVEVKQKRTTVTVTVDEAPRPD
FT                   TSLAALAKLKPAFKSDGSVTAGNASGINDGGAALVLASESAVNRLGLTPLAEWQGSAVV
FT                   GLDPALMGLGPYYAIKKLLKNQQLSADDVDTYEINEAFATQALVCQNLLHLDPRAVNPW
FT                   GGAIALGHPVGCSGARIIVTMISEMHRDNHELGIASLCVGGGMGEAVLLKKI"
FT   gene            66525..67874
FT                   /locus_tag="Lreu_0053"
FT   CDS_pept        66525..67874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0053"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82329"
FT                   /db_xref="GOA:A5VHK5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHK5"
FT                   /protein_id="ABQ82329.1"
FT                   /translation="MSQEKSTGAGLPTLSKSTIWMINFGFLGVQTAFTLQSSQMSRIFQ
FT                   TIGADPNNLGWFFILPPLAGLIVQPIIGYYSDRTWALKLGGRRLPYLLLGMIVAVIVMI
FT                   LLPNSGSFGFGYGSLAALWFGAITVALLDLSSNVAMQPFKMMVGDMVNDDQKSYAYGIQ
FT                   SFLSNTGAVLAAVFPFILTAWFGVRNTAKRGVVPDSVIIAFYVGAALLVVTSLFTVFRV
FT                   HEYDPATYAKYHGITEDDNKEGGNWFTLLKHAPKAFWTVTLVQFFCWFAFQYLWTYSAG
FT                   AIAKNVWNTVDATSAGYQAAGNWYGVLAAVQSIAAVIWSYVLAKVPNKYHKLGYGGSLL
FT                   LGALGFISVFFVHDQWTLIVSYTLVGIAWAAMNTYPLTIVTNALTGKHMGTYLGLFNGS
FT                   ICLPQIVASILSFVLFPLFGHSQVHMFILAGIVMALGALSVATIKETYAE"
FT   gene            67963..70215
FT                   /locus_tag="Lreu_0054"
FT   CDS_pept        67963..70215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0054"
FT                   /product="maltose phosphorylase"
FT                   /EC_number="2.4.1.8"
FT                   /note="PFAM: glycoside hydrolase, family 65 domain protein;
FT                   glycoside hydrolase family 65, central catalytic; glycoside
FT                   hydrolase family 65 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82330"
FT                   /db_xref="GOA:A5VHK6"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHK6"
FT                   /protein_id="ABQ82330.1"
FT                   /translation="MKRTFDIAPWHVATHKWDPQDKRLQESMTSLANENLGMRGFFEEG
FT                   YSGDHMEGIYLGGVWFPDKTRVGWWKNGYPKYFGKMINAVNFMKLIIKVNGEQLDLAKQ
FT                   TPKDFKLDLDMKRGVLERRFTVEIGGTEMYFNFERFVSVTQKELVGQRLHIKNRGDSDA
FT                   KVEITSMIDADVYNEDANYDEQFWNVLGKSADGEHAELTSMTKKNDFGTPQFIVGMKTT
FT                   SKTNLDHVDDGTDEKHAYNTFAGTVAAGKEVNFEKRSIVMTSRDYDSQADIEKNLDVLG
FT                   DQLDNQSFDDLLDPHIKEWADRWVKSDVEIEGDEGAQQGIRFNLFQLFSTYYGQDYRLN
FT                   ISPKGFTGEKYGGATYWDTEAYCIPVYLGVADPEVARNLLMYRYKQLDGAFVNAKEQGL
FT                   DGALFPMVTFNGIECHNEWEITFEEIHRNGDIAFAIYLYTKYTGDKSYVLNEGAEVLTE
FT                   ISRFWADRVHYSQNKNKYMLHAVTGPDEYDNNVNNDWYTNLLCRWTLQYTLDILDQVDE
FT                   KVAKKLNVSEDEKRKWKGIVDNMYLPYDKEKDIFPENDGFMDKDLTPVSEIPSDQLPLN
FT                   QHWSWDKILRSPYVKQGDVIQGLWDFIDDFTKEEKKNNFDFYEQFTVHESSLSASVYSI
FT                   IAADIGYEDKAVELYERSARLDLDNYNNDTSDGLHITSMTGSWLDIVQGFAGMRVRDGQ
FT                   LHYAPFLPKKWDSYQFRQMFRGRILKVKVDKHGTKIDLVSGDPITIDLDGKKLELK"
FT   gene            70234..70896
FT                   /locus_tag="Lreu_0055"
FT   CDS_pept        70234..70896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0055"
FT                   /product="beta-phosphoglucomutase"
FT                   /EC_number="5.4.2.6"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase; beta-phosphoglucomutase
FT                   family hydrolase; PFAM: Haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82331"
FT                   /db_xref="GOA:A5VHK7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHK7"
FT                   /protein_id="ABQ82331.1"
FT                   /translation="MKFEDLKGFAFDLDGVIADTARFHGQAWHQLADKVGTEWTPELAD
FT                   ALKGVSRMDSLELILKAGGHENDYTQEEKEALATEKNDNYIKLVETLTPADILPGMKDF
FT                   LDELKANGYHIVLASASKNAPKVLKYLQLTDYFEGIVNPANLSHGKPDPEIYQEAAKLM
FT                   DLPADQVAGLEDAQAGIESINRAGELSIGFGADLKDADVKFDKTGDVSLAAIKAQMN"
FT   gene            70973..71455
FT                   /locus_tag="Lreu_0056"
FT   CDS_pept        70973..71455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82332"
FT                   /db_xref="PDB:2MQD"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHK8"
FT                   /protein_id="ABQ82332.1"
FT                   /translation="MKRKVIITIIILISCLWVAVTINFNRPSSQQVQDETQSSQQPRPK
FT                   FTDQQIGVLAGLAISPEWLKQNIAANQLVYGIVKPSDTVPAGVDDYSYLVAADDQDGTI
FT                   IFFKAEGQTVIIKYTSQRNTKLKAKALTLSQLKKEFYQTRSQKREVDDYVAGLRTE"
FT   sig_peptide     70973..71065
FT                   /locus_tag="Lreu_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.754) with cleavage site probability 0.419 at
FT                   residue 31"
FT   gene            71540..72164
FT                   /pseudo
FT                   /locus_tag="Lreu_0057"
FT   gene            72166..72831
FT                   /locus_tag="Lreu_0058"
FT   CDS_pept        72166..72831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0058"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82333"
FT                   /db_xref="GOA:A5VHK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHK9"
FT                   /protein_id="ABQ82333.1"
FT                   /translation="MRILVAEDEQQLSHVLSSAMTASGYQVDIANNGQEAVEQAKENAY
FT                   DVIILDIMMPVKSGLEALKEIRATGNRTYIMMLTAMGEEDDKVTGLDAGADDYLSKPFS
FT                   LKELLARLRSRQRRDDSYQVDVLEFGDLTLNGNDQSLESHNSISLTNRENRLLQYFILN
FT                   ANKELSANELINHVWDENETADQEDLWINICYLRQKLQAIQSQVTISGEKTGPFMIAC"
FT   gene            72843..74090
FT                   /locus_tag="Lreu_0059"
FT   CDS_pept        72843..74090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0059"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82334"
FT                   /db_xref="GOA:A5VHL0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL0"
FT                   /protein_id="ABQ82334.1"
FT                   /translation="MIQRFRYKFIAISTAALLFVILTIVGSICTLTYYQSHQEIERVLT
FT                   ILVNNDGQIPRKGIRTTDNSQPQFSREGLHQYRYFAVLVDNKNQVTEVQDDHIATVTPQ
FT                   DARAMTDRLVRRKVHSGQLLYRGVNYAYKIRNKNGEKVIVFLDESLLMARTRSLMHTGL
FT                   ILGVIVLVLYTIVLTLYSRRAIRPIIEAEQRQKEFITNASHELKTPLTVISANNEMQEI
FT                   INGENEWTTSTKQQVTRLTKLINNLVSLARMQEQPTLTMLPVNVSQIAGDVASSFKSVI
FT                   STEQKQFNVQIDEGLVANADENTLRELLNILLDNANKYCDPQGEIDFTVSSSNHSKNIV
FT                   ITIANSYKDGKSLDAKKFFNRFYRVDESHTQGKKAGFGIGLSMAQYIVKQFKGKITAKY
FT                   TNGKLAFIVTLKEVGK"
FT   sig_peptide     72843..72953
FT                   /locus_tag="Lreu_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.833) with cleavage site probability 0.272 at
FT                   residue 37"
FT   gene            74093..75274
FT                   /locus_tag="Lreu_0060"
FT   CDS_pept        74093..75274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82335"
FT                   /db_xref="GOA:A5VHL1"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL1"
FT                   /protein_id="ABQ82335.1"
FT                   /translation="MKFWRLKIGIYAVVWSLIIGMLTAAYLNLVNWVIDLVWHQYLDPA
FT                   VSSKWYPFLVCIPLGFLIGFLNERWGNYPLTIEQVLTQVRLKGQLNYHNWWKSFILGLL
FT                   ALGAGGSIGPEASTTVLTSSMINWLGDRMRWATSMRQKVSLWYGKMQTQDLARAPRFSQ
FT                   LFKNKSQRVFVISGLVGIGIVGAAIVFKLFPEEGVFGIHHRIINWEWINLLTSIPTIII
FT                   GIAFGWLFVHLENWAALIINAKISKIWQGGIFGLILAISSLITSDILFSGEFRIVPFTH
FT                   EAFNHSIIFLLVVALVKAVMSNLGFAMGWRGGTIFPAIFSSVAVGTACAMMLPGDVRIN
FT                   AIVVIAASLTFILEKPLLTIIPLLLLVPIELAPVIIVVAFLVGRIIKLFPASE"
FT   sig_peptide     74093..74167
FT                   /locus_tag="Lreu_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.794) with cleavage site probability 0.548 at
FT                   residue 25"
FT   gene            75426..76766
FT                   /locus_tag="Lreu_0061"
FT   CDS_pept        75426..76766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0061"
FT                   /product="glutamate-cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="PFAM: glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82336"
FT                   /db_xref="GOA:A5VHL2"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL2"
FT                   /protein_id="ABQ82336.1"
FT                   /translation="MFSRIGQLIFDNEAVAKTSDFTMGLEIEMQRVDEDGNLSLEPYPS
FT                   AIGDEKTNPWITNDFLETMAEMVTPSAQHALDAMHYLYVINNTLRSALAPGELLWPLSM
FT                   PPRLPKDKTKLRLAKMGPKKEAYLKEWAKRHGYSQGTPCGAHINLSIDQHIIELVLNAF
FT                   PERFNSEREVRNYLYTILAQGFVRYRWLLTYLYGASPIVEGNYFEPGKELPHPIRSVRQ
FT                   SQYGFGIKFTGDFTNLDRYIARIEEGVKAGILTSDYEFHGPVRFKGNTDLKKLPEHGIE
FT                   YLELRMLDLDPSSSVGVRTGTLRFIRLLASYLIMQPPLKENEVEEILVTADKMNEVVAE
FT                   ENPQATCRYQAKARAVLKSLERYANQIQLGPEYSEVLEDLEDRVENPLTTPSAKLLNYV
FT                   KNGSLTEYALRRAKRYQQAAQETIHPFKGFEDGRIYTADELRKELTL"
FT   gene            77012..77470
FT                   /locus_tag="Lreu_0062"
FT   CDS_pept        77012..77470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0062"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82337"
FT                   /db_xref="GOA:A5VHL3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL3"
FT                   /protein_id="ABQ82337.1"
FT                   /translation="MANKLNSLAHTKWLCKYHIVFIPKYRRKAIFNQYRRDLRDYIRLL
FT                   CKYKGVEIIEGHMMPDHVHLLVSIPPKLSVSQFMGYLKGKSALMMFDRHANLKYKYGNR
FT                   HFWAEGYYVSTVGLNESTIKKYIRDQEKHDIAMDKLTSVEYSDPFKGK"
FT   gene            complement(77669..78397)
FT                   /locus_tag="Lreu_0063"
FT   CDS_pept        complement(77669..78397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0063"
FT                   /product="peptidase C26"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82338"
FT                   /db_xref="GOA:A5VHL4"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL4"
FT                   /protein_id="ABQ82338.1"
FT                   /translation="MHPRIAIPADTLTEATNIINERNAAFAPRPLIEAIIKSGGLPVIL
FT                   PSVAASLAPSYLDLFDGIIFAGGSDVDPTFFNEEPHQKLGPTYLKRDQFEISLATAAFN
FT                   AGKPIMGICRGMQVLNVALGGTLYQDLSENPHQTLKHSQDAPGNFPSHHVNTDKASRLF
FT                   NLVGPRPYVNSRHHQSLNQIAEPLHVTAWADDQVPEAVETINSDQILAVQWHPENMFKH
FT                   YDYSRAIFADLIARAKKAVK"
FT   gene            78516..79382
FT                   /locus_tag="Lreu_0064"
FT   CDS_pept        78516..79382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0064"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82339"
FT                   /db_xref="GOA:A5VHL5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL5"
FT                   /protein_id="ABQ82339.1"
FT                   /translation="MLELTNINSTFNLNNEVKIPCVGYGTFRTPADVAEQAVKEAIETG
FT                   YRHIDTAAVYGNEEAVGKGIKDSGIKREDLFVTSKLWNTNRGYEQTKKAFQETLDRLQM
FT                   DYLDLYLIHWPANEKQFGDDAAKINAETWRAMEDLYNEGKIRVIGVSNFMPHHIAELIK
FT                   TAKVAPAVDQIEVHPGWPHTEEIKYLQAHNILVEAWAPLGGQGAKVLTNPTMIQIADKY
FT                   QKTPAQVCLRWILQQGILPLPKSVHKERMISNQNIFDFELTDEDMRKINLLPNLGGQCA
FT                   DPDEVDF"
FT   gene            79521..81308
FT                   /locus_tag="Lreu_0065"
FT   CDS_pept        79521..81308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0065"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82340"
FT                   /db_xref="GOA:A5VHL6"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL6"
FT                   /protein_id="ABQ82340.1"
FT                   /translation="MKNAYRAFRQYSCQFRKNWLEYLILFGGLDILNQFLVIPFFRWIT
FT                   TFVLQAGEIPFISYQNIVIILTHHPLVVVSLLIELICLMVIIYGEFMLLLTGFREIGLP
FT                   EFSWRRMFRQTKETLSLLNFGSLILLLGYFLLIIPFADIIFRTPLLAKIQVPQFIVDYL
FT                   TRNAWLIGGLTLFYLLMTMIGIRLILTMPLMAYQHLRLRAAMSQSWQMTSKLRWLKFLI
FT                   QIVLMTIIVGSITVVFYLMIYILQVVLDLLPGKLSLITAIFNLSILQLGGEVLAVWAGT
FT                   IILLVVVNPLTSISELATTPEHPSRGLLTSFMLVFLVIGLATLANNTFYMMGTGIKRPI
FT                   TISHRGVTEKNGVQNTIPAMEKTSKLKPDYIEMDLHETKDHRFVVMHDENLKDLTGVNK
FT                   TPHELTLKQLTRLTARENGYHAKVASFDQYLAAAEKYHQKLLIEIKTTPHDSKQMLQNF
FT                   NRRYGKRILQDHDQVHSLDYSAVTKLKNINPRLTVLYIQPYNLGNPQGVADGFSMEYST
FT                   LNQDFITQAQWQHKPVYAWTVNDTDLMKQTMYNHANGIITDDLGELNAAIKDFTGKQSY
FT                   ANRILNYIIVVPTSGGIEP"
FT   gene            complement(81361..81858)
FT                   /locus_tag="Lreu_0066"
FT   CDS_pept        complement(81361..81858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0066"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82341"
FT                   /db_xref="GOA:A5VHL7"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL7"
FT                   /protein_id="ABQ82341.1"
FT                   /translation="MESTFRLRRSIIAAMLLALTLVLGRFFLIPIPWTHGNVNLCDAGV
FT                   FIAAMLLGPGAGTIVGGFGGMFLDLISGFPQDALFSFAAHGLEGFISGWIYKKYGNTTW
FT                   GKWTAILVGTIVMIAIYFICNTVMYHVITGFLSLGSNFIQGMIGGIVALIVIRQLKKHH
FT                   VG"
FT   sig_peptide     complement(81754..81858)
FT                   /locus_tag="Lreu_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.605) with cleavage site probability 0.337 at
FT                   residue 35"
FT   gene            82127..83476
FT                   /locus_tag="Lreu_0067"
FT   CDS_pept        82127..83476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0067"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82342"
FT                   /db_xref="GOA:A5VHL8"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL8"
FT                   /protein_id="ABQ82342.1"
FT                   /translation="MKVIIVGCTHAGTITATQILQNHPETEVTIYERNDNVSFLSCGIA
FT                   VYLSGDVGNPDAMFYSSPEQLAAMGATVHMQHNVTDIDPKTKTVTVTDLVTGETKTDHY
FT                   DKLVDTTGSWPVIPPIEGVDGPHVYLCKNYHHAKELFNVAKDAQRIVVIGGGYIGVELV
FT                   EAYTRQNKDVTLIDGSPRMLHKYFDREYTDRIQQEFVDHGAHFAFDQRVTGFENHENGV
FT                   TVKTDKGNYEADIAILCVGFRPNTDLLKGKVKMHDNGAIITNEYMQSSDPDIYAAGDST
FT                   AVHYNPTGKDAYIPLATNAIRQGTIVGTNLFGNTMRDMGTQSSSGLNLYGTTMVSSGLT
FT                   LENAKEAGFDAAAVTVEDNYRPEFMPTTTPVLMTLVWDKKTRQILGGQFMSKHDVSQSA
FT                   NIISLCIQDKHTIDYLAFVDMLFQPHFDRPFNYVNILGQAAVKKQAELEK"
FT   gene            complement(83536..84510)
FT                   /locus_tag="Lreu_0068"
FT   CDS_pept        complement(83536..84510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0068"
FT                   /product="guanosine monophosphate reductase"
FT                   /note="TIGRFAM: guanosine monophosphate reductase; PFAM:
FT                   IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82343"
FT                   /db_xref="GOA:A5VHL9"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005994"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL9"
FT                   /protein_id="ABQ82343.1"
FT                   /translation="MKTFDYDDIQLVPNKCVIKSRKDADTSVKFGPHTFKIPVVPANME
FT                   SVIDEDLAIWLAQNDYYYVMHRFNPETRAAFVKMMHEKGLFASISVGIKDDEYNFIDQL
FT                   KSEQLNPEYITIDVAHGHSDFVIKMIQYIKEKLPDTFVTAGNVATPEAVRDLENAGADA
FT                   TKVGVGPGKACITKLKTGFGTGGWQLSAIRWCAKAARKPIIADGGIRHNGDIAKSVRFG
FT                   ASMVMIGSMLAGHLESPGHVINIDGKQYKQYWGSASEVQKGAYRNVEGKQMLVPYRGSI
FT                   KDTLTEMQEDLQSSISYSGGRDLEAIRKVDYMIVKDSIMNGDF"
FT   gene            84706..86004
FT                   /locus_tag="Lreu_0069"
FT   CDS_pept        84706..86004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0069"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82344"
FT                   /db_xref="GOA:A5VHM0"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHM0"
FT                   /protein_id="ABQ82344.1"
FT                   /translation="MSSVVIVGSQWGDEGKGKMTDYLSQEADVVVRSQGGNNAGHTIAF
FT                   DGKKFALRLVPSGIFAKDKLAVIGNGVVINPPALLKELHYLQDNGIDISGLRISSRSHI
FT                   TFPYHILLDKCQEEAKGDHKVGTTKNGIGPTYMDKVSRVGIRMCDLLEKDTFKEKLERN
FT                   LAEKNELFTKLYHVDPISFDDIFESYYEYGQELKQYVTDTAQIVNDALDQDKKVLFEGA
FT                   QGVMLDVDQGTYPYVTASNPIAGGVCTGVGVGPNKIETVVGICKAYSTRVGAGPFPTEL
FT                   TDEIGDQIRETGHEYGTVTGRPRRVGWFDSVAMRHARRVSGISCLSLNLLDVLTGLKTV
FT                   KICTSYKLDGKQIDYYPASLKELERCEPVYEELPGWDEDITGAKKFEDLPINAQNYLKR
FT                   VSELSESPLATVSVGADRIQTIIVKDPWEFAHK"
FT   gene            86115..86900
FT                   /locus_tag="Lreu_0070"
FT   CDS_pept        86115..86900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82345"
FT                   /db_xref="GOA:A5VHM1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032179"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHM1"
FT                   /protein_id="ABQ82345.1"
FT                   /translation="MMTQPTLTVEKHYLNWPLNRPLNQADIMHELGVHASDEKGQDLTS
FT                   KVMMNLTQVDVNKAGEYPVMLSVMDNNGQSTQVSITLNIQPMRTQNATQETATPQKSRR
FT                   GWLWVIIAIVVILCAWWAISSHNRQAANQAATDSQQSSQISNNSSSISDLTKDNQRLAN
FT                   QVAELKGATQQYQKDHDQQALESRLDKIQSQIQDLQNQVQSNNVKQDLNQVNETVNEVR
FT                   ENPANGTKIVNNLKNKGDFQEIWGNISQEVQKWLDEFAN"
FT   gene            87063..87602
FT                   /locus_tag="Lreu_0071"
FT   CDS_pept        87063..87602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0071"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82346"
FT                   /db_xref="GOA:A5VHM2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR023050"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHM2"
FT                   /protein_id="ABQ82346.1"
FT                   /translation="MMAHEILDGSSMQRALTRITYEIIEQNKGVDNLVFVGIKTRGVYL
FT                   AKRLAKRLNQLENVEIPVAPLDVSLYRDDRHVPDHTQEPTVKTDQLDIDITNKHVILVD
FT                   DVLFTGRTVRAALDALMDMGRPTRISLAVLVDRGHRELPIRPDFVGKNIPTAMNETVHV
FT                   AVEEYDGHEDVTIEHN"
FT   gene            complement(87721..88107)
FT                   /locus_tag="Lreu_0072"
FT   CDS_pept        complement(87721..88107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82347"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHM3"
FT                   /protein_id="ABQ82347.1"
FT                   /translation="MRNIILNPTKRQVHKINKRIEKVYRPRQKQALIVFTTNISNNPIY
FT                   KISLDTFPALGTGISMTMVSEIPIDEISKEQYILLLYALYSHWKKLPLVFRGFTPKQVR
FT                   WFQKKFGTRVFNEHSTVDWWRKIR"
FT   gene            complement(88356..89612)
FT                   /locus_tag="Lreu_0073"
FT   CDS_pept        complement(88356..89612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0073"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82348"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHM4"
FT                   /protein_id="ABQ82348.1"
FT                   /translation="MKSMAQLEYHYGLKMRCYPSDQQKQIIKVNSDASRFIYNEMVAIG
FT                   KELWQLSRVKLPIDTVQDRIKQLTMRQNAKQMSNHYQFLEDKRIDSLTKANAIQNYRKA
FT                   WNSFRKVHTAGVPKFHRKSYRWRYQTNCQYPGQKTALLTNGTVCFLDNSHVKVPKIGQL
FT                   RVAGSQARLLKRMCETRIGTVTLTKDPADHFFLSMQLASDESFVKVSKANHEHIGIDLN
FT                   TDNFLTDSEGNTVPNPRYYRTIKGKLAKEQRILSRRQRRIKKEHRSLRDSKNYQKQRLL
FT                   VAKLHVKVMNQRHNFLQQISTALIKNHDLVVAEELRSKNMLKNHALAMSIADVGWRSFL
FT                   NMLAYKADLYGRQFITVSPKNTTQTCHDCGFVMGSGGTKKLTLADRKWTCPQCHTHHIR
FT                   DHNAALNILEKGFQKQQKS"
FT   gene            89687..90142
FT                   /locus_tag="Lreu_0074"
FT   CDS_pept        89687..90142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0074"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82349"
FT                   /db_xref="GOA:A5VHM5"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHM5"
FT                   /protein_id="ABQ82349.1"
FT                   /translation="MAKEKIQDAIYTRRYVYNFHYHLIWVTKYRHQAFSTKELVDEMKD
FT                   ILRMVAKDNEIVIEKMEVMPDHVHVLISFPPSKAPTSAIKALKGRSAFIFLKRHPEIRQ
FT                   SQYWGGHLWSPSYYMSTLGNMSKDVVENYINNQKYNALQKKKRPNGR"
FT   gene            90267..91001
FT                   /locus_tag="Lreu_0075"
FT   CDS_pept        90267..91001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0075"
FT                   /product="peptidase C26"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82350"
FT                   /db_xref="GOA:A5VHM6"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHM6"
FT                   /protein_id="ABQ82350.1"
FT                   /translation="MMTKPIIGISGSRIIDQQGPFPGYRRSYVNEDYVNAVIQNGGIPY
FT                   IIPFNEDPEVTIAQVATVNGLILSGGHDIDPRLYGEESLPQIGEIWPQRDAFDLLLLKE
FT                   AEKRHKPVLGICRGAQLLNVAHGGSLYQDISYRDEPTLKHSQGHTTNLETQTIILASDS
FT                   YLASLFGEEQLSVNSFHHQLIKTVGKDLYPVAKAKDGVIEAIENGDGSVLGVQWHPEML
FT                   HSSDQQMNKLFSDLITKSMKEG"
FT   gene            91007..92401
FT                   /locus_tag="Lreu_0076"
FT   CDS_pept        91007..92401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0076"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82351"
FT                   /db_xref="GOA:A5VHM7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHM7"
FT                   /protein_id="ABQ82351.1"
FT                   /translation="MTKTKLGFWSIVLLAINSIIGSGIFLTPGSVVSMVGTKAPLAYFF
FT                   AAIFASILAITFAAAAKYVNKSGAAYSYAKAAYGENMGFYMGVVRFFSASVAWGVMAVG
FT                   VIRTTFSIFGWNQSFGNITLGFVVLMLIIMVINMMGRRIFTIINDLSTVGKLGALALII
FT                   IAGVIILLKTGENHFNELNHLTDSTGKSLIPAFTTSGFVMAVISAFYAFTGFEAVATGS
FT                   EDMKDPEKNLPRAIPLAILVIAIVYICTIAVAMMVNPAAMVTTKQVVALVAIFHNKVLQ
FT                   DVILVGAIISMFGINVASSFHTPRVLEAMANENQVPQFIARRTKRNFPLVSFIITLVLA
FT                   VGIPMAFQYNLPTIIVISATVRFFEFIVIPLGVIRFYRGTNREKILPAHKNFFTDVILP
FT                   ILSVVITLFLLMRYDWISEFSINRAGHLMPNWFAIFGMVFGFVILPLILFWLTRRERAE
FT                   NDERVK"
FT   sig_peptide     91007..91108
FT                   /locus_tag="Lreu_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.835) with cleavage site probability 0.687 at
FT                   residue 34"
FT   gene            92873..93070
FT                   /locus_tag="Lreu_0077"
FT   CDS_pept        92873..93070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82352"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHM8"
FT                   /protein_id="ABQ82352.1"
FT                   /translation="MDIRKINTLNRIKEGFITVLDTKKLSECTTNDIVDSAEISKKLST
FT                   TITKINKIFSMKLKMIYWEV"
FT   gene            93058..93513
FT                   /locus_tag="Lreu_0078"
FT   CDS_pept        93058..93513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82353"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHM9"
FT                   /protein_id="ABQ82353.1"
FT                   /translation="MGGLKEALVIDREELKDVKHLPSADEIKELAEVAFNHTLAFCNEN
FT                   KHALSNLLSSNGDMQFYQMIIEVANNEFDARVPYLFGDINIKEANVKSSLPFSFIKTLY
FT                   INTSVNLLMLWGAAPDSLSINEIKSIAGLIQTKSPVELIQIYKSYLN"
FT   gene            complement(93578..94021)
FT                   /locus_tag="Lreu_0079"
FT   CDS_pept        complement(93578..94021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82354"
FT                   /db_xref="GOA:A5VHN0"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHN0"
FT                   /protein_id="ABQ82354.1"
FT                   /translation="MLILLFIERSGRDMQNPFGNNNNDNQNPFNLNNLPLPPNYAKIVN
FT                   DQGDIRIAKVGFSWTTLWFGPLPALFRADYYNFILMIVLTLDYALVALFFGLNALLQFP
FT                   WPSVFFGFFYNMMYFRHLFTKGYRPADQRSRELLTRARYWKGN"
FT   gene            94121..95662
FT                   /locus_tag="Lreu_0080"
FT   CDS_pept        94121..95662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0080"
FT                   /product="Protein of unknown function DUF1975"
FT                   /note="PFAM: glycosyl transferase, group 1; Protein of
FT                   unknown function DUF1975"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82355"
FT                   /db_xref="GOA:A5VHN1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022372"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHN1"
FT                   /protein_id="ABQ82355.1"
FT                   /translation="MLFFLNDNIQRNKSGIEHAQIKRLHLFEKYHQPAKIVTRQYSNEL
FT                   HLVTAEAGIDDRNFINLFDYFQEACEVPQKNIRIKDIPVNPHWERKADGINYNYYQNGK
FT                   RILYIRRRSDTDRRVINIQYFDHYGKLLKVSWFDSRGFISVEQLYDWDGKMATENYYRP
FT                   DGTLAIQLAHQQDKRGNEIKTYHLFNYHGHDYQFSGFDQLTRFFLDELVADKQICGEGP
FT                   IGFIVDRVYELGWAVLHMKHHVFRVLQLHNDHVNNPDDMLHSPLNYNYDWGLKHLQDWD
FT                   GVIALTPQQQEDLQDRFGKFGVKIYRIPGPIVPAAVIDKRHVPFKKRTKKQVVMVARLS
FT                   PEKQQDHLLKAWPQVLAAVPDAKLDFWGYANDDFDKTLNKIVKEEGINSSVTFHGYTDD
FT                   VNSVYEDAQLLILPSRAEGLPLSLVEAQSHGLPIIANDIKYGPSDVVIDRQDGLLTKNG
FT                   DIDGLAQAIIRLLQNQEQLAQMSENAYADSERYSEPNVMKLWNELVNDMKEKGEE"
FT   gene            95664..97166
FT                   /locus_tag="Lreu_0081"
FT   CDS_pept        95664..97166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0081"
FT                   /product="Protein of unknown function DUF1975"
FT                   /note="PFAM: glycosyl transferase, group 1; Protein of
FT                   unknown function DUF1975"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82356"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHN2"
FT                   /protein_id="ABQ82356.1"
FT                   /translation="MYFFVNQYLLSSNSSVEHAELKRLALFKKHGRKAKLVTRDFDLVL
FT                   HDTIKKFGLTNDQIVNMYDFFANTTDYQGEKLHTEDLPLPIDYQVGTGNNYREVKDGDR
FT                   LVCEVHFAAGTIGQVNHVDYFDIAGNMTLRQQYDIRGFKAADEFFGEDGQEYYARYYRP
FT                   DGETYLERYFVKSVENTPINSLNVLRNYQGQDRFFDSLEDLFIFFLDELNKANGENNVF
FT                   IADRPAVAIKPVQSMMTKAKKFLWLPMNQINDGQNLINGPLNPMLQGPVTTDADKWDGV
FT                   IVMTAKQAEILQQQIHNTVPIYVINGSPVLANYARINEADRTPGQLIYVGRLAEDKQTS
FT                   QLINMFAQIHQQVPESKLTFYGYGTGEDMDNYKKQVKSLGLDEAIEFAGYQISLDEAYD
FT                   QAQLFVDASRIDAQPLAMGEALNHGVPVVSYDYLYGPREMVTSGKNGEIIPLNNQGQFI
FT                   QTVVKLLQDQDKLQSLSTGAYDNLDELAEEKTWKQWQQLSAI"
FT   gene            97278..99095
FT                   /locus_tag="Lreu_0082"
FT   CDS_pept        97278..99095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82357"
FT                   /db_xref="GOA:A5VHN3"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR011252"
FT                   /db_xref="InterPro:IPR011266"
FT                   /db_xref="InterPro:IPR041171"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHN3"
FT                   /protein_id="ABQ82357.1"
FT                   /translation="MMDNYQAMNFYYGLLNLRAGFFKADLCEILMAIAQSVPDKNRQSA
FT                   TAYHTVEENLSQDREQLKHDQVEFGSFYEDGHILHNVKINTQSDFFLDPTREDTVKWHV
FT                   SFTVAKDVRPADQFTIQLSSNLMVAPNGHPEKPVPDFSDQDGVVIAMGAYDRDKHELVY
FT                   TFTNYVTEHRQIIGELEGELAIDPLTTPENEFGLECFISVDDHRKDFTIDIDYPDLAND
FT                   MFLGISSRMMHFDKDQQLFEDIIYVNPAQKDLNHAYIVFNTSDLVEELSNAVVKPSTMR
FT                   VEIYRNSRGLKLPQSYGVNLQRLRDITNRFPVVEGDHLVEAPYTMSFADNKMRLNFGAD
FT                   QTNDSYIIRVVGQYNDELDGTVRLRARLFGMDQQNVYMSNSTAATATGTSMVASGHAIS
FT                   KEKLAEETADTTEDLKQEEPFESSAIEGVAEDVGIPSASDSQEQFTSSQAEEEEMPIEE
FT                   NQEDIPINDVAAEEQVEPQEDFPQSAISVPDDAAVEEESDSSAYIISFNSNDEEEATAA
FT                   EQEGNQAEAPTVSAAVGGDELSISFDITPQAAPAETKEDLTEETESSDGKEETSAAPLP
FT                   MPGRRPPRRHSRFQNTTRSNHSLRHLRRF"
FT   gene            99279..100961
FT                   /locus_tag="Lreu_0083"
FT   CDS_pept        99279..100961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0083"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82358"
FT                   /db_xref="GOA:A5VHN4"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHN4"
FT                   /protein_id="ABQ82358.1"
FT                   /translation="MENNHWWNKSVVYQIYPKSFQDTNHDGVGDLRGIIDRLDYIKKLG
FT                   VDVIWLNPIYESPQVDNGYDISNYEAINPTLGNMDDFQELIDGIHERGMKLVMDLVVNH
FT                   TSDQHDWFKESRKSKDNPYRDYYIWRDGKNGEEPNNWGSYFSGAAWKYDDESGQYYLHL
FT                   FAPEQPDLNWENPKVRHSVYDMMNWWAAKGVDGFRMDVINLISKPDGLPDANKNEDEKY
FT                   ANVEPLVSNGHRIHEFLQEMNKNVMSKHKMVTVGETPGATPEDAEKYASLDNKELNMIF
FT                   QFEHMGLDSNPNPALGKWDDRKTTLKDLRANLTKWQEKLYGKAWNSLYWNNHDQPRVVS
FT                   RFGNDQTEDYRVKSAKMLATMTHMMQGTPYIYEGEEIGMTNAYFPKLEDYVDLESINAY
FT                   HQLVDDQHLLDGKTMMKYIAIHSRDNARTPMQWDDSEYAGFSDHTPWEKVNPNYKQINV
FT                   KDALADKNSIFYYYQKLIELRHSMQVITNGKYALVPGNEDDEQIFAYTRQDDNTTLLVI
FT                   LNYTDETVNRHYNVPADAKLLISNYEDDQNDTIRPYEAKVYQY"
FT   gene            100979..102364
FT                   /locus_tag="Lreu_0084"
FT   CDS_pept        100979..102364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0084"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82359"
FT                   /db_xref="GOA:A5VHN5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHN5"
FT                   /protein_id="ABQ82359.1"
FT                   /translation="MDKSLSNSKQKVETKQVDLDTGMPDLPKKELFAITFAFLGINMAF
FT                   SLQSSQMSRICQTIGANPNNLGFFFIFPPLMGMIVQPIMGKMSDRMWNRFGRRLPYLLF
FT                   GTPIAALVLIMLPFSGSLGFGYGSMAAMIYAATAVCLMDLFSNICMQPSRMIVGDMVNN
FT                   KQKNFAWSWQQVFSNGGGILATILPFIFTMFGMSNTAKRGVVPNTVIWSYLCAAAVLLF
FT                   TGLWTVFNVKEYDPETYAKYHHIDPEEQNKSVSLWKLIKTAPRAFWEINLVQLFSWFAI
FT                   MYVWTYTTGTCARNIWHTSDVTSAGYQAAGNWYGILTAVYSIAGIVWGLIYAHAKAGSR
FT                   KKWYTFGMIVGGLGLVWMTFVTTKTTSIIAMIMFGIGNFSINTIPFTLLTSSLNGKNEG
FT                   AYLGLFNVGICVPQIVASLCSFFLFPLVGHNQPMMLLLGGISLLIGALAVQAIHEGVTV
FT                   KEA"
FT   gene            complement(102442..105612)
FT                   /locus_tag="Lreu_0085"
FT   CDS_pept        complement(102442..105612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0085"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82360"
FT                   /db_xref="GOA:A5VHN6"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHN6"
FT                   /protein_id="ABQ82360.1"
FT                   /translation="MPKRTDIHKILVIGSGPIIIGQAAEFDYSGTQACLALREEGYETI
FT                   LVNSNPATIMTDKEIADHVYIEPLTVESLSRIIRQEYPDAILPTLGGQIGLNLAVSLSE
FT                   TGLLDELGIELLGTKLDSIDEAEDREKFKELMNELGEPVPASQTVNTVDEAVEFAHQCG
FT                   YPVIVRPAFTMGGTGGGICHNDAEMRTVAKNGLELSPVTQCLIEKSIAGYKEIEFEVMR
FT                   DAADNVMVVCCMENFDPVGIHTGDSIVFAPNQTLSDREYQMLRDCALKLIRALKIEGGC
FT                   NVQLALDPQSFQYNVIEVNPRVSRSSALASKATGYPIAKMAAKIAVGLTLDEIKNPVTK
FT                   TTFAEFEPALDYVVCKIPRWPFDKFTQADRHLGSQMKATGEVMAIGRTAEEALHKAVRS
FT                   LEIDEKDLFSAEAHHAPTDMLEKKLRYPQDDRLFYLAETFRRGYSLQQTHDLTKISPYF
FT                   LDIVKHLVELEDDLSTKPFDVETLITSKKYGFSDATIARLWHTSSQEVRKFRKQNEVLP
FT                   VYKMIDTCAAEFASSTPYFYSAYDHENESQRTKKPSILVLGSGPIRIGQGVEFDYATVH
FT                   SVKAIQRAGYEAIVINSNPETVSTDFSVSDKLYFEPLTLEDVLNVIDLEQPVGVIVQFG
FT                   GQTAINLAEGLAKNGVNILGTTVDDLDAAEDREVFDQVITDLNLKQPIGLTATTHSAVI
FT                   KAAEKIGYPVLVRPSYVLGGKAMETVYNQEELQQYLQQNASITADHPILIDAYLEGREC
FT                   EVDAICDGKDVLIPGIMEHIEHAGVHSGDSMAVYPPQHFNDDIKRQIVTATEKLAVALK
FT                   CIGIMNIQFIVHNHEVYILEVNPRASRTVPFLSKITGIEMAQVATRVILGQSLADQGFT
FT                   NGLYPEPQTIHVKAPVFSFNKLANVDSYLSPEMKSTGEVMGTDTTYEKALHKAFSGAHI
FT                   QVPNDGKILFTIENGDEKEVLPLAKRFAQIGYQVFTTPQTASHFKDNGIHIHQEISNID
FT                   ELNCLLKAGQIDLVINTMRHDYEQDSLGFQIRQSTIAQNVPLMTSLDTVNALLRVKEDQ
FT                   SLEAITIK"
FT   gene            complement(105605..106693)
FT                   /locus_tag="Lreu_0086"
FT   CDS_pept        complement(105605..106693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0086"
FT                   /product="carbamoyl-phosphate synthase small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase, small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82361"
FT                   /db_xref="GOA:A5VHN7"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHN7"
FT                   /protein_id="ABQ82361.1"
FT                   /translation="MKRYLILEDGTVYTGEGFGATKATLGEVVFTTGMVGYQEAITDQS
FT                   FANQILVFTNPLIGNYGINSEDNETLYPQIKGVICHHVARVPSNWRMTDSLPNFLAKHH
FT                   IPGLQGIDTRELVRKLRQYGTLRGIMTDNITDIKDKIEQLKQTSPTQNIISKVSTKESY
FT                   ANPGTKRTVVVLDFGMKNSILRELNKRNCNAIVLPYNTSISEIMAFNPDGILLSNGPGD
FT                   PLEMTDAAATVAELEKHLPIFGICMGHQIFALANGAKTYKMKFGHRGFNHPVRNLQTGK
FT                   IAFTSQNHGFAVDPSSIDDTDLQITHLEVNDGTVEGLQHSKYPAFSVQFHPDAAPGPHD
FT                   AEQLFDKFMALIDSNKEVLTYA"
FT   gene            complement(107075..108448)
FT                   /locus_tag="Lreu_0087"
FT   CDS_pept        complement(107075..108448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0087"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82362"
FT                   /db_xref="GOA:A5VHN8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHN8"
FT                   /protein_id="ABQ82362.1"
FT                   /translation="MSQDESVVLNQDQETSTTGLPILPKSTIWMINFGFLGVQIAFTLQ
FT                   GSQMSRIFQTIGANPNNLGWFFLLPPLAGLIVQPIIGYYSDRTWAPKLGGRRLPYLLIG
FT                   MVIAVIVMILLPNSGSFGFGYGSLAALWFGAITVAFLDLSSNMAMQPFKMMVGDMVNDD
FT                   QKSYAYGIQSLICNTGAVLAAIFPFLLTWWGVSNTAKKGVVPQSVVISFYVGAVILVIT
FT                   CLFTIFRVHEYDPATYARYHGISEEDNKKGGNWFTLLKHAPRVFWNVALVQFFCWFSFQ
FT                   YLSTYAVGAIAKNVWLTTNASSAAYQAAGNWYGVMTAVQSIAAVVWSYVLAKVPNNHHK
FT                   AGYAFSLLLGAIGYTSIFFIHSQNALIFSFVLIGIAWASMNTYPLTMVTNALSGKHMGT
FT                   YLGLFNGSICVPQMVASLLSFGLFPLLGSSQVNMMLVTGISALLGAISVLFIKETYQA"
FT   gene            complement(108608..109618)
FT                   /locus_tag="Lreu_0088"
FT   CDS_pept        complement(108608..109618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0088"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82363"
FT                   /db_xref="GOA:A5VHN9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHN9"
FT                   /protein_id="ABQ82363.1"
FT                   /translation="MKPTIKDIAQRAHVSTATVSRVLSKKAKSYRPETAAKIEAIAKEL
FT                   GYKKNLAAAELAANSSMLIAVILNNTQTNFSNDIIAAIQAETDKAGYQMFILYAGNHDA
FT                   RLLNQAISVALERHVAGILLVATSLDEQAARTLRESNTPCRLVSVYDEDDPRYTGFKFT
FT                   SSNNEEIGYSAANYLIERGHSRIGLAGIDRSSTGKQRLHGYQRSLTEHGLIPHMEWVEY
FT                   GDYSFGPQQNMLKTLMNKDLDAIITASDMVAVGMIREAHLLGLDIPKDLSFISIDGTFL
FT                   CDITIPTITSVTQDFYQMGLIAVRSLLNDDDSQFIPVHITPRNSVRLLSEKSLEY"
FT   gene            complement(109757..111163)
FT                   /locus_tag="Lreu_0089"
FT   CDS_pept        complement(109757..111163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0089"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM;
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82364"
FT                   /db_xref="GOA:A5VHP0"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHP0"
FT                   /protein_id="ABQ82364.1"
FT                   /translation="MTQTKQHEQDVDVWVGKRFPLTIRRLGVNGHGIGYYKHKVCFVPG
FT                   ALPNEVVVAEVTRVLPRYLEAKIHRIRKKSRDRVTPRDEYADIAGGFELENLAYQQQLK
FT                   FKRQVIIDSLEKFQPYGYRNYDVRPTIAAPEEYGYRNKAQFQVRMVNGKVAAGLYQPNS
FT                   HTLVDMETCAVQMPRTMETVRAVTKMIEDLQIPVYDEKHNSGIVKTLAVRESWSTGEVQ
FT                   LTFITNSAKLPHKRELLERIEKELPAVVSVMQNVNPGDTPLVWGDKMIHLAGKDSILES
FT                   LMGLDFKLSARSFLQLNPEQTEVLYEEASKALELDQDDTLIDAYAGIGTIGLSLASRVK
FT                   AVRGMEIIPEAVADANENAKLNNITNAKYEVGKAEEVLPRWQKEGLNFDALVVDPPRTG
FT                   LDDQLIKQILKVKPRKFAYVSCGMASLARNLRRLTSVYHVDYIQPIDMMPQTARCEAVV
FT                   KLSLRNGNKE"
FT   gene            111380..111991
FT                   /locus_tag="Lreu_0090"
FT   CDS_pept        111380..111991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0090"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82365"
FT                   /db_xref="GOA:A5VHP1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHP1"
FT                   /protein_id="ABQ82365.1"
FT                   /translation="MKCCINNLKEVTRLKIAAIAGSNANHSYNRMLLEFIARHFSDDDI
FT                   DVIDIRQVPMFNENYKGKIPEAVADIDRRVSSADAVIIASPEYNHSVTSALKCVIEWLS
FT                   YEVHPLENKPVMIIGASTHDQGSSRSQVQLRDILISPGVNAYIFQNEEFFMSDAANIID
FT                   KDGDITNETTIHFLEKCMREFKHYAKAINRMVAEKKEAKK"
FT   gene            111991..113241
FT                   /locus_tag="Lreu_0091"
FT   CDS_pept        111991..113241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0091"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82366"
FT                   /db_xref="GOA:A5VHP2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHP2"
FT                   /protein_id="ABQ82366.1"
FT                   /translation="MKILALVGTNANFSYNRILLKYMKKHFRQMADIEIAEISQLPPFS
FT                   VDAPLSEQTEVWKLKQKVKAADGVIFSTPEYDHGIPAALKSTVEWLSYKTDVLKRKPVM
FT                   VVGVSYGRQASARSQVQMRQILVSPDCDANLLPGNEVLIGNASHSFSKDGRLINAEARD
FT                   NLENCFTHFVEYIQIFENANKEGLDMSVKQPTISEAYINFPTGRLTLKEVQQIFSTIPF
FT                   EIDLIDSTDHFAWFSDKPNREHVRNVASLGETVQECHPPLAVPAVMKIINSFRNGEKDV
FT                   VTRPLWMNGHRSLIQYYALRDVNGHYLGTIEFTGSVEYILNLFENGAWSTDGNTGASKH
FT                   ENANDNSEEADSVDASTGASESSDDDNADSVSEVVATPAPAANDDTDADATTGVSDAGS
FT                   VDANDDEADATTGASEN"
FT   gene            113244..114170
FT                   /locus_tag="Lreu_0092"
FT   CDS_pept        113244..114170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0092"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82367"
FT                   /db_xref="GOA:A5VHP3"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHP3"
FT                   /protein_id="ABQ82367.1"
FT                   /translation="MNNELMAQRHVMTHHALGTRINLTIFGNEYFSLLKKSMDLIDHYE
FT                   DQLTVNRNESEVMSVNHGAGKTPKMVSPTTFDLIELAVKYSRENFGFNALIGPLVKLWK
FT                   IGFAGAHVPSDAEIKERLKLIDPYKVLLNRDARTVYLEEPGMELDLGGIAKGYIADRIR
FT                   DLWIEAGVPAGIIDLGGNLLFVGKSPRRDDGQWIIGVQDPQLHRGENLATVREPACSAV
FT                   TSGIYERFLIKNGRRYHHLLDPRTGYPLETDLSSVTVFTDQSVMGEIEAKRLFFNGEPI
FT                   TGWKARPGNRGAIFIHNDESMVNVGFE"
FT   gene            114668..116050
FT                   /locus_tag="Lreu_0093"
FT   CDS_pept        114668..116050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0093"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron, maturase-specific domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82368"
FT                   /db_xref="GOA:A5VHP4"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHP4"
FT                   /protein_id="ABQ82368.1"
FT                   /translation="MRQSQKTEQQADRLSRIGLENRKYTRARSTDYGEGKGMSVTIQDL
FT                   VLDRNNLNQAYLRVKRNKGAAGIDDMTVNDLLPYLRENKTELIASLREGKYKPAPVKRV
FT                   EIPKPNGGVRKLGIPTVVDRMVQQAVAQILTPIFERVFSDNSFGFRPHRGAHDAIAKVV
FT                   DLYNQGYRRVVDLDLKAYFDNVNHDLMIKYLQQYIDDPWTLRLIRKFLTSGVLDHGLFA
FT                   KSEKGTPQGGPLSPILANIYLNELDKELTRRGHHFVRYADDCNIYVKSQRAGERVMRSI
FT                   TQFLEKRLKVKVNPDKTKVGSPLRLKFLGFSLGVDHNGAYARPAKQSQQRVKKALRLLT
FT                   KRNRGISLTRMFEEIQRKMRGWLQYYSIGKLTDFIQRLDKWLRARIRQYIWKQWKKLKT
FT                   KVTNLQKLGLSQRDAYVFASTRKGYWRTAHSKTLSYSLTNRKLEQLGLMNMSKTLQSIQ
FT                   SD"
FT   gene            116315..120965
FT                   /pseudo
FT                   /locus_tag="Lreu_0095"
FT                   /note="YSIRK Gram-positive signal peptide;cell wall/surface
FT                   protein"
FT   gene            121729..123036
FT                   /locus_tag="Lreu_0097"
FT   CDS_pept        121729..123036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0097"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (G, H, P and S); seryl-tRNA
FT                   synthetase, class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82369"
FT                   /db_xref="GOA:A5VHP5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHP5"
FT                   /protein_id="ABQ82369.1"
FT                   /translation="MLDIKKIRQEPDFYKEKLATRGVKPEEIDEVIALDKKRRELLQQT
FT                   ETMKAQRNEASKKIGEAKRNGESADAAIKETRELGDKIKELDTEVEANDAELHDKMAHL
FT                   PNVPHDGVPVSLTEDGAVELRKVGKVRDFDFEPKHHWDIGENLGILDFDRAGKVSGARF
FT                   VYYLGLGAQLERAVYNFMLDEHMKEGYTEVLPPYIVNADSMYGTGQFPKFKEGVYQVNG
FT                   EDMTLIPTAEVPLTNYYRGEVIPTEELPVYVTALTPSFRSEAGAAGRDTRGLIRMHQFN
FT                   KVEMVKYTKPENSWDELEKMTANAENILKKLNLPYHVITLTTGDMSFTASETHDLELWM
FT                   PAQNKYREVSSCSNCLDFQARRMHTQYRDENGKLQYVHTLNGSGLAVGRTVAAILENYQ
FT                   NADGSVTIPEVLVPYMHGVTKITKENAVPFRNKVNK"
FT   gene            123305..124768
FT                   /locus_tag="Lreu_0098"
FT   CDS_pept        123305..124768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0098"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family / amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; extracellular
FT                   solute-binding protein, family 3; SMART: ionotropic
FT                   glutamate receptor; TC 3.A.1.3.-; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82370"
FT                   /db_xref="GOA:A5VHP6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHP6"
FT                   /protein_id="ABQ82370.1"
FT                   /translation="MHSSKIKNMIITIVAVLGIVVGWQMVEPQQVSAAEPTYTFATNNT
FT                   FEPFEIQDSKGGYSGKNPGIEIEILKKIAKHEHFKYELKPMSFNGDLQALEAGQVDAVI
FT                   AGMSVTDERKEKYDFSTPYYTSGVVMAVAKDSNIKSMSQLKGKTVSAKSGTSAALFLKN
FT                   NQKKYGYKIRYFDSSNTMWNDVKTGNTVATFDDGPVLEYGIKEGVPLKIVTKKPIDAQP
FT                   VAVGYQKGKNLELQKKMNDGIKWLKDTGQMDQIIDKYTKSDKTTKGSATDRTILGLIRA
FT                   NYPALLRGLWMTIELTVVGIIFAMIFGVILGVLGIAQNKFANAVSSTLIYIFRGIPMIV
FT                   LAFFIYMGIPNVIGHKVPLFLAGILTLTFNEGAYIGAIVKGGFESVNIGQWEAARSLGL
FT                   PYSKALIKVIAPQGFKLMIPSLVNQFIITLKDTSILSAIGVMELTQTGTVIISQNMEGF
FT                   KMWLIIGTMYIIIITLLTWLSNYVQKRMG"
FT   sig_peptide     123305..123406
FT                   /locus_tag="Lreu_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.957) with cleavage site probability 0.948 at
FT                   residue 34"
FT   gene            124770..125513
FT                   /locus_tag="Lreu_0099"
FT   CDS_pept        124770..125513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0099"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82371"
FT                   /db_xref="GOA:A5VHP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHP7"
FT                   /protein_id="ABQ82371.1"
FT                   /translation="MDKNYKVQVKNLHKSYGSNEVLKGISLDVKPNEVVCMIGPSGSGK
FT                   STFLRCINKLEEPNSGHIYIDGYDIADPQVNINKVRENIGMVFQHFNLFPNMNVLENIT
FT                   LAPVQLGKMTKEEAEKDAMHYLDLVGLADKAGADPTKLSGGQKQRVAIARALAMKPDVM
FT                   LFDEPTSALDPEMVGDVLEVMKRLAQEGMTMIVVTHEMGFAKQVADRVVFFHNGDIREQ
FT                   GTPEEIFDHPQHPDTKNFLDKVLNI"
FT   gene            125817..127166
FT                   /locus_tag="Lreu_0100"
FT   CDS_pept        125817..127166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0100"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82372"
FT                   /db_xref="GOA:A5VHP8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHP8"
FT                   /protein_id="ABQ82372.1"
FT                   /translation="MDEKQQQKLERSLKSRHVTMIAIGGAIGTGLFLGSGTAIHQAGPS
FT                   IILSYLIVGIFCFFMMRALGELILADTSKHSFIDSVKEYLGDRMEFVAGWMYWACWLTL
FT                   AMADLTATGIYLKYWFPNLPQWVGPLIIVILLMLVNMVNVGLFGELESWFSMIKVIAIL
FT                   ALIAVGAVLLVMHGHVEGRPVTLSNLVNQGGFFPTGPMGFLMSFQMVVFAFVGIEMVGL
FT                   TAGETKNPDKDIPKAINTLPVRIGLFYIGSMIAMMSIYPWFHIKTTSSPFVQVFAAIGV
FT                   PGAAAILNFVVLTAAMSATNSAIFSTSRSLYSLARSGNAPKRFGELSAKAVPNHALTFS
FT                   SLILFITVILNYIMPAGIFDVIAGISTITFIFTWIIILVAHIKFRRQNPKGVTNFRMPG
FT                   YPITSWLTIIFFLAVLVILLFIDSTRVPLILSIVIFALLAYGYGFLKKKN"
FT   gene            128117..129328
FT                   /locus_tag="Lreu_0101"
FT   CDS_pept        128117..129328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0101"
FT                   /product="Na+ dependent nucleoside transporter domain
FT                   protein"
FT                   /note="PFAM: Na+ dependent nucleoside transporter; Na+
FT                   dependent nucleoside transporter domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82373"
FT                   /db_xref="GOA:A5VHP9"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHP9"
FT                   /protein_id="ABQ82373.1"
FT                   /translation="MSMYLIINIIGLIVFLGIGWLFSKNRKEINWKTVGVMVVLNLLLA
FT                   WFLVSSAAGRAGVKAAADGFAWIVNVSAKGTVFALGDWYTPKNLNFICSALMPILMIVP
FT                   LFDILNYIGVLPWIIKWIGRGLSFITGEPKFESFFAVEMMFLGNTEVLAVSGMQLRAMN
FT                   KERNLTIAMMSMSCVTASILGAYIEMMPGQYILTAVPINIINSLIAVSMLNPVKVPAED
FT                   DTIEKVGAEVDSDKREPFFSFLGDSILGAGKLILIIIANVVAFVALAALIDAILALFWK
FT                   DLSLESILGVIMFPFSWLLGLPVHQAWMLSQDMGMKLITNEFVVMGKVTGEINSYAPHL
FT                   RAVLTVFVTSFANFGTLGMIIGAFKGLVDKENNDYIASNIGYLMLSGILVSLLSAAFVG
FT                   LFVW"
FT   gene            129409..130317
FT                   /locus_tag="Lreu_0102"
FT   CDS_pept        129409..130317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0102"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82374"
FT                   /db_xref="GOA:A5VHQ0"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHQ0"
FT                   /protein_id="ABQ82374.1"
FT                   /translation="MTTKIIMDTDPGIDDAAALTMAINDPSLDLKLVTTVAGNVTVDKT
FT                   TANALKIIHFFGKDIPVAAGAKQPLIKPFEDAARIHGESGMPGYDFGDDYGKPLDKTAV
FT                   EALHDAIMAEDEVILVPTGSYTNIALLFSEYPEVKSHIKQIVAMGGSFSGGNMTSVAEF
FT                   NVFTDPDAAKIMYNAGVPIVTVGLDVTLKALLTADTIEKLGSLNKTGEMLHGLITHYND
FT                   GSDQGRPMHDVNTIFYLLHPEAFTTKDMWVDVQTDGPAIGATVGDIRAAYHDGKTNAKV
FT                   CLDIDAEYFNKWFLEEVSKMK"
FT   gene            130420..131304
FT                   /locus_tag="Lreu_0103"
FT   CDS_pept        130420..131304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0103"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82375"
FT                   /db_xref="GOA:A5VHQ1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHQ1"
FT                   /protein_id="ABQ82375.1"
FT                   /translation="MKNIMIAGAGVLGSQIAYQTALSGFNVSVYNHHIDTAERRIKALK
FT                   SDYERDLHLTDKEFQQGLNNIKVITDDVATAVKDADLMIEALPESLELKEQFYEEVSEL
FT                   APEKTIFASNSSTFIPSQLAPYTDRPEKFLNMHFANQIWKFNVVEIMGTSQTSPEVIEE
FT                   ATKFAREIKMVPVILNKEQHGYILNSLLIPLLASGLSLWAKGVADPAMIDKDWMISTGA
FT                   PMGPFGILDMVGLRTAAQIERNAYAQTKDESHKEIADKMEQMIQEGHEGKESGQGFYNY
FT                   PNPAFMDPDFLKH"
FT   sig_peptide     130420..130479
FT                   /locus_tag="Lreu_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.728) with cleavage site probability 0.574 at
FT                   residue 20"
FT   gene            131482..132207
FT                   /locus_tag="Lreu_0104"
FT   CDS_pept        131482..132207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0104"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82376"
FT                   /db_xref="GOA:A5VHQ2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHQ2"
FT                   /protein_id="ABQ82376.1"
FT                   /translation="MNPEQFQQALADHGITLSAEQMQQFADYYQLLVETNEHVNLTRIT
FT                   EKNEVYLKHFYDSITGAFAEPRLESEDLTLCDIGAGAGFPSLPLKIAFPQLKVTIVDSL
FT                   NKRIAFLEDLVAKLGLTGVTLIHDRAETFSAKTSPYREKFDIVTARAVARLSVLSELCL
FT                   PAAKVGGEFIAYKASAAPEELQQGGTAIKQLGGKVQKTVTLTLPGTDEERNIIVIDKIK
FT                   ATPKKYPRRPGLPSKKPIQ"
FT   gene            132225..133193
FT                   /locus_tag="Lreu_0105"
FT   CDS_pept        132225..133193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0105"
FT                   /product="Effector of nucleoid occlusion Noc"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82377"
FT                   /db_xref="GOA:A5VHQ3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHQ3"
FT                   /protein_id="ABQ82377.1"
FT                   /translation="MAFSLFGIGKNNSDNTKNKVVEVKIDQIIPNRYQPRKVFDQDGIR
FT                   ELAQTIDEHGLLQPIVLREYEPTKYEIIAGERRYRAMKLLKWEKAPAIIEKMSDQETAS
FT                   LALIENLQRSQLSSVEEAQAYRQLMDLNHLTQSQLAKGMGKSQSFVANKLRLLRLITPV
FT                   QTAILDHRITERHGRALLDLDEKQQRDMLMRIVNERLTVRQTEDEVARLLGRPLPSEIA
FT                   ELKAAAKRKELASIEDHTEETADVEEVSVEKPAEKKRAPKRKTAKKSQSKKTQQVNDAR
FT                   LALNTIKKSIKLATNEGFEIKMHEEENGDTYQLTIEIPKKQ"
FT   gene            133206..133976
FT                   /locus_tag="Lreu_0106"
FT   CDS_pept        133206..133976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0106"
FT                   /product="chromosome segregation ATPase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82378"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHQ4"
FT                   /protein_id="ABQ82378.1"
FT                   /translation="MGSVIALANQKGGVGKTTTSVNLGACLAETGQRVLLIDLDPQGNA
FT                   TSGLGVEKQNIKQSIYDVLINEVPLEDVIQKTSHEGVDIAPTTIALSGAEVELTNLMAR
FT                   ETRLKDSFGEIRQKYDFILIDCPPSLGLLTINAFTACDSILIPVQSEYYALEGLSQLLN
FT                   TIKLVRKHFNPQLKIEGVLLTMFDRRTNLGQQVNSEVKKFFGDQVYDTIIPRNVRLSEA
FT                   PSHGLAIIDYDKNSTGAHVYQQLAKEVLANHGKE"
FT   gene            133963..134847
FT                   /locus_tag="Lreu_0107"
FT   CDS_pept        133963..134847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0107"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82379"
FT                   /db_xref="GOA:A5VHQ5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHQ5"
FT                   /protein_id="ABQ82379.1"
FT                   /translation="MAKNKKGGLGRGIEALFAENEVTELADETVQDIKLSLIHPNPYQP
FT                   RRTFDKEALAELASSIEKSGVFQPIILRQTDPKINRYELIAGERRFRASKIAKQKTIPA
FT                   IVRKMSDDQMMEIAVLENLQREDLTPLEEAQAYQMLMDKLSLTQAQVASRLGKSRPYIA
FT                   NYLRLLGLPKVIKEFLNTGKLSMGQARTILGLKDKSKLVPLAQRAVGQNLTVRQLEEIV
FT                   TQTNGTAKKKEERRTQRKPIYIREAESQLQSKFGTKVAVAQSRKKGAGKIEIPYTSNED
FT                   FTRILELLNISLD"
FT   gene            134861..135058
FT                   /locus_tag="Lreu_0108"
FT   CDS_pept        134861..135058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0108"
FT                   /product="protein of unknown function DUF951"
FT                   /note="PFAM: protein of unknown function DUF951"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82380"
FT                   /db_xref="InterPro:IPR009296"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHQ6"
FT                   /protein_id="ABQ82380.1"
FT                   /translation="MAAYDKGDIVMMKKAHPCGTNRWKITRVGADIKIECQGCGHIVMM
FT                   TRQKFDKGLKKVIEKANQAD"
FT   gene            135142..136239
FT                   /locus_tag="Lreu_0109"
FT   CDS_pept        135142..136239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0109"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: GTP-binding
FT                   protein, HSR1-related; Protein of unknown function DUF933"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82381"
FT                   /db_xref="GOA:A5VHQ7"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHQ7"
FT                   /protein_id="ABQ82381.1"
FT                   /translation="MSLTAGIVGLPNVGKSTLFNAITKAGAEMANYPFATIDPNVGMVE
FT                   VPDSRLDRIQELIPAKKIVPTTFEFTDIAGIVKGASKGEGLGNKFLENIRQTDAIVHVV
FT                   RAFDDNDITSVSGKVDPIEDIDTINLELVMADLDAVNKRLAKVQRAAKGRDKDALAELE
FT                   VLNKIKPVLEDGKSVRSIDFSDDEQKIVKGLFLLTSKPVLYVANIAEEDMADPDSNKYM
FT                   DAIKEHVKDDGEVIGVAAAAEEQIAEMDEADKADFLEMEGVTEPGLNRLIRAAYKLLGL
FT                   ETFFTAGGPETRAWTYKKGTKAPQAAGIIHSDFERGFIRAEVMSFEDLDELGSESAVKE
FT                   AGKLRLEGKDYVMQDGDIVEFRFNV"
FT   gene            136272..137042
FT                   /locus_tag="Lreu_0110"
FT   CDS_pept        136272..137042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0110"
FT                   /product="membrane protein of unknown function UCP033111"
FT                   /note="PFAM: membrane protein of unknown function
FT                   UCP033111"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82382"
FT                   /db_xref="GOA:A5VHQ8"
FT                   /db_xref="InterPro:IPR009214"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHQ8"
FT                   /protein_id="ABQ82382.1"
FT                   /translation="MSEEQPRNAQAGQRQKQLEKERRQANGNAFSNYDLTRKNEDFMYQ
FT                   LNKQLDRLGVPSDKKDSMLKETIDKLLAGQKKGQTARALFGTPTEYAKELKNPKPTPAE
FT                   ASKQSIKLLAIDNMLIFLSIFTFMFGLMFWLSPAAMQTKNAGSSGITAILIVAITGGLI
FT                   FGYVATQVQPQIDKNGKRVSKKPLWQRILLIVAGLAAWLIIYMLVSMLPNVINPRLNPW
FT                   VYIGIGVITFIGDMYFRSKFHVTGSLYGNRAPRR"
FT   gene            137255..137929
FT                   /locus_tag="Lreu_0111"
FT   CDS_pept        137255..137929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0111"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82383"
FT                   /db_xref="GOA:A5VHQ9"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHQ9"
FT                   /protein_id="ABQ82383.1"
FT                   /translation="MKLTQAQLAKYMDHTMLKPEATPEMIDKTVEEARKYNTASVCINP
FT                   YWVKRVHEGLEGTDINTCTVIGFPLGATSTESKVFETKQAIEDGADEIDMVINIGELKA
FT                   ENDDAVVADIKAVADATHEKGKLLKVIIENALLTDEEKARASKLTVKGDADFVKTSTGF
FT                   LTSGAKVEDVKIMREAVGPDFKIKAAGGIHSLQEAYDMIEAGANRLGVSASVQILEEAA
FT                   KQ"
FT   gene            137982..139175
FT                   /locus_tag="Lreu_0112"
FT   CDS_pept        137982..139175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0112"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="TIGRFAM: phosphopentomutase; PFAM: metalloenzyme
FT                   domain protein; Phosphopentomutase N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82384"
FT                   /db_xref="GOA:A5VHR0"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHR0"
FT                   /protein_id="ABQ82384.1"
FT                   /translation="MSYKRVFVIVMDSVGTGAAHDAAKFDDVGSDTLGHVGEYYKGALK
FT                   LPNLGKLGISNLRDTPIEGVPVADPAIGDYGKMEEISAGKDSMDGHWEMMGLPVMKPLS
FT                   TFPNGFPQEIVDKLEKFSGRKVIVNKPYSGTEVIHDYGERQMETGELILYTSGDSVMQI
FT                   AAHEDVIPVEELYKICEYARTLVNGPEYTVGRIIARPYVGPDKDHFTRTANRHDFSLKP
FT                   IGETDMDRLRAAGYDVIGVGKINDIFSGEGIDKGYHNESNMDGMDHVDEVMKQDFTGFC
FT                   FTNLVDFDAMYGHRRNPKGFGQALMDFDKRLGNVLDEMKPDDLLMITADHGNDPGFKGT
FT                   DHTRENVPLLVYSPSMNKPNQSLGVRKTFSDLGATILENFNVEPVKGTSFYKEISND"
FT   gene            139204..140502
FT                   /locus_tag="Lreu_0113"
FT   CDS_pept        139204..140502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0113"
FT                   /product="thymidine phosphorylase"
FT                   /EC_number="2.4.2.4"
FT                   /note="TIGRFAM: pyrimidine-nucleoside phosphorylase; PFAM:
FT                   glycosyl transferase, family 3; Pyrimidine nucleoside
FT                   phosphorylase, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82385"
FT                   /db_xref="GOA:A5VHR1"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHR1"
FT                   /protein_id="ABQ82385.1"
FT                   /translation="MRMVDIIDTKRNGGVLSDEQLQFFVDGVVNGTIPDYQISALLMAI
FT                   YFQDMTKEEQTSLTMKMMESGERLDLSRIPGIKVDKHSTGGVGDKVSLPLAAMVAATGI
FT                   PVPMISGRGLGHTGGTLDKLEAIPGFRVELSEDEFINQVAKEKLAIVGATGEVAPADKK
FT                   IYGLRDVTDTVDSIPLIASSIMSKKIASGTDALVIDVKTGTGAFMKTLDQSRLLAKALV
FT                   EIGKQAGLKCMAVISDMNQPLGNKIGNALEIEESIDVLKGKGPKDLTELVLTLGSYMVV
FT                   MGEKAQNTTEARKMLEQTIQDGSAFERFAAMIKAQGGDPAVVDNYQLMPQAKYKIPFKA
FT                   DRDGVLTKLSADEVGTASMLLGGGRQKADDALDYSVGIELHHKLGDYVKDGEPILTIYS
FT                   NRQEIPDIEQLLRESIKISDDGKVPTLIHEIIE"
FT   gene            140523..141233
FT                   /locus_tag="Lreu_0114"
FT   CDS_pept        140523..141233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0114"
FT                   /product="purine nucleoside phosphorylase"
FT                   /note="TIGRFAM: purine nucleoside phosphorylase; PFAM:
FT                   purine or other phosphorylase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82386"
FT                   /db_xref="GOA:A5VHR2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHR2"
FT                   /protein_id="ABQ82386.1"
FT                   /translation="MSTHINAKMGDYADTVLLPGDPLRAKYIAENFLENVKQVNSVRNA
FT                   FGYTGEYKGHRISVQGSGMGIPSMSIYINELVREFGVKTIIRVGSCGGIAPDVHVRDVL
FT                   LAQGSSTDSAVTVNTFGPGFHYAPLADFKLLDTAYHVAGKLGIETKVGDIFAADRFYND
FT                   ELDMEKLRDYGILGTEMESAGLYLLAAKLHFRALSVLTVSDLIFGDEKATAEERERTFN
FT                   DMINISLETAIAGK"
FT   gene            141343..142275
FT                   /locus_tag="Lreu_0115"
FT   CDS_pept        141343..142275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0115"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: putative sugar-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82387"
FT                   /db_xref="GOA:A5VHR3"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHR3"
FT                   /protein_id="ABQ82387.1"
FT                   /translation="MDDKNKIELALKVATLYYRDGWNQSDIATELNISRATVSRLLQFG
FT                   RDRGLVTIKIHNPVAPLHQLEVDLLAKYPSLHKIIIVPGTDDPLEEVGAAGAKYIEQVV
FT                   EDKDIIGLGWGKTVYQVGLHLKPKDVTDITVVQMKGSMANTNTRNYAFETVNIFANAFN
FT                   TVPQYLPLPVIFDHAKTRELVANDTHIKHILKLGEQSNIAVFTVGTVRDSALLFKLGYF
FT                   TKQEQLTLQHEAVGDVFSRFIDSKGQIVNEDINQRTIGIALPELQKKKHSILVAANVAK
FT                   VPAVHGVLSAGYANTLVIDQESANSLVDF"
FT   gene            142359..143501
FT                   /locus_tag="Lreu_0116"
FT   CDS_pept        142359..143501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0116"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="PFAM: IMP dehydrogenase/GMP reductase;
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82388"
FT                   /db_xref="GOA:A5VHR4"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHR4"
FT                   /protein_id="ABQ82388.1"
FT                   /translation="MSNWDTKFAKKGLTFDDVLLIPAESHVLPNEVDLSTQLADNLKLH
FT                   IPLISAGMDTVTEGPMAIAMALQGGLGVVHKNMSIQAQAGEVANVKSVVVPAGATKAAV
FT                   DDNNRLLVAAAVGVTSDTFERAEALLKAGADAIVIDTAHGHSAGVLRKIAEIREHFPDA
FT                   TLIAGNVATGEATRALFDAGVDVVKVGIGPGSICTTRVVAGVGVPQITAIYDAASVARE
FT                   YNKPIIADGGIKYSGDVVKALAAGGNAVMLGSMLSGTTEAPGEVFEDNGKKYKAYRGMG
FT                   SVGAMAQAHGSSDRYFQGGVNEANKLVPEGIEARVEYKGDVSDIVFQIDGGLRSGMGYV
FT                   GAGDIPTLIEKAQFVQITNAGLIESHPHDVQITRSAPNYK"
FT   gene            143682..144371
FT                   /locus_tag="Lreu_0117"
FT   CDS_pept        143682..144371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0117"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82389"
FT                   /db_xref="GOA:A5VHR5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHR5"
FT                   /protein_id="ABQ82389.1"
FT                   /translation="MKILVVDDDKEIVQLLEIYIRNEGYEPISAYDGKEALTKLNTNPD
FT                   IGLIILDLMMPEIDGMDVIKRVRKDSDIPILVLSAKTADMDKIQGLITGADDYVTKPFN
FT                   PLEVMARVKSLLRRSQGEVTNDQPDILNVGPLLINKDSHEVKTIKGDVIQLTALEFGIL
FT                   YLLASHPNRVFSADDIFERVWQQESVVSAKTVMVHVSHLRDKIEEATNGEKVIQTVWGV
FT                   GYKVEDH"
FT   gene            144403..145548
FT                   /locus_tag="Lreu_0118"
FT   CDS_pept        144403..145548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0118"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82390"
FT                   /db_xref="GOA:A5VHR6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHR6"
FT                   /protein_id="ABQ82390.1"
FT                   /translation="MKLTGREKSSLILEGVVTVILLLLLNMAIIVIIQDAIQSNPGVTN
FT                   GIFMIKQSLKIGPLQAQIWSYQRILIAFLVIIDVWVVWWRLRRRYHLYQMDHIIAELHY
FT                   IAQGHLDHRIPFRLKGNQQHVITSVNALVDSAVRSMDDERKIEKSKDELITNVSHDLRT
FT                   PLTSIIGYLGLIEDKQYRSEEDILKYTHTAYEKAKQMKTLVDDLFEYTKVQQHGAPVNI
FT                   MKIDLNQLIEQLTASFELEAQHRGIEITSSVIPNPLMIEADPEKLGRVFNNLVSNAFKY
FT                   GNGASYIRINARQENDMVVVKVANDGTPIPEKALDHLFERFYRAEASRSRATGGTGLGL
FT                   AIVKSIVDLHHGSVKVTSTEDETAFIVTLPLKQEVKENKQK"
FT   gene            145684..146592
FT                   /locus_tag="Lreu_0119"
FT   CDS_pept        145684..146592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0119"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82391"
FT                   /db_xref="GOA:A5VHR7"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHR7"
FT                   /protein_id="ABQ82391.1"
FT                   /translation="MAKAQINPERTRWLEVLGVSMPLCLSYIPIGLACGILLHAAGLNF
FT                   IMILLVSVLVFSGGAQFILASLLASNAPLGTIFISLFFLELRYALLGSSLSKYIKDKSA
FT                   RFILIFSASMNDENYAVNYMKFATDKKWDPDDALLVEYYSLAAWSISNMVGGLIGGAIS
FT                   IDLEVVDFALTALFLYMIVMQVQNHLTLVIGILAAVLGVYFQALTKSTLGIIIATLIAS
FT                   FVGFLIENTVRHHSKHPNSNWFLTKMFRPKITKTTIEDKQAQQKEVKEVEKLETKIEDV
FT                   VEHHDKKHEERKHDDQHPDEG"
FT   gene            146595..146939
FT                   /locus_tag="Lreu_0120"
FT   CDS_pept        146595..146939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0120"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82392"
FT                   /db_xref="GOA:A5VHR8"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHR8"
FT                   /protein_id="ABQ82392.1"
FT                   /translation="MEQLLSNKIVYHIIVIILAALAAFIPRYLPVLFFSTRKIPEWFNE
FT                   WMKYVPVSLFATLVVKGIFLTGSYHFTLFGYPERIIAALIVIVIAYFTRSMSISVIAGL
FT                   VAVWLLSLAL"
FT   gene            147035..147766
FT                   /locus_tag="Lreu_0121"
FT   CDS_pept        147035..147766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0121"
FT                   /product="Transcriptional regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82393"
FT                   /db_xref="GOA:A5VHR9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHR9"
FT                   /protein_id="ABQ82393.1"
FT                   /translation="MDFKQTIAFVNLANTLDYQYAAKKSGITVDELVRTIKALEEELNV
FT                   KLIRPEGGVVELTEIGAKLLPLITEIAQKHAKLLSVVTDYRKKEAEEAIKVTVVPGFAN
FT                   YQAAPVVKKLAQQHKMNIVEDVDPMAQLQQGESELAFISYAGKLPDDFEVLSVGTDDLV
FT                   AYIPARNPLSEQKELTLTDLKTEKFLTLNHQNPFAVFVQQVCAAAGFDPYSVFEGEKGR
FT                   TLVNMVALGDGDNLVDGTINK"
FT   gene            147741..147908
FT                   /locus_tag="Lreu_0122"
FT   CDS_pept        147741..147908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82394"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHS0"
FT                   /protein_id="ABQ82394.1"
FT                   /translation="MLMEQSISENLDSKVVKVPIVPKVTQHLAVVRRKNVEHTSEQEEL
FT                   WQALKESFEK"
FT   gene            148253..149182
FT                   /locus_tag="Lreu_0123"
FT   CDS_pept        148253..149182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0123"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82395"
FT                   /db_xref="GOA:A5VHS1"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHS1"
FT                   /protein_id="ABQ82395.1"
FT                   /translation="MISTERIQPNLVTVADMDAADAIDLIHEAQAYKAGKQAVLTAPAY
FT                   AVNLFFENSTRTKTSFQMAQMKLGMNVLEFEAGTSSVKKGESLYDTVKTMESIGVNVAV
FT                   IRHPENEYYNQLINHSDLKIGIVNGGDGSGQHPSQCLLDMMTINEEFGDFKGLKVLIIG
FT                   DLSHSRVAHSNAMMLNRLGAEVYFAGPEKWYDPTLEQYGTFGDFDELLPQMDVVNLLRV
FT                   QNERLTTADGQAFDANQYHQAYGLTLERAAKMKQGAIIMHPAPVNRGVEIDSSLVEAPN
FT                   SRIFQQMTNGVYTRMAILSRVLRYQGLM"
FT   gene            149196..150488
FT                   /locus_tag="Lreu_0124"
FT   CDS_pept        149196..150488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0124"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82396"
FT                   /db_xref="GOA:A5VHS2"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHS2"
FT                   /protein_id="ABQ82396.1"
FT                   /translation="MSKAILLTNGQRIYNDELVKSEVLIVDGKIKAIGEHIQVPSDAEK
FT                   VDLDNGLITPGLIDIHVHLREPGYTNKETIATGSKAAAHGGFTTIAAMANLNPTCDTPE
FT                   KFKEQVDRNEKAGLVKILQYSPVTVGRAGKQAVNVAEQYAAGARLFSDDGAGIQDAGVV
FT                   YQAMQQLAKVNAPLCDHAQDNQLAQNGVINDGATIAKKLALPGMPAISETAQIARNLVI
FT                   AQATGVHYHVCHVSTKESIDLIRHAKQQGINVTCEVTPHHLLLADADIKEDDAEFKMNP
FT                   PLRQRLDQQACLIGLLDGTIDCIATDHAPHTDAEKQQGFLKSPNGIVGSETAFALLYTH
FT                   FVKTGIFTLAQLIDWMAVKPQAIFNLDNAGLLKVGDPADIAVFDIDHQDVIQPDQFFSK
FT                   GHNTPFVGEQVYGMTKRTYVDGKLVYLEGEG"
FT   gene            150488..151414
FT                   /locus_tag="Lreu_0125"
FT   CDS_pept        150488..151414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0125"
FT                   /product="dihydroorotate oxidase B, catalytic subunit"
FT                   /EC_number="1.3.98.1"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase family
FT                   protein; PFAM: dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82397"
FT                   /db_xref="GOA:A5VHS3"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHS3"
FT                   /protein_id="ABQ82397.1"
FT                   /translation="MQETQRLAVELPGLSLKNPIIAASGTCGYGQEAAKKYNLNHLGSL
FT                   VLKSTTLYPRQGNPRPRVCETSAGWLNANGLQNVGITAATNEKIPWLRKNYPQLPIIAS
FT                   AAGFSEDEYVKVVSEFANTAGVKAIELNVSCPNVKHGGMAMGTDPEVLQRLVKQVVKAA
FT                   LGIPIYVKLTPNVTNIVPLAQAAEQGGANGLTMINTLTGLSIDLKTRRPALANVTGGLS
FT                   GPAIKPLALRMIHQVRQVSSLPIIGVGGIESAEDVLEFMMAGANAVQIGAASFHDPLAC
FT                   PKIAADLPIVMDRYGIKKLTDLWEVRF"
FT   gene            151411..152142
FT                   /locus_tag="Lreu_0126"
FT   CDS_pept        151411..152142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0126"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82398"
FT                   /db_xref="GOA:A5VHS4"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHS4"
FT                   /protein_id="ABQ82398.1"
FT                   /translation="MKRFVPMVAIDVATKQEAIDLFDKLMVKPQPIVKIGMELYYGLGQ
FT                   VIVKEAKKRGFKVFLDLKLYDIPNTVHRAMAAIGRLGIDFTTIHAAGGSEMLIAGLAGL
FT                   EEGAKEAGVEPAKLLAITQLTSIDEKILHEQQHVDLSLIESVQSYAQLAEKVGLAGVVC
FT                   SAHEIKAIREVTGDDFLCVTPGIRPTHAIKDDQKRVVTPAQARIDGSNAIVVGRPITQS
FT                   FDPVAAYQEVQKAFLNEEEEK"
FT   gene            152139..152780
FT                   /locus_tag="Lreu_0127"
FT   CDS_pept        152139..152780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0127"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82399"
FT                   /db_xref="GOA:A5VHS5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHS5"
FT                   /protein_id="ABQ82399.1"
FT                   /translation="MTYSQRVAKALLDIHAVTLNPDQPFTWASGLKSPIYTDNRLTISY
FT                   PEVRQAIFNGMVEQIKLHFSAADVIAGTATAGIPHAAWVAQNMELPMIYVRTKPKDHGQ
FT                   GKQIEGVLKEGQKVVVIDDLISTGGSVLNAVRAVNNAGGKVIGVVSVFTYDLPAAEQNF
FT                   MANGLKYYSVTDYMTLIKVAKENNQISTDHLKSLQEWRKDPLSWSKEQAS"
FT   gene            complement(152852..153493)
FT                   /locus_tag="Lreu_0128"
FT   CDS_pept        complement(152852..153493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0128"
FT                   /product="phosphatase/phosphohexomutase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82400"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHS6"
FT                   /protein_id="ABQ82400.1"
FT                   /translation="MDGAIFSFNNIFVNTNKLSFTAWQRFAMYEFGMGLPGKLASQFDN
FT                   LTPSQGLSLILAHFNANLAPSEKASMIAEWQKFLNEEADSLSEKDQLPGIKRLLLNLYD
FT                   HYVKIAVLDTNGDVQNVLKQIGLDNYVDSIVKTNDKENPYLTAVNQLNLIGANCIGVGT
FT                   TAHDIENIHHINAIAIGVGDAKTLASADYQVVQVGDLRYPMLQKIWEDKQ"
FT   gene            complement(153636..154847)
FT                   /locus_tag="Lreu_0129"
FT   CDS_pept        complement(153636..154847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0129"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /EC_number="2.1.1.79"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82401"
FT                   /db_xref="GOA:A5VHS7"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHS7"
FT                   /protein_id="ABQ82401.1"
FT                   /translation="MNIIIAERRMRFMLEKTFYKSLLKHSFNIPVKIVFWDGSSVIYGD
FT                   GTPEVTITFKEKIPMRDITKNASIALGEAYMDKKIEIQGSIQELIESAYESADSFMRSS
FT                   KFRKFLPKQGHSEKESENDVQSHYDVGNDFYKLWLDDTLTYSCAYFTDGNHDDLTKAQV
FT                   DKVHHILKKLDPKPGKTLLDIGCGWGTLMLTAAKEYGLKVTGVTLSEEQYRFVKERIEK
FT                   EGLQDVAEVKLVDYRELGDQKWDYITSVGMFEHVGKENLGLYFKDIQGYLADDGVALIH
FT                   GITRQQGGAYNGWINKYIFPGGYVPGLEEMIGHIEENHMQIADIEMLRRHYQRTLEIWD
FT                   MNFNEHRAQILDMMGERFTRMWDLYLQACAASFESGNIDVIQYLITKGPSGKNLPMTRD
FT                   YMTK"
FT   gene            154983..156008
FT                   /locus_tag="Lreu_0130"
FT   CDS_pept        154983..156008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0130"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82402"
FT                   /db_xref="GOA:A5VHS8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHS8"
FT                   /protein_id="ABQ82402.1"
FT                   /translation="MTNAWKHFIENVKLRRFTVLLLIIVVLWLMRSMMNLILFTFILTY
FT                   LVVSWVRLVQRWLPRMSTSLIVIVTYVLLIVLLYLGVTRYLPVLSRQVVKMVNSVVHFY
FT                   STHQATMIYRYVSHYVSTATIMSQVRHGITIAVSTLTSIGAITVSFVMSLILSFFYTLE
FT                   LKQMNEFSHSFLDSDFGWFFQDIDYFGKKFVNTFGVVLEAQFFIAICNTVITTIGLLFM
FT                   RMPQIFALSLIVFIFSLVPVAGVIISTIPLAMVGYSVGGIRDVVYIIIMIIIIHTLEAY
FT                   VLNPKFMSSRTDLPIFYTFIVLLIGEHLFGTWGLIVGVPIFTFLLDVLGVKSIRGAKKS
FT                   K"
FT   gene            156185..157846
FT                   /locus_tag="Lreu_0131"
FT   CDS_pept        156185..157846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0131"
FT                   /product="Formate-tetrahydrofolate ligase"
FT                   /EC_number="6.3.4.3"
FT                   /note="PFAM: formate-tetrahydrofolate ligase, FTHFS"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82403"
FT                   /db_xref="GOA:A5VHS9"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHS9"
FT                   /protein_id="ABQ82403.1"
FT                   /translation="MTDIEIADQATLEPITEIAEKLGLSEDEIEQYGKYKAKIDLNVKP
FT                   LPDKKHKLILVTSINPTPAGEGKSTVLIGLGDALNQLNYQTTIAMREPSMGPVFGIKGG
FT                   ATGGGYSQVVPMEDINLNFTGDLHALTSANNTLAALIDNYIMRDNAMNLDPRRIIWKRV
FT                   EDVNDRALRNVVTGLGGPMAGVPRETGFDITAASELMAILCLSTSLHDLKERISRIVVG
FT                   YTYDKEPVTVGQLNFQDAITIILKDALKPNLVQTLDHTPTIVHGGPFANIAHGCNSVLA
FT                   TQTALNLSDYTVTEAGFGADLGGEKFLDIKQRVLGKHPDAIVIVATVRALEYNGGAKLA
FT                   DLNEENLDALKKGMANLNRHIKNMQLYGLPIVVAINHFVSDTDKEIQMIKDDCAKQNVE
FT                   AILTDAWAKGGKGTHDLANKVVELADSPSEFTHIYDVQVDDLQTKLEKIAKQIYGAKEV
FT                   SFSRKAQNQLKRFAKYGWNDLPVCIAKTQYSFTDDQKQLGAPTDFTFHIRELVPKIGAG
FT                   FVVALAGNMMTMPGLPKEPAAVNMMIDDNGKITGLF"
FT   gene            158040..159719
FT                   /locus_tag="Lreu_0132"
FT   CDS_pept        158040..159719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0132"
FT                   /product="acetolactate synthase, catabolic"
FT                   /note="TIGRFAM: acetolactate synthase, catabolic; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   thiamine pyrophosphate protein, central region; thiamine
FT                   pyrophosphate protein TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82404"
FT                   /db_xref="GOA:A5VHT0"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012782"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHT0"
FT                   /protein_id="ABQ82404.1"
FT                   /translation="MEKKLHGADIVIDSLRKHGVNLVFGIPGAKIDRLFEGLDGQDSED
FT                   APKLIVTRHEQNAAFMAQAYGRLTGKTGVAIATSGPGVGNLATGIMTANAEGDPMLAIG
FT                   GQVQRKDLHRATHQSTLSTEIMAPITQYSAEIQDPNNISEIMANAFEASQDARKGAAFV
FT                   SLPQDVDDAEVTEKPLPIYETPKMGPADPNDLQKLVELIKNSKMPVILVGQRGADEEIT
FT                   TALRKLLSDYSLPVVETYQAAGVVSRDLEQQSYFGRIGLFRNQVGDQLLQQSDLVIAVG
FT                   YDPIEYEPRNWNKEGNLRIVNLDTLPAQIDNHYTPIMQLVGNIATSLTGLDKLLKGYEY
FT                   PVAATEQLAKYKQELDQDKKIQVPTSNDASHPLAVVHAIQENVTDDMHVALDVGSHYIW
FT                   MARHFRCYQPRHLLISNGMQTLGVGLPWAMVAAMLYPEHKSVAVCGDGGFLFSGAELAT
FT                   AVQHHLNVVTIVWNDGGHYDMVKFQEEMKYSQAAGVKFGNVDIVKYAESFGATGLRVNK
FT                   PADLTKVLSQAFNIDGPVVVDVPVDYSNNKELAANLIDSQLG"
FT   gene            159736..160452
FT                   /locus_tag="Lreu_0133"
FT   CDS_pept        159736..160452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0133"
FT                   /product="Acetolactate decarboxylase"
FT                   /EC_number="4.1.1.5"
FT                   /note="PFAM: alpha-acetolactate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82405"
FT                   /db_xref="GOA:A5VHT1"
FT                   /db_xref="InterPro:IPR005128"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHT1"
FT                   /protein_id="ABQ82405.1"
FT                   /translation="MTTLYEHGTLAALMAGNFDGTITVGDLLKHGSMGIGTFTGLDGEV
FT                   VILNNEVYQAVSNGQVNHITDMDATMPFASVHFPAEQQDITLRNVNFAKLNNDFVKEHK
FT                   LANVFAFLQLSGEFEHVKIRIAPKQEKPYPTLLDVAQHQSEFTAENISGTIIGYYAPEI
FT                   FGTITAEGWHLHFISDDRQFAGHLLAFDAPELTGSFEIFDNLEQHLPIHNQEFRESTVD
FT                   MATLRDGIAKSEGNAE"
FT   gene            160637..161122
FT                   /locus_tag="Lreu_0134"
FT   CDS_pept        160637..161122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0134"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82406"
FT                   /db_xref="GOA:A5VHT2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHT2"
FT                   /protein_id="ABQ82406.1"
FT                   /translation="MSDISVVMGSKSDWPTVKETCDILDEFGVSYEKNVISAHRMPNEM
FT                   FAFAQNAVDNGVKVIIACAGGAAHLPGMIAANTPLPVIGIPGQTKALGGMDSLLSIVQM
FT                   PAGIPVATTAIGKAGAKNAALLALQILGITDKHIQQQIIEYRQAMHDQAKESGQYLE"
FT   gene            161178..162239
FT                   /locus_tag="Lreu_0135"
FT   CDS_pept        161178..162239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0135"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide
FT                   synthase"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   ATPase subunit; PFAM: ATP-dependent carboxylate-amine
FT                   ligase domain protein, ATP-grasp; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82407"
FT                   /db_xref="GOA:A5VHT3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHT3"
FT                   /protein_id="ABQ82407.1"
FT                   /translation="MMALDAKQTGMKVIILDPTPNCPAGQVADEQIVAPYADTKAIEKL
FT                   ADKADVLTYEFENVDLNALEDVQDRVYLPQGTNLLYTTKNRLREKNFLRQAGVKTAPFM
FT                   AVHTSAELKDAVKKIGYPAVLKTSEGGYDGHGQEVLRNKDDLDKCAPILATGDCILEGW
FT                   VPFNRECSVMVGRNEDGEITAFPVSENIHHDEILHLSIVPARISSELQQKAQKIAVQIA
FT                   QAINLRGILGVEMFVTDDGEIYINELAPRPHNSGHYSIEACNFSQFAIHNRAICNWPLP
FT                   QVELLKPVVMVNVLGQHVNGVRQQIQKKADWHFHDYGKAEVRHNRKMGHVTILTDDIEA
FT                   TLAEIDNTGIWGA"
FT   gene            162311..163606
FT                   /locus_tag="Lreu_0136"
FT   CDS_pept        162311..163606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0136"
FT                   /product="Adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82408"
FT                   /db_xref="GOA:A5VHT4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHT4"
FT                   /protein_id="ABQ82408.1"
FT                   /translation="MIDRYTSPEMKKIWSLETQYQCWLDVEIATDEAWSELGHIPAEDV
FT                   EKIKKNAKFSVEGIAEIEAVTHHDVIAFTRDVSKSLGPERKWVHYGMTSTDVVDTAQGL
FT                   RLKKANDILRQDIDNFMDVLKELAEKYKYTVCMGRTHGIHAEPTTFGLKAARWYSEMKR
FT                   NKERFEHAAKGVEAGKISGAVGTFAEIDPFVEEYVCKKLGLRPQEISTQVLPRDLHAEY
FT                   IATIALIGTSMEEMATEIRSLQRTEIHEVEEHFAKGQKGSSAMPHKRNPIGSENITGCA
FT                   RMLRGFMVPAYEDVSLWHERDISHSSAERMILPDATSLLDYMLRRFGRILKNLDVFPET
FT                   MKKNMDKTLGLIYSGRVLLKLVNSGMTREAAYDLIQPYTAKCWAEQIPFRPLLEDDPTI
FT                   QKQLTKEDLDDAFDYHWHLRHVDDIYKRLGLD"
FT   gene            163830..164549
FT                   /locus_tag="Lreu_0137"
FT   CDS_pept        163830..164549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0137"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82409"
FT                   /db_xref="GOA:A5VHT5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHT5"
FT                   /protein_id="ABQ82409.1"
FT                   /translation="MEKLLYTGKAKQMWQTEDPAVLRVVYLDQATALNGKKKDHFTGKG
FT                   KAANAISSLVFDYLMKQGIETHFIKKLSTNEDLVKKCEMFPLEFVTRNVIAGHFASRYG
FT                   LSEGEELPSPVEETFYKSDELNDPFINESATIALEIASKEELAQMWGICRKVNNLLKPL
FT                   FAKANLRLVDFKLEFGRLSDGKIILADEFSPDNCRLWDLTTKQHMDKDVYRRKLADLTQ
FT                   TYDGVLERLEAVMKEEA"
FT   gene            164550..164798
FT                   /locus_tag="Lreu_0138"
FT   CDS_pept        164550..164798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0138"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82410"
FT                   /db_xref="GOA:A5VHT6"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHT6"
FT                   /protein_id="ABQ82410.1"
FT                   /translation="MVNVRIFVTYKQSVFDPQGETIKDAIHSLGHDEVTAVKVGKFFDV
FT                   TLDTNEDEVATAVKEIDDQLLVNFNMETYTYQVMEEA"
FT   gene            164799..165479
FT                   /locus_tag="Lreu_0139"
FT   CDS_pept        164799..165479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0139"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82411"
FT                   /db_xref="GOA:A5VHT7"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHT7"
FT                   /protein_id="ABQ82411.1"
FT                   /translation="MKIAVVVFPGSNCDVDLYEALHSVCHADVEYVSHRQKSLAGFDAV
FT                   MLPGGFSYGDYLRAGAIARFTNIMPAIIKMANEGKPVFGTCNGFQILTEAGLLPGGLKR
FT                   NDSQRFVCKTVPLEVVNSHTLFTSHYQDHERIALPIAHADGSYYADEKTLDELEANNQV
FT                   VFRYATENPNGSLHNIAGITNKHGNVLGMMPHPERAVETILGSTDGLRLFESLLENGRI
FT                   KVEA"
FT   gene            165483..167711
FT                   /locus_tag="Lreu_0140"
FT   CDS_pept        165483..167711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0140"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82412"
FT                   /db_xref="GOA:A5VHT8"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHT8"
FT                   /protein_id="ABQ82412.1"
FT                   /translation="MKQAMTPEEIKEKKPYLDWSLTEAEYDYIRTQLLGRLPNYTETGL
FT                   FSAMWSEHCSYKKSKPVLRLFPNKNERVLQGPGEGAGVVDIDDGQAVVFKAESHNHPTT
FT                   VEPYQGAATGVGGILRDIFSMGARPIASLDSLHFGELDNSTTRMKVTNTVRGIGDYGNC
FT                   MGIPTIAGETTFDPCYQGNILCNAMSVGLMDQKDIQQGRAAGIGNAVMYVGAKTGRDGI
FT                   HGATFASADFNDENMTQRSAVQVGNPFMEKLLLEACLDLIRNHPDWLVGIQDMGAAGIV
FT                   SSSAEMASEGQSGMELNLDLVPQREPGMSAYEIMLSESQERMLLCVKKGHEEDVKKIFD
FT                   FYDLEAVTIGRITAGHDYVLFHDGEEVCHIPVSSLTDDVLEEESLEKKPARIELAEQQP
FT                   AWIPDIDNVAEVLTALLAQSTIADKSSLYQQYDSQVRTNTVAGPGSDAGVLRIRGTHKG
FT                   LAMTTDGNGRFVYLSPEVGGQIALVEAAANIIASGAEPLAITDCLNYGDPTDPEIFWEL
FT                   HQSVQGMADACREFNTPVISGNVSLYNENNGQAIHPTPMVGMVGLIKNIDRVIPSFVQH
FT                   PGDKVYLVGQTRDDYAGSELQKMMTGDISGIVESFDLHHVHQYMQRLLTTMENGLVSSA
FT                   HDLSEGGLGVALAETVFKTDLGLKIDLADQHTARLFSETPGRFIVTVAPEKATEFEQVL
FT                   GKDAHLIGEVTNSHWLMVKLANGELNENVAKLQETWEEAIPCQLKSKD"
FT   gene            167687..169141
FT                   /locus_tag="Lreu_0141"
FT   CDS_pept        167687..169141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0141"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase, class-II;
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82413"
FT                   /db_xref="GOA:A5VHT9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHT9"
FT                   /protein_id="ABQ82413.1"
FT                   /translation="MPTEIKGLNEECGVFGVFDAANASQLTYYGLHTLQHRGQEGAGIV
FT                   STDGTELYQHRDRGLLAKVFADPAELKRLKGNAAIGHVRYGTSGHNSIANVQPFLFHFH
FT                   DGAVALAHNGNLTNAVTLRRELENEGAVFQSDSDTEILIHLIRKYINEGFIPALKKSLN
FT                   LVHGGFAYLLLQKDRLIAALDPNGIRPLCIGRLENGAYVVASETCALDIISAQFVRDVL
FT                   PGELIVIDKNGLHIDHYTTQTQLAICSMEYIYFARPDSIIHGVTVHNARKRMGKLLAKE
FT                   HPVDADMVIGVPNSSLSAASGYAEESGLPYEMGLIKSQYVARTFIQPTQELRELGVQMK
FT                   LSAVRGVVKGKRVVVVDDSIVRGTTSKQIVQMLKRAGAKEVHMLISSPPFKFPCFYGID
FT                   VSTRSELMAAHYSIEEMRQLIGADSLNFLSIDSLIKAINVPDAGDAPNGGLTVAYFDGK
FT                   YPTPLYDYEKGYLKSLSEQERLAGKG"
FT   gene            169146..170183
FT                   /locus_tag="Lreu_0142"
FT   CDS_pept        169146..170183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0142"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein; AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82414"
FT                   /db_xref="GOA:A5VHU0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHU0"
FT                   /protein_id="ABQ82414.1"
FT                   /translation="MSRYQDAGVDVNAGYELVHRIKDAVKSTDRPGVIGGIGSFGGMFD
FT                   LEKLQVQHPILVSGTDGVGTKLLIAQQMNKHDTIGIDVVAMCVNDVLAQGAEPITFLDY
FT                   IATGHNDPAKMAAIVSGVATGCREAGAALIGGETAEMPDMYAANEYDLAGTVTGIAEKE
FT                   ELLTTAGPQKGDILLGLPSSGLHSNGFSLVRQILFKDNHVKLTDRPEALRGKTVGETIL
FT                   TPTRIYVQAVLPLVHRKLVHGISHITGGGLIENVPRMLGDNLQAVIDPGRWPQLPVFDY
FT                   LRVLGGLTKEDCFEAFNMGIGMVLAVAPDQVAQVQEILSNKNMTSYQIGYLRHCLPDTK
FT                   KIVIK"
FT   gene            170193..170765
FT                   /locus_tag="Lreu_0143"
FT   CDS_pept        170193..170765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0143"
FT                   /product="formyltetrahydrofolate-dependent
FT                   phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82415"
FT                   /db_xref="GOA:A5VHU1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHU1"
FT                   /protein_id="ABQ82415.1"
FT                   /translation="MRVAILASGNGTNFEVLAQHFKNNDLPGELALLFCNHPDAPVMKR
FT                   AARLGISAESFTVKSCGGKQEYEEKLLGVLKKYQIDFIALAGYLRVIGPTILDHYAHRI
FT                   INLHPAWLPEYPGLHSIERAFADQQAQTGVTVHYIDAGLDSGPIIAQEHVPILPTDTIE
FT                   TLEARVHETEHRLYPEALKQALEKEQH"
FT   gene            170769..172307
FT                   /locus_tag="Lreu_0144"
FT   CDS_pept        170769..172307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0144"
FT                   /product="IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM: MGS domain
FT                   protein; AICARFT/IMPCHase bienzyme, formylation region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82416"
FT                   /db_xref="GOA:A5VHU2"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHU2"
FT                   /protein_id="ABQ82416.1"
FT                   /translation="MKRALVSVSDKQNLVPFVKGLVENGFEIISTGGTKRVLDEAGIET
FT                   IGIEDVTHFPEILDGRVKTLNPYVHGGLLARRNLPEHMATLEKLNITPIDLVCVNLYPF
FT                   KETIEKPGVEIADAIENIDIGGPSMVRSAAKNYHDVTIVVDQADYDEVLAQIKEDGETS
FT                   LATRARLAAKAFRHTAAYDSLISQYLTKQTGLEDPEKLTLSWDLKETMRYGENSHQKAW
FT                   LYEDALPKAFSVLQAKQLHGKKLSYNNIKDADEALRCIREFDEPTVVAMKHMNPCGIGR
FT                   GDSLVQAWDRAYEADPVSIFGGVIALNRQVDLVTAEKMHKIFLEIVIAPGFDDDAFELL
FT                   AKKKNIRLLTLDFSKKDEPTKHEVVSVMGGMLLQEQDMLKEDYHDWQCVTEKQPTEEQL
FT                   KTLMFAWKAVKHAKSNAIVLANDERTLGVGEGQPNRIDSLKIAVKHAGEAIDDRTVMAS
FT                   DAFFPFGDCVEYAGQNGIKAIVQPGGSVRDQESIEMANKYGIAMVTTGIRHFRH"
FT   gene            172323..173582
FT                   /locus_tag="Lreu_0145"
FT   CDS_pept        172323..173582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0145"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82417"
FT                   /db_xref="GOA:A5VHU3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHU3"
FT                   /protein_id="ABQ82417.1"
FT                   /translation="MEKQVNVLVVGEGGREFAVAKKLQESPRVKQVYCAPGNVGMSTVG
FT                   VVPVAIAETDFAKLIQFAKEHNVAWTFVGPEDCLVDGIVDEFKAAGLKIFGPDARAAQL
FT                   EGSKDYALNFMNNYHVPTARHATYRDQTAAINNVGQFGFPVVIKENGLAGGKGVVIAKD
FT                   RVEAIKTIKEMFVNGQARLVIEECLSGPEYSMFVLISNGHYRILPMAQDHKRAFDGDKG
FT                   PNTGGMGAYSPLPQLSSAVRQQMIDEVLKPTVDGLVAGEYHYHGILYIGLILTDDGPKV
FT                   IEYNVRLGDPETQVILPRMKTDLFELVDAAINDRPLPEVEENEDACFGVVLASKGYPTK
FT                   PIHGQKLGTFPVDPNVTIDYANVAGTINDLRGAGGRLLMVIGKDDSLQKARDHVYDYLR
FT                   QLDEPECFYRHDIGAKAGLQ"
FT   gene            173678..174364
FT                   /locus_tag="Lreu_0146"
FT   CDS_pept        173678..174364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0146"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82418"
FT                   /db_xref="GOA:A5VHU4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHU4"
FT                   /protein_id="ABQ82418.1"
FT                   /translation="MAKLVLIRHGQSEWNLSNQFTGWVDVDLSEKGVEQAKNAGKALKE
FT                   HGIEFDYAYTSVLKRAIKTLHYALEECDQLWIPEYKTWRLNERHYGALQGHNKQKAAEK
FT                   YGDEQVHIWRRSYDVLPPLLSADDEGSAAKDRRYANLDPRAIPGGENLKVTLERVIPLW
FT                   QDEIAPKLLDNKNVIIAAHGNSLRALSKYIENISDEDIMNLEMATGQPVVYDFDDKLNV
FT                   LSKEKY"
FT   gene            174532..175581
FT                   /locus_tag="Lreu_0147"
FT   CDS_pept        174532..175581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82419"
FT                   /db_xref="GOA:A5VHU5"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHU5"
FT                   /protein_id="ABQ82419.1"
FT                   /translation="MKMEKQRTLPMKEFFPSLKELVKPNYLKAMWPVAGVSIIFIALAA
FT                   ILALLNSNIAASLSMTMMMVMYGMASPVAILFSLLEIVGIVAIIAALAFFYTFFGVATQ
FT                   YTYQDKMAHPEQPVSAGSIWMHYKHLRKNQVWRIVLYIGLFTFLWSLPLNIVNALLLPH
FT                   LSGVAAVYTGWAIRILNDIVVLWKSIEYSQSYFLYREKQPQFLGQSMRYALTASRRFMT
FT                   GRKWNYFVILFVLEFLPIFIWTLIFGGLAFYGVYTATYVLTYIGIVLVIVGISCYLPVV
FT                   YAILALYYNKARAGMEMDVLFKDTFKPVAELTGEAYVHEVYVEKQPKEQPSPTVKREDE
FT                   KKHEAKKDE"
FT   sig_peptide     174532..174666
FT                   /locus_tag="Lreu_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.739) with cleavage site probability 0.636 at
FT                   residue 45"
FT   gene            175934..177184
FT                   /locus_tag="Lreu_0148"
FT   CDS_pept        175934..177184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0148"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib; RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82420"
FT                   /db_xref="GOA:A5VHU6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VHU6"
FT                   /protein_id="ABQ82420.1"
FT                   /translation="MDILNELEWRGAINQVTDEEGLRKLTSEDKIALYCGTDPTGDSLH
FT                   IGHLIPFMILKRFQLAGHHPVIIIGGGTGAIGDPSGRKSERQLQTMDQVHHNEEALTAQ
FT                   MKKLFGTENFTIVNNYEWLSKISLLDFLRDYGKLFNINTMLNKEVVASRLDAGISFTEF
FT                   TYQILQSVDFLHLYRHNDVQLQIGGSDQWGNITAGIDLIHKVEGPDTKVYGLTIPLMLK
FT                   ADGTKFGKTAGGAIWLDPEKTSPYEFYQFWINQDDRDVIKYLKYFTFLSKEEIDDLAEK
FT                   VEKEPWKREAQRRLAQEVTKFVHGQEAVEEAERISKALFSGDVADLSVAEIEQGFKNMP
FT                   SVDVENKKENIIIWLTDNGIEPSRRQARQDVSSGAIRINGEKVDDVDAEIDPQAHFAGK
FT                   FVIVRKGKKHYYLARVK"
FT   gene            177728..179296
FT                   /locus_tag="Lreu_R0003"
FT   rRNA            177728..179296
FT                   /locus_tag="Lreu_R0003"
FT                   /product="16S ribosomal RNA"
FT   gene            179500..182422
FT                   /locus_tag="Lreu_R0004"
FT   rRNA            179500..182422
FT                   /locus_tag="Lreu_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            182504..182619
FT                   /locus_tag="Lreu_R0005"
FT   rRNA            182504..182619
FT                   /locus_tag="Lreu_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            182702..182774
FT                   /locus_tag="Lreu_R0006"
FT                   /note="tRNA-Thr1"
FT   tRNA            182702..182774
FT                   /locus_tag="Lreu_R0006"
FT                   /product="tRNA-Thr"
FT   gene            182964..183152
FT                   /locus_tag="Lreu_0149"
FT   CDS_pept        182964..183152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82421"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHU7"
FT                   /protein_id="ABQ82421.1"
FT                   /translation="MEGKHDIVSPIFKPKNSVVNKDEFIPRPAAKLQVDNIELTIFKGA
FT                   NLSLATDIAKVVIRYAH"
FT   gene            183142..183498
FT                   /locus_tag="Lreu_0150"
FT   CDS_pept        183142..183498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0150"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82422"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHU8"
FT                   /protein_id="ABQ82422.1"
FT                   /translation="MLINWQTPEHVYLVCGKTDLRKGIDGLAMVVAENFGLELYNNSLF
FT                   LFCGSRNDRFKALYWDDEGFILLYKRYENGSLRWPKNKSEVKELKPAQLNALFTGLSPF
FT                   PERSIHKIKPGSLY"
FT   gene            183565..185094
FT                   /locus_tag="Lreu_0151"
FT   CDS_pept        183565..185094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0151"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82423"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHU9"
FT                   /protein_id="ABQ82423.1"
FT                   /translation="MTESLKKQNEALRAQLKKAQEQLERQAATIKQLQEIIFGKKTEVL
FT                   EQVADGQLSLFDPVDDLNLDQEITEVVKTTTTKVVRHRPAKKQLTRQEFLDQLPQVEEV
FT                   VSLKTTACPDCQHKMAHIGKRLARREARLKEPELYCANLYEESYKCKHCSQDENDKLVT
FT                   SKAPMALLPHSYFSSSTMAFIAYLKFNLALPFHRQEGFVQGLGLPVSAKQMASNIIKVS
FT                   QTYLEPLYQYLSNIIRQEPVIHMDETPFKVVDSPKSQDYFWVTRTTKEFAQHPVVVFHH
FT                   ANTRSGRIIGQIVGNNYPGIIMCDGYKGYSNQLYPQAKFGSCLVHIRREFVKLVKALPK
FT                   TMKASKAQQAITLLSQVFHSENQLSYQTANEKLVQRQIHVKPLMDKFYNYISQISQPIG
FT                   QLRKAIQNAIQLKSRVYRVFENGQLPLSNNSVEQSIRPSTLIRKNCLFAKTEEGAKANA
FT                   VYYSLVETAKLNQLNVQRYLKYLFDHLPESNCQDLAAFLPWSKSVQEECHE"
FT   gene            185377..185934
FT                   /locus_tag="Lreu_0152"
FT   CDS_pept        185377..185934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0152"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82424"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHV0"
FT                   /protein_id="ABQ82424.1"
FT                   /translation="MKLNCKQSITVRIEKIGIMSYRRLRKGDSAEQKQARRLKRYWRLF
FT                   LQDRENLSTKVYYEGRYFNRVVNSIMILDLILAYDQELRATYNFIQSLKHAYNQRDFTT
FT                   FFQLLKLRPDSVSHYTIHRCQALARYKEGIKRGFETKFSNGRTEGINNRIKTIKRVACG
FT                   YRYFTAFKTRIYLIIGHQIQTN"
FT   gene            complement(186527..187495)
FT                   /locus_tag="Lreu_0153"
FT   CDS_pept        complement(186527..187495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0153"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82425"
FT                   /db_xref="GOA:A5VHV1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHV1"
FT                   /protein_id="ABQ82425.1"
FT                   /translation="MTYKHLTTRELTLIADFWYQGTKAYRAAKLLQRSQETIYRVYRFL
FT                   NNGKTIDQYLQTYQRHKRRCGRKQTQLPTIEVNYIHAQIKAGWTPDTIIGRHEHPISCS
FT                   MRTLYRMFARNQYGFSVKQLPMKGKRHPNGYVEHRGKAGQLGRSIYQRYRDFPHYQHEF
FT                   GHFEADTVQGKAHRGAVMTLVERQSKVMIVLNIHHKTDEAVNCQLDQWLAKLPRHFVKS
FT                   ITFDNGKEFAGWREIANKYDLHTYFAEVGAPNQRGLNENNNGILRRDGLSKKLDFRHLP
FT                   NELVTQLMHRRNNIPRKSLNYRTPLEVFMSYVTEEQLSTFF"
FT   gene            187695..188411
FT                   /locus_tag="Lreu_0154"
FT   CDS_pept        187695..188411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0154"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82426"
FT                   /db_xref="GOA:A5VHV2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHV2"
FT                   /protein_id="ABQ82426.1"
FT                   /translation="MVDKIVARPLITIANIIWSFNPQTHLPQILLVKRAYAPFKDRWAL
FT                   PETLLRSNESAKIACIRLIKDKIGVQLSNSATEQLATFTNPQRVSGDRALAIAYMTFLP
FT                   VMPQLKAGYGATEVRWFSLNFDHGDFLLQNGELVLGLSDDSPLAFDHHQIIGTAIRRIK
FT                   NKLNYQPTILQILGPTFTLRQAREVYAIFLQTTVEKIDNSNFKKTHRKIFKEVGTAATK
FT                   RSGRPPKLFKLAEGCI"
FT   gene            188513..189946
FT                   /locus_tag="Lreu_0155"
FT   CDS_pept        188513..189946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0155"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /note="TIGRFAM: putative nicotinate
FT                   phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase and related"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82427"
FT                   /db_xref="GOA:A5VHV3"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHV3"
FT                   /protein_id="ABQ82427.1"
FT                   /translation="MNHELLTDMYEFSMANGYYLTLSHDKQARFDVFYRKAPDDGSFVI
FT                   SAGLKQVVDEVKNWHFSPDDIAYLKSLKHFSDDFLFYLTEAHNRCSIEALPEGTPVFPQ
FT                   EPFLSITGPLMDVQLLETLILNIINHQSLIATKAWQITSAADNRPVMEFGARRAQGPDA
FT                   AIYGARAAIIGGCGSTSNVLAAKLFNVPAVGTMAHAWIESFPDELTAFRAWAKIYPDNA
FT                   ALLVDTYDVLQSGVPNAIKVFKELRAAGHEPVGIRIDSGDIAQLAKQARKMMDDAGFPD
FT                   AKITASNALDAHIIKSLLNQGAPLDNFGIGERLITSSSSPVLSGVYKMAALENKGKWEP
FT                   KIKISNSREKVTLPGHKQVYRLYDKHDPQHAVADVIALADEQIGSKITAISADVHVTRN
FT                   KVILTDFIAKPLLQQVLTPDKTATCEANPFVIQRFAKKNLAQLPAATQRLLNPDHFPVY
FT                   LTKRLVDLQQKLIDEATNM"
FT   gene            189959..190507
FT                   /locus_tag="Lreu_0156"
FT   CDS_pept        189959..190507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0156"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82428"
FT                   /db_xref="GOA:A5VHV4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHV4"
FT                   /protein_id="ABQ82428.1"
FT                   /translation="MMAKALLIIDYTYDSVADDGALTCGKPAQKLENSLVELADKFYRA
FT                   GDYVIFPTDGHTGDKFSPEYKLYLRHNIVGTSGQLLYGELKEWYDQHCDSDRVYQFNKN
FT                   RYSAFQNTNLDNYLRERKIDDLWLAGLCTDICVLHTAISAYNLNYHLTIPRKDVATFTN
FT                   NGQQWALDHFKNSLGATLV"
FT   gene            190867..191952
FT                   /locus_tag="Lreu_0157"
FT   CDS_pept        190867..191952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0157"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82429"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHV5"
FT                   /protein_id="ABQ82429.1"
FT                   /translation="MKKKHYEKAKDTYSNFAEFDLTLGAWGVFMRDKDKILGALYGQAI
FT                   GDSMGMPTELWPIQKIRDKFGRNITTFLDGTDDNDIAINFKAGEYTDDTNQAFAILDAL
FT                   IETNWEPDTKVLVKHIMKWADAVGVWTNNILGPSSKAALKLVKEGKNPSEVTKTALTNG
FT                   CGMRISPIGTLYEPEDFDQLIEMVYEVTKITHSSDVSISGAAMIAGAVTAAMADYDWDD
FT                   IIDYAKKANDAGFKLGTPTWAAHNKERLEVGIALAHKYEGNDEAFSRAISNTVGTGTTI
FT                   SESIPAALAIAYYAKDVKKSAFICTNLGGDTDTIGAMATAICGAKVGAKNIPEDWKKLI
FT                   DEKNPQHNIQEFADKISEFKA"
FT   gene            191972..193324
FT                   /locus_tag="Lreu_0158"
FT   CDS_pept        191972..193324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0158"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines, uracil,
FT                   thiamine, allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82430"
FT                   /db_xref="GOA:A5VHV6"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHV6"
FT                   /protein_id="ABQ82430.1"
FT                   /translation="MDNEFVKVPEKDKTLSPGKLFYNWFAANIGIMGFVYGAIIVSYHL
FT                   SFWQSVTAALIGALTFAIPGWVAMIGQREGVTTFKMSRATFGTHGNKIPNFMAWLNMVG
FT                   WLAVNVITGTLLFSAMLKTIHVPQTGFTKFICLVVFAGLVFLSGIFKEDTLAKIQTWLS
FT                   WIFGGLTLVMLIMFLMNANWGEAFAMKPGSWVTGWLPAVAFIAAGSSISWSMAAADWGA
FT                   YVHPNTKPSATFWNTTLGAATPLFILMAGGVLLSTISPSLASASDPYQVMYGVIPGWFG
FT                   FLYFLVAAGGIIPQCLVSFRSARINLSTIGIEVSQKRSLILHAVIIILISIYVLFISGD
FT                   FLSNFELFLNFLGICLASWVAIFLVDSVIYRKNGYDVKLMEPNSSVHYNWPGIISWIIA
FT                   TIFGFLFTSNAAYRGPFAHGIFENNSSLAVFVSGIAAIIVMFIKSSDKQED"
FT   gene            193330..194217
FT                   /locus_tag="Lreu_0159"
FT   CDS_pept        193330..194217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0159"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82431"
FT                   /db_xref="GOA:A5VHV7"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHV7"
FT                   /protein_id="ABQ82431.1"
FT                   /translation="MTKKSLIIGAAFVDVIMDVPQMPTSGSDVTAKLKSYNVGGCAFNV
FT                   YGAIKHYLGANSADLFVPVGKGQYSEIVRKTMNYSRIPILLEDNHQDNGWDLCLVEPNG
FT                   ERTFITVPGIEQDWKDEWFSKINLSDYKYFYVSGYEMEDVKSANLLLDYLEQRDNDSYI
FT                   LFDASPRISHIDSRILNRLITKGVIINANEDEIGFLSDRDTLEEKTSDVFEKTDEPVLV
FT                   TLGAKGTYLYDDNGGRIISSDKVENVVNTIGAGDTHCGGVIAGLLNGNSFAEVCKIGNN
FT                   LSAQVIQQEAGSLI"
FT   gene            194345..194590
FT                   /locus_tag="Lreu_0160"
FT   CDS_pept        194345..194590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0160"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82432"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHV8"
FT                   /protein_id="ABQ82432.1"
FT                   /translation="MKFKDKWGITGALTSQIDELLYKRRIKNKVCRFSELQKRMPNCSR
FT                   RMLSLQLSELEKDNIVEKKLYPVIPPKTEYKLTRFG"
FT   gene            195009..196331
FT                   /locus_tag="Lreu_0161"
FT   CDS_pept        195009..196331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0161"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82433"
FT                   /db_xref="GOA:A5VHV9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHV9"
FT                   /protein_id="ABQ82433.1"
FT                   /translation="MDSTVTNTPQTNSKLNVKRDPVKTVILASMMGTAIEFFDFYAYGT
FT                   ASAAYFPKIFFPQMTPLLATLLSLLTFGVAFVARPIGSFLFGHYGDRLGRKKTLVVSLL
FT                   VMGVATVAIGFIPSYQVIGVWGALLLCLCRFVQGIGLGGEWSGAVLVATENAPANKRAL
FT                   YGAFPEVGAPIGFFLCNGLFFALERVLTPTQMMTFGWRIPFWASAVLVVIGLYVRRRLQ
FT                   ETPLFKLAQERDNTAASPLREVFKSNWREILKGTFIMGATYALFFTLTTWSLSYATTAL
FT                   GFTSSEFLLLLMGAIVEFAALIMLTSVLADRVGRKKVLLTASVALVGYSLVFPYFLTGQ
FT                   HNLVGVLLFLGLGFLVMGTLYGPVGAVLPELFPTRVRYSGAGITYNLAAVVGAAVAPTV
FT                   TTWLIANYGLHSAGYYMLVLSVLAVISWLLTKETKDVDYTK"
FT   gene            complement(196490..197230)
FT                   /locus_tag="Lreu_0162"
FT   CDS_pept        complement(196490..197230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0162"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82434"
FT                   /db_xref="GOA:A5VHW0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHW0"
FT                   /protein_id="ABQ82434.1"
FT                   /translation="MQTVVITGGTSGIGLATANIFLKNEWNTVLIGRDAEKGMQVEQQL
FT                   GETYSPAQVAFIQADISKSSEVEHVKQITLNKFKTVDAIINNAGIVIHGEVHETSEEDW
FT                   DKIFNVDVKGTFLVSKAFLPTMIEQDHGSIVNISSVSGMAGDRAMVAYNAAKGAIINMT
FT                   RAMAIDYGKNNIRVNVVAPGPTNTPLFHQDKQKFAKNSPLNRIVEPEEVAAAIYFVASP
FT                   AASAITGEVIPVTAGFEISTGQPM"
FT   gene            197338..197565
FT                   /locus_tag="Lreu_0163"
FT   CDS_pept        197338..197565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82435"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHW1"
FT                   /protein_id="ABQ82435.1"
FT                   /translation="MNTATLKALQNWLHGRGYTLEQVDAQLILKYHGQERAVITPPDRY
FT                   QVKDLDLNFNEWVEFNKCIRNIRHYLASNE"
FT   gene            197644..198294
FT                   /locus_tag="Lreu_0164"
FT   CDS_pept        197644..198294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0164"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82436"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHW2"
FT                   /protein_id="ABQ82436.1"
FT                   /translation="MIRVGIIGASGMAGSAIYKLASTKKDLNVTGIVRNESKARKILGA
FT                   DANLISGDIFALNDSLLSRFDVIVDAYGTSPENADRQVRLAEKLVVLARKHKIRLIFIL
FT                   GAGSLKTGKDKHLFVDDIEKMPGAETWINTPRQQLKELQYLETISDIDWLGISPSAVFE
FT                   AGVATNYILGQDELLFNEQNESKVTAGTMAKLVVNEILAPRHHRERITVIDAE"
FT   gene            complement(198360..198593)
FT                   /locus_tag="Lreu_0165"
FT   CDS_pept        complement(198360..198593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0165"
FT                   /product="cytochrome b5"
FT                   /note="PFAM: cytochrome b5"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82437"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHW3"
FT                   /protein_id="ABQ82437.1"
FT                   /translation="MRSFTHNELAQYNGQEGRPAYIGVRGNVYDVSEVPEWKGAEIHGN
FT                   VFGHDLSDVTYQQAAKKYSPVSKLPIIGKLVD"
FT   gene            complement(198736..200154)
FT                   /locus_tag="Lreu_0166"
FT   CDS_pept        complement(198736..200154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0166"
FT                   /product="putative tyrosine permease, NhaC family"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; TC 2.A.35.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82438"
FT                   /db_xref="GOA:A5VHW4"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHW4"
FT                   /protein_id="ABQ82438.1"
FT                   /translation="MKIINKSKNSPEPVIGFSESLLILGVILCILGYPIIFKHQEPQAP
FT                   LFISLVLLAVYGRIRGFKWDTIMNGMRHGLRAGVDPLIIFLSIGVLIATWIFSGTIPTI
FT                   MYFGFEIISVKFFLPTVFIVCTLVGVACGSSFTTVSTMGIAFIGIGATLKINPGLTAGV
FT                   IVSGAFCGSNISPLSGTTNLAASVGEISIYKHIKSLLTTDIPAWAICLILYTFLGLNSK
FT                   NVSLGAVHQMMAGLQNGFWISGWALLPVLLLIVLAIFQVPAIPSLGLGSLFAVVLGWIH
FT                   APKTSLTTITNTIMTGYVSHTGDKTIDTLLSKGGISSMLTSLALIIFALALGGLLIKFN
FT                   IISAIINHLTGIVKTPGRLAFSTALTCIGVNLLVGEHYLAIILPGQSFLPSFDKLGLKR
FT                   VDLTRILNDAGAAVNAIVPWSVSGVFIASTLQINPLSFIPWVFFPFLVTILTIIAGMLV
FT                   KVPVKSPAANLATE"
FT   gene            complement(200488..201519)
FT                   /pseudo
FT                   /locus_tag="Lreu_0167"
FT                   /note="cation efflux protein"
FT   gene            complement(202132..202674)
FT                   /locus_tag="Lreu_0169"
FT   CDS_pept        complement(202132..202674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0169"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82439"
FT                   /db_xref="GOA:A5VHW5"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHW5"
FT                   /protein_id="ABQ82439.1"
FT                   /translation="MENAYLIHGTSTRDDDWFPWLEEEAKPIIALDRIWLPNPFNPQQA
FT                   EWDQAVDNQINPQDNLILVAHSLGCITALRYIERHHVKDARLLLVGAFDKGLSAYPELD
FT                   GFMKDRPHYEQIFPKLAKATVITAKDDPIVPYQNSIEVANKIRAKLIVKETGGHFLTSD
FT                   GFTKFPLALKELNKLAE"
FT   gene            complement(202686..203087)
FT                   /locus_tag="Lreu_0170"
FT   CDS_pept        complement(202686..203087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82440"
FT                   /db_xref="GOA:A5VHW6"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHW6"
FT                   /protein_id="ABQ82440.1"
FT                   /translation="MKKIYKLAANFSHILRLCTIGALAILGILLTIILFTETFSLIPLM
FT                   QDGNTDHVIFKILDRVIVFFLFFSFMTMIIAALKHHGRIAVDFLLSLGIMALIRGLIAA
FT                   HGQPYEILTNSIAILLLIIGMVVLKHFMK"
FT   sig_peptide     complement(202977..203087)
FT                   /locus_tag="Lreu_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.819) with cleavage site probability 0.710 at
FT                   residue 37"
FT   gene            203219..203989
FT                   /locus_tag="Lreu_0171"
FT   CDS_pept        203219..203989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0171"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82441"
FT                   /db_xref="GOA:A5VHW7"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHW7"
FT                   /protein_id="ABQ82441.1"
FT                   /translation="MRKPFIAANWKMHKNVQESVEFVDAIKGKLPDPQEVEVGIAAQAF
FT                   ALPSMVQAADDSGLKIIAQNAAAEYSGAFTGEISLRGLADAGVSYVMLGHIERRHLFHE
FT                   DNELVNRKVLAALQMGVTPIICTDETMVQKEVNGEIHYVFQQLMSVLRGVSLDQIKNVV
FT                   VSYEPSWAVGYGQHANPVLAEEGCRQIRRTIADNYTYEIADKIRILYGGSVNPDNIGMI
FT                   MNKPDVDGVLIGRASLDVDNFLRMVNYLKNDQEK"
FT   gene            204045..204119
FT                   /locus_tag="Lreu_R0007"
FT                   /note="tRNA-His1"
FT   tRNA            204045..204119
FT                   /locus_tag="Lreu_R0007"
FT                   /product="tRNA-His"
FT   gene            204267..205220
FT                   /locus_tag="Lreu_0172"
FT   CDS_pept        204267..205220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0172"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82442"
FT                   /db_xref="GOA:A5VHW8"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHW8"
FT                   /protein_id="ABQ82442.1"
FT                   /translation="MKNVQIGGTNWEVSNVALGIMRMGTLAVNKAIDALEAAHDAGINF
FT                   IDSADIYGNDPQLGRGSSEIHFGEALKKSSLTRDDFYIQSKGGLFANADDKITRYDSSK
FT                   KHLIAAVDGILQRMGIDYLDSFLIHRPDPLMEPAEIAEAFDQLQASGKVRHFGVSNFNP
FT                   QQIALLQAGTNQRLLIDQVQFGLKHTGMIDFGLHTNMTDDAAINHDGGLLEYTRRKQMT
FT                   IQTWSPFQYGTFAGTFINNDQFPELNAMLETLAQKYKVSKNAIAVAWILRHPAHMQVLL
FT                   GTMTPAHIIDSAKGSDITLTNQEWYDLYLAAGNDLP"
FT   gene            205220..205720
FT                   /locus_tag="Lreu_0173"
FT   CDS_pept        205220..205720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0173"
FT                   /product="phosphoesterase, PA-phosphatase related"
FT                   /note="SMART: phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82443"
FT                   /db_xref="GOA:A5VHW9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHW9"
FT                   /protein_id="ABQ82443.1"
FT                   /translation="MKKDYLQFYQHITAPFYRHPWTIPLLRAVNKFVVWTMYVAYIVIL
FT                   VWVGKNNVLKAGPFLLIPGIGFILLSFIRQRIDAPRPYEKFPINPLIRRQKTGDSLPSR
FT                   HVFSATVIAMCGLRLNLILGVILLVLAVVSAITRVIGGVHFPRDVVIGFICGFICGSFL
FT                   FLV"
FT   gene            205741..208590
FT                   /locus_tag="Lreu_0174"
FT   CDS_pept        205741..208590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0174"
FT                   /product="type III restriction protein, res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein, res subunit; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82444"
FT                   /db_xref="GOA:A5VHX0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHX0"
FT                   /protein_id="ABQ82444.1"
FT                   /translation="MDNSVLQDAILNGLISTQYQGNTLLGPQLLTNNQSSTIWQTLRHE
FT                   LLSCKNFTWSVAFITLDMLVPFKAVMADLAQQGVQGTIITSDYLNFNHPAMFEELQKIP
FT                   NLTVRIADLNGFHTKGYLFDHGKYQTVIIGSANFTRSALLVNKEWNLKLSSRQEGSLFQ
FT                   QLTAELNAVKHESTVLTSEWIAEYRKNWQPPKTRVTQPEKLKPIEPNQMQQAALGQLST
FT                   LIKTGAKKGLVVSATGTGKTYLGAFAVNKYQPRRFLYVVHREQIAKKSLASFRRVIGGK
FT                   KTDYGLLTGNRHDWNAKYLFATVQTLSQQAVLDKLKATEFDYILIDEAHRAAAPSYQRI
FT                   LNHFMPQFWLGMTATPERMDNQDVFKLFDYHLAYEIRLKDALAAKMLAPFHYVGVTDYE
FT                   VDGEVITETSKLNQLIVSKRVNYVLNQLDYYGYCGDQPRGLVFCSRQAEAKELAVQFNA
FT                   ANHPAIALTNQSSSQERAKAVEQLEAGKIEYIITVDLFNEGVDIPSVNQIVMMRNTQSP
FT                   IVFIQQLGRGLRKYPGKDFVTVIDFIGNYQHNYMIPLALNQDNSRSKDQARREVKVPTN
FT                   FDVSTINFTKVAEEQILASLDKVKLDSMRELRQAYHDLANQLGRAPLLGDFYRYGSVDP
FT                   RVFAQNSQLNHYGDFLEKMGTELKLTKYERQVLAFLTKELLNGKRPHELILLQCLLRGT
FT                   CSIDAFKAELEQQNIRVTPAVLQSVDDILSLQFFNVKAGKQLKKDQYGGLPIIDHPDLL
FT                   TYQLNSKIRAGLESDNDFKCLFTDVLTTGLEIAKQYDLKQAFTLYQQYDRKDVCRLLNW
FT                   PLDVSAPLYGYRVAEDVCPIFITYHKDAEEKRNAIYNNQLQDGRSLRWYTRTPRHLSSD
FT                   EVQRLLAGVKEGKPQVKLHLFVKQSDAVGKEFYYLGPAYVQPDSVREELVGPKKKAAVG
FT                   MDLVLEQPLTPAMMNLLAI"
FT   gene            208652..208939
FT                   /locus_tag="Lreu_0175"
FT   CDS_pept        208652..208939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82445"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHX1"
FT                   /protein_id="ABQ82445.1"
FT                   /translation="MNIMAKGKVKTSDKRSVRDVKLDELAGLLNEYDVNTMGALVKSLK
FT                   KSQKKNKQSKKDELRDTIERQQEHIDEQKGTIDQLNNHISKLIDRLDNKL"
FT   gene            complement(209066..210421)
FT                   /locus_tag="Lreu_0176"
FT   CDS_pept        complement(209066..210421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0176"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82446"
FT                   /db_xref="GOA:A5VHX2"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHX2"
FT                   /protein_id="ABQ82446.1"
FT                   /translation="METVKNIIIGFGKGGKTLAKFLAQHGEQVLVIEKSKQMYGGTCIN
FT                   IACLPSKRLIIEAAHGTSFEDAVDGKNVMTSQLRQKNYQMLASEDNITVLDGTAHFTGN
FT                   HTIDVQTPDGHTLSYKGERIFINTGATSTIPDIPGLKDSRFLMNSTQAMDQPKLPRELV
FT                   IIGGGYIGLEFANMFTSFGSHVTVLDHHQTLLPREDDDVAEMVIQNFKDNGVRFEVGVD
FT                   IKAIGEQDNQAAITFARTDNRETTIFADKILVATGRKPATAALDLQNTDIKVAKNGAIV
FT                   VDDLLHTSVPNVWAIGDVKGGPQFTYISLDDFRIIKDELFGNKERRISDRLIVPTNVFI
FT                   EPSLAQVGLTEREAQKQEKDYLLFKMPAAAIPKAKVLKDTRGLLKVLVDPQTNLIIGAT
FT                   LYVQEAQEIINMIVLAMRAKLPYQMLRDQIYTHPTISEAFNDLFKQSVDKKE"
FT   gene            210708..211028
FT                   /locus_tag="Lreu_0177"
FT   CDS_pept        210708..211028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82447"
FT                   /db_xref="GOA:A5VHX3"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHX3"
FT                   /protein_id="ABQ82447.1"
FT                   /translation="MKAAHLVEHPKKVNEKKPVIQETKFIDILSKVATVVAILMYVSYI
FT                   SQIKNNLAGNYGAPLQPLVAALNCTLWCIYAYFKQQRDWPVFWANFPGIIFGLITFITC
FT                   LH"
FT   gene            211137..211841
FT                   /locus_tag="Lreu_0178"
FT   CDS_pept        211137..211841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82448"
FT                   /db_xref="GOA:A5VHX4"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHX4"
FT                   /protein_id="ABQ82448.1"
FT                   /translation="MPKDGMSVVRFSSFAPVTEMILQSLPAEKDKEDQKAPAIKNFDQL
FT                   RQRLNSQARFLILDLEFFQDQQKHRNGVAQIAGKMFETQNSFNYYLYAQNMSAERQLAF
FT                   LRQYDLRLSEVNGYEVRQTFNRIFHFIAVERPDYIVSWDNGTDFESLNYEANRLKIRKE
FT                   DRPWRTIQSLDLEKLVAKEVWKSKSGISLEKMCRLLHLPRVKYHQAQNDVIAIEQILKF
FT                   YARDLERELNCR"
FT   gene            211917..212651
FT                   /locus_tag="Lreu_0179"
FT   CDS_pept        211917..212651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0179"
FT                   /product="peptidase M10A and M12B, matrixin and adamalysin"
FT                   /note="PFAM: peptidase M10A and M12B, matrixin and
FT                   adamalysin"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82449"
FT                   /db_xref="GOA:A5VHX5"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHX5"
FT                   /protein_id="ABQ82449.1"
FT                   /translation="MNEINFIFRLLKRIFIIGLLVGGGWLYFNDARVQATANQTAWNVR
FT                   DRIAKLIGRDDTNSNDNSNLHLNDANNGSSKNEQGPTTEQQTSTQTSIPSTGRWATNQA
FT                   TVYVNTNNAQLDAATNTAIQNWNQTGAFTFKPVNNQSKADIVVTTMNRSDSNAAGLTKT
FT                   SSNSLTRRFMHATVYLNTYYLTDPSYGYSQERIVNTAEHELGHAIGLDHTNAVSVMQPA
FT                   GSFYTIQPDDVQAVQKLYANNK"
FT   gene            complement(212835..214643)
FT                   /locus_tag="Lreu_0180"
FT   CDS_pept        complement(212835..214643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0180"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82450"
FT                   /db_xref="GOA:A5VHX6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHX6"
FT                   /protein_id="ABQ82450.1"
FT                   /translation="MKKLSNKQKLIIILVIAAIAVVLQFGFHLQLFAQILVTVVGAIVA
FT                   FSMFIGMIKTIRSGKYGVDLLAIMAVVATLAVSEYWAAMVILVMLTGGDALEDYAAKKA
FT                   STELKALLNNSPQTAHLITNGKTSDIPVNDVKVGDQLIVKPGELVPVDGIIKIGEGLFD
FT                   ESSLTGESRPVSKTTGDEVMSGSVNGDNAITLQVTKLAKDSQYQQLVKLVKEAESTPAH
FT                   FVRLADRYAVPFTIIAIIISSLAWVLSGRPERFAEVLVVASPCPLILAAPVAMVSGMSR
FT                   ASRNGIVVKTGSVLEKLAVAKTGAFDKTGTITSGQLTVDKILPTGKIDSTQLLHYAVSA
FT                   EQQSSHILARSLLSYATAYNVSLSPVDQLTEITGKGILATVDGREVKVGKLKFVSPENL
FT                   NQMLASTAIYVSVDGQYYGAITFTDHIRPEAKQTMNQLKKLGVTNLLMLTGDQAVIADK
FT                   VAQQVGITQVKADLLPQDKINALKAIPTNEHPVFMVGDGVNDAPSLVTADVGIAMGAHG
FT                   STAASESAAVVILKDDLSRVAKAVSISQETLRIAKQAVLIGIAICTILMLVASTGIIPA
FT                   FFGAMLQEVIDTVSILWALKARKMTD"
FT   sig_peptide     complement(214542..214643)
FT                   /locus_tag="Lreu_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.993 at
FT                   residue 34"
FT   gene            214747..215934
FT                   /locus_tag="Lreu_0181"
FT   CDS_pept        214747..215934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0181"
FT                   /product="Phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="PFAM: metalloenzyme domain protein;
FT                   Phosphopentomutase N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82451"
FT                   /db_xref="GOA:A5VHX7"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHX7"
FT                   /protein_id="ABQ82451.1"
FT                   /translation="MQNGQSYQRIFVVIIDSLGIGATADANHFESLGADTLGHLGEHFR
FT                   VRLQLPTFQKMGLGNLHPIMGMPSLENLHAVYGQMSSISTGLSDRESQWEMMGLATTAE
FT                   PDVFIDGVPLEIAINFARKAKRPLLSNSLMNIRTALKDYGLEQLTTGGLLVATASSSSV
FT                   WLIAHEQTISVGELKEDCQILRKMLDNSPYTIENVNGLLFSGNQAANFYPQELYKFPLA
FT                   PASPTVIDCLLEEGYAVKLIGKSTQFFGLDHNEITGNNQESFVQLKELIEKKFTGVCIA
FT                   EVGEIEQFGKARNPEGFGTELMRIDHELTKIIDKLQDDDLLIVTGNFGNDPTYPGEKHT
FT                   REYVPLLVTSPQIKPNISLGGRSFSDIGATILDNYDLGDKLPVGNSFLRELFSAY"
FT   gene            complement(216153..217007)
FT                   /locus_tag="Lreu_0182"
FT   CDS_pept        complement(216153..217007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0182"
FT                   /product="3-beta hydroxysteroid dehydrogenase/isomerase"
FT                   /note="PFAM: 3-beta hydroxysteroid dehydrogenase/isomerase;
FT                   NmrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82452"
FT                   /db_xref="GOA:A5VHX8"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHX8"
FT                   /protein_id="ABQ82452.1"
FT                   /translation="MKYMVTGATGHLGQHVVKQLSKLTSPDNIRVGVHNPAKVSQFKDA
FT                   GYEIAAIDYHDVAKMTAAFSGIDVVIYIPSITYLVKDRIDEFENSLTAIFKADVHNLVD
FT                   VSFIADQYNNPFQMAGYYAYLPARLASSGLKYAVVKNSLYADPLVPYLPELIERHNIIY
FT                   PVGDQAMSFISRQDSAEAIANVAVKPYLRDKGQNYLLTMSKNYTMSELSYIMTNVTGEE
FT                   IGYDPVTVKRFAEIYAAEGDGNELASMYQAAAMGLMDQVTDDFAHITGHQPTDMKEFLI
FT                   KNY"
FT   gene            complement(217010..217330)
FT                   /locus_tag="Lreu_0183"
FT   CDS_pept        complement(217010..217330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0183"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="PFAM: protein of unknown function UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82453"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHX9"
FT                   /protein_id="ABQ82453.1"
FT                   /translation="MSALNKAGLINTVHGAADPALAKSPENISLYDIFLAIEGDAHLFT
FT                   IDERTNPQCIVGGNIQETLDGFYQQAETAAKAKLAKTSLQDVIDTIRVKQAIKDAKKER
FT                   GN"
FT   gene            217613..218512
FT                   /locus_tag="Lreu_0184"
FT   CDS_pept        217613..218512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0184"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82454"
FT                   /db_xref="GOA:A5VHY0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHY0"
FT                   /protein_id="ABQ82454.1"
FT                   /translation="MRFKKIVALSLLSIAGLLAGTITPAVASAASNKPIIVGSKNVSES
FT                   KTVSEIYALALEHEGYKVTRKPNISNNVIFSATQKGEVDVYPDYTGTIVEAYLKKKGTG
FT                   KSASQMAKLAHDGIQKDGLTTFKYAPGDNRQGVAMPTKDAKKYHITNLSELQKNAKKIN
FT                   FASQGEFEKRADALPEMNKVYGKFDFKSIKDYDVNLLYKIMEQGKAQAAPVSTTDGQLA
FT                   TGKFTLLKDNKNIWPPYNLVPVVNKKAAKSHPKMEQALNKVDAKLTTKQLTDLNKKVNV
FT                   DGQNYKTVAKNWYNQNMK"
FT   sig_peptide     217613..217702
FT                   /locus_tag="Lreu_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.754 at
FT                   residue 30"
FT   gene            218579..219244
FT                   /locus_tag="Lreu_0185"
FT   CDS_pept        218579..219244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0185"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82455"
FT                   /db_xref="GOA:A5VHY1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHY1"
FT                   /protein_id="ABQ82455.1"
FT                   /translation="MGSGSLLEQIIQYFQTNSGQYWQYVGQHIILTVVTLVISMIIALP
FT                   LGYIGSRIKPVAQFCVMFAQLLRIIPSLALLFLLIPFIGTGVVPALIALIVLALPPLLI
FT                   NTILGFNEVSPLYKEVGIALGMDQRQLRRQIEIPLALPYILNGIKLALVEIIASATLAT
FT                   YIGAGGLGTLIFTGLGLYDMSYVVIGAVSVAILSLLAMISFDFLIRKVQKHDRTNYSI"
FT   gene            219219..219989
FT                   /locus_tag="Lreu_0186"
FT   CDS_pept        219219..219989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0186"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82456"
FT                   /db_xref="GOA:A5VHY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHY2"
FT                   /protein_id="ABQ82456.1"
FT                   /translation="MTEPIIQFKHVEKRFNDQTVIPDLNFTVNKGEFITILGSSGSGKT
FT                   TTLKMINGLITPSAGEILIDGQKLRDLDLVKLRRHMGYVVQQIGLFPHMTIGQNIAVVP
FT                   KMLHWDKKEINNRVKELLSLVQLNPAEYMNRYPQQLSGGQQQRVGVARALATNPPYVLF
FT                   DEPFGALDALTRMELQREVKKIHESLAEKTFMFVTHDINEALFLGQRVMIMHEGRIVQF
FT                   ATPEEIVRHPATEFVEQLLGTIRQNQDLWRQQYE"
FT   gene            219982..220620
FT                   /locus_tag="Lreu_0187"
FT   CDS_pept        219982..220620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0187"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82457"
FT                   /db_xref="GOA:A5VHY3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHY3"
FT                   /protein_id="ABQ82457.1"
FT                   /translation="MSEYWNENWPIMLDDVQQHATMVLSSLAIALVIAVVIILLFLRRE
FT                   KWLNSLIYFFSLLYSIPSFAFFALLLPISGLGMKTAIIVLTIYSEYVLLRSFITGIRGV
FT                   DPQLIEVGVGMGMTSRQVFRQIQLPQALPAIFSGIQVALASTMAMATIAATINAGGLGQ
FT                   LLFEGLQGQQVVPILWGTVLTMALTLICAGIVQLISWMLLHRWKGVLNN"
FT   gene            220692..221120
FT                   /locus_tag="Lreu_0188"
FT   CDS_pept        220692..221120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0188"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82458"
FT                   /db_xref="GOA:A5VHY4"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHY4"
FT                   /protein_id="ABQ82458.1"
FT                   /translation="MDKNELKKLTPMQYAVTQMGVTEKPYSGKYDRFDEPGIYVDVVSG
FT                   EPLFSSLDKYDAGCGWPAFTKPIKKRVLTEKRDQSFGMERTEVRSKEADSHLGHVFTDG
FT                   PTDRGGLRYCINSAALQFIPVDKLQEKGYGEYLSLFDK"
FT   gene            complement(221184..222521)
FT                   /locus_tag="Lreu_0189"
FT   CDS_pept        complement(221184..222521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0189"
FT                   /product="Chloride channel, core"
FT                   /note="PFAM: Chloride channel, core"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82459"
FT                   /db_xref="GOA:A5VHY5"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHY5"
FT                   /protein_id="ABQ82459.1"
FT                   /translation="MKNENTLYHKRARDILGKPFTSIVSRYLGVSIAIGIVTGLVIGVF
FT                   RWIIDHTLTLLTIIYPFMGKHPLVLIPYVLGTFIVAWLIGKIVKPYEEDVVRSGVTQLK
FT                   AVLLGRHRIHWWPVLWRKFVASLLTICPGLFLGREGPSIQIGACIGACFNEKFFHLTDK
FT                   DKYLLMECGVAAGLSAAFSAPLAGTMFLLEEMTHNFNSRIWIPALTSSIVSAFITFLFF
FT                   GIKPCLYIPITTKLPVASYPWLIIAGVAIGFLAYCFQFAALNLTWWYSKITFIPKEFHS
FT                   IIPLLLVIPVGLWNPYILGGSHDFIKYVTNMSLSTNWQAMVAILLVYFILRFGGTMIAY
FT                   GATVPGGIFMPLFVLGTVVGALTGTILIHMGIIPASCYVNVIIISMAAYFGGAEGLPFT
FT                   AILLVTEMVGSVEQILPMTLITLVAYYVNRLLGGRPSLYDAMLEEK"
FT   gene            complement(222868..224013)
FT                   /locus_tag="Lreu_0190"
FT   CDS_pept        complement(222868..224013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0190"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82460"
FT                   /db_xref="GOA:A5VHY6"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHY6"
FT                   /protein_id="ABQ82460.1"
FT                   /translation="MEVSEKVKVLQDLIKIHSVNGNEVEVAHYLQKLLSSHGIDSKVDE
FT                   FGDRRANLIAEIGTGESKKILGLTGHQDTVAVPNPDRWQHDPFGGEINGDYVFGRGAAD
FT                   MKSGLAAQAIVLIELKEAGQLPSGTVRFIATAGEELGTPGAYRLQKQGVADDLDALVVG
FT                   EPTGGNVIFAHSGSMNYRVTSYGKSCHSSHPQNGINAIEGLLKFIEEEKHLFDNSKDDQ
FT                   YLGKVQHSITVIDGGSQVNTIPDSASLHGNIRPTAAFNNIKVADRLNDALEYINHTTPF
FT                   QLELKIIQDFYPIATEPNNDFVQIALNAAQRNYPNDIKLDIINGATDASVFTLNRPDLP
FT                   VVILGCDDWNAAHQNDEYTTISSYVATIKAYKQIIRDFFKE"
FT   gene            complement(224032..224721)
FT                   /locus_tag="Lreu_0191"
FT   CDS_pept        complement(224032..224721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0191"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82461"
FT                   /db_xref="GOA:A5VHY7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHY7"
FT                   /protein_id="ABQ82461.1"
FT                   /translation="MNNLIPNVIQLGWGGDNGWGTSIVQTIYMTFWPAIFGGILGLIFG
FT                   VALVVTEPGGILENRIVFSIVDKVVSVFRAIPFIILLAFIAPFTQLIVGTQIGTTAALV
FT                   PLSLGVFAFYARQVQVALESVDHGKIEAAQAIGATNWDIIIDVYLREARSELVRVSTVT
FT                   LISLVSLTAMAGAIGAGGLGNTAISYGYDRFNNDVTLVATILVLLFVLIIQVVGDILAK
FT                   KLNHQDR"
FT   gene            complement(224714..225778)
FT                   /locus_tag="Lreu_0192"
FT   CDS_pept        complement(224714..225778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0192"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82462"
FT                   /db_xref="GOA:A5VHY8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHY8"
FT                   /protein_id="ABQ82462.1"
FT                   /translation="MANPIIDLDNISVTFKQRKQVVHAVKDVTLKVEKGDIYGIVGYSG
FT                   AGKSTLVRTINLLQLPTAGSVTVNGTVFFKDHQQQISNKELQEKRRKIGMIFQHFNLLN
FT                   ETSVIENVLFALKHTDMDDDAKEKKALELLDLVGLKDKAEFYPVQLSGGEQQRVSIARA
FT                   LANDPEILISDEATSALDPQNTNQILDLLKRLNEKLDLTIVLITHEMDAVKRVANKIAV
FT                   MEYGQIIERGTLQKVFLQPQQDLTRQFVGGSLAAIDTLKAFDLGHLDDDEELLQLVYDA
FT                   NNVTKSIIIELYKKLQVEASMLYGNIEVLAGSPVGTLFVVIKGDADKRQQAIDFLKEND
FT                   VTVTKIDDRRIWNE"
FT   gene            complement(225791..226642)
FT                   /locus_tag="Lreu_0193"
FT   CDS_pept        complement(225791..226642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0193"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82463"
FT                   /db_xref="GOA:A5VHY9"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHY9"
FT                   /protein_id="ABQ82463.1"
FT                   /translation="MKRKKRRNIIIWSVVALIVVIAGYFSFIRPQQQAKRTVTVGIMAG
FT                   SKQDDEIWNSVSKTAKDKYNVTLKFKRFTDYNQPNKALENGDVDLNAFQHKLFLQTWNK
FT                   AHKTDLVSLGDTFITPIRLYSKQYKSVKEIPNGGTIAVPNDASNESRALFALKNAGLID
FT                   LKKGTKLATVSSISKNPRDLKIKELAADQTARSLDNVDASVVNTNYAQAAGLNYKSAIF
FT                   VEPVNRDSKQWVNIIAVKGSEKNNKIYKDVVRAYQTEKTKREIKKLYGTAEIPAWDLNF
FT                   NK"
FT   sig_peptide     complement(226538..226642)
FT                   /locus_tag="Lreu_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.699 at
FT                   residue 35"
FT   gene            227163..228095
FT                   /locus_tag="Lreu_0194"
FT   CDS_pept        227163..228095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0194"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="PFAM: Lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82464"
FT                   /db_xref="GOA:A5VHZ0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHZ0"
FT                   /protein_id="ABQ82464.1"
FT                   /translation="MTRKVGVIGMGNVGSTVAHYIVAMGFADDLVLIDKNEAKVKADAL
FT                   DFEDAMANLPFHTNITVSDYSALKDADVIVSALGNIKLQDNPNADRFAELPFTRRAVKE
FT                   VAQKIKESGFNGKIVAITNPVDVITSLYQKITGLPKNHVLGTGTLLDSARMKRAVAERL
FT                   NLDPRSVDGYNLGEHGNSQFTAWSTVRVLGRPLTELADKRGLDLEELDKEAKMGGWTVF
FT                   QGKKYTNYGVATAAVKLVNAILSDSLTELPVSNFREEYGVYLSYPAVVGRDGVVEQAQL
FT                   DLTEEELQKLQTSADFIKEKYQESLQAKD"
FT   gene            228242..229438
FT                   /locus_tag="Lreu_0195"
FT   CDS_pept        228242..229438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0195"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82465"
FT                   /db_xref="GOA:A5VHZ1"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHZ1"
FT                   /protein_id="ABQ82465.1"
FT                   /translation="MTKEVKRIIFVVLFCEFLICLGMSLIFPVEPFIKNEYHFTAFDMG
FT                   VMSSLFAFVQFIASPIVGRISDKVGRKPMLVWGLLIFAIAEFVFALAQHLWLFDLSRAV
FT                   DGLSAAMFVPTSMALAADITSEKDRAKVIGWLSAAFSGGLILGPGLGGMLAHVNYKFPF
FT                   WVAGILGLISTVVAWRFLPHDEDELFKSETKNPENELLTGGWSQLKQIMTPILITLFGM
FT                   IFVASFGLAGFESIYSLYVNEVHNFDLNAIALVLTLNGIISLILQVFFFDRLVRWLGEV
FT                   RLMRYSFFLSLVGTIMVIYDHNHWHIIIATLFVFEAFDLLRPTITTLLTKMSKTNQGLL
FT                   NGVNMSLTSVGNIIGPLISGYLLDVNYQYPYWFVSIFLIISWVITLILGRERKAAAND"
FT   gene            complement(229520..229813)
FT                   /locus_tag="Lreu_0196"
FT   CDS_pept        complement(229520..229813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0196"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82466"
FT                   /db_xref="GOA:A5VHZ2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHZ2"
FT                   /protein_id="ABQ82466.1"
FT                   /translation="MDNNKMREIDRNQYIGSGFSAYGGESEVLLTYQDDKIQDLQVIKH
FT                   HESEMGQWALDELPGKIIAANSADVDGITGASATSRAIKEATKDALQQAQQN"
FT   gene            complement(229825..230466)
FT                   /locus_tag="Lreu_0197"
FT   CDS_pept        complement(229825..230466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0197"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: endonuclease III; PFAM: helix-hairpin-helix
FT                   motif; HhH-GPD family protein; SMART: iron-sulfur cluster
FT                   loop"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82467"
FT                   /db_xref="GOA:A5VHZ3"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHZ3"
FT                   /protein_id="ABQ82467.1"
FT                   /translation="MLSPDEIRYSIKVMRQTFPEAGTTLIADTNYHFLLATILSAQSTD
FT                   QSVNEVTPALFARFPLPADLAGVEPAEVEPYIKRLGLYRNKAKFLVKTSQQIVTDFNGE
FT                   VPHTLKELITLSGVGRKVADVVLAECFNIPAFPVDTHVSRVARRLRMVEPKASVLAIEK
FT                   KLMKTIPPEHWLDAHHSMIFWGRYVCTARNPKCQTCPLLSLCVTGQNNVI"
FT   gene            230764..232236
FT                   /locus_tag="Lreu_0198"
FT   CDS_pept        230764..232236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0198"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82468"
FT                   /db_xref="GOA:A5VHZ4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHZ4"
FT                   /protein_id="ABQ82468.1"
FT                   /translation="MSFWKTITRKEDPRVYDNKDGHLVRSLKVRDFLALGVGTIVSTSI
FT                   FTLPGEVAAMHTGPSVVISFLIAAIVAGLVAFAYAEMAAAMPFAGSAYSWINVVFGEFF
FT                   GWVAGWALLAEYFIALAFVGSGLSANFRALFVPLGWKLPASLSNAFGTEGGVVDIVSVV
FT                   VIILVALLISRGVSQAARVENLLVILKVFAILLFIVVGLTAIKASNFMPFIPQYHETAN
FT                   GAFGGWQGIYAGVSMIFLSYIGFDSIAANSAEAINPQKTMPRGILGSLVIAVVLFIAVS
FT                   LVLIGVLPYQQYANSAEPVGLALRAAHHSGVATVVQTIAVLGMFTALIGMSMAGSRLIY
FT                   SFGRDGMLPKWLGKLDEHNRPNRALWTLTIGAVLIGAFFPFAFLSQLISAGTLIAFMFV
FT                   SLGVYALRRREGKDIPNPSFKMPFYPVLPALGFLASLLVFMGLDYQAKLYAGIWFIFGL
FT                   IIYFAYGIRHSSMAKKEDGQNVKNETEAEENE"
FT   gene            232199..233560
FT                   /locus_tag="Lreu_0199"
FT   CDS_pept        232199..233560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0199"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82469"
FT                   /db_xref="GOA:A5VHZ5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHZ5"
FT                   /protein_id="ABQ82469.1"
FT                   /translation="MLKTKLKQKKTNRDVLLEEKNAFASAARIKYYDIVLDHGRGAMVT
FT                   DIEGNDYIDLLASASSTNTGHAHPRVVQAIQEQAAKMIQYTPAYFANSQAARLAPRLAE
FT                   LAPISGPVEMVWGNSGSDANDAIIKFARAYTGRQYIISFTGAYHGSTYGSMSLSGVSLN
FT                   MTRKMGPMLPGVVKVPFPSPWERLTNESDEAFVERMFHQFMLPFETYLPVDEVAAILIE
FT                   PIQGDGGIVKTPPAYMQKVYEFAKANGILFAVDEVNQGMGRTGKWWSIQHFGIEPDLMS
FT                   VGKSLASGMPLSAMIGRKEILESLGAPANVYTTAGNPVTTAAANATLDVIQNEHLLERS
FT                   QRLGKKAAEFFKLEQQKYPFVGDVRMYGLDGGIDIIDPVTGKGDTEATTKLMYRIFELG
FT                   AIIISLRGSILRFQPPLVITEKELDQAFAMIDQAFAELAAGKLAAPANAEELGW"
FT   gene            233600..233673
FT                   /locus_tag="Lreu_R0008"
FT                   /note="tRNA-Thr2"
FT   tRNA            233600..233673
FT                   /locus_tag="Lreu_R0008"
FT                   /product="tRNA-Thr"
FT   gene            233843..235012
FT                   /locus_tag="Lreu_0200"
FT   CDS_pept        233843..235012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0200"
FT                   /product="sodium/proton antiporter NapA, CPA2 family"
FT                   /note="PFAM: sodium/hydrogen exchanger; TC 2.A.37.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82470"
FT                   /db_xref="GOA:A5VHZ6"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHZ6"
FT                   /protein_id="ABQ82470.1"
FT                   /translation="MEFIAVLAGLLLATQIVAHLCRRVEIPEVIGQILVGIIAGPAVLD
FT                   WVHLNSMMNEFQEIGVIILMFIAGLESDLSLLRKYLKPAVVVALLGVIVPIVIMGPVSY
FT                   MFGFTKLESLFIGVIFATTSVSISVAVLREFNRLDSREGATVLGAAVADDIIGVILLSV
FT                   MISVINGSSNSGHGNGQPLGIVLLMQLVFFGGTYLLIRWLAPYLIHMSDRLLTVASTSV
FT                   MAMIICLGMAAIADYVGLSGAVGSFFAGIAVANTKHKEVVDRSFIPIGYAMFIPLFFVS
FT                   VGLNMRFDNIGESFVFVIVMTILACLTKLLGCGAGAKLSGFSMPSSYVVGSGMVARGEM
FT                   GLITAQIGYEAHLLSPMYYSDVITVIIIATVLAPFILKNALKRSANELE"
FT   gene            235025..237343
FT                   /locus_tag="Lreu_0201"
FT   CDS_pept        235025..237343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0201"
FT                   /product="Superfamily I DNA and RNA helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82471"
FT                   /db_xref="GOA:A5VHZ7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHZ7"
FT                   /protein_id="ABQ82471.1"
FT                   /translation="MENHERETEQARVDNVEKQIDQQVAATTKAVEDAHRETRAVERNY
FT                   SENASINRYEVDDIAESRSMIEQQRQLVSRAAESESILKHQLRTLKNLKGSPYFGRIDI
FT                   QDPGEDKSETLYIGTSSLMNEDKTDFLIYDWRAPISGVYYNGTLGKVNYETPAGMQTTE
FT                   LKKKRQFTIKDGKITNMFDTNETVGDEVLQAALGKQNDQYMHNIVATIQKEQNDIIRDT
FT                   RSDLLLVQGVAGSGKTSAILQRIAYLLYHSRTELNADQIVLFSPNNLFSHYISEVLPSL
FT                   GERNMRQVTLEGFIRRRFEGLQVETLFDRYEERQKPENASHVVADFIESESFMTSIAHY
FT                   VEKMTIDDLQFADIRFNGQVFFSADHVKDLYKELPLTMAPADKLVQLKNKLIRELQRRV
FT                   KDEAKKDWVAKELDSLDLQQLHNLYGKKTIDDFKDEDEQYAYLSRRLAKRRLRVIADAI
FT                   YNNYFLDFYNQYNKFLHQVEVPKTISQREWATMILAFQDEIEYHRLELMHAAPLMYLRD
FT                   LISGTGQNRSFQYVFIDEMQDYSTAMLIYLKHAFPQAKFTVLGDSEQALFKPLQLPEEL
FT                   LNKLSGVLKAKRPNLIALRRSYRSTTEITNFAKALLPDGDKIISFTRHGKKPRLLVRYS
FT                   DKESQQSLLDETLKLADEHETVAILTKNQEQAAGIYQLLHRQKVENIHLLDKDASELPK
FT                   GVLILPIYLAKGLEFDAVLAADVSAKNLTNTDEVGMIYTMASRAMHELVLLSNGSVSDA
FT                   INEKAGRLLTIEYQLPNKN"
FT   gene            237431..237874
FT                   /locus_tag="Lreu_0202"
FT   CDS_pept        237431..237874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0202"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82472"
FT                   /db_xref="GOA:A5VHZ8"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHZ8"
FT                   /protein_id="ABQ82472.1"
FT                   /translation="MVKDEYTLVLVKPDGVKTRHIGDIITRIERKGYNIEALKMINPSE
FT                   EKLRQHYFDKVDKPFFPELLEYMTEGPIVGIVVSGTNVIQAIHNMAGATNPGEAEWGTI
FT                   RGDYGREWPDGNLRNIIHTSDNVDSATREIGIWFPEFDIKDKQ"
FT   gene            complement(237926..238885)
FT                   /locus_tag="Lreu_0203"
FT   CDS_pept        complement(237926..238885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0203"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82473"
FT                   /db_xref="GOA:A5VHZ9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHZ9"
FT                   /protein_id="ABQ82473.1"
FT                   /translation="MRSKRNKTIDFTLEEASPELLSQIIHPTDNLQTISNKIINGDSFK
FT                   VMTQLAPHQVDLALIDPPYNLNKQYDGLNFKKMSTSQYQTYTQKWIDLLKPLLKENASI
FT                   YVFSDWATSMALAPILEKNFTIQNRITWQREKGRGSQKNWKNGMEDIWFLTANPSDYTF
FT                   NVDQVKQRRQVVAPYRQDGVAKDWQATKNGNFRDTMPSNFWDDISIPYWSMPENTGHPT
FT                   QKPEKLLAKIILASSNPNDFIFDPFAGSGSSLVTAAKLNRRYLGIEQSLLYCAWGQYRL
FT                   NQVKDDPSIQGYTDGVFWERNTLAVQRKIKRQQRASDE"
FT   gene            239163..240185
FT                   /locus_tag="Lreu_0204"
FT   CDS_pept        239163..240185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0204"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="TIGRFAM: tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82474"
FT                   /db_xref="GOA:A5VI00"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI00"
FT                   /protein_id="ABQ82474.1"
FT                   /translation="MAEEKHVILTGDRPTGKLHIGHYVGSLKNRVELQNTGKYDTFIMI
FT                   ADQQALTDNARDPEKIRRSLHEVALDYLAVGIDPKKSTILVQSQIPALSELTMHYLNLV
FT                   TVARLRRNPTVKTEIKQKKFGESVPAGFFTYPVSQAADITAFKADTVPVGDDQEPMLEQ
FT                   TREIVRTFNRIYQQDILVEPEGVFPPKGQGRIPGLDGNAKMSKSLGNAIYLSDDADTVQ
FT                   KKVMSMYTDPTHIKVSDPGHVEGNTVFTYLDIFDPDKEQVAKLKEQYQAGGLGDVKIKR
FT                   YLNEVLEAKLAPIRKRREEYAANLDYVDQVLKEGSARANEVANQTLKEVRDAIGINYFG
FT                   "
FT   gene            240332..241270
FT                   /locus_tag="Lreu_0205"
FT   CDS_pept        240332..241270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0205"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82475"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI01"
FT                   /protein_id="ABQ82475.1"
FT                   /translation="MENLAIVDLGSNSARMAITEIAPDGRFREIRRVKENTRLSEGMGR
FT                   EKMLQESAIERTIAALKRFKKIYQEIPNIKVRAITTAAVRQARNRQEFLKRVQQEVGIH
FT                   LQVLSGKKEAYYDYLGVVRTLRLNHCLILDVGGASCELILVQQRKARNLISIPVGAVNL
FT                   SEQYHLNGYVRSADLFRAQVAMNERLTKIPWLRYATRVPIVLLGGANRTLARMTQSYHH
FT                   HHRRNGSIHGYQLSSRVVFATYRELLNRNLAQRKRMTGLEPERADIIIGGMLPLVTLLQ
FT                   RNSDGRVIFSESGVREGIITEYVNQRKRHHD"
FT   gene            241263..242525
FT                   /locus_tag="Lreu_0206"
FT   CDS_pept        241263..242525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0206"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase"
FT                   /EC_number="1.1.1.34"
FT                   /note="TIGRFAM: hydroxymethylglutaryl-CoA reductase,
FT                   degradative"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82476"
FT                   /db_xref="GOA:A5VI02"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI02"
FT                   /protein_id="ABQ82476.1"
FT                   /translation="MTDWQHGFYKLSADDRRQQLTKARQLSPIEEQVLANTSSDLGDEL
FT                   VENYITDYSLPEGVALNITVNNRSYVVPMVIEEPSVIAAASNGAHRVSRSGGFTAPRQD
FT                   RQLVGQVVLDDVTDKAAVKAWLLEHQDEILTIANQAHPSMQARGGGVKSMKVRTPGDFI
FT                   SVDLGIDVCQAMGANSVNTMAEAVGKWLTDQGFHVITAILSNLATQSLQTATCKVAFRY
FT                   LATPEMDGKEVAQRIARLSDLAQVDPYRAATHNKGIMNGIDAVMVASGNDWRAIESGAH
FT                   AYAARDGQYRGLSTWEIQDGYLVGKIVLPLPVGVIGGSIGLNKMTKINYHISQIKSAEE
FT                   LAAVTASVGLAQNLAALRALTTTGIQAGHMKLQYRSLAASVGATPAEVPLVVAQLKQRS
FT                   HVDQALAKEILSTIRKDQVND"
FT   gene            242518..243477
FT                   /locus_tag="Lreu_0207"
FT   CDS_pept        242518..243477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82477"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI03"
FT                   /protein_id="ABQ82477.1"
FT                   /translation="MTEERITLNKENQALLDQVNSLYPEGSVFVQFHGDKSGYVRHDQA
FT                   TQQTIPGALVIIVTDLTAPNYTASHELLHLLMLLKGFPQIFFQLSLGDKELDEQMMIMS
FT                   TDLYNIAMHRVVVAEQRKHGFITDEIEEQYLKGIEHTLTPEKEEDDERTLRLLTLLDAL
FT                   VFYGDHLSKYEKTLAEKYPLALAAAKKMYAEITKKPIKSPFDMRRSIVKIYSLFDQQMQ
FT                   EWGLPALHNNEYTTLSPVLSARQLRLEMRQVFEIYHSDMKERGTDKRAYVGLRRSDGQN
FT                   SFTLPAPTQNAPEAFKKIYDQSVQEFLEQNSIPYIVRK"
FT   gene            243483..244181
FT                   /locus_tag="Lreu_0208"
FT   CDS_pept        243483..244181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0208"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82478"
FT                   /db_xref="GOA:A5VI04"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI04"
FT                   /protein_id="ABQ82478.1"
FT                   /translation="MDATIQKTFDDAKNIVFLTGAGVSTASGIPDFRSANGLYTQNRNA
FT                   EYYLSHRYFASDPEGFYEFCKQNLYFPDAKPNVIHQKQAALTQQDRATVITQNIDNLYE
FT                   EAGTKHLIDFHGNLFHVYCEKCHETVPVSEYLKSRLHQKDNGPLRPDIVLYDEGIKQED
FT                   IINSVKAMQQADLVVIVGTSMKVYPFAGLLDYRNPNAKVIAVNQQLLHFPFDFQMVQDD
FT                   ATKFFDELKV"
FT   gene            244630..245478
FT                   /locus_tag="Lreu_0209"
FT   CDS_pept        244630..245478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0209"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82479"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI05"
FT                   /protein_id="ABQ82479.1"
FT                   /translation="MKITMGMTTWTEHPVLIHDEQRPVRLDEYAQHFPVVEVDTFFYAL
FT                   PQIATIQNWLATVPPTFQFIVKANQKMTLHQRNQERGELEQVFQQYRRTISPLVAAGQL
FT                   KTILFQFPPYFDATVRDFSYLRLIREWLGNLPIAVEFRNQTWYKKEILPSVLDFCRELN
FT                   FTLVAADEPHNTPTSVPFLLATTNPDLAMLRLHGRNRKGWENQGKEWRKTRTLYRYSPE
FT                   ELQFFKKQIESLQPQPKELCVIFNNNSAKDAAPNALSLQKMMNIEFEGLAPKSPEQLDL
FT                   F"
FT   gene            245556..247583
FT                   /locus_tag="Lreu_0210"
FT   CDS_pept        245556..247583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0210"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: t-RNA-binding domain
FT                   protein; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82480"
FT                   /db_xref="GOA:A5VI06"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI06"
FT                   /protein_id="ABQ82480.1"
FT                   /translation="MAEQKPTYYITTPIYYPSGKLHIGNSYTTIACDAEARFKRLMGYD
FT                   VFYLTGTDEHGLKIEQKAEKLGMKPQEYVDQMAAQIKELWKKLEITNDKFIRTTDDYHE
FT                   KAVQKIFQQLLDQGDIYKGKYTGWYSVDDEEYFTESQLAEVYRDEDGNVIGGKAPSGHE
FT                   VQLVEEESYFFKMSKYANWLMNYYKEHPDFIEPQSRMNEMINNFLKPGLEDLAVTRTSF
FT                   NWGVKVPSDPKHVVYVWIDALSNYITALGYGSDDDSLFKKYWPADVHMVGKEIVRFHTI
FT                   YWPIMLHALGLPLPKHIIGHGWLTMRDGKMSKSKGNVIYPETLVDRYGLDATRYYLLRA
FT                   MPFGNDGVFSPEDFVDKVNYDLANDLGNLLNRTVAMINKYQNGKLVGTNDATTDFDADL
FT                   EQTASDVIAEYKELMDKTRFAEALATVWKLVSRANKYIDETEPWVLAKDDSKKDVLSDV
FT                   MTHLAKSLWIIAALIQPIMPHAPKQIVEQLGIEGTDLSLTDLQFNDFPAEAQVVAKGTP
FT                   IFPRLDVKAEVEFIKSKMTANEKKKGRKAMAEAKEKAQETAQEEKTDGKKPIRIDVFDK
FT                   VELKVAQITAADHVEGADKLLKFHMDDGTEEGRQILSGIAKWYPDPSVLVGKKVLIVAN
FT                   LKPRKMRGELSQGMLLSAEKDGNVQVVTVPDNLVPGMGVE"
FT   gene            247585..248394
FT                   /locus_tag="Lreu_0211"
FT   CDS_pept        247585..248394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0211"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82481"
FT                   /db_xref="GOA:A5VI07"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI07"
FT                   /protein_id="ABQ82481.1"
FT                   /translation="MHNHQHQQLVYDSHTHLNDDAFYDDVPAFINRAAHYGVTEMNIIG
FT                   SNQLLNTRALKLGHQYDNLHPIIGWHPEDIANWNSETKKELCQQLADPLVVGIGEIGLD
FT                   YYNDEHSPHQQQQEIFAEQLEWARELKLPVSIHCRDAMADTYEILRNAHIDEFGGVMHS
FT                   FNGTPEWAEKFMDLGMMISFSGVVSFKNATEVHEAALVVPLEKMMVETDAPYLTPLPYR
FT                   GKQNEPGFTKFTVDAIADLKQVDAGKVAYKTFTNARRLFLENKERGL"
FT   gene            248391..248957
FT                   /locus_tag="Lreu_0212"
FT   CDS_pept        248391..248957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0212"
FT                   /product="RNAse M5"
FT                   /EC_number="3.1.26.8"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; PFAM:
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82482"
FT                   /db_xref="GOA:A5VI08"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI08"
FT                   /protein_id="ABQ82482.1"
FT                   /translation="MIRIKEVIVVEGKDDTKQILKAVDADTYETNGSAISTADLAKLKK
FT                   LQASRGLIVFTDPDFNGERIRKIISEAIPGVKHAFIKRKDGVPTEAHGSLGVEHATPAV
FT                   IKSALEHLYTQTTTPQQVFKREDLQKWGLTGQADSRKRREKLGQLLGIGYGNGKQLIHR
FT                   LNMFQVDRATFEQAIKQINQEEDHE"
FT   gene            248950..249843
FT                   /locus_tag="Lreu_0213"
FT   CDS_pept        248950..249843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0213"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82483"
FT                   /db_xref="GOA:A5VI09"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI09"
FT                   /protein_id="ABQ82483.1"
FT                   /translation="MSNSPEIGSRTRTRAIMEKYGIRTKKSFGQNFLTDLNVLKNIVEA
FT                   ADITANDNVIEIGPGIGALTEQLAQAAGEVLALEIDQDLIPVLKEVLSPYDDVKVINQD
FT                   VLQANLPELIKKEFKDPSRPIKVVANLPYYITSPILMNLLASPVEWATICVMMQKEVAQ
FT                   RLTAKPGTKQYGALTLAIEYQMQAKIAFDVSRKVFVPAPNVDSAIVVLTPRTNPLPVQP
FT                   FDKQKLFGFIRGCFAHRRKSLWNNLQSVIGKDPAAKEKMTAVLNQLDISPQIRPEKLTL
FT                   EQFIELANALHQQNLL"
FT   gene            249934..250176
FT                   /locus_tag="Lreu_0214"
FT   CDS_pept        249934..250176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0214"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82484"
FT                   /db_xref="GOA:A5VI10"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI10"
FT                   /protein_id="ABQ82484.1"
FT                   /translation="MPNSIVEIKKKLDERIGEHVLVKAQAGRKRITTHHGILSKTYPAV
FT                   FVIHLNDEQGTLDRVSYSYTDLLTRNISIAFDEAE"
FT   gene            250362..251213
FT                   /locus_tag="Lreu_0215"
FT   CDS_pept        250362..251213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0215"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase, C terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82485"
FT                   /db_xref="GOA:A5VI11"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI11"
FT                   /protein_id="ABQ82485.1"
FT                   /translation="MIVTEKAPAKLNLSLDTPMRYFDGSPQWDMVMVSADLADYVTVET
FT                   HRRPATIKVYTNSGFLPNDQRNLAYQAAHILRSRFHCKDGVTIRIKKQIPVAAGLGGGS
FT                   SDAAAVLRALNSIWRLGLSLSELAKIALTIDSDVPYCIYNKLAHVTGHGEKIELLPPQP
FT                   HYWAVIAKQKISVSTPQILRQINYEKLQHLNNEALLTNLKKEDWQEATKYMGNVLEPLT
FT                   MKFYPEIGRLKNKMKELGADVAQMSGTGPTVFAICHTESRAKRIQNSIRGFCRDVHVVT
FT                   LL"
FT   gene            251353..252264
FT                   /locus_tag="Lreu_0216"
FT   CDS_pept        251353..252264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0216"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82486"
FT                   /db_xref="GOA:A5VI12"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI12"
FT                   /protein_id="ABQ82486.1"
FT                   /translation="MKKYIIGISSIIALLVIILGLSFVPWKSMGKNQKPIRVVTGLNFY
FT                   GEVAQKVAGDHGQVISFIDNASVDPHDYQPNTKQAQQVAKANVVIENGLGYDSWVNKLV
FT                   KSSSNHNKIKVINVASLTGKKDGDNEHIWYAPETVEKLANDLATQYGKIDPQHAKDYQK
FT                   NARKYLASLQPLNEEIAKVKRQVNPNNNRVAVSEPVFDYALENVGYQIMDKHFEKAVED
FT                   GNDPSPKDIEEIQQAIINHQIAFFVDNSQTSDKVVDNLVKLAPEHNVPVLKVTETKPNG
FT                   DDYMQWMLKQYQALSRIQQKEN"
FT   sig_peptide     251353..251445
FT                   /locus_tag="Lreu_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.940) with cleavage site probability 0.787 at
FT                   residue 31"
FT   gene            252272..252943
FT                   /locus_tag="Lreu_0217"
FT   CDS_pept        252272..252943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0217"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82487"
FT                   /db_xref="GOA:A5VI13"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI13"
FT                   /protein_id="ABQ82487.1"
FT                   /translation="MAVVSVDDLTIAYGNHTVIDHLSFSINEGDFLVVVGENGVGKTTL
FT                   VRSMLGFLKPKSGTITIPQSTRLGYVPQFRNIDEEYPLSIRDFVALNTKPRLLPWLTKS
FT                   ERNRVERMIRENNLTKIAERPLGLASGGEKQRAYLAQALLPNPNLLILDESTASLDNEM
FT                   KYELLDLVTRFQQNGLSVMFITHDWDLAEQYGTRFLYLSPGSYSTGPINELPSPVKGDK
FT                   K"
FT   gene            252943..253740
FT                   /locus_tag="Lreu_0218"
FT   CDS_pept        252943..253740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0218"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82488"
FT                   /db_xref="GOA:A5VI14"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI14"
FT                   /protein_id="ABQ82488.1"
FT                   /translation="MLTLSFMRHAFVASTFIAIICGIIGVFVVARNLSFLTHTLSEIGF
FT                   AGGAFAVFAGWPALNGMILFTMLSSVIVGQMSIKESRREAVISAVSALFIGLGILFLSL
FT                   SSQSASSATSILFGSVVGISLNEVWQLVYLSILVLIILLLMYRRLKFDSFDSIGAQVSG
FT                   INQTVISVVFLLLLALSVSVAAQIVGSLLIFILLTLPAASAKYFTHGVARMIILAILFS
FT                   LLGTWLGLFLGYLTDWPVSFFIAVIEVIIYTTALIYSKFIESN"
FT   sig_peptide     252943..253035
FT                   /locus_tag="Lreu_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.761) with cleavage site probability 0.731 at
FT                   residue 31"
FT   gene            253972..254817
FT                   /locus_tag="Lreu_0219"
FT   CDS_pept        253972..254817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0219"
FT                   /product="purine operon repressor, PurR"
FT                   /note="TIGRFAM: pur operon repressor; PFAM:
FT                   phosphoribosyltransferase; purine repressor-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82489"
FT                   /db_xref="GOA:A5VI15"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI15"
FT                   /protein_id="ABQ82489.1"
FT                   /translation="MKIRRSNRLVDMTRYLLEHPRSLVSLKFFGERYDSAKSSISEDLG
FT                   IVKHTFQTWGQGRLETIPGASGGAVLTPFYSKENAQAAIDNLVDRVNDDSRLLPGGYVY
FT                   LSDLIGQPEILRQIGKLIATQYVDTDVDVIMTVETKGIPIAQSVAMYMNKPFVIVRNSS
FT                   HITEGPTVSVNYVSGSVQRIKKMELSRRTLSAGANVLVVDDFMKGGGTINGMKSLIKEF
FT                   DANLVGITVFAEGRPVNGQRLVDNCTSLIKVETKDGTEKKIAAQAGSFMENVFDKKVEN
FT                   "
FT   gene            254821..256188
FT                   /locus_tag="Lreu_0220"
FT   CDS_pept        254821..256188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0220"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.7.7.23"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82490"
FT                   /db_xref="GOA:A5VI16"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI16"
FT                   /protein_id="ABQ82490.1"
FT                   /translation="MTKRNAIILAAGKGTRMRSKLYKVLHQVCGKTMVEHVLTQLEKAK
FT                   IDNIITIVGFGAETVEQQLGHRTKYALQEQQLGTGHAVMQTKDLLANEDGETIIVSGDT
FT                   PLFTAETFEKLFEYHEQRHAAATILTSIAPDPTGYGRIVRNDVGIVERIVEQKDATVQE
FT                   QAIKEINTGVYCFDNKKLFAALSKITNDNAQGEYYLTDVIGILKQENEIVTAYKMDNFD
FT                   ESMGVNDRVALARANKVMRNRINTHWMREGVSMIDPETTYIDADVKIGRDTVIEGGVVI
FT                   KGHTEIGNDCYIGAGSRITDSKIHDGVKIISSTLQEAEMHNGSDIGPNSHLRPEAEIGE
FT                   NVHIGNFCEVKKAYIGEGTKVGHLTYIGNATLGKDINVGCGVVFVNYDGTNKHHTNVGD
FT                   HAFIGSNSNLVAPVNIAKDSFVAAGSTITDSTEQYDMAIARARQVNKENYAKKLPW"
FT   gene            256263..257252
FT                   /locus_tag="Lreu_0221"
FT   CDS_pept        256263..257252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0221"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82491"
FT                   /db_xref="GOA:A5VI17"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI17"
FT                   /protein_id="ABQ82491.1"
FT                   /translation="MTQQYFDQNLKIFALNSNRPLAEKIAKHVGVDLGKLSVNRFSDGE
FT                   IQINIEESVRGDNVYVIQSTSAPVNDNLMELLIMVDALRRASAKTINVVMPYYGYARQD
FT                   RKARSREPITAKLVANMLQNSGVDRIIALDLHAAQIQGFFDIPVDHLMGAPLLAEYFIN
FT                   QGVAENAVVISPDHGGVTRARALAEFLKSPIAIIDKRRPRANVAQIMNIIGDVKGKKCI
FT                   MIDDMIDTAGTISLGSQALIDAGAEEVYASCTHAVLSGPAIERLRNAPLKEVVVTDSIQ
FT                   LPKEKQIDKIKQVSVAPLIGDAIKRINENRPVSPLFKQVFQSAQLEKK"
FT   gene            257428..258165
FT                   /locus_tag="Lreu_0222"
FT   CDS_pept        257428..258165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82492"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI18"
FT                   /protein_id="ABQ82492.1"
FT                   /translation="MTTIKFFKKAMVGTAAVATIFALAGCGKQSASSSDTSSSSTSSVR
FT                   SSESKASKAYRTANKLIQNHDYEGAYEQLSQLNDHNAQTEALADDLQSYMNAQKAYENG
FT                   DYDGAKNNLKSQKSTSTAMRNAYADLQSKVSSAQGSTSSQTSSSTNSKQTNKQSSSTSS
FT                   ATQQSSSAANQAASDATSDNVVQQFANKMGFSGSQGYQIMPTGKDGNVYKFEVRQNNSD
FT                   NTVASLIGIYQYNSQTGAVTKIA"
FT   sig_peptide     257428..257523
FT                   /locus_tag="Lreu_0222"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.820 at
FT                   residue 32"
FT   gene            complement(258244..259065)
FT                   /locus_tag="Lreu_0223"
FT   CDS_pept        complement(258244..259065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0223"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase, type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82493"
FT                   /db_xref="GOA:A5VI19"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI19"
FT                   /protein_id="ABQ82493.1"
FT                   /translation="MAIKLVAIDIDGTLINDQRQITPQTVAAIKKASAQGVKIVLCTGR
FT                   PMTGVKAYLDQLDLNDSDNEFVISFNGALAQSTSGNVLVNYTMPFNDYADWQTYCIKEG
FT                   VKSQIETRDYIYTINRDLSPYTVYESDLVSMPIRYRTFEELSKMQDQYVIAKAMMVDTK
FT                   EQIDKAWAELPAEMRDRFSIVRSEDFYLEFMNKQASKGNALQLLSEELGIKKDEVMALG
FT                   NAQNDDSMIEYAGLGVAMGNSIPGTLKIADVTTADNNHDGVGKAIEEYVLK"
FT   gene            complement(259065..260432)
FT                   /locus_tag="Lreu_0224"
FT   CDS_pept        complement(259065..260432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0224"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82494"
FT                   /db_xref="GOA:A5VI20"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI20"
FT                   /protein_id="ABQ82494.1"
FT                   /translation="MNHFYDEKLRREKVFRDPIHGQIIVDNQIIMDLINTPEFQRLRRI
FT                   KQLGTSSFTFHGAEHSRFGHCLGVYEITRQMCNYFQRNYPSQHPGDGLWDDHERPVTLC
FT                   AALLHDLGHGPYSHTFEHIFHTNHEQITRQLITDSSTNINKILQRVSPDFPHQVASVID
FT                   HTYENPQVVQMISSQVDADRMDYLQRDAYYTGTNYGKFDLDRVLHVMRPVKRGIAFEIS
FT                   GMHAVEDYIISRLQMYLQVYFHPVSRSMEVILDHLLMRAKYIYQHPNDFEPDFTPHMLM
FT                   PFFNGKFTLDDYLALDDGVLTTYFIHWTHSRDDILSDLASRFLNRRPFKSVIYDQNTQK
FT                   LLPTLRKLIQTAGFNSQYYTAVNDSFKLPYDTYHPQDSNTQTQIELLQPNGDFIELSQV
FT                   STLVASVSGREAGDQRFFFPKEMLETRNNIEIFEPIYEEFQGYIKNNHIINPKEQK"
FT   gene            complement(260434..261258)
FT                   /locus_tag="Lreu_0225"
FT   CDS_pept        complement(260434..261258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0225"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82495"
FT                   /db_xref="GOA:A5VI21"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI21"
FT                   /protein_id="ABQ82495.1"
FT                   /translation="MPNFKNQCFQQFIQPLTPADNLSSFIYTNALLRSASELKFPLLHF
FT                   WTLEDTVILGLKDQRLPHLSTALASLTHRGFHYFMRNSGGLAVVSDDGILNLSIFYPWH
FT                   LEDHELTIDEAYQRMVNLIQAAFPSLEIATGEITYSYCPGSFDISVNGQKIGGISQRRN
FT                   KVGVTVMLYLSVCGNQQDRGKLIRDFYDTGLQQDQNKWHFPDVWPGAMTTISKALNTQL
FT                   SVQDAIQRIQSVVQIIAPDSLNNLMWSPNFISTLSKELISMERLQERLEKED"
FT   gene            261522..261866
FT                   /locus_tag="Lreu_0226"
FT   CDS_pept        261522..261866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0226"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82496"
FT                   /db_xref="GOA:A5VI22"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI22"
FT                   /protein_id="ABQ82496.1"
FT                   /translation="MVVKYRRKVINDEISEYLKHCFVVVGQAYGINLQEWNHDQDHVHV
FT                   LFRATPHTEMAKFLNAYKSSSSRMVKKQFPEIKQYLWKSAFWTQSYCLISTGGAPLEVL
FT                   KRYIESQGRK"
FT   gene            261866..263041
FT                   /locus_tag="Lreu_0227"
FT   CDS_pept        261866..263041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0227"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82497"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI23"
FT                   /protein_id="ABQ82497.1"
FT                   /translation="MVLKAVKMRIYPNSAQRNQLWQTFGCVRFVWNQMLNMQIERRKNN
FT                   PEAKFVNAFGMNNLLKQLKVEYPWLKQAESTALQSANRNLADAFQRFFKGQNKFPRFKS
FT                   RKYSQSYNSKYVNGNIKVLDCHHIKLPKLGIVYFRAGRLPMGKIKNVTVRLNVAGQYYI
FT                   TVLVESENQTLPKTSKYIGGDLGLKSLLNLSDGCKEPINHFEDKYRKKLYRWEKLRSRR
FT                   FLKAQQEITWDHHNKVLVPRQLDDFKNYQKARIMVAKYRQKIANQRLDQLQKFTTKLVK
FT                   KYDIIVLEKLNTKGMMKNHHLARGIANASWSKLVDILQYKCNWYGKKLIQVNPSYTSQI
FT                   CANCGKNNHRLGLNKLEWLAVREWDCPNCGKHLDRDINAAQVILQKGLAIR"
FT   gene            263268..263666
FT                   /locus_tag="Lreu_0228"
FT   CDS_pept        263268..263666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0228"
FT                   /product="Domain of unknown function DUF1934"
FT                   /note="PFAM: Domain of unknown function DUF1934"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82498"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI24"
FT                   /protein_id="ABQ82498.1"
FT                   /translation="MNLSTIIDQSGQQEKFTFTEEGTFVEMNGKYYLRYIEHQDGQETP
FT                   VQIKFEDELIRLRRRGNVETNLFLDPTQETIMRYQTEYGMIKIDVLTESLEKDVDVKAP
FT                   AGHLSVKYQLKQAGQLIGSYQLELQFAA"
FT   gene            263712..264269
FT                   /locus_tag="Lreu_0229"
FT   CDS_pept        263712..264269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0229"
FT                   /product="DNA-directed RNA polymerase delta subunit"
FT                   /note="PFAM: DNA-directed RNA polymerase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82499"
FT                   /db_xref="GOA:A5VI25"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI25"
FT                   /protein_id="ABQ82499.1"
FT                   /translation="MDLKVFDGQDKSELSMIEVAHAILAHHGKAMAFVDLTNEVQQYLG
FT                   KSDEEIRERLAQFYTDLNVDGSFISLGDNTWGLRAWYPFESIDEATVGENEEDEEDDRP
FT                   KKKRRKVNAFLADTDDDDDVIDYDNDDPEDEDLDTDDDADSEDDYDDDTDDFSDDDDDL
FT                   DDGIEGQLSELHDEEDEDEDDE"
FT   gene            264445..266049
FT                   /locus_tag="Lreu_0230"
FT   CDS_pept        264445..266049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0230"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="PFAM: glutamine amidotransferase class-I; CTP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82500"
FT                   /db_xref="GOA:A5VI26"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI26"
FT                   /protein_id="ABQ82500.1"
FT                   /translation="MTKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKIAIQKFDPYIN
FT                   VDPGTMSPYQHGEVFVTDDGTETDLDLGHYERFIDNDLNKYSNVTTGKIYSEVLRKERR
FT                   GDYLGGTVQVIPHITNAIKDKIKRAGESTDAEVVITEIGGTVGDIESQPFMEAIRQMKE
FT                   EVGSENVLYIHTTLVPYLRAAGEMKTKPTQHSVRELRGLGIQPNILVVRTEQPITDDMR
FT                   KKIALFCDVDPKAVVESMDVHTLYEIPLNLQKQGMDQLVVDHFGLEVPEADMTEWTEMV
FT                   NHIEHDLTKTVKIAMVGKYTDLQDAYISVNESLRHAGYPVNAKVKIDHFNAENITPENV
FT                   EETLKDYDGILVPGGFGNRGVEGMITAIKYARENDVPYLGICLGMQTACIEFARDVLGY
FT                   TDANSTEFDPNTKHNIIDLMADQADIEDMGGTQRLGAYPCKLKPGTVAAAAYGNQSMIS
FT                   ERHRHRYEFNNDYRQEMENHGLVISGVNPDRNLVEVVEIPDKKFFVAAQYHPEFKSRPN
FT                   HPEGLFAAFVKAAAEDK"
FT   gene            266562..267944
FT                   /locus_tag="Lreu_0231"
FT   CDS_pept        266562..267944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0231"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron, maturase-specific domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82501"
FT                   /db_xref="GOA:A5VI27"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI27"
FT                   /protein_id="ABQ82501.1"
FT                   /translation="MRQSQKAEQQADRLSRIGLENRKYTRARSTDYGEGKGMSVTIQDL
FT                   VLDRNNLNQAYLRVKRNKGAAGIDDMTVNDLLPYLRENKTELIASLREGKYKPAPVKRV
FT                   EIPKPNGGVRKLGIPTVVDRMVQQAVAQILTPIFERVFSDNSFGFRPHRGAHDAIAKVV
FT                   DLYNQGYRRVVDLDLKAYFDNVNHDLMIKYLQQYIDDPWTLRLIRKFLTSGVLDHGLFA
FT                   KSEKGTPQGGPLSPILANIYLNELDKELTRRGHHFVRYADDCNIYVKSQRAGERVMRSI
FT                   TQFLEKRLKVKVNPDKTKVGSPLRLKFLGFSLGVEHNGAYARPAKQSQQRVKKALRLLT
FT                   KRNRGISLTRMFEEIQRKMRGWLQYYSIGKLTDFIQRLDKWLRARIRQYIWKQWKKLKT
FT                   KVTNLQKLGLSQRDAYVFASTRKGYWRTAHSKTLSYSLTNRKLEQLGLMNMSKTLQSIQ
FT                   SD"
FT   gene            268228..269505
FT                   /locus_tag="Lreu_0232"
FT   CDS_pept        268228..269505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0232"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82502"
FT                   /db_xref="GOA:A5VI28"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI28"
FT                   /protein_id="ABQ82502.1"
FT                   /translation="MKKMIIQGGNRLSGEVTIGGAKNSTVALIPAAILADTPVEFDTVP
FT                   DILDVHNLMIILESMNVKSEFSHGVLDIDPTQIVEAELPSKAIKSLRASYYFMGALLGR
FT                   FHRATLTFPGGDNIGPRPIDQHLKAFKALGATVIEEKGTVHLDAPNGLHGSRIFLDMVS
FT                   VGATINAILAAVRAEGTTIIENAAREPEIIDLATFLNNMGAKIRGAGTDTIRITGVKTL
FT                   QSMNTHTIIADRIEAGTYLSLAAALGDGVMIHNVIPEHLESFTSKMIEMGVELQIDSDK
FT                   IYVPKSSHLHPVTVKTMPFPGFATDLQQPLTPLMSLADGDSTIVDTIYPKRVKHISQLQ
FT                   KMGMKIEAHDGMIIVKHTEKLHGAEVSAGEIRAGAALTIAGLMADGQTVINNAGNILRG
FT                   YDRIVWKLNRLHANVSIEDDSSVKIG"
FT   gene            269598..269843
FT                   /locus_tag="Lreu_0233"
FT   CDS_pept        269598..269843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0233"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="PFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82503"
FT                   /db_xref="GOA:A5VI29"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI29"
FT                   /protein_id="ABQ82503.1"
FT                   /translation="MKQGIHPDYHPVVFEDSSTGYKFLSGSTATSSETVKWEDGNEYPL
FT                   IRVEVTSDSHPFYTGKQKFTQADGAVDKFNKKYGLK"
FT   gene            270005..271321
FT                   /locus_tag="Lreu_0234"
FT   CDS_pept        270005..271321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0234"
FT                   /product="Phosphotransferase system cellobiose-specific
FT                   component IIC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82504"
FT                   /db_xref="GOA:A5VI30"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI30"
FT                   /protein_id="ABQ82504.1"
FT                   /translation="MHEKIINRIIALHRYSFVRITRQTLIMIFPIVFIGTMAKMILKTV
FT                   FKPDGFIYNVAFLDVIPQNVLRVIQFVLTSISQLTLGILGIYTVYMAAKFTAKRYRRDG
FT                   KFAGITAILTLLLMSYRYGKFSPQFSLSFYQRLLSGNSLLIVLILGYGVGQLYRWLTPP
FT                   KDGDNTNALPLLKERSFSSMLPMTISLIFGVTVALFLNSNTIYHAWSTSYSTLVTTAQE
FT                   HRQLWLTLLATMGLTIFDWLGLGVPYTSMALTSGDSFTANLNYALAHGTPWNVPYEFLG
FT                   SSLYNSFANFGGDGLILALIVAILLTSNGSYMHRVARWTALPTLFNFNYAAMIGLPVVF
FT                   NPLFLIPFVFLPIVNILLASLAIAIHLIPSTPYPVLQGTPGPLISFLGTNGNWGILIFT
FT                   LVLLLIDIAAYIPFVKMALVVENRLTLAEQDVISHEKND"
FT   gene            271305..272195
FT                   /locus_tag="Lreu_0235"
FT   CDS_pept        271305..272195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0235"
FT                   /product="protein of unknown function DUF915, hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF915, hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82505"
FT                   /db_xref="GOA:A5VI31"
FT                   /db_xref="InterPro:IPR010315"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI31"
FT                   /protein_id="ABQ82505.1"
FT                   /translation="MKRMTKSILHTRLVLIGLILILVLMAIPAYFWMKDTNKYLAAQHN
FT                   SRMSPIIMVPGSSATQNRFNPLIRKLNEDSPKKHSVLRLEVMNSGKIVSQGWINRGDNE
FT                   PIIVIGFENNRDGYQNIKKQAQMVNQAFERLTEEYNFNNFKAFGHSNGGLVWTYWLEHY
FT                   YPEYKDAITIKRLMTLGTPYNFAESSVSHPTQMFSDFVKYRSRIPKNLLVYSVAGTETY
FT                   TSDGLVPEGSVDAGKYIYQKQVAHYTRMTVTGKDAQHSNLPQNKQIVRLIEEYLLDPND
FT                   NGNPNSQNKQRATQN"
FT   sig_peptide     271305..271385
FT                   /locus_tag="Lreu_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.820) with cleavage site probability 0.793 at
FT                   residue 27"
FT   gene            272245..272949
FT                   /locus_tag="Lreu_0236"
FT   CDS_pept        272245..272949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0236"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase
FT                   C60, sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82506"
FT                   /db_xref="GOA:A5VI32"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042007"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI32"
FT                   /protein_id="ABQ82506.1"
FT                   /translation="MKKDKKRSFEWLRWTAVVVLLLVSVVLIFNQQIKSYLVGSYKPEI
FT                   TRQTVQSNQKKKATYDFQSVKDLNLQTAAKARANKQSINTIGAITVPAINMTIPIANGV
FT                   DNTTLALAAGTLRPDMKMGEGNYALAGHNMAHGSKILFSPLYYHAKVGQMIYITNMDRV
FT                   YEYKIYQREFIAATRVDVVDNTPEKIITLITCDATGANRLMIRGKFVKSEPFTKAPQNV
FT                   QKNFSEKYTTGR"
FT   gene            273350..274129
FT                   /locus_tag="Lreu_0237"
FT   CDS_pept        273350..274129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0237"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82507"
FT                   /db_xref="GOA:A5VI33"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI33"
FT                   /protein_id="ABQ82507.1"
FT                   /translation="MRKPFIIANWKMNKNVHESVAFVKAIKEKLPADKEIGIAAQAVSL
FT                   YNMKKVASSSNLQIIAQNASAELEGPYTGEISMRSLADAGVTYVMLGHLERRRLFNESN
FT                   DSINQKVLAALNAGIIPIICTDEEMVQTEVNGQIHYVFRQLKSVLKGVPANKLSQIVIS
FT                   YEPSWAVGSTHQANPDIAEEGCQAIRQSLVEMYGNEIGEQVRILYGGSVNPENIGQIMS
FT                   KPNVDGALIGRASLEIESFLQMINYIELASKQKLQVI"
FT   gene            274141..275007
FT                   /locus_tag="Lreu_0238"
FT   CDS_pept        274141..275007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0238"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="TIGRFAM: ketose-bisphosphate aldolase;
FT                   fructose-1,6-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82508"
FT                   /db_xref="GOA:A5VI34"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI34"
FT                   /protein_id="ABQ82508.1"
FT                   /translation="MAYFDNGNKLFDDARKNQYAIGAYNINNLEWTRAILRAAAETNTP
FT                   VLIQVSMGAAKYMGGYKFVKDMVEDQMDAMGIKVPVILNLDHGDYDAAIECINLGYSSV
FT                   MFDGHKLPIEENYAKTKEIVQLAHSRGIAVEAEIGKVGENQDTSSGELADVEDAMAFAA
FT                   MGVDRLACGIGNIHGIYPANWPGLDFDRLQEIANAIDIPLVLHGGSGIPREQVQKAISM
FT                   GIAKVNINTEFQLAFQDATRKYIENELDLNKEQKGYDPRKLLLPGTDAITAKMKDMIEW
FT                   LGTPAVA"
FT   gene            275027..275683
FT                   /locus_tag="Lreu_0239"
FT   CDS_pept        275027..275683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0239"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82509"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI35"
FT                   /protein_id="ABQ82509.1"
FT                   /translation="MAITVYFVRHGETYFNRFARLQGWSDTPLTEKGEMDAKKIGQVLA
FT                   DLRIDYLFSSDLKRAVDTARLLIADHLTATVKEPIQKKFFREVFYGSFEGHSNEEGAIW
FT                   ASYLEGKRFRRIGELVDEFGVEKAHDLLKAADPAHLAEDSNELNARVEQAIAFLQSLPD
FT                   ESNVVVVAHGSIIQYIAGMYGKPGYKYENLHNGALMKVQLTARDVEITGYNQFKL"
FT   gene            complement(275722..276186)
FT                   /locus_tag="Lreu_0240"
FT   CDS_pept        complement(275722..276186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0240"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82510"
FT                   /db_xref="GOA:A5VI36"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI36"
FT                   /protein_id="ABQ82510.1"
FT                   /translation="MNVLFVCLGNICRSPMAEAMFKQMVDDAGLNGKINVDSAGTSNEE
FT                   EGNGPHPGAAKTMHAHGLSTDGLISRPITRQDFEWADYIICMDNMNKYNLQRIAPAQDR
FT                   DKVHLAYEVIPGKEDQEIPDPWYTHRFEDTYNSLNETLPLWLDKITKELS"
FT   gene            276316..276885
FT                   /locus_tag="Lreu_0241"
FT   CDS_pept        276316..276885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0241"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82511"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI37"
FT                   /protein_id="ABQ82511.1"
FT                   /translation="MTLIIVIVVIVLLIAIYAGLYNSLIQLRTHAQESWSQIDVQLQRR
FT                   NDLIPNLISTVKGYSKYEAGTLEKVTKLRTELNSIPDSDHAKKMEVSNELTGTLRTLFA
FT                   VAENYPDLKASAEYQKLMEELTNTENKIAYSRQLYNSTVAALDAKIQSFPSNIVAKIHH
FT                   FQQMDYLQVPEEAKAVPKVSFDDLGD"
FT   gene            276888..277784
FT                   /locus_tag="Lreu_0242"
FT   CDS_pept        276888..277784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0242"
FT                   /product="Heat shock protein, Metallo peptidase, MEROPS
FT                   family M48B"
FT                   /note="PFAM: peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82512"
FT                   /db_xref="GOA:A5VI38"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI38"
FT                   /protein_id="ABQ82512.1"
FT                   /translation="MLYQQIARNKRKTILVMFGFFVLLALIGAAIGYLFARTVIGGMII
FT                   AAIIAVIYMSVIIGQSTDVVMRMNNATEVRSASDAPELWHIVEDMALVARVPMPKVYII
FT                   HDPSPNAFATGNDPEHAAVAATTGLMEKMNREELEGVMAHEMTHVRNYDIRLQTIALAL
FT                   ASAIAMLVNFAGNFWWIGGRSSSDDRDNPSSIFAILGSILLIILAPLAATIAQMALSRN
FT                   REYLADAGAVELTRNPQGMISALEKLKTAVPMKHVDPSSSALYISDPEKNAKHHPFSNL
FT                   FDTHPPLDKRIERLRQM"
FT   sig_peptide     276888..276998
FT                   /locus_tag="Lreu_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.932 at
FT                   residue 37"
FT   gene            277938..279317
FT                   /locus_tag="Lreu_0243"
FT   CDS_pept        277938..279317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0243"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82513"
FT                   /db_xref="GOA:A5VI39"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI39"
FT                   /protein_id="ABQ82513.1"
FT                   /translation="MKMKLAEIAKAINAQNDIEQWKDVEVTSVSFDSRHLDQGSLFVPL
FT                   QGAQDGHQYVPSAFTNGAVASLWASDHEITDQTHPLLVVSDPLAALQQLGKYYLHKINP
FT                   IVVAVTGSNGKTTTKDMIASILSTQFNVAKTYANFNNEIGVPVTLLNMESNTEAVVVEM
FT                   GMDRFGQLDFLSKLVNPDIAVITMIGEAHIEFFGTRDKIADAKMEITHGLKEDGTLVFN
FT                   GDEPLLEERVKDLAQRQMRFGRQLSNNLYATSVHDEPRQLSFTVNEWPDEEFTIPMVGE
FT                   YNINNALAAMEVGKILHITPAHMKQALANVELTENRAEWVKGKNGEQILSDVYNSNPTA
FT                   AKEVLKTIAETPVAGRRIAVLGDMLELGDAAAKLHASLAEEIDHQKIASVYLVGEQMKN
FT                   LKDKLIQEGYPAEDIHHYAASDLQQLIADLTATLTGEDIVLLKASHGIHLEEVLTALKA
FT                   E"
FT   gene            279389..280885
FT                   /locus_tag="Lreu_0244"
FT   CDS_pept        279389..280885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0244"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82514"
FT                   /db_xref="GOA:A5VI40"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI40"
FT                   /protein_id="ABQ82514.1"
FT                   /translation="MKFSELGLSDSLLKAIKRSGYEEATPIQEQTIPMVLEGKDVIGQA
FT                   QTGTGKTAAFGLPIIENVDTENLNIQAIIISPTRELAIQTQEELYRLGKDKHVRVQVVY
FT                   GGADIRRQIKSLKQHPQILVGTPGRLRDHINRHTVKLDHIKTLVLDEADEMLNMGFLED
FT                   IESIIKETPDDRQTLLFSATMPPEIKRIGVQFMSDPETVRIKAKELTTDLVDQYYIRAR
FT                   DYEKFDIMTRLIDVQDPDLTIVFGRTKRRVDELSKGLIARGYNAAGIHGDLTQDKRSKI
FT                   MWKFKNNELDILVATDVAARGLDISGVTHVYNYDIPSDPDSYVHRIGRTGRAGHHGVSL
FT                   TFVTPNEMDYLHEIEKLTRVRMLPLKPPTAEEAFKGQVASAFNDIDELIAQDSTDRYEE
FT                   AAEKLLETHNATDLVAALLNNMTKEAASEVPVKITPERPLPRRNKRNNRNGNRNNSHGG
FT                   NHYRRKNFRRHQHGGGHRNDNHGKSHSSRHAFNIRHRKED"
FT   gene            complement(280966..281802)
FT                   /locus_tag="Lreu_0245"
FT   CDS_pept        complement(280966..281802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0245"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82515"
FT                   /db_xref="GOA:A5VI41"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI41"
FT                   /protein_id="ABQ82515.1"
FT                   /translation="MGTTILSFEDRVVIETLRYESRSLKYIADYLGFSKTTIFNEVHRL
FT                   TDEYHTVKAQADHEAKLSHRGRKTILTSNLKRLIEEKIKIQKWSIEQVAHVVRIAYKTI
FT                   YTWIDQGVLDIGVADLPDHGIRRRRAKETRGTFSHGRSIEDRPAEVIDRHTSGHFEADT
FT                   VLSGKRKGQAIATFVERKSRLVIVKRLQGRDSTSMTKAILELANQLEDNLKILTVDHGK
FT                   EFANYKLIEEQARIPLYFAHAYSPHERGSNENRNRVLRRFIPKGQPIEIFLRNLRH"
FT   gene            282268..283209
FT                   /locus_tag="Lreu_0246"
FT   CDS_pept        282268..283209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0246"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82516"
FT                   /db_xref="GOA:A5VI42"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI42"
FT                   /protein_id="ABQ82516.1"
FT                   /translation="MPCVREVLTMQKLEQLIDKNFAETAHGKVANYIPILGIVDPQQLG
FT                   IAIYDVDEDEIGTAGMAGTRFAIESIAKVITLILTIKRLGHKRVLAELENGSADYSLSS
FT                   VLLDDELTEQVHRVNYLNNSSALLTTALIDQLMGQNSFNALLGFCREICNDPCISLNER
FT                   LFRSAIMNDKDIHALAYYMKDKDILETVDQTLITYFMQSSMMVTSQSLANLGAVLANDG
FT                   IKPWDNERLISHEDNELVKKLLTTVGSFEESKEYTIKIELPIKSGTGGGLLACAPQKCG
FT                   IGIFSPALDQHGNSLAGMSLLQDVVDQLELVV"
FT   gene            complement(283355..283813)
FT                   /locus_tag="Lreu_0247"
FT   CDS_pept        complement(283355..283813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0247"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82517"
FT                   /db_xref="GOA:A5VHL3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL3"
FT                   /protein_id="ABQ82517.1"
FT                   /translation="MANKLNSLAHTKWLCKYHIVFIPKYRRKAIFNQYRRDLRDYIRLL
FT                   CKYKGVEIIEGHMMPDHVHLLVSIPPKLSVSQFMGYLKGKSALMMFDRHANLKYKYGNR
FT                   HFWAEGYYVSTVGLNESTIKKYIRDQEKHDIAMDKLTSVEYSDPFKGK"
FT   gene            284469..285851
FT                   /locus_tag="Lreu_0248"
FT   CDS_pept        284469..285851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0248"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron, maturase-specific domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82518"
FT                   /db_xref="GOA:A5VI44"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI44"
FT                   /protein_id="ABQ82518.1"
FT                   /translation="MRQSQKTEQQADRLSRIGLENRKYTRARSTDYGEGKGMSVTIQDL
FT                   VLDRNNLNQAYLRVKRNKGAAGIDDMTVNDLLPYLRENKTELIASLREGKYKPAPVKRV
FT                   EIPKPNGGVRKLGIPTVVDRMVQQAVAQILTPIFERVFSDNSFGFRPHRGAHDAIEKVV
FT                   DLYNQGYRRVVDLDLKAYFDNVNHDLMIKYLQQYIDDTWTLRLIRKFLTSGVLDHGLFA
FT                   KSEKGTPQGGPLSPLLANIYLNELDKELTGRGHHFVRYADDCNIYVKSQRAGERVMRSI
FT                   TQFLEKRLKVKVNPDKTKVGSPLRLKFLGFLLGVDHNGAYARPAKQSQQRVKKALRLLT
FT                   KRNRGISLTRMFEEIQRKMRGWLQYYSIGKLTDFIQRLDKWLRARIRQYIWKQWKKLKT
FT                   KVTNLQKLGLSQRDAYGFASTCKGYWRTAHSKTLSYSLTNRKLEQLGLMNMSKTLQSIQ
FT                   SD"
FT   gene            complement(285935..287224)
FT                   /locus_tag="Lreu_0249"
FT   CDS_pept        complement(285935..287224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0249"
FT                   /product="DltD, C-terminal domain protein"
FT                   /note="PFAM: DltD, C-terminal domain protein; DltD,
FT                   N-terminal domain protein; DltD, central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82519"
FT                   /db_xref="GOA:A5VI45"
FT                   /db_xref="InterPro:IPR006998"
FT                   /db_xref="InterPro:IPR023896"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI45"
FT                   /protein_id="ABQ82519.1"
FT                   /translation="MHNGKKLWSIFGPLIVACLLVVLLFSLPISKKHSAAIEHEAAVSL
FT                   SPVVFKNQSIKQQALSDKHTHYVPFFGSSELRRMDRFHPSVMAARYHNYTPFLFGSRGT
FT                   QSLPQFFNINSMETQMRNNKAVYIISPQWFTKQGVQPPAFKYYNGELANLNWLQHANPK
FT                   SPYDRYIATRLIAMLGKDGTVSSYAKKIAEGKSLSSFDMGVIRFRLNMLVHEDAIFSGF
FT                   QLNNNYGKHILPNVKKLPQHYNYNELYDDAMNEAARDTNNNRFGIKNSFYTQRVKKNLA
FT                   KTKGSQRNFNYTKSPEYGDLEVVLNQFKNTNSNVLFIIPPVNSKWEKYTGMDMNMYYQS
FT                   VEKIKFQLRQQGFNHILDLSHDGDKPGFMEDTIHIGWAGWVKVDKATNSFISNKQPQPH
FT                   YQINSKFLSPEWTNLTPTPGNLQKFQEKLH"
FT   sig_peptide     complement(287129..287224)
FT                   /locus_tag="Lreu_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.709) with cleavage site probability 0.399 at
FT                   residue 32"
FT   gene            complement(287217..287456)
FT                   /locus_tag="Lreu_0250"
FT   CDS_pept        complement(287217..287456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0250"
FT                   /product="D-alanyl carrier protein"
FT                   /note="TIGRFAM: D-alanyl carrier protein; PFAM:
FT                   phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82520"
FT                   /db_xref="GOA:A5VI46"
FT                   /db_xref="InterPro:IPR003230"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI46"
FT                   /protein_id="ABQ82520.1"
FT                   /translation="MQEQIINILADATGRDTADFSDASQNLFESGLLDSMATVSLLLGL
FT                   QDAFGVQVPVSEFDRNQWDTIEKIEERVKELQNA"
FT   gene            complement(287476..288693)
FT                   /locus_tag="Lreu_0251"
FT   CDS_pept        complement(287476..288693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0251"
FT                   /product="membrane bound O-acyl transferase, MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase, MBOAT
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82521"
FT                   /db_xref="GOA:A5VI47"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024024"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI47"
FT                   /protein_id="ABQ82521.1"
FT                   /translation="MIDWISNLPNFSAYGTPVYFFYLLLAILPLGIGLYFGKRFSWYEA
FT                   LISFIFIFLMFDGSSWQQGISLIAYVIYQTIIVMAYHRYRQNNNSSGVFYFTAALSILP
FT                   IVIVKLSPAMVGHNSLLGFLGISYLTFRAVGTVIETRDGMIKEISPWKFIRFILFMPTI
FT                   TSGPIDRYRRFEKDYKKVPTREEYLNLVNTGILYLFLGFLYKFVIGYFFGQRFYPFFEK
FT                   AALADPSFPSWNLVGVMYTYGLYLFFDFAGYSLFAVAISYFMGVRTPMNFKQPFKSKNL
FT                   KEFWNRWHISLSFWFRDYIFMRFVFLATKKRWFKNRNTLSSTAYMLNMLLMGFWHGITW
FT                   YYILYGFLQGLGLVVNDWWLRFKRKNLKQLPHNKFTTGVAIFVTFNFVMFTFLIFSGFL
FT                   DTYLFK"
FT   gene            complement(288693..290219)
FT                   /locus_tag="Lreu_0252"
FT   CDS_pept        complement(288693..290219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0252"
FT                   /product="D-alanine-activating enzyme"
FT                   /note="TIGRFAM: amino acid adenylation domain;
FT                   D-alanine-activating enzyme; PFAM: AMP-dependent synthetase
FT                   and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82522"
FT                   /db_xref="GOA:A5VI48"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010072"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI48"
FT                   /protein_id="ABQ82522.1"
FT                   /translation="MSKNIITVFEQIAKDNSTRIAYDEMGKTTTYADLSSAVDTLAAWL
FT                   STQSLPDRSPILVYGDHQVEMIISFLAALKAGHTYIPVSNDSAIPRMQSILDTAKPAMI
FT                   IAVNDFPSNDLQFDAPIVDHQQLEKILATPQTFDTSAMINGDELAYVLFTSGTTGSPKG
FT                   VEVSHDNFMTFVDWMLSDEFKIKEHANFLGQPPYSFDLSNMYWLPALLNGGTIKALPHE
FT                   VVENFGQMFTALPNLDLEVFVGTPSFADMLMLSPAFNQQKMPSLKTFLFCGEELTVKTA
FT                   KGLHQRFPDAKIFNTYGPTETTVAVSGIEITPEIIENNDRLPVGYAKPGVKLSIWNGNQ
FT                   EITTPGEQGEIVISGNSVARGYMNNPEKTAKSFFKIDGVPAYRTGDAGTLDSDGLLHHK
FT                   GRMDFQIKLHGYRIELDEVRASLEKSSLIKQAVAVPKYNKDGKVTHLIAYVIPNEATGD
FT                   TAGLTKQIRESLDGLIMPYMMPTQFVYRESFPMSANGKIAVKQMVAEANK"
FT   gene            complement(290241..290381)
FT                   /locus_tag="Lreu_0253"
FT   CDS_pept        complement(290241..290381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82523"
FT                   /db_xref="GOA:A5VI49"
FT                   /db_xref="InterPro:IPR021008"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI49"
FT                   /protein_id="ABQ82523.1"
FT                   /translation="MAQIIQRHPALRFILKTLFYFVVLLLLIYLYGYYGAGQEPFIYNE
FT                   F"
FT   gene            290712..291074
FT                   /locus_tag="Lreu_0254"
FT   CDS_pept        290712..291074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0254"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82524"
FT                   /db_xref="GOA:A5VI50"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI50"
FT                   /protein_id="ABQ82524.1"
FT                   /translation="MIKGIGIDITEIERVKKAATAHSQFIQHVLTPTELEQYSQFSGQR
FT                   SVEYLAGRWSLKESFAKAYGTGIGANLGFHDIEIIDNQYGAPIVTKSPYNGNAHASVSH
FT                   TATLVMTEVILESENK"
FT   gene            291074..292201
FT                   /locus_tag="Lreu_0255"
FT   CDS_pept        291074..292201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0255"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="TIGRFAM: alanine racemase; PFAM: alanine racemase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82525"
FT                   /db_xref="GOA:A5VI51"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI51"
FT                   /protein_id="ABQ82525.1"
FT                   /translation="MVNGRLRDTSLIVDLDALRHNIQEQKKVLPENSKILAVVKANAYG
FT                   NGLIPVAQTAMTSGASGLCVAILDEALELRDNGIEAMTLVLGITSVEDALIAAQAGVSL
FT                   TVGSLDWLEQYHQLAQVAKPKKPLKVHLGIDSGMGRIGFTEVAAFKQAVKLLDSPEFEF
FT                   EGMFTHFATADSPDENYFNQQVQRWHQFVASLAELPPYVHMANSATGLWHRETITANTI
FT                   RMGISMYGQNPSGRDLKLTLDLQPVSSLVSSISFVKQLKAGRSVSYGATYTAEQDEWLA
FT                   TLPIGYADGYPRCMTGYKVLVDGQFCDIAGRVCMDQMMIRLPKYYPVGTPVVLMGKSGD
FT                   QEITATDLAERAGTINYEILTNISNRVHRIYRQSK"
FT   gene            292220..292594
FT                   /locus_tag="Lreu_0256"
FT   CDS_pept        292220..292594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0256"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82526"
FT                   /db_xref="GOA:A5VI52"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI52"
FT                   /protein_id="ABQ82526.1"
FT                   /translation="MTKRKVKRGDIYYADLSPVIGSEQGGVRPVLILQNDVGNHYSPTV
FT                   IIAAITAQMQKKKMPTHVQLKGKSLPLTHDSVILLEQLRTIDKQRLKDRIAHLSPETMA
FT                   KVDKALTISVGLNAAYDENK"
FT   gene            292785..294161
FT                   /locus_tag="Lreu_0257"
FT   CDS_pept        292785..294161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0257"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines, uracil,
FT                   thiamine, allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82527"
FT                   /db_xref="GOA:A5VI53"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI53"
FT                   /protein_id="ABQ82527.1"
FT                   /translation="MKEQKGTTIFSIPMKNRKTNTWDMFATWVGANANNGTWFVGGVLA
FT                   ACGFSVAMKVLVLSSALSYVFLSLVGYIGYKTGVSTMTLSRASFGERGSYLPSLVNITQ
FT                   FIGWTAVNTFIAAQSVSILFHDLLGWPVWGQHGGYLGLVVGIIIMSILHIISVSSGSRS
FT                   VQMIERLGIILVLVFVIWESVAVFRTVSFSQIVNWHVPAQSKMAVGAAVDYVAAFNLAW
FT                   VTAGADFTRFTAKEKNATLTPFLGALLGVVWFAFIGLISTISIAISSGVYNANNSDPST
FT                   IASKLGLGVVALLVIILTSMTANAVNLLAAGSALSNIFIKLKLKYSLWIVVLLATVVTF
FT                   IPMFVGSFLSAFESFLDYVGMVLGPTIAIICTDFYFRAHRQYDVDELGKVGGKYWYRGG
FT                   VNWVAIIVFAIGVAFFLGVHQLPIFVNTIGATFIDMCLSGILYYGIMLLVDRKEDELCY
FT                   "
FT   gene            294152..295390
FT                   /locus_tag="Lreu_0258"
FT   CDS_pept        294152..295390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0258"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82528"
FT                   /db_xref="GOA:A5VI54"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI54"
FT                   /protein_id="ABQ82528.1"
FT                   /translation="MLLKNVHVDNHEEVVDVRILNGKFSEIKANLAPHDGEEVIDGKEN
FT                   LLLPPFVDSHVHLDATLTAGQPEWNETGTLFDGIRIWSERKQDLTKEDVKSRAKKTLLN
FT                   MVGHGIQHVRSHVDVTDPHLIAARALLELREELKDQIDLQLVAFPQEGILSYPHGRELM
FT                   EQAVKEGLDVVGGIPHFEFTTEYGWQSVHFLMALADKYDRLVDVHCDEIDDPASRNLEV
FT                   LATEAYERGMKDRVTASHTTAMGSYNDAYTYKLFRLLKMSDINFVSNPLVNVHLGGRFD
FT                   TYPKRRGVTRIKELTGAGINVSFGEDDIQDPWNPLGDGNMLDAVTMGVYIAHLMGYHQL
FT                   QDAFNYVTYNGAKTLHISDNYGIEVGKPANCILLNAHDFYNALNKHVEVLYNIRHGKVL
FT                   AETKPAETKVNIK"
FT   gene            295775..296566
FT                   /locus_tag="Lreu_0259"
FT   CDS_pept        295775..296566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0259"
FT                   /product="Hydratase/decarboxylase"
FT                   /note="PFAM: Hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82529"
FT                   /db_xref="GOA:A5VI55"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI55"
FT                   /protein_id="ABQ82529.1"
FT                   /translation="MTELNARQEEFAKALFEAYDTNTPLNEEEWKDVVTDDETAYAVQD
FT                   AVVKLKGKPTAGYKVSLTSKETQDMFDADSPLYGQQVAERFLQSPADVDLQMLNEPLLE
FT                   VELTFRAKEDLQPSDTLEDLFHKVTVAGALELPDARFVDWFPDLGKYNVMADCAVGGLV
FT                   VYGEEHDADSVFENVDDAANVHAVLFKDGEKLKEGVSSEVLGNPFKSLQWLVQKLAEQG
FT                   KAFTKGQMVSSGTFVLPPKLTAGKWEVEFDSGLGNVVVNAK"
FT   gene            complement(296675..297313)
FT                   /locus_tag="Lreu_0260"
FT   CDS_pept        complement(296675..297313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0260"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82530"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR017036"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI56"
FT                   /protein_id="ABQ82530.1"
FT                   /translation="MIFNSLIKPKATLTTLPETATLDEALTVLEDTGYRCVPVLDKSGK
FT                   IFRGNIYKMHLYRHKARQGDMHLPVTALLKNATKFISINAAFFSIFFAIRDLPYIAVLD
FT                   NNNQFYGILTHNSLLRMLAAGWNVNNGSYVLTVITPDERGALVTAAKEITRFCQIVNVI
FT                   SLDPKDETMKRVLYTLPADVTKEKMERIVKRLEKKGLEVSEIEDLHQSY"
FT   gene            297519..298079
FT                   /locus_tag="Lreu_0261"
FT   CDS_pept        297519..298079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0261"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82531"
FT                   /db_xref="GOA:A5VI57"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI57"
FT                   /protein_id="ABQ82531.1"
FT                   /translation="MKMIVGLGNIGTRYDETRHNTGFMVVDQLARDYHLGAFTHLKQEA
FT                   VAVSGVINGEKVMLVKPTTFMNDSGRAVGPLVDYYDIDLDDLVIVNDDLDMPVGKVRLK
FT                   THGASGGHNGLKSIISVLGTKNFNRVKVGIDHPQHGTVVSHVLGKFSKEERPKFDQAVE
FT                   QAEHALEDWINGEDFAKLMNAYN"
FT   gene            298098..301637
FT                   /locus_tag="Lreu_0262"
FT   CDS_pept        298098..301637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0262"
FT                   /product="transcription-repair coupling factor"
FT                   /note="TIGRFAM: transcription-repair coupling factor; PFAM:
FT                   helicase domain protein; transcription factor CarD; TRCF
FT                   domain protein; type III restriction protein, res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82532"
FT                   /db_xref="GOA:A5VI58"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI58"
FT                   /protein_id="ABQ82532.1"
FT                   /translation="MVQIENLIEKTPSFKQITADLQPKNHQLITGISGSARTELLSALS
FT                   KEGQRPILVVTDTISHMQELASDLENLLPANRVYQFPVEEVLAAEVATSSPNYRLQRVL
FT                   ALNALINNEPAVVVASAAGLRRNIISPEYFAQSSLKIKTGGEVDPVKIRQQLSAMGYQY
FT                   QKMVLRPGDFAIRGSIIDIYALNTDNPVRIDLFDTEVDSLRYFDASTQRSIDNVEEVQI
FT                   LPATDFIIPATEFSRVYEALDTEYKKVVKELSADDADIKQQVANRFEPLLNALKNQHLP
FT                   NELLEFSNLVYPTKHSLFDYLPDDGTIYFDDLTRIKQFAKQMTQEDAGWFKDKVAHHQL
FT                   TDVPDLSNDVSTIIKKDLHPQIYGALFKKGLGNIKLSQITDLKSRTMQRFFGQMPLLKA
FT                   ELQRWIDQGQTVILMANSPERRKQIAQTLADFDITATETELTNIKPNVVQIVAANLNNG
FT                   FEMPLAGLVVITESEMFKQVKRVHHRPQKLANAERLKNYTDLKPGDYVVHVNHGIGIFS
FT                   GIKTMEVDHVHQDYMIINYRDNAQIYVPVTQLNLVQKYVSSESKTPHINKLGGNEWAKT
FT                   KRRVSSKIEDIADELVDLYAKREAEKGYAFPKDDYLQKQFDANFPYNETRDQLRSIDEI
FT                   KEDMEKPKPMDRLLVGDVGYGKTEVAMRAIFKAVTGGKQVAFLVPTTVLAQQHYNTLMR
FT                   RFEGFPINIALMSRFKTPKELKETEAGLKDGSVDVVVGTHRILSKDVEFKDLGLLIVDE
FT                   EQRFGVKHKEKLKQLKNNVDVLTLTATPIPRTLHMSMLGVRDLSVLETPPAGRYPIQTY
FT                   VMEQNSSAIRDGIIREMQRGGQVYYLHNRVHDIEETVAWLQELVPEARIGYINGQMSEN
FT                   ELETVLYEFIQGNYDVLVTTSIIETGVDIPNANTLFVENADRMGLAQLYQIRGRIGRSN
FT                   RVAYAYFMYQPNKVLTELGEKRLAAIRDFTELGSGFKIAMRDLAIRGAGNLLGKQQHGF
FT                   IDSVGYDLYSAMLSDAVAKKQGKKQTIHSDAEVELGVEAYLPTDYIADQRQKIELYKTI
FT                   RQAKTDEEIIDIQGDLIDRFGDYPAPVGTLLLVSQLKNHADLAMIAEIKRQRDNINIKF
FT                   TERASRLIKAPAIIKEIANTRFKATIGEDNQQLTIRLVIQPKMTTDDWLHQLLQFVTAL
FT                   GNVMQADEKGAEK"
FT   gene            301634..301906
FT                   /locus_tag="Lreu_0263"
FT   CDS_pept        301634..301906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0263"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82533"
FT                   /db_xref="GOA:A5VI59"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI59"
FT                   /protein_id="ABQ82533.1"
FT                   /translation="MRLDKFLKVSRIIKRRSIAKEIADQGRILINGQPAKSSSRVAVGD
FT                   TLTIKFGNKTETVKINRIVETTKKSEAEDMYEIIDETYAESFDQL"
FT   gene            302007..302363
FT                   /locus_tag="Lreu_0264"
FT   CDS_pept        302007..302363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0264"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82534"
FT                   /db_xref="GOA:A5VI60"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI60"
FT                   /protein_id="ABQ82534.1"
FT                   /translation="MKGQSDSKISQLNTPYARQVSNQKTYNRHVHKRRCQRIIAVFLVI
FT                   FLIFGIQIFQSKRTLADINGNIRHAQSQLTKQKQKNQQLQRQIKLLHNPEYIQQVIRAK
FT                   YNYSKKGEIIYNLN"
FT   gene            302547..303041
FT                   /locus_tag="Lreu_0265"
FT   CDS_pept        302547..303041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0265"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82535"
FT                   /db_xref="GOA:A5VI61"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI61"
FT                   /protein_id="ABQ82535.1"
FT                   /translation="MAIEVGAKVSGKVSGITNFGAFVDLDDNQTGLVHISQISDKYIKD
FT                   VHDVLAVGDEVTAKVTRIGDDGKIALSIKAAAPREHQDHHENNHHRENNHRDFHHERNN
FT                   NFRGHNDNFRGGFSGRHHNSHQHEDFNDMLAGYLKESESRLSTLKRQTDGKRGGRGGRR
FT                   S"
FT   gene            303043..304437
FT                   /locus_tag="Lreu_0266"
FT   CDS_pept        303043..304437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0266"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82536"
FT                   /db_xref="GOA:A5VI62"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI62"
FT                   /protein_id="ABQ82536.1"
FT                   /translation="MTDLQQAFERHLVRSRFFATQDKVVVAVSTGVDSMVLLDLLQHLS
FT                   SKNRPQIIVAHMNHELRKQSQLEERFIRQYCKQNDLKLAVTHWPQDLHPQTGIENAARQ
FT                   ARYQFFRKVMKDNRASILLTAHHQNDLAETMLMKMTRGGQLSQLVGIRDRRPFASGTLI
FT                   RPLLPFSKQQLKKYALQHHLKWYEDKTNKDLNIQRNRFRHAIIPMLEEENPQLLSHLES
FT                   YHQQLTDLLTWRDQEVADQLAACFDQQGRMILASLAKNKEIIRKEILRQWFNQQGIYDI
FT                   KDQQLDELLEALENEQKPQQIIELPHRYILAKSYATCALKKLDNPLENLQKPQDHVIKL
FT                   EQWYQVDPINLMAVSAERSFFKDEEQVVSQWLAPDQFPLRLRQWRQKDRIRLKNGHHQL
FT                   VKRVLINQKVSRKQRDQQMVLVDAHDEVVWIVNQKWSWFERPTGYQLTWQPCFIGIKNK
FT                   EKKVNE"
FT   gene            304430..304972
FT                   /locus_tag="Lreu_0267"
FT   CDS_pept        304430..304972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0267"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82537"
FT                   /db_xref="GOA:A5VI63"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI63"
FT                   /protein_id="ABQ82537.1"
FT                   /translation="MNNDIERVLYSEEMLGKRMDELATDLTKDYKDKRPIIISVLSGAV
FT                   LFTVDMIERLDIMAQIDFIDVSSYFGGLGSTGKVKLIHDLKIDVKDRHVLIMEDIVDTG
FT                   RTLKYLMDLLADRGAKSIKVCSLLNKPEGRKVDIEPDYVGFTVPKEFLVGYGLDYKGFY
FT                   RNLPYVGILKPSVYQND"
FT   gene            305206..307314
FT                   /locus_tag="Lreu_0268"
FT   CDS_pept        305206..307314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0268"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82538"
FT                   /db_xref="GOA:A5VI64"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI64"
FT                   /protein_id="ABQ82538.1"
FT                   /translation="MNNNRKKNNFTHNVLFYAVMFLCIMGIAYFFFGGNTSTGQSKTVS
FT                   QSEFISELKSNKVKSVQLQPNGGVYKVTGTYRKPQSNNDNSANNTGFALTPQRNNKVTQ
FT                   FQSSVLESDVTVSQLQNYANRHNVKISTRAEESNSVWMNLLLTVLPLVIMIFFFYMMMG
FT                   QAGQGGGGRGVMSFGKTKAKPSDAKKNKVRFSDVAGEEEEKQELVEIVEFLKNPKKFTK
FT                   LGARIPSGVLLEGPPGTGKTLLAKAVAGESGVPFFSISGSDFVEMFVGVGASRVRDLFD
FT                   QAKKAAPAIIFIDEIDAVGRRRGNGMGGGHDEREQTLNQLLVEMDGFQGDEGIIVMAAT
FT                   NRSDVLDPALLRPGRFDRKILVGRPDVKGREAILRVHAKNKPMASDVDLKEIAKQTPGF
FT                   VGADLANLLNEAALLAARRNKTEIDAADLDEAEDRVIAGPAKHNRVQSEQERKTVAYHE
FT                   AGHTIVGLVLNDARVVHKVTIVPRGRAGGYAIMLPREDQMLMSKKNAMEQIAGLMGGRA
FT                   AEELVFKSQSSGASNDFEQATQIARSMVTQYGMSDKIGPVELQSSGQVFTGQGYDQSPY
FT                   SEKTAALVDEEVRRILTEGHETALHIIETHREQHKQIAEALLKYETLDEKQILSLYKTG
FT                   KVPDKDVAAEDEEARAQTFEESKRELERLENERHDEAKDNQNDSSDTKSDNSNDSQSSD
FT                   DSDNSEDK"
FT   sig_peptide     305206..305325
FT                   /locus_tag="Lreu_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.702 at
FT                   residue 40"
FT   gene            307405..308325
FT                   /locus_tag="Lreu_0269"
FT   CDS_pept        307405..308325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0269"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82539"
FT                   /db_xref="GOA:A5VI65"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI65"
FT                   /protein_id="ABQ82539.1"
FT                   /translation="MKTTDYLVKSMTKDGKFRAYAVNATQVVQKAHEIHDTWSASSAAL
FT                   GRTLIGTILLATSSLQGEAGMTVKIQGNGPVGFIIADGTAEGTVKGYMGNPHVSLPAND
FT                   KGKIDVAKAIGNQGTLSVTKMAPGDKTPYTGEVNLVSGELGDDFTYYLAQSEQIPSAVG
FT                   LSVFVNPDENIDVAGGFMIQVMPGASDEEISKLEKTLKGLPLVSQMLRDGDTPEDILKK
FT                   IFGDDLKILETMPVRYACDCSKERFAHALASISKDDMKKLIDEDHHAEAVCQFCGKKYE
FT                   FNEDELKKIYAEMTANDDKKSTDEK"
FT   gene            308433..309434
FT                   /locus_tag="Lreu_0270"
FT   CDS_pept        308433..309434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0270"
FT                   /product="tRNA-U20-dihydrouridine synthase"
FT                   /note="TIGRFAM: putative TIM-barrel protein, nifR3 family;
FT                   PFAM: dihydrouridine synthase, DuS; dihydroorotate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82540"
FT                   /db_xref="GOA:A5VI66"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI66"
FT                   /protein_id="ABQ82540.1"
FT                   /translation="MKWKIGNVEIPNQVVVAPMAGVTNSAFRVICKRFGAGYVVCEMIS
FT                   DRGIMYHNQRTLNMMDVDPEEHPMGIQIFGGTKETLVEAAKYVDQHTAADVIDINMGCP
FT                   VNKVVKTDAGARWLLDPNKVYEMVSYVTDAVKKPVTVKMRTGWDDKHILAVENALAAER
FT                   AGASAIAMHGRTRKQMYTGQADWNILKEVASQLKIPFMANGDVKTPEDAKKILDMTGAT
FT                   AAMIGRAAMGNPWMLKRTEHYLATGELLPEATPEQKIEMAKDHLNRLVDLKGEYVGVRE
FT                   FRGLSTYYIKGIPRAARTKVALVEAETLDEMNDIFDRFAEQTAERAAKRQQA"
FT   gene            309455..310981
FT                   /locus_tag="Lreu_0271"
FT   CDS_pept        309455..310981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0271"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (D, K and N); nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82541"
FT                   /db_xref="GOA:A5VI67"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI67"
FT                   /protein_id="ABQ82541.1"
FT                   /translation="MSQELDQMRVRREKMEELKEAGIEPFGRRFKRDHLAQDLHDKFDQ
FT                   YDKEELNEMGAKVIIAGRMTRKRSSGKAGFADFVDRTGKIQVYARKDMVGDEPYHVFKR
FT                   SDIGDFLGIEGDVIKTDTGELTVRAHKITFLSKALRPLPNKWDGVTDPETIYRQRYLDL
FT                   ISNPESFKRFHQRTAIIKAVRKYMDDNGFTEVETPILNTQAGGANARPFITHHNALDID
FT                   MYLRIATELYLKRLIVGGFERVYELGRIFRNEGMDPHHNPEFTTMETYAAYFDFQDVMD
FT                   ETEGIVKAAAKVVSDDGKITYQGHEIDLGGNFKRITMVDAVKEKTGIDFSDESMTDEDA
FT                   KKLADEHKVEYKPYWTKGHILNAFFEEFVEDTLIQPTFVYEFPVEVSPLAKRNADNPAM
FT                   TDRFELYVDGSELANAFSELNDPIDQKERFEMQAKEKANGNDEAEPVDLDYVQALEYGM
FT                   PPTGGLGIGIDRLVMLLTDAKSIRDVILFPTMRPEKEAKNDSKKKKNKKK"
FT   gene            311107..311640
FT                   /locus_tag="Lreu_0272"
FT   CDS_pept        311107..311640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82542"
FT                   /db_xref="GOA:A5VI68"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI68"
FT                   /protein_id="ABQ82542.1"
FT                   /translation="MGELEKLKQDCIVKQKRGLHIIIASIAVWGGILAVELLNVPVLTK
FT                   NLFVFICTALLLPVSYFISRLINVDFQNKTNPLTKLGMLFSMNQLLYLLIAMWIYPTIP
FT                   NKMLMVLAIIFGAHLLPYSWLYNSRAYLISSIVISILALLVGINFKPFILASVMLAMVA
FT                   AFCITLILENHQLD"
FT   gene            312393..313961
FT                   /locus_tag="Lreu_R0009"
FT   rRNA            312393..313961
FT                   /locus_tag="Lreu_R0009"
FT                   /product="16S ribosomal RNA"
FT   gene            314165..317087
FT                   /locus_tag="Lreu_R0010"
FT   rRNA            314165..317087
FT                   /locus_tag="Lreu_R0010"
FT                   /product="23S ribosomal RNA"
FT   gene            317169..317284
FT                   /locus_tag="Lreu_R0011"
FT   rRNA            317169..317284
FT                   /locus_tag="Lreu_R0011"
FT                   /product="5S ribosomal RNA"
FT   gene            317289..317361
FT                   /locus_tag="Lreu_R0012"
FT                   /note="tRNA-Asn1"
FT   tRNA            317289..317361
FT                   /locus_tag="Lreu_R0012"
FT                   /product="tRNA-Asn"
FT   gene            317408..317480
FT                   /locus_tag="Lreu_R0013"
FT                   /note="tRNA-Thr3"
FT   tRNA            317408..317480
FT                   /locus_tag="Lreu_R0013"
FT                   /product="tRNA-Thr"
FT   gene            317731..317919
FT                   /locus_tag="Lreu_0273"
FT   CDS_pept        317731..317919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82543"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI69"
FT                   /protein_id="ABQ82543.1"
FT                   /translation="MTEQNEIITPVFKNKPSNLQKRSFTARPAVKINVNEVELTIFKGT
FT                   NSVLASDIVKVVIRYAR"
FT   gene            317909..318265
FT                   /locus_tag="Lreu_0274"
FT   CDS_pept        317909..318265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0274"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82544"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI70"
FT                   /protein_id="ABQ82544.1"
FT                   /translation="MLVNWHDPDHIYLVCGKTDMRKGVDGLAMVIAENYGLELYNNSLF
FT                   LFCGGRNDRFKGLFWDGEGFIMLYKRFENGHLSWPRNSNEAKELSAQQLDWLLQGLNPL
FT                   PIRKIQAVRLGSFY"
FT   gene            318336..319880
FT                   /locus_tag="Lreu_0275"
FT   CDS_pept        318336..319880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0275"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82545"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI71"
FT                   /protein_id="ABQ82545.1"
FT                   /translation="MKQTAEEQIKELKQQLAMANEKIAQLTAIIKLQKNQIFGKKTEVM
FT                   EPVVDGQQSLFSEQEMDQLQDPDISVTEVTEKKIKQVVRHRKAKQSGQRTTFLDGLPQV
FT                   EEVIPLKDTNCPHCHQLMKKVGQHVYSREARLKPAELYCVNLIQETYKCNECINSNGSD
FT                   VLVSSKMPQSLLPHSYFSSTILAKVAELKFNLALPFHRQIKFWQAVGLRVDARLLATNI
FT                   IKVSQTYLEPLYDYLQELIRKESVIHMDETPFKVIDEPNETGYFWVTRSTKEFSKHQII
FT                   MFHYYNTRAGKTIGQIIGHQYRGIIMCDGYGGYSDRLYPQAKFGSCLVHIRREFYHITC
FT                   LLNKEQLKNSKAYRVLQLMRPIFHEEKQLTYSNHKEKLVQRRLHVKPLMDKLYTYLENI
FT                   SFPQGRLKAAINNALKLRKRVYQIFEDGRVPLTNNPVEQAIRPSTLIRKNSLFAKSSAG
FT                   AQANAIFYTLVATANQNHLNIYKYFKYLFDYLPNRKDAGLEAYLPWSKEIQAECHK"
FT   gene            320661..320733
FT                   /locus_tag="Lreu_R0014"
FT                   /note="tRNA-Asn2"
FT   tRNA            320661..320733
FT                   /locus_tag="Lreu_R0014"
FT                   /product="tRNA-Asn"
FT   gene            320936..321634
FT                   /locus_tag="Lreu_0276"
FT   CDS_pept        320936..321634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82546"
FT                   /db_xref="InterPro:IPR020961"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI72"
FT                   /protein_id="ABQ82546.1"
FT                   /translation="MRFSKAILVATSIIAIGLCTSGCSSSSTSSNSSKSSAQVSSAKKE
FT                   ESHIVGSYRDDADGAAITLNSDGTGTYVMANPTQADIHDQLTWKKEKNNYIINLNDSNY
FT                   DTPIDARLNEDNLSLVGNDEWPNQSFKRVHGDFDVDNFLKEQHAKNNSSTTKDTHSKES
FT                   STHARAALKKWASDHHKDTSKIDNLKATTDLSEPDEGWAFVDDNGTEYAIVRNGKVYPR
FT                   PVIDGDTSSN"
FT   sig_peptide     320936..321049
FT                   /locus_tag="Lreu_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.287 at
FT                   residue 38"
FT   gene            321847..323346
FT                   /locus_tag="Lreu_0277"
FT   CDS_pept        321847..323346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0277"
FT                   /product="amino acid/peptide transporter"
FT                   /EC_number="3.1.3.1"
FT                   /note="TIGRFAM: amino acid/peptide transporter; PFAM:
FT                   TGF-beta receptor, type I/II extracellular region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82547"
FT                   /db_xref="GOA:A5VI73"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI73"
FT                   /protein_id="ABQ82547.1"
FT                   /translation="MSKQKNLDTSFFGQPRGLSTLFFTEMWERFSYYGMRAILLFYMYY
FT                   AVTKGGLGMDQATAASIMSIYGSLVYLASVVGGWLSDRVWGSRRTVFIGGVLIMFGHIA
FT                   LSLPFGVSALYVSIALIVIGTGLLKPNVSEMVGGLYSPEDRRRDSGFSMFVFGINLGAA
FT                   VAPWAVPWAANGFGLNLFHGEMNFHAGFSLAAIGMFFGLVQYVVDGRKYLSKDSLYPDD
FT                   PIDKESLRPVIIWSIVGVVALVIILGLLAAMGQLNINNIITIITVIAIALPIYYFVMML
FT                   NSKKVTKDEKSRVVAYIPLFIAAAIFWAIEESGSVVLALFAEQRTVLHIGGWHFAAANF
FT                   QTLNPLFIMILTPFFVALWDHWKKQPSAPGKFAAGLVIAGLSYVWMALPAMIHGTTAGR
FT                   VSPFWLVGSWFIVEIAEMLISPIGLSVTTKLAPKAFKSQMMSMWFLADAAGQAVNAQVV
FT                   KYYSSATEVPYFLIIGAVSIVFGLILCLFVKKIHGLMDGVD"
FT   gene            323403..324233
FT                   /locus_tag="Lreu_0278"
FT   CDS_pept        323403..324233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0278"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82548"
FT                   /db_xref="GOA:A5VI74"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR022302"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI74"
FT                   /protein_id="ABQ82548.1"
FT                   /translation="MKIAVSSDLHLDLNHADVAEIITQQAHYLTRQEIDHYFFVGDAFN
FT                   DFEQTSACFAELQSQLPTTKVHYLAGNHDMLKGVTYEQLENLDDDLYFHNRFIDIPQTN
FT                   WRIIGNNGWYDYSFSMYESNVKEVAKWKRAYWVDRPIMQPMNDPERMAIVLHQVEEALK
FT                   QAHNQQKQVIFMTHFAPIREALPHPLIESARRQRMWEMTTAMLGSKHLGALLARFLEVK
FT                   AVFYGHLHYAQPLITVGNIEYRNQAVGVRRKNSEDWKGKSLLDQWISHLYTKKI"
FT   gene            324334..324416
FT                   /locus_tag="Lreu_R0015"
FT                   /note="tRNA-Tyr1"
FT   tRNA            324334..324416
FT                   /locus_tag="Lreu_R0015"
FT                   /product="tRNA-Tyr"
FT   gene            324427..324498
FT                   /locus_tag="Lreu_R0016"
FT                   /note="tRNA-Gln1"
FT   tRNA            324427..324498
FT                   /locus_tag="Lreu_R0016"
FT                   /product="tRNA-Gln"
FT   gene            324592..325236
FT                   /locus_tag="Lreu_0279"
FT   CDS_pept        324592..325236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82549"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI75"
FT                   /protein_id="ABQ82549.1"
FT                   /translation="MPKQGHFAKSMRTKQINDFKVKRNATGATIDDEQLTDFLVVRFAL
FT                   TAKKRVGSGARETVQRFLIEIGDSLQENDGDLQTIIPNLLASLNARVPWQFYLEILGEW
FT                   DLLQKFLQKELPAVPLEKRLRIKHPVTTQEMETLIAKLLAKKITAITFINQPGVDQNKK
FT                   DQMVTMMLTTIYHDQTIEWEKVRLLLAPFKFEIAPELDEETKDWLKKLAEK"
FT   gene            325354..326754
FT                   /locus_tag="Lreu_0280"
FT   CDS_pept        325354..326754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0280"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82550"
FT                   /db_xref="GOA:A5VI76"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI76"
FT                   /protein_id="ABQ82550.1"
FT                   /translation="MAEKNYSRIYLAIGSLALLTFIGILNETSMNVTYPELSAQFNVSL
FT                   DVIQWITTGYLLMVTITMGTTAYLLRQYQARCLHLFAVSFFIIGDLMCALTGNFPILLT
FT                   GRLIQAIATGLATPIMFHLIFTEIPRERIGMMTGMAAMVISFAPALGPTYGGVVSEMLS
FT                   WRMIFWILLPIVLISLVCGQLFIRNKPLGNDKAFSYGSLITLAIALISIISAVSSIGKQ
FT                   GFGKQFWLLLLVAIIFFSAFIYINNHGKSELFDLRVFKVVPLRLSTVTYFNLQFINIGI
FT                   SLVIPIYVQYVLHSSAIVAGLILFPGSLIGAFISPFAGTLADRYGFATPVISGGTLLVI
FT                   GTSCFSIFQRHLTPLLITIFFVILRIGFNFAFSNTISNASMLVQPQNAPDVNSIFNMVQ
FT                   QFAGSLGTSLLASTIALFQMSNSGSLMGRTYAGGRFDFILLGVLAIVTLLTMVTNYRMQ
FT                   QKKESISQ"
FT   gene            326845..328494
FT                   /locus_tag="Lreu_0281"
FT   CDS_pept        326845..328494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0281"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: TrkA-C domain
FT                   protein; YidE/YbjL duplication domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82551"
FT                   /db_xref="GOA:A5VI77"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI77"
FT                   /protein_id="ABQ82551.1"
FT                   /translation="MIHSIVHFMVSNQVFTLFICLAIGFLIGNYKIAGKFNIGATVGTL
FT                   IVTLIVGQIGSFPRDEMLGTIFFGAFMFSVGYRIGPQLLVSLKLFGVRILIASIFWMVV
FT                   AFLVGWSLFSAFKIGPGIAAGVISGALTQSATVASSLQTIGSLPVSQSVRATYEAQLPV
FT                   AYALTYVFGTLGVIIFLRDLAPKILGISIAEQGPKMAEHYHFHAKNPNPTWRRTYRIAD
FT                   DSPLVGKTLEEFNRRSNYRIIGLAAFHDGKMTDHLEYQLQVGDLLTVIGYAVHFDRLMR
FT                   VPGLTEVLTPTNAPRERAFVLGKNFKPSELALLRQHGVFVNIQDPISGNQQLINQLRPG
FT                   DVISLTGNTSRTKAILKKMGRWKAADTAMNYSLFSLGIGCASLLGIIGLKLNSIPLQLG
FT                   NGTAALIMGLILSSWIERHRDRKSIPVTVTSFLQSFGLTLFVGTVGLQSAQAFTSAIKS
FT                   LGIGVLFIGAMISIMPHLLTMFFGRYVLKMEPLALIGAMTGSGTIAAAMNEISQKAGPE
FT                   GGAYYAAAFTPAFVVGNIGITLLGPIFVALLS"
FT   gene            328527..329237
FT                   /locus_tag="Lreu_0282"
FT   CDS_pept        328527..329237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0282"
FT                   /product="aspartate racemase"
FT                   /EC_number="5.1.1.13"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82552"
FT                   /db_xref="GOA:A5VI78"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI78"
FT                   /protein_id="ABQ82552.1"
FT                   /translation="MQQFFTILGGMGTLATESYVRLLDKRTPIHCDQDYLNYLVVNHAT
FT                   VPDRTTWILDHSQPDPNEALIEDIKQQSLLNPAFFVLICNTAHYSFDKLQAATEIPILN
FT                   MLQETVNEIKKIKPDAKRVGLLATKGTLAANLYDPYIEKAGYELIKPTPEIADMTEDLI
FT                   YHDIKEAGHSDGKKYHELVRKMIEEQGVDVVVLGCTELSFAEEMDPETKYPVADSQSII
FT                   VDRSLERALKLRQK"
FT   gene            329403..330104
FT                   /locus_tag="Lreu_0283"
FT   CDS_pept        329403..330104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0283"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82553"
FT                   /db_xref="GOA:A5VI79"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI79"
FT                   /protein_id="ABQ82553.1"
FT                   /translation="MSSPVYIQIHNQLRQNIEDGEWKVGDKIPAERELANDFGVSRMTL
FT                   RQAIQALVDEGILERRVGSGTFVANRKVQEKMSGITSFTELMHATGKKAASKTISYHLT
FT                   IPSQTEVEKLKLAPDEQVLRMERVRYGNDVPICYEIATVPANLVQKFSKEEITTSFYRT
FT                   LEKKANLYPGHATQHISATKATEKIANYLQIKRGDALLRMTQLSYLQDGRPFEYVHTQY
FT                   VGSRFEFVFEK"
FT   gene            330166..331632
FT                   /locus_tag="Lreu_0284"
FT   CDS_pept        330166..331632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0284"
FT                   /product="putative nicotinate phosphoribosyltransferase"
FT                   /note="TIGRFAM: putative nicotinate
FT                   phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase and related"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82554"
FT                   /db_xref="GOA:A5VI80"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI80"
FT                   /protein_id="ABQ82554.1"
FT                   /translation="MKFDYPDDSLTLHTDAYELSMMQTYWKKGMGNRRAVFEAFFRKMP
FT                   FNNGYAVFAGLDHIIRYVKQLHFTDSDIEYLKSTNQFDDDFLEYLRNFKFTGSINSFEE
FT                   GDLVFNHEPIIQVDAPIIEGQLIETAILNILNYQIMIATKASRIKSIVGNQTVMEFGSR
FT                   RAQELDAALWGTRAAYIGGFDATSNVRAGKLFGIPISGTHAHALVQVYMNDYDAFKAYA
FT                   ETHHNCVFLVDTFDTLKSGVPNAIKVAKEFGDKINFIGVRIDSGDMAYLSKKVRKMLDD
FT                   AGFPDAKIIASNGLDEKTIQNLQMQGAKIDTWGIGTKLITAYDQPTLGAVYKLVAIEDE
FT                   DGQLVDTIKISNNVGKMSTPGKKQVWRINDRGDGKSEGDYITLVDEDPRNEKSLNMFNP
FT                   NFPLQQKDVEDFTARPMLKPIWQDGKYVYDEPTLEESRQHRFDSLNALWDEYKRDLNPE
FT                   VYPVDLSQKCYDNKLKLIHQVHEYVKSLSK"
FT   gene            331645..332472
FT                   /locus_tag="Lreu_0285"
FT   CDS_pept        331645..332472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0285"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="TIGRFAM: NAD+ synthetase; PFAM: NAD+ synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82555"
FT                   /db_xref="GOA:A5VI81"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI81"
FT                   /protein_id="ABQ82555.1"
FT                   /translation="MRKYQEEIINALGVNSQIDPQAEVTKRVQFICDFLQTTKMKALVL
FT                   GISGGQDSSLAGRLSQLAVEKLREETGDNEYQFIAVRLPYGEQADESDAMFAINDFIKP
FT                   DKIMRVNIKAATDAMVASLNEAGTPISDFSKGNIKARERMIVQYAIGGENKGAVVGTDH
FT                   AAEAVTGFYTKFGDGGADITPLSGLDKRQGKALLQYLGAPAKLYDKTPTADLEEDKPMR
FT                   PDEEALGVRYDEIDDYLEGREVSPAAAEKIESWYRRTQHKRHLPIAPYDTWWK"
FT   gene            332535..334715
FT                   /locus_tag="Lreu_0286"
FT   CDS_pept        332535..334715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0286"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase, RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82556"
FT                   /db_xref="GOA:A5VI82"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI82"
FT                   /protein_id="ABQ82556.1"
FT                   /translation="MMEEETLQLVSKQLPDIRPQQIKAALGLMDEGNTIPFIARYRKEM
FT                   TGTLDEVQLQAIRDEYHRVTTLRERQATVINKIKELGKLTPALEKQINSATELQEVEDL
FT                   YLPYKQKRQTKAQQAREHGLAPLANWLLSYPDDDLSAKAQEFINDDVPDAESALTGAHE
FT                   ILAEAISEMATVRSWLRNYTAQHGQLETSVKRDGEEKDELGTYKQYYEFTSPVQKLNSY
FT                   QILAFNRGEKEGIINAKITLDEEPVMNYLRFRLIKTSKKNDATAFIEEAYKDAYKRFLG
FT                   PAIERELRRQLTEGADEQAIKVFGENLYHLLMQAPIKGKVVLGFDPAYRTGCKLAVLDE
FT                   NGKFLTKAVIYPHKPAPEKQRATAESEFIDLLEKYHVEMIAIGNGTASRESEQFVAEAL
FT                   KKIKRPIYYVIVNEAGASVYSASKEARDEFPDLHVEQRSAISIGRRLQDPLAELVKIDP
FT                   QAVGVGQYQHDLPKKELNGELETIVERAVNRVGVNLNTASYQLLTRISGLNKTIAKNIV
FT                   TYRDENGRYTNRTQLKKVPRLGPKAYQQSVGFLRIIGGENPLDNTDVHPESYQVAEKII
FT                   QAAGINVDELGTPSADDKLKKIDVKQFTDDQVGTETVTDIISSLQKPGRDLRDSMPAPL
FT                   LRHDVMTIEDLKPGMKLQGTVRNVVDFGAFVDIGVKHDGLVHVSKMSKQFIRDPRAMVA
FT                   VGDIVDVWIDDVDLKRQRIQLTMLEPETVTND"
FT   gene            334708..335160
FT                   /locus_tag="Lreu_0287"
FT   CDS_pept        334708..335160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0287"
FT                   /product="protein of unknown function DUF335, SprT"
FT                   /note="PFAM: protein of unknown function DUF335, SprT;
FT                   SMART: protein of unknown function SprT"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82557"
FT                   /db_xref="GOA:A5VI83"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI83"
FT                   /protein_id="ABQ82557.1"
FT                   /translation="MTNAELQQLTEQWSKEYFGREFTHKVFFNKRLKTTGGRYHLSDHH
FT                   IDINPLMYTEFDLHNLRQVVLHELCHYHLHLLGMDYHHRSKEFKALLTQVGGSRYAPPT
FT                   SKRKVNSKKKWHYICTGCGVEIARQRRFNTQRYICRRCGHKFILKN"
FT   gene            335218..335306
FT                   /locus_tag="Lreu_R0017"
FT                   /note="tRNA-Leu1"
FT   tRNA            335218..335306
FT                   /locus_tag="Lreu_R0017"
FT                   /product="tRNA-Leu"
FT   gene            335463..337349
FT                   /locus_tag="Lreu_0288"
FT   CDS_pept        335463..337349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0288"
FT                   /product="glycoside hydrolase family 2, TIM barrel"
FT                   /note="PFAM: glycoside hydrolase family 2, immunoglobulin
FT                   domain protein beta-sandwich; glycoside hydrolase family 2,
FT                   TIM barrel; glycoside hydrolase family 2, sugar binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82558"
FT                   /db_xref="GOA:A5VI84"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI84"
FT                   /protein_id="ABQ82558.1"
FT                   /translation="MDADIKWLDEPETFRVNQLPAHSDHYYYGNYDEWRHNNSRFAQNL
FT                   DGQWQFNFAENPRKRENDFYKVDYDSSSFGTIEVPSEIELNNYAQNNYINTLIPWEGKI
FT                   YRRPAYALSPDDAQEGSFSDGDDNTVGEYLKHFDLEPSLRGKQIRIRFDGVERAMYVWL
FT                   NGHFIGYAEDSFTPSEFDLTPYIQDEGNVLAVEVFKHSTASWIEDQDMFRFSGIFRSVN
FT                   LLAQPLVHVEDLHIRPIVTDNYQDGIFNVDLQLHGEKTGNVNVRVIDNDGNTLVNETHP
FT                   VDSTVKVQDQFLENVHLWDNHDPYLYQLLIEIRDDEGNLVELVPYRFGFRRIEINKDHV
FT                   VLLNGQRLIINGVNRHEWNAKRGRAITMDDMTSDIHTFKENNINAVRTCHYPDQIPWYY
FT                   LCDDNGIYMMAENNLESHATWQKMGAIEPSYNVPGSVPQWRDVVVDRARTNYETFKNHP
FT                   SILFWSLGNESYAGDNIVKMNEFYKKHDDSRLVHYEGVCHTPEYRDRISDVESWMYLPP
FT                   KEVEEYLKNNPDKPFMECEYMHDMGNSDGGMGSYISLLDKYPQYFGGFIWDFIDQALLV
FT                   KDPVSGQEVMRYGGDFDDRHSDYEFSGDGLMFADRTPKPAMQEVRYYYGLHK"
FT   gene            337333..338292
FT                   /locus_tag="Lreu_0289"
FT   CDS_pept        337333..338292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0289"
FT                   /product="glycoside hydrolase, family 42, domain 5, loop
FT                   region"
FT                   /note="PFAM: glycoside hydrolase, family 42, domain 5, loop
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82559"
FT                   /db_xref="GOA:A5VI85"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI85"
FT                   /protein_id="ABQ82559.1"
FT                   /translation="MAYTNKLRVIYGDATLGLSGDSFHYIFSYERGGLESLKLNGKEWL
FT                   YREPMPTFWRATTDNDRGSGFNIRSAQWLAADTFHKCVGIDLTVDNQHFAELPIAPITN
FT                   EFSDPVSAENVKIKYTFETLTVPATQVTVTYEVNRQGEIKVTMHYYGHEDLPGLPVVGM
FT                   RFIMPTVATGFDYQGLSGETYPDRMAGATEGTFHVDGLPVTKYLVPQENGMHMDTHALT
FT                   ITRDSTQNNADHSREPFNLTIKQDEQPFAFSCLPYTAEELENATHIEELPLARRTVLVV
FT                   AGAVRGVGGIDSWGADVEEQYHIPADRDVEFSFVLNAK"
FT   gene            complement(338390..340159)
FT                   /locus_tag="Lreu_0290"
FT   CDS_pept        complement(338390..340159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82560"
FT                   /db_xref="GOA:A5VI86"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI86"
FT                   /protein_id="ABQ82560.1"
FT                   /translation="MKSKIANLINWVLPYCAIAAMAYLIMFPQFVSHGVILGTDSIFHF
FT                   NRFYDAAKQIQQLNFSYFQSNYSFQQSGRIINAVYGPLFAYLNGAILGVVGTWYQYQIV
FT                   TTFIVYLLGGIGMYRLGIRVHSKRTFAIICALIYMNIGWLPRWELAQNMNAWGAALAPY
FT                   MVICGVRMIQDHQRPVNWLQLMTLMTIIIQIHMLSSLFFVITLTPFFIIGLIITTNRKK
FT                   MWIETLKAVGGTVILTANVWGALLMLNLHNNIANPADFSLADNVLLPSMFSSTRDYLIY
FT                   AMWILFILQLIYVLFTFKKSLTNTVLTLLGSLVLLLSSPLTPWSFFQDVIPALGHTLQF
FT                   PNRLTIIAFPLLLAGVGISATTLDKKAQEIDLRNQLITGILLLMVFLVFTPTTIDVYKR
FT                   AARYDSEIVLNSFSAITRVSENKTALRHSVHDLYPGQLLTMVEKRSPDYLPIPKKYMNQ
FT                   KYVRSYAYEGQIINEAHKYTHTVLPHGGLQLSWEAGKAGKVRLPIITYHESQLTVNGHL
FT                   LRHYQRSSVGAPYIQQRKGKNTVTLYFKQAKWFTALLVISLVGLSILAIYGLYYFCTHV
FT                   KKYFQGIAAGQIS"
FT   sig_peptide     complement(340055..340159)
FT                   /locus_tag="Lreu_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.703) with cleavage site probability 0.544 at
FT                   residue 35"
FT   gene            340329..341039
FT                   /locus_tag="Lreu_0291"
FT   CDS_pept        340329..341039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0291"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82561"
FT                   /db_xref="GOA:A5VI87"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI87"
FT                   /protein_id="ABQ82561.1"
FT                   /translation="MAELVIVRHGQSQANRDNIFTGWTDVPLTPKGIEQGELVGKELLR
FT                   LGIQFSDAYTSYMERAIMTTNIILEEINQLYIPVHKTWRLNERHYGALSGRNKDEVKKE
FT                   IGAEQLHKWRRGFKDLPPQLKERQHDRRYDRLGVKIPLSESLEMTLQRLLPYWQDHIAP
FT                   RLIDGHNQLIVAHGSSLRALIKYLDGISDDDIDKVEVPNGKPILYRFDDHLNVIKKTFI
FT                   TMDGEIDDNTRISK"
FT   gene            341014..341880
FT                   /locus_tag="Lreu_0292"
FT   CDS_pept        341014..341880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0292"
FT                   /product="Esterase/lipase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82562"
FT                   /db_xref="GOA:A5VI88"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI88"
FT                   /protein_id="ABQ82562.1"
FT                   /translation="MTIHELANNPTLSGQVRLIENIVYGAMDGEALHMSILAPWTQRFP
FT                   KQYQTEPRPLIVFVQGSSWRTPKMGEEIPQLVQFVRAGYIVATVQHRSSIDSHPFPAFL
FT                   QDVKTAIRFLRANAQKYAIDPQQVAIWGTSSGANAAMLVGLTGDDPRYKVDLYQDESDA
FT                   VDAVVSCFAPMDVEKTFEYDANVPGNKLLQYCLLGPDVSKWPEIEKQMSPLYQVKDGQN
FT                   YPPFLLFHGDADKVVPYEQMEKMYMRLKDNGNSVEAYRVKGANHERDFWSPTIYNIVQK
FT                   FLGDQFK"
FT   gene            342146..343288
FT                   /locus_tag="Lreu_0293"
FT   CDS_pept        342146..343288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0293"
FT                   /product="cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82563"
FT                   /db_xref="GOA:A5VI89"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI89"
FT                   /protein_id="ABQ82563.1"
FT                   /translation="MKFNTQLIHGGNSEDPTTGAVSTPIYRSSTFHQHVLGGEPKWEYS
FT                   RTGNPTRASLEKLIAELEHGTAGFAFASGSAAIHATFSLFSQGDHFVVGSDVYGGTFRL
FT                   INKVLKRFGLEFTVVDMQDLEAVENAIQDNTVAVYFETPTNPLLQIADIKAIADIAKKH
FT                   GIKTIVDNTFATPYNQQPLTLGADIVVHSATKYLGGHSDVVAGLAVTNDDEIAEQLAFL
FT                   QNSIGSTLGPDDSWLLQRGMKTLGARMRVHQENANEVINFLQNDDHIGKIYYPGLKDFP
FT                   GHEVAAKQMRNFGAMISFELKDGLDAKKFVESLQLIDLAESLGGIESLIEVPAVMTHGS
FT                   IPREIRLENGIKDELIRLSVGIEDPEDIIADLQQALKKLD"
FT   gene            343315..344016
FT                   /locus_tag="Lreu_0294"
FT   CDS_pept        343315..344016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0294"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82564"
FT                   /db_xref="GOA:A5VI90"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI90"
FT                   /protein_id="ABQ82564.1"
FT                   /translation="MWEIIKTSLPQLLAAGFKYTIPLAIISFFFGLIIALVTALIRLSR
FT                   QRGAFMILKWIASFYVWLFRSTPLLVQLFIVFFGLPYLRIKGVLPHGIKLEPFTAGIIT
FT                   FSLNTGAYASETIRAAISSVPTGQWEAGAAIGMTRLQILWRIILPQALRVALPPLSNSF
FT                   ISLVKDTSLAASITIMEMFAVSQQIAAENYQPLLMYTLVAMVYAVFTTVLSYFQGYLER
FT                   VVDRQVNANNR"
FT   gene            344022..344771
FT                   /locus_tag="Lreu_0295"
FT   CDS_pept        344022..344771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0295"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82565"
FT                   /db_xref="GOA:A5VI91"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI91"
FT                   /protein_id="ABQ82565.1"
FT                   /translation="MKLTNINKSFGNKNVLKNTTLEFPAGKTTVMVGPSGSGKSTILRS
FT                   LNLLVMPESGQYDFDDHHLDFSQKVSNKDKLAIRQETGMVFQDYNLFPNKTVLGNIIEG
FT                   PTQVLKQTKKEAIANAHNLLAKVGLADYGEAYPNELSGGQAQRVAIARALAMSPKYILL
FT                   DEPTSALDPELELSVLKVLLQLAEEKQSMVIVTHNMVFAKHVADKIIFVENGEILYDGT
FT                   PDEFFAPDNPNKRIKNFIASMTMENLK"
FT   gene            344787..345578
FT                   /locus_tag="Lreu_0296"
FT   CDS_pept        344787..345578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0296"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82566"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI92"
FT                   /protein_id="ABQ82566.1"
FT                   /translation="MKFWKKALLTIAALTVGTSAGITSVSAASSAVNSELVHKGELTIG
FT                   LEGTYSPYSYRKNNKLTGFEVDLGKAVAKKMGLKANFVPTKWDSLIAGLGSGKFDVVMN
FT                   NITQTPERAKQYNFSTPYIKSRFALIVPTDSNIKSLKDIKGKKIIAGTGTNNANVVKKY
FT                   KGNLTPNGDFASSLDMIKQGRAAGTVNSREAWYAYSKKNSTKGLKMIDVSSEQDPAKIS
FT                   ALFNKKDTAIQSSYNKALKELQQDGTVKKLSEKYFGADITE"
FT   sig_peptide     344787..344870
FT                   /locus_tag="Lreu_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.715 at
FT                   residue 28"
FT   gene            complement(345686..347026)
FT                   /locus_tag="Lreu_0297"
FT   CDS_pept        complement(345686..347026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0297"
FT                   /product="aminopeptidase C, Cysteine peptidase, MEROPS
FT                   family C01B"
FT                   /EC_number="3.4.22.40"
FT                   /note="PFAM: peptidase C1B, bleomycin hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82567"
FT                   /db_xref="GOA:A5VI93"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI93"
FT                   /protein_id="ABQ82567.1"
FT                   /translation="MNFSINKEDIASFHKNYRHHPNSSVLENTVTKNGVRNASFNWHSI
FT                   ADNTPHFSIDLKTGDVADQKQSGRCWMFAALNTMRHDMQQKFNLPDNFELSQAYQFFWD
FT                   KFEKSNYFYQNVIKTAKKPTDSRKVSWLMNEPQNDGGQWDMLCALISKYGVMPKAAMPE
FT                   SFNSSNSRGIDEVLNNKLRHDAVILRKMINEDHANEEAIDETRRKMLNENYRMLAYTFG
FT                   EPVSHFDFEYRTKKDNEFHRDTNLTPQEFFKKYVGWNLDDYISIIQAPTADKKYHQTYT
FT                   IDMLGNVVGGREIKHLNLPMDEFKQLAIEQLKNGESVWFGSDVIKYSETKLGIMALNTY
FT                   DYDKLFDVDLEMTKAEALDYGESMMDHAMVITGVDLVNGKPTKWKVENSWGNKVGHKGY
FT                   FVMSDDWMDKYCYQVVINKKYLSEDLKRDYAKTPVVLKPWDPMGTLA"
FT   gene            complement(347055..347738)
FT                   /locus_tag="Lreu_0298"
FT   CDS_pept        complement(347055..347738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0298"
FT                   /product="ribose-5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82568"
FT                   /db_xref="GOA:A5VI94"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI94"
FT                   /protein_id="ABQ82568.1"
FT                   /translation="MDQNALKEQTGKESVKYIKSGMIVGLGTGSTVKYMVDELGKQVQE
FT                   GKIKDIIGVTTSNRTAKQARDLGITIKDIDDVDHIDLTIDGADEISDDFQGIKGGGGAL
FT                   LWEKIVANASNKVMWIVDESKLVHKLGAFPLPVEVIPFGSQHVFDRLEKKGYKPTWRMD
FT                   GDKKFRTDENNYIIDLHLGEIDDPKALADELIHMVGIVETGLFLNRVNDVIVGTPEGPK
FT                   VLHAR"
FT   gene            complement(347750..348046)
FT                   /locus_tag="Lreu_0299"
FT   CDS_pept        complement(347750..348046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82569"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI95"
FT                   /protein_id="ABQ82569.1"
FT                   /translation="MQYRVDSQRIIAFDDQEPLVGEISFPKVPDTNDHVVVERVFVQPT
FT                   YRGQGIAAELVRQFVDYATKEQYTVKLMCPYAVAQFKLHPEYQQLLPVADRFN"
FT   gene            348185..348721
FT                   /locus_tag="Lreu_0300"
FT   CDS_pept        348185..348721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0300"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82570"
FT                   /db_xref="GOA:A5VI96"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI96"
FT                   /protein_id="ABQ82570.1"
FT                   /translation="MKRGFKIVSSKKDQDIHLPQRQTTRAAGYDFEASEDFVLPSIWKG
FT                   NFLKALWQIHQQKKLTDEEFKAADSCLKPYLVPTGIKAYMQPDEFLLLANRSSGPFKRR
FT                   LILPNGIGIVDADYYDNDSNEGEIFFQLINYGLRDYHIKKGERIGQGIFMPYLIADGEE
FT                   QPTAKRTGGFGSTKE"
FT   gene            348746..350119
FT                   /locus_tag="Lreu_0301"
FT   CDS_pept        348746..350119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0301"
FT                   /product="DNA replication and repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82571"
FT                   /db_xref="GOA:A5VI97"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI97"
FT                   /protein_id="ABQ82571.1"
FT                   /translation="MAKVRTQYVCQNCGYNSPRYLGRCPNCGEWNTLVEEQVEANSAPT
FT                   KKATTTLTGLVAKPQKINEIDSTETPRVKTKLNELNRVLGGGIVPGSLILIGGDPGIGK
FT                   STLLLQVSGQLSDEHHRVLYVSGEESGTQIKMRAERLKVAGDDFYVYPETNMDSIRDTI
FT                   RDLKPEYVVIDSVQTMQATDVSSAIGSVSQIREVTAQLMQIAKSNNITIFVVGHVTKGG
FT                   AIAGPKILEHMVDTVLYFEGDLHHTYRILRSVKNRFGSTNELGIFEMHTNGLTEVKNPS
FT                   EIFLEERLHDATGSAVVVSLEGTRPILVEIQALVTPTVYGNAQRTATGLSRNRVSLIMA
FT                   VLEKRANLMLQNQDAYLKAAGGVKLDEPAIDLAIAVSIASSYRDKGTQPTDAFVGEVGL
FT                   TGEIRRVNRIEQRVAEAEKLGFKRIFIPKNNLKGWKPSTNIQVIGVSTLKEALYLALG"
FT   gene            350147..351289
FT                   /locus_tag="Lreu_0302"
FT   CDS_pept        350147..351289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0302"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein, PINc"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82572"
FT                   /db_xref="GOA:A5VI98"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A5VI98"
FT                   /protein_id="ABQ82572.1"
FT                   /translation="MRRRMITLIYILVGAAVGFYYLPLLWGILNIALNPALLVFIDIII
FT                   GALIFWLLSLPLASGTEKLIQRIEKELTKRSPVYLFFGTLLTIIGLVLAVLISIPLWRT
FT                   RIPVINNILPILLMIVFSYFGFRIGTTRLDDWRKAFTHAKSSKNDGGNVIERQDDNYHH
FT                   YKILDTNILIDGRIYDLVKTGFLEGTLLVPNFVLYELQYIADSGESIKRVRGRRGLDIL
FT                   NKLRNEKIVPIEMYDGDFEDIPEVDSKLIALAKKVDGVIVTNDYNLNKVIQFQNVQVLN
FT                   INNLAKSLRPRVIPGETMTVVVVKKGTERQQGVAYLDDGTMVVVEDGRYFMDKQIEVEV
FT                   TSALQTDAGRMIFARPLHSQRGIDEHTDHKENRNNKDKKK"
FT   gene            351664..353076
FT                   /locus_tag="Lreu_0303"
FT   CDS_pept        351664..353076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0303"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="TIGRFAM: cysteinyl-tRNA synthetase; PFAM:
FT                   Cysteinyl-tRNA synthetase, class Ia, DALR; tRNA synthetase
FT                   class I (M); Cysteinyl-tRNA synthetase, class Ia-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82573"
FT                   /db_xref="GOA:A5VI99"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VI99"
FT                   /protein_id="ABQ82573.1"
FT                   /translation="MLTIYNTLTRKKEEFKPLHPGVVNMYVCGPTVYNYIHIGNARSAI
FT                   AFDTVRRYLEFKGYKVNYVSNFTDVDDKMIKAAAEQGITVPQLAEKYINAFMEDTAAIN
FT                   IEPATLHPRATENITEIIKFVQGLIEKGYAYPKDGDVYYRARKFNHYGQLSGQSLDDLE
FT                   VGASEHVSADEVNKKEDPLDFALWKAAKPGEISWDSPWGKGRPGWHIECSVMSTKYLGK
FT                   TIDIHAGGQDLEFPHHENEIAQSEAETGQKFVRYWMHNGFVTIGKDNEKMSKSLHNFIT
FT                   VHEIIKEVDPQVLRFFMATTQYRRPIQYSQANLTDAQNNLNHIQTAFDNLTYREQDADE
FT                   GDVQEVTDRLEQFHHQFITAMDDDINVQNGIATVYELVKYANVYAQQDNVSLGAIQAIK
FT                   KELVELMSIFGVKLEASDNQINDEKIKQLIEERNIARKNKDFARSDEIRDNLKKQGIIL
FT                   EDTPQGTRYKKE"
FT   gene            353088..353501
FT                   /locus_tag="Lreu_0304"
FT   CDS_pept        353088..353501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0304"
FT                   /product="ribonuclease III"
FT                   /note="PFAM: ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82574"
FT                   /db_xref="GOA:A5VIA0"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIA0"
FT                   /protein_id="ABQ82574.1"
FT                   /translation="MVQADYRQLNGIALAYLGDAAYEVYIRQHLLTKGISKPTKLQHIA
FT                   THYVSAKAQAALIDLMKEDKLLSDEEWSYFKRGRNANSHTHAKNTSVMTYRISTGFEAV
FT                   MGYLKLAGKEERLAELAQWCIKQVEAGRTAHEK"
FT   gene            353491..354240
FT                   /locus_tag="Lreu_0305"
FT   CDS_pept        353491..354240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0305"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase, substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82575"
FT                   /db_xref="GOA:A5VIA1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIA1"
FT                   /protein_id="ABQ82575.1"
FT                   /translation="MKNENTDFIIGRHPAVMALKSDQEINKVFIQSGLKADAISQIVKL
FT                   AKERHLVVSNVPKNKLDLMTDRQNHQGVVLAVAAYQYATIDDLFDNAAKHDEDPFFLIL
FT                   DELEDPHNLGSIMRTADAAGVHGIIIPRRRAVGLTSVVAKTSTGAIEHVPVARVTNLVQ
FT                   TAKELQERGVWLFGTDMKGKDYRTWDAHGAVALVIGNEGKGISSLLKKTCDEMLTIPMV
FT                   GHVQSLNASVAASLLIYQGFNSRHPLK"
FT   gene            354455..354643
FT                   /locus_tag="Lreu_0306"
FT   CDS_pept        354455..354643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0306"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82576"
FT                   /db_xref="GOA:A5VIA2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIA2"
FT                   /protein_id="ABQ82576.1"
FT                   /translation="MEENMHLIRFIKSVNHEMKLVVWPTAKENRRDTTIVVSLTLFFVL
FT                   FFALFDWLIQLMMKLFV"
FT   gene            354762..355304
FT                   /locus_tag="Lreu_0307"
FT   CDS_pept        354762..355304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0307"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: transcription antitermination protein
FT                   NusG; KOW domain protein; SMART: NGN domain protein; KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82577"
FT                   /db_xref="GOA:A5VIA3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIA3"
FT                   /protein_id="ABQ82577.1"
FT                   /translation="MESHEKRWYVLHTYSGYENRVKSNLESRAQSMGMEDYIFRVVVPE
FT                   EEVRQVKDGQAKETIEKTFPGYVLVEMVMTDQAWYIARNTPGVTGFLGSHGGGSKPTPL
FT                   LPEEVDRIMKRMGTETTVSDIDVKEGDTVKVIAGSFANMTAKVVEVDHEKQKIKATVEM
FT                   FGRETAAELGFDQIDTF"
FT   gene            355444..355869
FT                   /locus_tag="Lreu_0308"
FT   CDS_pept        355444..355869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0308"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82578"
FT                   /db_xref="GOA:A5VIA4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIA4"
FT                   /protein_id="ABQ82578.1"
FT                   /translation="MAKKVANIVKLQIPAGAATPAPPVGPALGQAGINIMGFTKEFNAR
FT                   TADQKGMLIPVVITVYEDRSFDFITKTPPAAVLLKKAAGVEHGSGEPNTNKVASVTKDQ
FT                   VKEIAETKMQDLNAADVEAAMRMIEGTARSMGFTVED"
FT   gene            355892..356653
FT                   /locus_tag="Lreu_0309"
FT   CDS_pept        355892..356653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0309"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82579"
FT                   /db_xref="GOA:A5VIA5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIA5"
FT                   /protein_id="ABQ82579.1"
FT                   /translation="MKIVHPRGRYNSVRPHLQGGKHKMAKKRGKKYQDALKKVDSKKEY
FT                   AVKDAVQLVKDIAYANFDSTIEVAFNLNVDTKQADQQLRGAVVLPNGTGKDQTVIVFAN
FT                   GENAKAAQEAGADFVGDDDLVEKIQDGWLDFDVAIATPDMMPKVGRLGRVLGPKGLMPN
FT                   PKTGTVTMDVAKAVSDAKAGQVTYRTDRDGNVAVPFGKVSFDTDKLVENLATLEDIVAK
FT                   ARPASVRGTYIKHASISSTFGPSVTLDLTTF"
FT   gene            356831..358024
FT                   /locus_tag="Lreu_0310"
FT   CDS_pept        356831..358024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0310"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82580"
FT                   /db_xref="GOA:A5VIA6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIA6"
FT                   /protein_id="ABQ82580.1"
FT                   /translation="MTQFKYSKRVPADGTDAVGAILQAAADPKIISFAGGLPAPELFPV
FT                   KEMKAAVDKVFEEHGQEAMQYGAAKGVTALREVIQQHVKEKENVDSELDNVLVTTGSEQ
FT                   ALDLVGKAFVDPGDTVLVEQPTYLCALDVFRSYGANFASVEMDEDGMKMDALEEALKAN
FT                   PNTKLIYTVPNFQNPTGRTMTEERRKQLAELAEKYDVYVLEDNPYGEIRFAGQHVPAVK
FT                   SFDKSGHVFYMSTFSKTLAPGFRLGWLVADKAVVNKLTVLKQSADLHTDNLAQFAVAQF
FT                   FADNDVDAHVKEISALYGKRKDLMLEGIKKYFPEGVKYTDPEGGMFLWVEVPGVDDTVE
FT                   LFKECLEHDVAFVPGDPFFAGEVQPGAFRLNYSNMKEDQIEVGLKRLGAALTAAVNK"
FT   gene            358500..359804
FT                   /locus_tag="Lreu_0311"
FT   CDS_pept        358500..359804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0311"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82581"
FT                   /db_xref="GOA:A5VIA7"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIA7"
FT                   /protein_id="ABQ82581.1"
FT                   /translation="MLIIIFTLIWGIALFIFLVYSLISLLFRMISYPRDFYHFAGNQQP
FT                   AKIDRNLQYYVIVPCFNEAAVIQRTIKCLLRFKQFEIVVVDDASSDDSVSQIKQITNSR
FT                   VHLLRRYLPNAHTGKGDVLNFALDYICQITIRQRVPFEKVIIGVVDADAQLADNALQRL
FT                   NAYFSSPRTNVTQMRVKMYPHFKNWLQILQDIEFFSINHMAQIMRMYTKTVGLSGNGQF
FT                   FRLAPIIDKIGAHPWGNALLDDYELTIKMMLKKLHVDYMTDTYVYQEALTSPKRFVRQR
FT                   SRWVQGDLNCLKYLPQIIKSRVLSRTEKLGIYYFLLQPWLNFLADVAIIILTTITLTHW
FT                   HNLYGHLTLMTFSLVMAGLVVFSLFWGIIFGIFYYRDLAHYHEPPLKKHQLALLPLGIS
FT                   YMYVILFFSIIMAYWRWSFRQNSWIKTEHGKMFLK"
FT   gene            359817..360938
FT                   /locus_tag="Lreu_0312"
FT   CDS_pept        359817..360938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0312"
FT                   /product="UDP-N-Acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82582"
FT                   /db_xref="GOA:A5VIA8"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIA8"
FT                   /protein_id="ABQ82582.1"
FT                   /translation="MRKIKVMTVFGTRPEGIKMGPVVKALEKDDRFSSVVVSTGQHAEM
FT                   LQQVLAVFQITPDYDLKIMRPGQTLTEITIETMTKLEPIIQKEQPDIVLVHGDTSSAYA
FT                   SALVAFYNRVAIGHVEAGLRTWNKYSPYPEEMNRQMIDDLADLYFAPTQTSANNLKMGN
FT                   HQHGIIVTGNTAIDALRYTIDHSYHHQVLDEIDPDKKVILLTMHRRENWGKPMEETFKA
FT                   IQEIVDQRNDIDVIYPVHLNPKVQAIANKIFGNDNHFHLISPLDVVDFHNIMSKSLLVM
FT                   SDSGGVQEEAPALHKPVLVLRDTTERPEGVTAGTLKLIGTQFNNVTKELSSLLNSPEEY
FT                   NKMSEAQNPYGDGHASERILDAIARWVATQKEL"
FT   gene            361136..361636
FT                   /locus_tag="Lreu_0313"
FT   CDS_pept        361136..361636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0313"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82583"
FT                   /db_xref="GOA:A5VIA9"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIA9"
FT                   /protein_id="ABQ82583.1"
FT                   /translation="MSEAAIAKKAEIVKQTTDMLNAAQSAIVVDYRGLTVAEVTDLRKQ
FT                   LRDAGIQMSVIKNKILDRAVEGTDYEDLRSTFVGPTAVAFSDEDPIAPAKILKKFADDH
FT                   DALEIKGGFIEKSVKTLDEINEYANMPGREELLSMLASALQDPMRKIARAVKAIADKED
FT                   EAA"
FT   gene            361699..362064
FT                   /locus_tag="Lreu_0314"
FT   CDS_pept        361699..362064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0314"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82584"
FT                   /db_xref="GOA:A5VIB0"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIB0"
FT                   /protein_id="ABQ82584.1"
FT                   /translation="MAFDKDAIIASLKEASISDLNDLVKAIEEEFDVSAAAPVAVAGAA
FT                   GGDAAAKDSFTVELTEPGSAKVKVIKAVKDITGLGLKDAKDLVDGAPSAIKEDVKEDEA
FT                   NDIKEKLEAAGATVTLK"
FT   gene            complement(362252..362536)
FT                   /locus_tag="Lreu_0315"
FT   CDS_pept        complement(362252..362536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82585"
FT                   /db_xref="GOA:A5VIB1"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIB1"
FT                   /protein_id="ABQ82585.1"
FT                   /translation="MLFNVIFWILAIWFVINVIWMWFQLNNQILQKTFAWINVCAIVIG
FT                   FWVYYGVSHDASAINGWFIAMNWVNIAIAAIQFYFGYRTSNDSTTHPAK"
FT   gene            complement(362669..362899)
FT                   /locus_tag="Lreu_0316"
FT   CDS_pept        complement(362669..362899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82586"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIB2"
FT                   /protein_id="ABQ82586.1"
FT                   /translation="MFKKKNCPTSNSQKDATNAYQKGYDQAVKDYKALEPFRKYPQRII
FT                   NVTNKFIKGKMHALRDYVDGYEDAKQQLSKK"
FT   gene            complement(363033..363404)
FT                   /locus_tag="Lreu_0317"
FT   CDS_pept        complement(363033..363404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0317"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82587"
FT                   /db_xref="GOA:A5VIB3"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIB3"
FT                   /protein_id="ABQ82587.1"
FT                   /translation="MLKEFKTFIARGNVIDMAVGIIVGAAFTSIVKSLVNNLINPLIGL
FT                   FIGRIDLSNLVLTVGDAQFKYGSFLNAVINFLIISFVVFLMVKAINTFRKKEDKKTEAP
FT                   SEEVMYLKEITELLKKNKE"
FT   gene            363594..363926
FT                   /locus_tag="Lreu_0318"
FT   CDS_pept        363594..363926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0318"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82588"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIB4"
FT                   /protein_id="ABQ82588.1"
FT                   /translation="MKIQITADLLDGMVLAILEHKDYYGYALTQRMQSAITISESTMYP
FT                   VLRRLKKDGYLITYDQPYQGRNRRYYQITKAGKEHLQRIRKLWTDYKNSLDGIFYGLGE
FT                   GEDKDE"
FT   gene            363919..364530
FT                   /locus_tag="Lreu_0319"
FT   CDS_pept        363919..364530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0319"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82589"
FT                   /db_xref="GOA:A5VIB5"
FT                   /db_xref="InterPro:IPR012963"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIB5"
FT                   /protein_id="ABQ82589.1"
FT                   /translation="MNERQKYINDLSIYLRQLTDEERNDALEFYDEYIADAGLETRTAI
FT                   EERLGTPRQLSHKILADYSIKANNESIKEGHPASPHSSWRVFWWVLVAIITSPITFGLG
FT                   IAVLALLLAAGGVALSLIVGIVALIFGVAVIAIVSLYIGIGLLATNLFSGLFYLGLGVT
FT                   LIGLFLVCLPLIYWLIRVIVQGIANFAKFIYAKVQARRKK"
FT   gene            364531..365286
FT                   /locus_tag="Lreu_0320"
FT   CDS_pept        364531..365286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82590"
FT                   /db_xref="GOA:A5VIB6"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIB6"
FT                   /protein_id="ABQ82590.1"
FT                   /translation="MKRIFKIGVIVLILGVILLGIGFFNNGNKAIYFENNRPAIFHSHT
FT                   KTISTNKAFERIDISASTANVIVREGKKYQITYSGISRHTPAVTVHNNVASIRQTGGFP
FT                   LVFNFNDYQPHQDLIIVTIPHDQALAGRIHLESGDLTVSKVKMDNIDVNSDAGEVEYRQ
FT                   VTLRGGSTKLSSGNFTGHDLTVQGQYTVNNQSGDNTVTSTTVDGYFLKTEDGDNELNGE
FT                   DKGEEPLHQNDDAENVLRLITQSGDNEVN"
FT   gene            complement(365374..368010)
FT                   /locus_tag="Lreu_0321"
FT   CDS_pept        complement(365374..368010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0321"
FT                   /product="alcohol dehydrogenase AdhE / acetaldehyde
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /EC_number="1.2.1.10"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82591"
FT                   /db_xref="GOA:A5VIB7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIB7"
FT                   /protein_id="ABQ82591.1"
FT                   /translation="MPANNKKQVEKKELTAEEKKQNAQKLVDDLMTKSQAAFEKLRYYS
FT                   QEQVDKICQAMALAAEEHHMDLAVDAANETGRGVAEDKAIKNIYASEYIWNNIRHDKTV
FT                   GIIEDNDEDQTIKIADPLGVIAGIVPVTNPTSTTIFKSIISAKTRNTIIFSFHRQAMKS
FT                   SIKTAKILQEAAEKAGAPKNMIQWLPESTRENTTALLQHPNTATILATGGPSLVKAAYS
FT                   SGNPALGVGPGNGPAYIEKTANIERSVYDIVLSKTFDNGMICATENSVVVDEEIYDKVK
FT                   EEFQKWNCYFLKPNEIDKFTDGFIDPDRHQVRGPIAGRSANAIADMCGIKVPDNTKVII
FT                   AEYEGVGDKYPLSAEKLSPVLTMYKATSHENAFDICAQLLHYGGEGHTAAIHTLDDDLA
FT                   TKYGLEMRASRIIVNSPSGIGGIGNIYNNMTPSLTLGTGSYGSNSISHNVTDWDLLNIK
FT                   TIAKRRENRQWVKIPPKVYFQRNSLKELQDIPNINRAFIVTGPGMSKRGYVQRVIDQLR
FT                   QRQNNTAFLVFDDVEEDPSTNTVEKGVAMMNDFKPDTIIALGGGSPMDAAKAMWMFYEH
FT                   PETSWYGVMQKYLDIRKRAYQIKKPTKSQLIGIPTTSGTGSEVTPFAVITDSKTHVKYP
FT                   LADYALTPNIAIVDSQFVETVPAKTTAWTGLDVLCHATESYVSVMATDYTRGWSLQTIK
FT                   GVMENLPKSVQGDKLARRKMHDFSTMAGMAFGQAFLGINHSLAHKMGGAFGLPHGLLIA
FT                   IAMPQVIRFNAKRPQKLALWPHYETYHATKDYADIARFIGLKGNTDEELAEAYAKKVIE
FT                   LAHECGVKLSLKDNGVTREEFDKAVDDLARLAYEDQCTTTNPVEPLVSQLKELLERCYD
FT                   GTGVEEK"
FT   gene            complement(368368..369387)
FT                   /locus_tag="Lreu_0322"
FT   CDS_pept        complement(368368..369387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0322"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   beta subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="PFAM: ribonucleotide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82592"
FT                   /db_xref="GOA:A5VIB8"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIB8"
FT                   /protein_id="ABQ82592.1"
FT                   /translation="MKLEEFKPVNQYKAINWNEVSDMIDKATWEKLTEQFWLDTRIPVA
FT                   NDMDDWRELDDDHQWTVGHVFGGLTLLDTVQSEAGLTALKEDVKTPHETAVLNNIQFME
FT                   SVHAKSYSTIFSTLNTPDQIKEIFEWSDTEEYLQNKAVKIANMYLDPSQDPLKKKVANV
FT                   FLETFLFYSGFYTPLYYLGHNKLNNVAEIIKLILRDESVHGTYIGYKFQVGLRDRTEKQ
FT                   QQDMKDWMYNFLYELYDNEEKYTHLLYDQVGWTDDVLTFIRYNANKALMNLGQDPLFPD
FT                   TASDVNPVVMNGISTSTSNHDFFSQVGNGYRMGAVEAMNDSDYDVKDPNAGKDINACD"
FT   gene            complement(369502..371673)
FT                   /locus_tag="Lreu_0323"
FT   CDS_pept        complement(369502..371673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0323"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   alpha subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase, alpha
FT                   subunit; PFAM: ribonucleotide reductase large subunit;
FT                   Ribonucleotide reductase large subunit, N terminal domain
FT                   protein; Ribonucleotide reductase N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82593"
FT                   /db_xref="GOA:A5VIB9"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIB9"
FT                   /protein_id="ABQ82593.1"
FT                   /translation="MALSDIDMTKVKYYDYNNEVNIPKNGQIQLDKDKLALEDFIKNNV
FT                   EPNTKRFSSLKERFQWLEENDYIEETFMNKYSEAFIEKLYDYLKAQNFHFHSFMAAYKF
FT                   YAQYALRTNDKEYYLENYIDRVAMNALYLANGDEELAMQLADEIIHQRYQPATPTFLNV
FT                   GRKRRGEFVSCFAIQTTDDMNTIGRTINSALQLSKIGGGVGINLSNLREAGAPIKKIQG
FT                   AASGVVPVMKLLEDSFSYSNQLGQRQGAGVVYLSVFHPDIIEFLGAKKENADEKIRLKT
FT                   LSLGITVPDKFYELVEQNADMYLFSPYDVERVYGMPFSYVDITKEYNNLVANDDIRKKK
FT                   VNARDLEDEISKLQQESGYPYIINIDTENRDNPINGKIVMSNLCSEIAQVQVPAQVNDD
FT                   QSYSEMGIDISCNLGSTNIANMMESPDFGKSIKAMMRGLTRISDVEDLDVVPTIQNGNR
FT                   LAHSVGLGAMGLHSYLAKHHIQYGSPVAIEFTGVYFMLLNYWSLVASNEIAKERQETFH
FT                   DFENSKYADGSYFDKYVTKDWGPQSDVVKGLFEGIFIPGIEDWKKLKENVMQDGLYNQY
FT                   RLAVAPNGSTSYINDSTASLHPIINRVEERQEKMIGKIYYPAPYLSNDTMPYYRSAYDM
FT                   DMRKVIDTYAAAQQHIDQSLSMTLFMRSTIPAGLYEWKNGRTDKMTTRDLNILRHYAYK
FT                   RGIKSIYYIRTFTDDSDEIGANQCESCVI"
FT   gene            complement(371773..371994)
FT                   /locus_tag="Lreu_0324"
FT   CDS_pept        complement(371773..371994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0324"
FT                   /product="ribonucleoside-diphosphate reductase class Ib
FT                   glutaredoxin subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="TIGRFAM: glutaredoxin-like protein NrdH; PFAM:
FT                   glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82594"
FT                   /db_xref="GOA:A5VIC0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIC0"
FT                   /protein_id="ABQ82594.1"
FT                   /translation="MVTVFSKNNCIQCKMTKRFLEQHKISFIEHNIDEQPEYISQLKSE
FT                   GFMATPVVKLPNGQAFSGFRPDQLNQLA"
FT   gene            372252..372764
FT                   /locus_tag="Lreu_0325"
FT   CDS_pept        372252..372764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0325"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82595"
FT                   /db_xref="GOA:A5VIC1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIC1"
FT                   /protein_id="ABQ82595.1"
FT                   /translation="MKKNNSSLSEQQKFMKMAIAEAKQARILDEVPIGAIVVHDGQVIG
FT                   RGHNMREKFQDVTYHAEMLAIMEACTNLGSWRLEDCDLYVTLEPCIMCSGAIINARIKN
FT                   VYYGAADPKAGAVDSLYHLLSDSRLNHQVNVHSGILGDECSQMLKNFFREIRRRRKEAR
FT                   RKNKTNL"
FT   gene            372805..372894
FT                   /gene="ffs"
FT                   /locus_tag="Lreu_R0018"
FT   misc_RNA        372805..372894
FT                   /gene="ffs"
FT                   /locus_tag="Lreu_R0018"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT   gene            373037..374872
FT                   /locus_tag="Lreu_0326"
FT   CDS_pept        373037..374872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0326"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, subunits gamma and tau;
FT                   PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82596"
FT                   /db_xref="GOA:A5VIC2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIC2"
FT                   /protein_id="ABQ82596.1"
FT                   /translation="MSYQALYRVWRPQRFDDLVGQQIVTRTLKNAIITHQISHAYLFAG
FT                   PRGTGKTSAAKIFAKAVNCHHSKDGEPCNECEICKAITNGQLNDVIEIDAASNNGVEEI
FT                   RDIRDKAKYAPTQADYKVYIIDEVHMLSTGAFNALLKTLEEPPANVIFILATTEPHKIP
FT                   LTIISRVQRFDFRRISAEDAFNRMKYILDQKKVTYDEKALWVIANAAEGGMRDALSILD
FT                   QVLSFSDNEVKLDDALLVTGSVTKQLLKKYFLEISKHEGATALDTMKDILDEGKDGQRF
FT                   IEDLISFIRDILLYQESPSLISVESTGLKQEDFEEIVQLASSATLYRMIDELNNIQEEM
FT                   RFTTHPDVYLEVLTIKLAQIEPQKNLQSAPAVSADTNAEATKTIEKLQQEIQQLQQTVK
FT                   QLQNTPVRASRPSPRQQNEQPRVQQKKVQVNLNKIYPVLENATRQDLINVRELWGDMLN
FT                   LLSVPQRSLLHVSQPVAASAAGIIVAFDYPFLFQQAADDTTLLENMESALQRLTGNERQ
FT                   VVFVPKDKWPKIRQDFIKDHGFGKNQQKSQPITQKPQTTEESGQTPAATPAPMEEPPLP
FT                   PEDEALTEEKSPQEDKQVATAQKLFGSDIVKVEDN"
FT   gene            374893..375201
FT                   /locus_tag="Lreu_0327"
FT   CDS_pept        374893..375201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0327"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82597"
FT                   /db_xref="GOA:A5VIC3"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIC3"
FT                   /protein_id="ABQ82597.1"
FT                   /translation="MMRGMNMQQMMKQAKAMQKKMMAEHEELAKQEFVGKAPDDMVTAT
FT                   FSGDNQLIDLKIKPEAVDPDDIDMLQDLVIAAVKDGMKQVNDATQQKLGKYTQGMGL"
FT   gene            375205..375807
FT                   /locus_tag="Lreu_0328"
FT   CDS_pept        375205..375807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0328"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: RecR
FT                   protein; TOPRIM domain protein; SMART: Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82598"
FT                   /db_xref="GOA:A5VIC4"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIC4"
FT                   /protein_id="ABQ82598.1"
FT                   /translation="MIQYPEPLAKLIESYTKLPGIGQKTATRLAFYTLSMQEDDVTNFA
FT                   KSLLSAKRDLHNCSICGNITEDDPCPICRDKTRDHSQILVVEQSQDVMAMERMHEYHGL
FT                   YHVLHGVISPVAGTGPEDINITSLLKRLKKDDEVKEIIIATNASSDGELTAGYLAKLIK
FT                   PAGIKVTRLAHGLSVGADIDYADEMTLFKAVQGRTEM"
FT   gene            375812..376060
FT                   /locus_tag="Lreu_0329"
FT   CDS_pept        375812..376060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82599"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIC5"
FT                   /protein_id="ABQ82599.1"
FT                   /translation="MFFKRPTKEVERERNQRLLEAVYSTKASWDHARETERAVYEANVN
FT                   SELHYRSRIQEQKFLYLYKIARKFKVHGKLNDGVIDR"
FT   gene            376070..376711
FT                   /locus_tag="Lreu_0330"
FT   CDS_pept        376070..376711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0330"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82600"
FT                   /db_xref="GOA:A5VIC6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIC6"
FT                   /protein_id="ABQ82600.1"
FT                   /translation="MDGKFISFEGPDGAGKTSVIQQIQLELEDQLGTEKVMYTREPGGN
FT                   KISEQIRQVLFDGQNTDMDGRTEALLFAAARRQHIVSEIIPGLKAGKVILCDRFVDSSI
FT                   AYQGAGRGLGEKEIWQINQFAIDGLMPALTIYLDIESEIGLKRIAEHRSNQVNRLDEEK
FT                   LEFHRTVRQSYLKLYQNYPERIELIDASQPLEKVIEDVKATIHDRFSDLF"
FT   gene            376731..377054
FT                   /locus_tag="Lreu_0331"
FT   CDS_pept        376731..377054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0331"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82601"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIC7"
FT                   /protein_id="ABQ82601.1"
FT                   /translation="MKMIIAIVQSKDSNRLRKAFNKADIHVTQLSTTGGFLREGNATFL
FT                   IGIEDDRVQEVLSVIKKNAESREQYVTSQMHMDVEGGSAFPVNVKIGGATVFVLPVEDF
FT                   IKF"
FT   gene            377069..378082
FT                   /locus_tag="Lreu_0332"
FT   CDS_pept        377069..378082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0332"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82602"
FT                   /db_xref="GOA:A5VIC8"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIC8"
FT                   /protein_id="ABQ82602.1"
FT                   /translation="MAEQGQTRAEKLQPAIITRFQKILSNNELAHAYLFVGPGGSGKMS
FT                   IAQWLSLRLFCLHPQDNEPDLTCAECQRILSGNHPDIVYAAPEGRQIKVDEIRRLKAEF
FT                   SKSAVEGNKKIFIIKDADKMTNGAANSLLKFIEEPGAGVYIFMLTTNKSAVLPTIRSRT
FT                   QVIELPPLKRDALLTVLTEHNIPQSQQQIAVGITDSVAMIEQWQEDNWFESAIKGVIQW
FT                   YQDTTRNGMLGFVDVQTILQKVATDRDKQQVVLDLITLIWRDTLMVNSGITAANRLHFN
FT                   NILGEMGEVVRKYSPQQLLAASQLTLETRHMLEQNISFQNIVEQLTIRLVQVLSIS"
FT   gene            378093..378443
FT                   /locus_tag="Lreu_0333"
FT   CDS_pept        378093..378443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0333"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82603"
FT                   /db_xref="GOA:A5VIC9"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIC9"
FT                   /protein_id="ABQ82603.1"
FT                   /translation="MSEEYSSDNLYEQFAQVMNQTQDLVKKMEQLQAKIIAISEENVEL
FT                   SIENKHLRQMIKEKQPHHSENQLSGSRQNLKELYQQGFHVCSEYYGKRLEPNESCTFCL
FT                   DAIFGHEQGMTK"
FT   gene            378452..379318
FT                   /locus_tag="Lreu_0334"
FT   CDS_pept        378452..379318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0334"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82604"
FT                   /db_xref="GOA:A5VID0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5VID0"
FT                   /protein_id="ABQ82604.1"
FT                   /translation="MQQISSFNDHQSGSLYLVPTPIGNLDDMTFRAIKTLKEVDLIAAE
FT                   DTRHTQQLLNHFDISTRQISFHEHNTEQRVPELIEKLKAGYSIAQCSDAGMPSISDPGK
FT                   ELVAAAVREGLPVIPLPGANAGLTALIASGLVPQPFYFFGFLERKHQQQVTALEQLKER
FT                   KETMIFYEAPHRLKKTLATMAEVFGNERRVVLARELTKRYEEFTRGTLAEVTAWFEDHQ
FT                   PRGEFVILVAGNEHPTEKTDNEIELPLTEQVDKEILNGLSTNAAIKLVAKKNNIKRQEL
FT                   YKQYHQL"
FT   gene            379328..380089
FT                   /locus_tag="Lreu_0335"
FT   CDS_pept        379328..380089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0335"
FT                   /product="acyl-ACP thioesterase"
FT                   /note="PFAM: acyl-ACP thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82605"
FT                   /db_xref="GOA:A5VID1"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5VID1"
FT                   /protein_id="ABQ82605.1"
FT                   /translation="MELKQEAQTFEMPHLLTYYECDETSHPSLSMILSMISMVSDEHSM
FT                   SLGMGTKEIQSTGGTWVVSGYEGHLSAKQPSFGETVILGTKAVSYNRFFAVRDFWITGK
FT                   EHQIEYARIRSIFVFMNLKTRRMQSIPPALIEPFNAPVAKRIPRLKRPQKLDENASVIK
FT                   KNYQVRYFDLDANHHVNNARYFDWLLDPLGRDFLRGNQIKRFNLQYLQEVRNGEMVESK
FT                   VNKLQTNDEKVTYHQIGVGEQIDAIAEIEWY"
FT   gene            380254..381768
FT                   /locus_tag="Lreu_0336"
FT   CDS_pept        380254..381768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0336"
FT                   /product="Exopolyphosphatase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82606"
FT                   /db_xref="UniProtKB/TrEMBL:A5VID2"
FT                   /protein_id="ABQ82606.1"
FT                   /translation="MKRSLTAIIYLEPDQVNLRIIEIPTLKVINNVRSGLLNIGNAKVA
FT                   NYSENMTTIVNNIEGFKQIINDYQATPVKFYGDLEDLDPVATRYVADQLEVRTGLQIEW
FT                   LNNNQLMAQSMSYLLTLLPDFEKLSKHNMYLLSIGLSSTTLAYFHHGSFERAWDIDLGN
FT                   AKISQLVGRLRKTATNPTEIIQDYISSKLEYLTPELTKKKHTVMMVQNALSLNKLFLPH
FT                   DQQIAEVPLDKFHDDYQKILSPVKDGLMKSIQIDDQQFELLLPNYLVTARTVRLIQPAG
FT                   LYVTDISTMDGISHGIGVDNPKTRRQINEMIRTAADNISSRYGVDSAHRDFVTRFSLQL
FT                   FDQLRPIHRLGQHERLLLEIASRIDDIGNFINQRGHYRHSAYIMEANPLIGLSDKDNRI
FT                   IAEVARYHSAESPDISQAHYRHLDDEIQMPVAKLAAILRLVDALDDSRLQKISSIKLKL
FT                   VGDSRLIIKAIANDDLVLEKWSFSKKSQLFKDVYGIEPVLTERSDH"
FT   gene            381770..384013
FT                   /locus_tag="Lreu_0337"
FT   CDS_pept        381770..384013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0337"
FT                   /product="Polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /note="PFAM: Polyphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82607"
FT                   /db_xref="GOA:A5VID3"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:A5VID3"
FT                   /protein_id="ABQ82607.1"
FT                   /translation="MYKEFYKPQNYVNRELSWIDFNGRVLGEATDTANPLLERANFLGI
FT                   TQSNVDEFFMVRVASLHKLAAANVTTTDASGLTPEEQLDAVNEKEHRMVKQRYEVYNQQ
FT                   IIPDLAKNNIHILHVPKLDEKQYEFIRRYFNDELMPVLTPMADDASRPFPFISNNSLNI
FT                   AVQLRRQIHPTSKPVAEEILEGDQEVHRPQIEPHDDRQEADIKFATVRVPEIYKRLVRL
FT                   PGENNFILIDEIITEFLTALFPGYEILATASYRVMRDMDLDVAEEDTSDLLRAVKRQLR
FT                   EREHGRVMRLEVPASIDEWLKDQLIDNLHVSERSLYEVDGPVDLTFLKKLSGMVDGHDD
FT                   LRYPPYKPYLNPALDMDHNIFSSIRQKDYLMQHPYDNFQAVVNFIHQAAIDPDVLAIKM
FT                   TLYRVSGNSPIIKYLGMAAQQGKQVTVLVEVKARFDEQNNVRWAQRLEQMGCHVIYGLV
FT                   GLKTHCKVALVIRRDEDGLRRYMHLGTGNYNDVTAHFYTDMGLFTCDHELGIDMTNLFN
FT                   MLSGFARPAYFNELRVSPDGIRTFINAKIDEQIENAKNGNPALIRMKMNSLSDKQIIAR
FT                   LYAAAASGVKVELLIRGITCLRNDLPELHGNIEVHSIIGRFLEHSRIYYFKSNGHEEVY
FT                   LASADMMTRNLNRRVEELYPVTQPDTKAHAIHIFDVMWKDNVKARRLVGDHYERIDRGD
FT                   AAPFSSQEYFVKQAMKLNAREKKEKKAKKHFSSVFETLTRHVPNLHLDERKDE"
FT   gene            384017..384988
FT                   /locus_tag="Lreu_0338"
FT   CDS_pept        384017..384988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0338"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82608"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A5VID4"
FT                   /protein_id="ABQ82608.1"
FT                   /translation="MSNEQYLAILDLGSNSVRLKITKIQDNGSFETVQYEKRYVRLASN
FT                   MGPEKMLKSTPVKRTIDALKEFRAICDRYRNKNLTIIAVATAAVRQAQNQLQFLEKVQR
FT                   ETGFEIHVISGEREAYLDYVGVNQTLPIDKGIIIDTGGASMELISVNNGEAEKAVSIPI
FT                   GSVSISQTYHLEDQINPADLFDAMVKIDEVLSQQLWLNRMRETKIVALGGCNRALAKVY
FT                   RWQQALNPDEVRPVHGLTMRSEEAFLIMRQLLEADRQTRAGIRGITKVRADVIVGGLLP
FT                   LISLVRQLSINEISFSNSGLREGLLFKYLEQQINFNQLKSSL"
FT   gene            385100..386095
FT                   /locus_tag="Lreu_0339"
FT   CDS_pept        385100..386095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0339"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82609"
FT                   /db_xref="GOA:A5VID5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VID5"
FT                   /protein_id="ABQ82609.1"
FT                   /translation="MSILVAGGAGYIGSHMVKDLIENGEDVVVADNLSTGHRDAINPKA
FT                   KFYEGDIRDRQFLDKIFDNEDITAVVHFAAFSIVPESMSKPLKYFDNNTGGMITLLEAM
FT                   HDHDIKYIVFSSTAATYGVPEHMPIKETDPQKPINPYGLSKLMMEEMMDWADKAYGIKF
FT                   VALRYFNVAGAAPDGTIGEDHGPETHLVPIILQVAQGKRDELSIFGDDYNTPDGTNVRD
FT                   YVHVMDLADAHILAIKYLQEGNKSNAFNLGSSTGFSNKQMLEAAREVTGQPIPAKMAPR
FT                   RPGDPDSLVAASDKARNILGWSPKYDDVHDIIATAWKWHSTHPKGYDDRD"
FT   gene            386175..387551
FT                   /pseudo
FT                   /locus_tag="Lreu_0340"
FT   gene            387728..388453
FT                   /locus_tag="Lreu_0341"
FT   CDS_pept        387728..388453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0341"
FT                   /product="peptidase M22, glycoprotease"
FT                   /note="PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82610"
FT                   /db_xref="GOA:A5VID6"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A5VID6"
FT                   /protein_id="ABQ82610.1"
FT                   /translation="MKILAIDTSNHPMSVALVEDEQLLATTTLNMVRNHSIYLMPAISK
FT                   LFELVQWQPTDIDRVVVAQGPGSYTGVRIAVTTAKVLADTEKIDLVGVSSLAVLARNVI
FT                   PTASAIIVPFFDARRGNVFAGAYQWENGKLINKIEDQHLGIDVLLEQLARLGQQVVLVG
FT                   HMTDKIQAKYDQLPANVTLLPRSYSIPSTYQLALAGETKEPVKEIDPFVPHYLRITEAE
FT                   ANWQKLHPGEKRKNYVREV"
FT   gene            388437..388991
FT                   /locus_tag="Lreu_0342"
FT   CDS_pept        388437..388991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0342"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82611"
FT                   /db_xref="GOA:A5VID7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5VID7"
FT                   /protein_id="ABQ82611.1"
FT                   /translation="MFEKFKEWFVNTTNPTKRPTLDFTRRVVMISGHQYVVRMAKEQDI
FT                   QTLVEIEERIYGKAPWSYAAFRIELQRPCDRLYLVIEDDQQIVGFMGTAIDWYHYDLHI
FT                   TNIGITPSYQNKGIGTYLISTAKNYARHLKLHSMSLEVRVHNVSARRLYESLGFRNQHI
FT                   KPRYYLDNHEDAVDMQANLLR"
FT   gene            389010..390041
FT                   /locus_tag="Lreu_0343"
FT   CDS_pept        389010..390041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0343"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: putative metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82612"
FT                   /db_xref="GOA:A5VID8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VID8"
FT                   /protein_id="ABQ82612.1"
FT                   /translation="MTERTLTLAFESSCDETSVAVIENGTKILSNIVATQIDSHQRFGG
FT                   VVPEVASRHHIEQITKCTNEALEQADVDYNDLDAVAVTYGPGLVGSLLIGVTAAKAIAW
FT                   AHNLPLVPVNHMAGHIYAARYVGEFQYPQMALLVSGGHTELVYMPSEHEYQIIGETRDD
FT                   AAGEAYDKIGRVLGVNYPAGKTIDEWAAKGKDTFNFPRAMEKEDNYDFSFSGLKSAFIN
FT                   TVHNADQRGEKLDKYDLAASFQQSVIDVLAEKTMRALDDYPVKQLILAGGVAANHGLRA
FT                   RLDHDMKEFHPDVPMLQAPLKLCGDNAAMIGAAGYVNYKHGDRAGLDLNAVPGLMFDRI
FT                   QSK"
FT   gene            complement(390158..390931)
FT                   /locus_tag="Lreu_0344"
FT   CDS_pept        complement(390158..390931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0344"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="TIGRFAM: pyrroline-5-carboxylate reductase; PFAM:
FT                   NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82613"
FT                   /db_xref="GOA:A5VID9"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VID9"
FT                   /protein_id="ABQ82613.1"
FT                   /translation="MKITIIGVGNMGSAIMKGLSRTQNFTLSAMNPVNSRVTSLAEKLG
FT                   FKLVNTNSEVVNLTPDIVILTTPAPITTAVAKELAVLNDHTIFISAAAGITHADLAKVL
FT                   PNKEIVNIIPNTPVEVNAGTIGLALPTGISAEAISKVMTVLDSLGDVIEVPERQLDIIG
FT                   VIGGCGPAFVDVMMDAMSDAAVKYGLDRQTAYEVIASMVKGTGTLAYDSKLAPALLRDQ
FT                   VTSPAGTTIKGVEALEKNGFRYAVMDAVDKANGES"
FT   gene            complement(390949..392193)
FT                   /locus_tag="Lreu_0345"
FT   CDS_pept        complement(390949..392193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0345"
FT                   /product="glutamate-5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82614"
FT                   /db_xref="GOA:A5VIE0"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIE0"
FT                   /protein_id="ABQ82614.1"
FT                   /translation="MNQDLIAIGKRAQNAANKLALMNTATKNKALLQLADDLIKNKNQI
FT                   IAANQQDLAAATQMPTKFTDRLMVNSQRIADMANGLRTIADLNDPTSQIDKGWITKDGL
FT                   QILQRRVPLGVIGIIFEARPNVTVDATGLTFKSGNAVILRGGKEAIQTNTALVKILRES
FT                   LQSQHLPVDAVQLITDTSHAIADEMMNLTDYIDVLIPRGGRALIQRVVTTATVPVIETG
FT                   AGNCHIYIDKDADLTMATNITVNAKVQRPSVCNAAEKLLIHRDIAAKFLPVIAKALMEH
FT                   GVQLRGDETACQLVSTIRPVTEEDWDTEYNDLIMAVKIVDSLDDAISHINHYSTHHSES
FT                   IITNNITRGRYFQQAINSACVYVNASTRFTDGGEFGFGAEIGISTQKLHARGPMGLQQL
FT                   TTIKYEITGNGQIRK"
FT   gene            complement(392205..392993)
FT                   /locus_tag="Lreu_0346"
FT   CDS_pept        complement(392205..392993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0346"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82615"
FT                   /db_xref="GOA:A5VIE1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIE1"
FT                   /protein_id="ABQ82615.1"
FT                   /translation="MTHKIQKAVVKIGTSSLVLPNGKINLRTIDQLSFVLATLNNQGYQ
FT                   LILVSSGAIGVGLASLGLKDRPAEIAQQQALASIGQAALMRIYSQRFLDYQTHVAQLLL
FT                   TRDVLTYPISRQHTLNTINTLLQQNVIPIVNENDPVSVDELDHYTTFSDNDELSSQVAV
FT                   AIDADELIILSDIDALYDKDPHKFSDAHIIKEVPVLTPEIENAASGSSTRFGTGGMVTK
FT                   LRAAATMMQAGKQMILCNGRDPKILFDIFDGHTIGTHFGK"
FT   gene            393587..394372
FT                   /locus_tag="Lreu_0347"
FT   CDS_pept        393587..394372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0347"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82616"
FT                   /db_xref="GOA:A5VIE2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIE2"
FT                   /protein_id="ABQ82616.1"
FT                   /translation="MRRKVALAQLDIQLGNPAENYQKAKQAIEEAANHHADIVVLPEMW
FT                   NIGYALDQLAELADENGQKTQQFFSELALKNQINIVGGSVAVRNGQSFFNTTYVYDQNG
FT                   NLISSYEKVHLFGLMNEDQYLEAGQKENHFKLAGIPSASFICYDLRFPEWIRTVARYGT
FT                   DILYFPAEWPSKRIEQWKIMLRSRAIENQAFVVAVNRVGTDLENSFNGHSLVIDPLGQV
FT                   IHDAGEVEQVSYAEIDLAQLAQVRGPIPVFKDRRPSLYH"
FT   gene            394386..395564
FT                   /locus_tag="Lreu_0348"
FT   CDS_pept        394386..395564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0348"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82617"
FT                   /db_xref="GOA:A5VIE3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIE3"
FT                   /protein_id="ABQ82617.1"
FT                   /translation="MNFEQSKLLDTLPKQFFANLVAKVNKKIGEGVDVINLGQGNPDKP
FT                   TPDYIVKSTQKWVADPQTHKYSLFRGLPAFKEAAAKFYSEKYGADFDPEKEVAILGGSK
FT                   IGLVELPWALMNPGDTFLLPDPGYPDYLSGAALGEVNFETVPLLAENNFLPDLEAIPEE
FT                   VAQRAKFFYLNYPNNPTGAVATPEFYRKLVAWAKKYHVGIISDFAYGAIGFDGQAPVSF
FT                   METPGAKDVGIEFYTFSKTFNMAGWRIAFAVGNADIIEALNLIQDHLFVSLFPALQEAA
FT                   IDALTLPQRDAAIAEIVGRYEERRNAFINAAEKIGWHAFTPQGTFYAWMPVPKGYTSES
FT                   FADLLLDKAGVAVAPGNGFGKHGEGYVRIGLLIEPARLTEAVERIAKLNLFN"
FT   gene            395578..396543
FT                   /locus_tag="Lreu_0349"
FT   CDS_pept        395578..396543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0349"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   Ketopantoate reductase ApbA/PanE, N-terminal domain
FT                   protein; Ketopantoate reductase ApbA/PanE, C-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82618"
FT                   /db_xref="GOA:A5VIE4"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIE4"
FT                   /protein_id="ABQ82618.1"
FT                   /translation="MALKYTVLGAGAMGLRFGVLLQELAGAKVDFVDNWAPQVETIKQQ
FT                   GGVYVSRDHENRHLVPINIYSPEEYDWAPDVLIVFAKQMTLSDLLQRSAHFFRPDHQYV
FT                   FSGMNGMGHIEKINHYFPKEHVVAGTCLIGTVLNKAGDVDFIGKSGAGSINLAPQVGEP
FT                   DERVKQIVEDFTTANINPHLNDNFYGTLLTKVVFNSVINTICTLFEIQMGQFIDYDGAE
FT                   KLGKQLINEAFDVAERAGIQLLSTREEEWQTIKYVSEVTNPLHYPSMYQDMSKNRPTEV
FT                   DYINGYIYDLGKKYNYEASTHDFLRNLVHLAENTRKFRQN"
FT   gene            complement(396620..398230)
FT                   /locus_tag="Lreu_0350"
FT   CDS_pept        complement(396620..398230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0350"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82619"
FT                   /db_xref="GOA:A5VIE5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIE5"
FT                   /protein_id="ABQ82619.1"
FT                   /translation="MYQNYTIGQTEFVLNYNYDLPQNHVARLISDFVDSIPQDVLLEDS
FT                   GAATGRPLSHPAIMLKILLFAYSRQTYSGRKIEMMLDENLPMRWLAHDYTYSYHTINNF
FT                   RRSQHASKLIKHAFVYFTMTLKDHGLIQNDAVFIDGTKVEADANKYSFTWRRAVEKYHA
FT                   KLREKTSKLYEELVEKQVVQEMAPELVTSAEGMEVMEQELAEKITKLDEKIKQEPKIIK
FT                   GGSVRKRRRRFLKKLRHQLSNDLIPRAQKYERAENIFQGRNSYSKTDHDATFMCMKEDP
FT                   MMNRELKPGYNLQIATHKQFVLDYGLFSNPTDTRTLVPFLTQFHALDFFEHIVADAGYG
FT                   SEYNYTMILDRFEKQPVIPYTTYQKEQKRKFKNDPTRSQNWEYNANDDYYIDHQGVRFS
FT                   FYRYSKSTDKYGFKRDFKIYRADKHQLSVKLDELAKTPGGRQRYMKVNPTWNYYKAKVK
FT                   DALSSDEGKAIYRRRKFDVEPVFGHMKRDFGIRRTHLRGQRAVENDIGLALMALNLTKF
FT                   GQSISRLETNFINNLKSGL"
FT   gene            complement(398374..400311)
FT                   /locus_tag="Lreu_0351"
FT   CDS_pept        complement(398374..400311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0351"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82620"
FT                   /db_xref="GOA:A5VIE6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIE6"
FT                   /protein_id="ABQ82620.1"
FT                   /translation="MLLLQTNDVVRRFGADVLFHNMNMQIQEHGRTALVGRNGAGKTTL
FT                   LKMIAGITEPDEGTITKVKDLTIGYLAQDQGLDSQNSIWTELDTVFAPLHKMETQIHDL
FT                   EQQLADLDSSESNYQQILSTYDNLQTAFKKRGGFEYESRMRGILHGFGFGEDSYDTPIN
FT                   SLSGGQKTKLALAKILLQAPGLLILDEPTNHLDMNVLSWLEDYLKSYQGALLIVSHDRY
FT                   FLDRVVSDVYDLDNKTLTHYTGNYTQFVKHKQERLQAEWKHYDQQQKKIAKLEDFVNRN
FT                   IVRASTTKRAQARRKQLEKMERLERPETDDKSIHFQFHSEKDSGNEVLDVEQAKVGYDE
FT                   QILAGPLSFNVRKPQRVGIIGPNGIGKSTLLKSILHKIPLISGTIKLGANLDIGYYDQE
FT                   QQQLHPNKTVLEEVWDDHPEVPEKDIRSLLGSFLFVGDDVYKVVHDLSGGEKARLELTK
FT                   LSFKPINFLILDEPTNHLDIDSREVLENAINEFSGTVLFISHDRYFINQVATDILAMEH
FT                   DGIKHYEGNYDDYLVAKEKESSPKATSHNSNTIAKAPAGKQSYQQSKEQQRARRKIQRQ
FT                   VDELEQQMTELEEKQTAIQEQMSQPEIATDIGKLTDLQKELDELSAKSEEVELAWTEAA
FT                   EKLEEFDQEN"
FT   gene            400552..401196
FT                   /locus_tag="Lreu_0352"
FT   CDS_pept        400552..401196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0352"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82621"
FT                   /db_xref="GOA:A5VIE7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIE7"
FT                   /protein_id="ABQ82621.1"
FT                   /translation="MANKKIPRATAKRLPIYFRYLNVLKDANKQRVSSTELSEAVQVDS
FT                   ATIRRDFSYFGELGKRGYGYDVESLLKFFKGILHQDSLVSVALVGVGSLGSALLNFNFH
FT                   QDTNLRISAAFDTKPEYANTVKSGIPIYPSEDMVKQLKEQQIDVVILTVPGIKAQHVAD
FT                   QLVEAGVKGILNFTPVRLSVPKNVQVQNIDLTNELQTLIYFIKNYTEDSIK"
FT   gene            401431..401715
FT                   /locus_tag="Lreu_0353"
FT   CDS_pept        401431..401715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0353"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82622"
FT                   /db_xref="GOA:A5VIE8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIE8"
FT                   /protein_id="ABQ82622.1"
FT                   /translation="MLKPLGDRVVLKAETEEEKTVGGIVLASNVKEKPTTGKVIAVGEG
FT                   RTLENGQKLAPAVKEGDRVLFDKYAGNEVEYNGEKFLVVHAKDLVAIVE"
FT   gene            401807..403435
FT                   /locus_tag="Lreu_0354"
FT   CDS_pept        401807..403435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0354"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82623"
FT                   /db_xref="GOA:A5VIE9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIE9"
FT                   /protein_id="ABQ82623.1"
FT                   /translation="MAKEIKFSEDARSAMLSGVDKLADTVKTTMGPKGRNVVLEQSYGT
FT                   PTITNDGVTIAKSIELENQFENMGAKLVAEVASKTNDIAGDGTTTATVLTQAIVNAGMK
FT                   NVTSGANPVGIRRGIDKATEVAVEALKKMSHDVKTKDDIEQIASISAANPEVGKLIADA
FT                   MEKVGHDGVITIEDSRGVDTSVDVVEGMSFDRGYMSQYMVTDNDKMEADLDNPYILITD
FT                   KKISNIQDILPLLQSVVQEGRALLIIADDITGEALPTLVLNKIRGTFNVVSVKAPGFGD
FT                   RRKAQLQDIAVLTGGTVISDDLGMSLKDATVDQLGQANKVTVTKDTTTIVDGAGSKEAI
FT                   QERVDQIKQEIAKSTSDFDKEKLQERLAKLSGGVAVVKVGAATETELKEKKYRIEDALN
FT                   ATRAAVQEGFVPGGGTALINVIPALDKIEADGDELTGINIVKAALEAPVRQIAENAGVE
FT                   GSVIVNELKNEKEGIGYNAADGKFEDMIKAGIVDPTMVTRSALQNAASVSALLLTTEAV
FT                   VADKPDPNANNQAPAAPQGGMGGMM"
FT   gene            403529..404017
FT                   /locus_tag="Lreu_0355"
FT   CDS_pept        403529..404017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0355"
FT                   /product="Ala-tRNA(Pro) hydrolase"
FT                   /EC_number="3.1.1.-"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82624"
FT                   /db_xref="GOA:A5VIF0"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="InterPro:IPR040285"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIF0"
FT                   /protein_id="ABQ82624.1"
FT                   /translation="MTKNATSVYKYLDNEKINYQIVTHPPVYTAEQADKYVQEYQFART
FT                   KNLFLKNKAGYYLVTILENKRLNMKKLKENLSTSRFSFARPEELAMKLGITSGAVSPFN
FT                   LFNDKQHQVTFIIDADIFKNEDLIGCHPNINTATVILGIKDLLQIIKQNGNPVKAVQL"
FT   gene            404099..405709
FT                   /locus_tag="Lreu_0356"
FT   CDS_pept        404099..405709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0356"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82625"
FT                   /db_xref="GOA:A5VIF1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIF1"
FT                   /protein_id="ABQ82625.1"
FT                   /translation="MEKMKFQKITLFSGVMLALNSLIGSGWLFGAGTAAKVAGPAAILS
FT                   WILGAIIIISIALTYVELGAMFPESGGMSRYAQYSHGPFLGFIAAWANWISLITLVPME
FT                   AVASVQYMSSWPWAWANWTHHFMKNGNITTPGLLVVFGFMLVFTLINFWSVKLMTRFTN
FT                   LISIFKILLPTLTIVMLIVAGFHPSNFGHSVTTFMPYGSRSIFEAAAISGIIMSYDAFQ
FT                   TVINMGGEMINPHKNIVRGVLISMIITAVIYVMLQVAFIGAIDPNLLAQKGWHGINYTS
FT                   PFADIAILLGMNWLAILLYMDAFVSPFGTGVAFVATASRALAAMTHTGHLPQWLGRLER
FT                   RYMIPRFAMVVDLILAVVMVSLFRNWSLLATVITGSTLIAYLTGPVTVMSLRKMDANLK
FT                   RPFHPHFMSWLAPFAFVLTSLSIYWTMWPTTVQVIGVILLGLPIYLYYEVKYRHASGLR
FT                   DLRNSYWMLAYLVFISIVSYIGSEGFGGKDWLKYPWDFVVIIICSLGFYRWAVASRMKK
FT                   IDPAAEKVNAKVKMPEKDQ"
FT   sig_peptide     404099..404206
FT                   /locus_tag="Lreu_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.255 at
FT                   residue 36"
FT   gene            405794..407632
FT                   /locus_tag="Lreu_0357"
FT   CDS_pept        405794..407632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0357"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82626"
FT                   /db_xref="GOA:A5VIF2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIF2"
FT                   /protein_id="ABQ82626.1"
FT                   /translation="MWRYLKRVLIGKPLKTLDEGQTHLTKFKALAMLSSDAISSVAYGP
FT                   EQITTVLVTLSAAAIWYSIPIAAVVLVLLLAITLSYQQIIHAYPSGGGAYVVATRNWGS
FT                   NGGLFAGGSLLVDYMLTVAVSTTSGVEAITSAVPALYKFSIPIGIVIVLLIMFMNLRGM
FT                   SESANFLTIPVYFFVIMMIVMVVWGGYNIATGHIHYRAIVDYGTPVSGMSFVLLIRAFS
FT                   AGSSSLTGVEAVSNAVPNFNKPKEKNASTTLAIMSAILAFFFIAVIFFSFYLGVVPNSR
FT                   TTILSQMAAQIFGGHGLGFYLLQLSTAMILAVAANTGFSAFPILAFNMAKDKYMPHAFM
FT                   DRGDRLGYSNGIISLAIGAIILILIFHGQTNMLIPLYAVGVFVPFTLSQSGMIIHWFRE
FT                   REGFWLGKAFINLVGALISFVLVICLFWQHFANVWPYLIIMPLLLWMFHSIHRHYVKVA
FT                   AQLRVAEKTKVQLHDYDGATVIVLVGNVTRVTRGAINYARSIGDYVIAMHVSFDENPGK
FT                   EHKTANEFKAEYPDVRFVDIHSSYRSIAKPTLRFVDVIAKRAEARNYSTTVLVPQFIPK
FT                   HPWQLALHNQTSVRLRALLNSRENIIVASYNYHLQE"
FT   gene            407659..407919
FT                   /locus_tag="Lreu_0358"
FT   CDS_pept        407659..407919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82627"
FT                   /db_xref="GOA:A5VIF3"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIF3"
FT                   /protein_id="ABQ82627.1"
FT                   /translation="MNKKQLLWGLLFAIGLFMAASYTIDNRGFHSGIYGIIGCALILIA
FT                   YAGMNWEKLQSKDRHTRKILLLLSSILGIIIVLDIAEIILG"
FT   sig_peptide     407659..407730
FT                   /locus_tag="Lreu_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.593 at
FT                   residue 24"
FT   gene            408038..408448
FT                   /locus_tag="Lreu_0359"
FT   CDS_pept        408038..408448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0359"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82628"
FT                   /db_xref="GOA:A5VIF4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIF4"
FT                   /protein_id="ABQ82628.1"
FT                   /translation="MLIGRLVKQANNAMNQEMNAFAQQYGLTGTQMSIIDFLTHFPGNS
FT                   CDQHQIENEFGIKRSTTTVLLQRMAKKNLIERYPSPEDRRQKIVTLTAEGQKLSSDVSA
FT                   YITQYEEKLKADFSEQDISKIKRFLSTMIKEK"
FT   gene            408448..409833
FT                   /locus_tag="Lreu_0360"
FT   CDS_pept        408448..409833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0360"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82629"
FT                   /db_xref="GOA:A5VIF5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIF5"
FT                   /protein_id="ABQ82629.1"
FT                   /translation="MNTNTKKISAKVIAAIVATGLMSFCGVIVETSMNVTFSILMREFS
FT                   ITTNQVQWMTSIYLLLVAIIVPLSAILKSSYRTKTLFTVASLFFIGGIIIDALAPSFWL
FT                   LLVGRAIQGIGTGIALPLMFNIIMEQVPTGKIGFMMGIGNLITGVAPAIGPTFGGIIAS
FT                   KLNWRWVFYLLIPLLIISFLLGEWGITQKSPIEKQQIDIFSMLMIVFMFCGFVTGFSNL
FT                   GSQPFMTFSVGGALLIGILGMGLFAWRSLILEEPILQLRLFRNKNFSGHVLGFFLTQLI
FT                   SLGFAFLLPNYIQLVNGNSAMIAGLIVLPAGFAGAIFAPLGGRILDKFGARKPILIGTS
FT                   LCLIALIAFTIYGQHLTSTFIALVYILYMGGMGMCMGCVMTSALTVIGKEKQSQGNAIL
FT                   NTLQQFAGAIGTSLVAMIVAANQSHLNVVRRVSTAIGTQEAFGMLTVFCIIIWISYYRS
FT                   VKK"
FT   sig_peptide     408448..408537
FT                   /locus_tag="Lreu_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.931) with cleavage site probability 0.444 at
FT                   residue 30"
FT   gene            complement(409876..410508)
FT                   /locus_tag="Lreu_0361"
FT   CDS_pept        complement(409876..410508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0361"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82630"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIF6"
FT                   /protein_id="ABQ82630.1"
FT                   /translation="MTEPYLTIAKNTTYEQTIKKSRFICSIARVSSEEEAQQFIASIQA
FT                   VNKKATHNCFAYMIGDNDQIQRESDNGEPSGTAGIPILESLKLAKIHNVVAVVTRYFGG
FT                   IKLGAGGLIRAYSNTTTEAIHQAGLIQRIKQAILKITVTYALHDPLLYYLKENNLEVAG
FT                   EEYGVNVETSIYVNETDLKNVKEKLINRFNNQLQITEGDQRFNEIPY"
FT   gene            410570..411901
FT                   /locus_tag="Lreu_0362"
FT   CDS_pept        410570..411901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0362"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein, res subunit; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82631"
FT                   /db_xref="GOA:A5VIF7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIF7"
FT                   /protein_id="ABQ82631.1"
FT                   /translation="MDLDNYYGRRVLVPRHELIQSGIQELPTIRIDTANIRCYRCNYVT
FT                   EKSLGALPRGEFYCPHCINLGRVSTLNKFYHVPEPNQFTVTEPVLTWKGKLSPLQQQAS
FT                   EKISQGMADHVQQLLWAVTGAGKTEMMFAGIAAAIKRGERIGIASPRVDVCLELFPRLK
FT                   AAFANCDIALLHGRQELPYHYAQLTICTTHQLLRFYHAFDNLIIDEVDAFPYAANASLL
FT                   YATKQAIKENGGCLYLTATPGDALLREIKSKRLVVNYLPLRYHGHLLPQIKVRLAFGWR
FT                   RRLERQQLPPQVIQQLQETLREGHRFLLFIPHIADLALVEAALRHSFATFRFATVHASD
FT                   PERLEKVQKMRDGDYDFLVTTSILERGVTFPEIDVYVLGADDPVFSSSALVQIAGRAGR
FT                   AQSRPTGRVVFWINCNCRQVNQAISQVKYLNRKGQRLIDGVSFV"
FT   gene            411882..412562
FT                   /locus_tag="Lreu_0363"
FT   CDS_pept        411882..412562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0363"
FT                   /product="amidophosphoribosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82632"
FT                   /db_xref="GOA:A5VIF8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIF8"
FT                   /protein_id="ABQ82632.1"
FT                   /translation="MECLLCNKRISFQLSLKDIFSFREIIMPVLCAKCKESFVRWDDHG
FT                   CAGCGRNNTGKNSSLCADCQTWKKLYGWYLHHRGLYRYNEAMKEYMQRYKFNGDYRLRE
FT                   VFQRELSKVVNEQKADLIVPIPVTSTTMQTRGFNQVVGLLREVPYQSILGTRASSKVAQ
FT                   SSKTKEERLTTKQPFILKSPEEVINKRILLVDDVYTTGRTLYHAAVLFKQAGCKEIGSV
FT                   SLAR"
FT   gene            412694..413242
FT                   /locus_tag="Lreu_0364"
FT   CDS_pept        412694..413242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0364"
FT                   /product="SSU ribosomal protein S30P"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82633"
FT                   /db_xref="GOA:A5VIF9"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIF9"
FT                   /protein_id="ABQ82633.1"
FT                   /translation="MLKFNIRGENVEVTESIRDYVVKRISKLQKFFEDSVEATAHVNLK
FT                   VYPNRTYKVEVTIPLPYLTLRAEETSNDMYGSIDLVTDKLERQIRKYKTKVNRKSREKG
FT                   LKNLEFIPSDNDGTDGQDDELKIVRTKQVSLKPMDPEEAVLQMDMLGHNFFIFQDAETN
FT                   GTSIVYRRNDGRYGLIEAE"
FT   gene            413454..415817
FT                   /locus_tag="Lreu_0365"
FT   CDS_pept        413454..415817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0365"
FT                   /product="protein translocase subunit secA"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   helicase domain protein; SecA DEAD domain protein; SecA
FT                   Wing and Scaffold; SecA preprotein cross-linking region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82634"
FT                   /db_xref="GOA:A5VIG0"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIG0"
FT                   /protein_id="ABQ82634.1"
FT                   /translation="MANILKKWIESDRRELRRINKIANKVESYAKQMSELTDEQLQAKT
FT                   DEFRERYKKGESLDHMLPEAFAVSREGAKRVLGLYPFHVQIMGGIVLHEGNIAEMRTGE
FT                   GKTLTATMPVYLNAISGKGVHVITVNEYLSKRDATEMGQLYNWLGCSVGINNSEMSPDQ
FT                   KREAYKADIMYSTNSEIGFDYLRDNMAVYKEDQVQRGLNYALVDEVDSILIDEARTPLI
FT                   ISGPGTGTSKLYKQTDRFVKQLKKDVDYKIDLESKTVSLTDEGIKKAEKYFNLKNLYDP
FT                   ENTALTHHLDQALRANYIMLLDKDYVVQDGEVLIVDSFTGRVMEGRRFSDGLHQAIEAK
FT                   EGVEIQEENKTMANITYQNLFRMYNKLAGMTGTAKTEQEEFREIYNMETITIPTNRPVQ
FT                   RKDEPDLLYPTLQSKFAAVVDRIKKLHAKGQPILVGTVAVETSEYLSQLLDKENIPHVV
FT                   LNAKNHAKEAEIVKNAGQKGAVTIATNMAGRGTDIKLGPGVREIGGLAVIGTERHESRR
FT                   IDNQLRGRSGRQGDPGLSQFYLSLEDDLMKRFGGDRIKAFLERMKVNDEDAVIKSRFLT
FT                   HQVESAQKRVEGNNYDSRKNVLQYDDVMREQREIIYKERQQIITEDKSLKWVLMPMFRR
FT                   TIQREVDQHTLGDKKDWDLQGIVDFAEEVLIKPDTITVKDLEGKSPQEMVDYLMTFAQG
FT                   VYKEKQKQLYDPAQMLEFEKVVILRVVDSHWTDHIDIMDQFRQSVGLRGYGQLNPLVEY
FT                   QTAGYHMFEQMIADIEYETTRLFMKSEIRQNVTR"
FT   gene            416017..417015
FT                   /locus_tag="Lreu_0366"
FT   CDS_pept        416017..417015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0366"
FT                   /product="bacterial peptide chain release factor 2 (bRF-2)"
FT                   /note="TIGRFAM: peptide chain release factor 2; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82635"
FT                   /db_xref="GOA:A5VIG1"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIG1"
FT                   /protein_id="ABQ82635.1"
FT                   /translation="MAQPDFWNDNEQAQKVIAENNILKEKRDTFVNLRDQIGDLETSLE
FT                   LLAVEPDDDLQKEFEASFTNTQKALEQYRLTQLLDGEYDAKNAILEIHPGAGGTEAQDW
FT                   GEMLLRMYVRWGEQHGFSVETASYEAGDEAGIKSVTLLIKGHNAFGYLRSEKGVHRLVR
FT                   ISPFDAAGRRHTSFASVDVMPELDDSVEVDIDPSDLRVDTFRSSGAGGQHINKTESAVR
FT                   ITHIPTGIVTSSQAERSQLQNRVTAMNMLKSKLYELEEEKKAKKRAEIEGEQLDIGWGS
FT                   QIRSYVFHPYTLVKDNRTGYETHNGQAVMDGDLDPFIDAFLQWKLSQKNPQ"
FT   gene            417045..417380
FT                   /locus_tag="Lreu_0367"
FT   CDS_pept        417045..417380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0367"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82636"
FT                   /db_xref="GOA:A5VIG2"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIG2"
FT                   /protein_id="ABQ82636.1"
FT                   /translation="MRESQHKRLTRSGSDRMIAGVFGGIGQYFKIQPNILRILYVLLTI
FT                   FTGFVPGIIIYIILIIIMPADPQNPDLLGFLKSFSESQKTSQQPHQRSRRTLTNVEEKD
FT                   IKRNGRS"
FT   gene            417377..417736
FT                   /locus_tag="Lreu_0368"
FT   CDS_pept        417377..417736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0368"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82637"
FT                   /db_xref="GOA:A5VIG3"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIG3"
FT                   /protein_id="ABQ82637.1"
FT                   /translation="MMEFWKRVLIDTILFIALAGLFAGTGMFYITSAWIAPLASFVLAI
FT                   LNVAIKPILVILSLPINILTLGLFSVVINGIMLQLTSMLVGSANFHFSSFGSAMLIAII
FT                   MAIFNAVITSHEDRL"
FT   sig_peptide     417377..417475
FT                   /locus_tag="Lreu_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.749) with cleavage site probability 0.337 at
FT                   residue 33"
FT   gene            417751..418713
FT                   /locus_tag="Lreu_0369"
FT   CDS_pept        417751..418713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0369"
FT                   /product="Hpr(Ser) kinase/phosphatase"
FT                   /EC_number="2.7.1.-"
FT                   /note="TIGRFAM: HPr(Ser) kinase/phosphatase; PFAM: HPr
FT                   serine kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82638"
FT                   /db_xref="GOA:A5VIG4"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIG4"
FT                   /protein_id="ABQ82638.1"
FT                   /translation="MPNNVTVQELVDKVRLKVLQGEDYLQRKITTSDISRPALEFAGYF
FT                   KHYPAARIQLLGITETSFAKDLTHEQREEYMTKMCMPQTPCFVISTNLPIPKELKKAAE
FT                   DAKIPILGTHLTSSQILSNMTSYLLERLAPRKSLHGVLVDISGVGVLITGDSGVGKSET
FT                   ALELVRRGHRLIADDRVEVYARDEQTLVGTAPQILKHLMEIRGIGIIDVSTLYGTGAIM
FT                   PSDQISLIVHLETWTPDVQFDRLGDRGDTQTIQGVIVPKVSVPVKTGRNLAIIIESAAM
FT                   NYRAETMGYDATETFDRNLNQLIKQNSERDSKNNKGSAN"
FT   gene            418714..419541
FT                   /locus_tag="Lreu_0370"
FT   CDS_pept        418714..419541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0370"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82639"
FT                   /db_xref="GOA:A5VIG5"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIG5"
FT                   /protein_id="ABQ82639.1"
FT                   /translation="MINQGIKAALNPIAFQGGPFTIHWYGVIIASGVVLALLLAVREGK
FT                   REGIPEDDFYDYLLWALPIAIICARIYYVVFQWSYYSQHPSEIIAIWDGGIAIYGAILG
FT                   GFIVLLVFCHYRHLSSWLMMDIIAPTLIMAQGIGRWGNFMNQEAFGDITTRAHLMAQHI
FT                   PNWIINQMYIGGHYRIPTFLYESLWDLTGFALLMLLRHRKHLFRRGEIFLTYVMWYAFG
FT                   RFFIEGMRTDSLMLGSIRISQLLSIVFFVSALIILIIRRHKNIPWYYNGINKN"
FT   gene            419567..420583
FT                   /locus_tag="Lreu_0371"
FT   CDS_pept        419567..420583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0371"
FT                   /product="glycerol 3-phosphate dehydrogenase (NAD(P)+)"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; NADP
FT                   oxidoreductase, coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein;
FT                   Ketopantoate reductase ApbA/PanE, N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82640"
FT                   /db_xref="GOA:A5VIG6"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIG6"
FT                   /protein_id="ABQ82640.1"
FT                   /translation="MAEKIAVLGAGSWGSVLANMLTENGHDVTLWSRNEEQVKQLNTEH
FT                   TNPRYMKDFVYSTNLTATTDMKKAVKGASVVLIVIPTKGLREVAKQLNAILTELHQKPL
FT                   VIHATKGLEQNTYKRPSEMLSEDISPENRQAIVVLSGPSHAEDVAIKDMTAVTAACEDL
FT                   ASAKKAQKLFSNSYFRVYTNDDVIGAEFGAALKNIIAIGAGAIQGLGYHDNARAALITR
FT                   GLAEIRRLGVAFGANPMTFIGLSGVGDLVVTATSKNSRNWRAGYQLGQGKKLQDVIDNM
FT                   GMVIEGVYTTKAAYELSRKRQVQMPITEALYRVLYEGEDIKTAISQLMDRDLTSENE"
FT   gene            420648..421562
FT                   /locus_tag="Lreu_0372"
FT   CDS_pept        420648..421562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0372"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82641"
FT                   /db_xref="GOA:A5VIG7"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIG7"
FT                   /protein_id="ABQ82641.1"
FT                   /translation="MKRVRKAIIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEA
FT                   RKSGIEDIVVVDGKNKRSIEDHFDSNPELEDNLRSKHKDEMLKMVEETTDVNIYFIRQS
FT                   HPRGLGDAVLTARDFIGDEPFVVMLGDDLNNINNKNEALTKQLIESYNQTGASTLAVMR
FT                   VPHEDTAKYGVINPSKEVTPGLYNVTSFVEKPAPKDAPSDLAIIGRYVFTPEIFDVLAK
FT                   TKPGKGGEIQLTDAIDTLNQTQRVFAREYKGDRYDVGNKFGWVKTNIEYGLEHPQVKEE
FT                   LREYIKELGAKLAAEDKQNNSKK"
FT   sig_peptide     420648..420728
FT                   /locus_tag="Lreu_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.986 at
FT                   residue 27"
FT   gene            complement(421634..422368)
FT                   /locus_tag="Lreu_0373"
FT   CDS_pept        complement(421634..422368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0373"
FT                   /product="protein of unknown function DUF162"
FT                   /note="PFAM: protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82642"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIG8"
FT                   /protein_id="ABQ82642.1"
FT                   /translation="MTDYLQEADTAKNQEDFLNRIAKAANRPRHTLGEDPFVPVNDLPE
FT                   TTLAGKSQDELLELARKNSEEVHVDFHVVKSADLGHTLNDFIQEKEIKSLMLPSFDEEK
FT                   WQDYSLGKWQDNLRVDPIYYWEPEFGRQNIVNANNSDGAIGFADFLLAESGTVTVATYP
FT                   QQGRMFHFLPTHYLAIVPKSKILPRSRQAMDYYQKAIQDGSLQTSNINFITGPSNSGDI
FT                   EMVLIVGVHGPLDMEYVVVEDM"
FT   gene            complement(422361..423848)
FT                   /locus_tag="Lreu_0374"
FT   CDS_pept        complement(422361..423848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0374"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: iron-sulfur cluster binding protein; PFAM:
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain protein;
FT                   protein of unknown function DUF162"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82643"
FT                   /db_xref="GOA:A5VIG9"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIG9"
FT                   /protein_id="ABQ82643.1"
FT                   /translation="MGIATSDKPFTERIKDAEADKFMRASVAKAQDAQFQKRTEARRQL
FT                   GHWEGWRDLSAEIRQHVIKHLPDYLEEFSDNVQKNGGHVFFAKDGDEASAFIKQLAIKK
FT                   QAHHVVKSKSMVTTEIGLDKELLTIPGLSLMETDLAEFILQEDNWDEPTHIVFPTLHKN
FT                   RNQIQKVFEKLGYDGDNDPEHMARFVRHYLRNYFMQADFGITGCNFAIADNGMINLVTN
FT                   EGNADISMAIPKTQVVVMGMERIVPSLKEAEVLDNVLCRSAVGQKLTSYCTFSKGKEAD
FT                   EADGPDDFYVVIVDNGRSKMLNSDFEPMLQCIRCGSCLNVCPVYRQVGGKGYGSIYPGP
FT                   MGEVLSPILGGYQEFKELPYACSLCAACTETCPVKIPLHELIRHHRYVEIDELHLDHSP
FT                   SNALLKAVGKGTSSPTLFNDAMRFAHIALEPFGKKTTPEDIKNLYPDGKINHLPAIAPK
FT                   LAHGWVDVRDLAVPPKYHQNFRHWYRHYEEEEEQKND"
FT   gene            complement(423849..424718)
FT                   /locus_tag="Lreu_0375"
FT   CDS_pept        complement(423849..424718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0375"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224,
FT                   cysteine-rich region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82644"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIH0"
FT                   /protein_id="ABQ82644.1"
FT                   /translation="MISNYIFSIFKEAKCIQLMHACMKVCIFSTCIVDLLYPDVGKATV
FT                   ELLQRFGCETFFPDKQICCGQPTYNSGYDRETIATFKNQLDALLSIDADYIVGPSGSCV
FT                   AMLHEYKNIFKDDPEYSKKAQALYDKSFELTQFIYRVLGILDCGADLDDTATFHRSCHM
FT                   TRLLGERTAPIVLLEHVKGLELIPLHNIQLCCGFGGTFSAKEPLLSEAMVDDKANNVLK
FT                   TKAHILIACEQTCLMNIGGRINRRRDGSHITIMHIAEVLNHNVDTSRITYVKDTDHVMV
FT                   PANGNGVF"
FT   gene            424915..425847
FT                   /locus_tag="Lreu_0376"
FT   CDS_pept        424915..425847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0376"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase;
FT                   glucose-inhibited division protein A; HI0933 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82645"
FT                   /db_xref="GOA:A5VIH1"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIH1"
FT                   /protein_id="ABQ82645.1"
FT                   /translation="MAESKQYDVVIIGAGPGGMTAAMYASRANLSVLMLDRGIYGGNLN
FT                   NTAEIENYTGFKSVKGPELAQQMYEGATQFGAEYAYGTVTKVELDGDLKKITTDMDETY
FT                   TAKAVVIATGSDQRHLNVPGEEEFGGRGVSYCAVCDGAFFKGKHLIVVGGGDAAVEEGV
FT                   YLTQLASKVTVLVRRDELRAEPIIQAEAMNNDKIEFVYNTSVTEIVGDDIKVTGVKTHN
FT                   NKTGEDGEMAADGVFIYVGNFPMTAAFKNLDILDDQGWVKTDERMRTAVPGIFAIGDVR
FT                   ETPLRQVATAVGDGAIAGQQVYQYIKSMA"
FT   gene            425941..427110
FT                   /locus_tag="Lreu_0377"
FT   CDS_pept        425941..427110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0377"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82646"
FT                   /db_xref="GOA:A5VIH2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIH2"
FT                   /protein_id="ABQ82646.1"
FT                   /translation="MENDEKVKLLQKLIQINTVNGNEEDEANYIKRVLEAHHISCKLVS
FT                   FAPNRTNLIAEIGNDKGPVLALAGHLDTVDPSDPQKWTYPPFAGQLVDRKIYGRGAVDM
FT                   KSGLAAMVGALIELQEADLPKHGKVRLIATVDEEVGGKGSLELTDQGYVHDVDAMIIGE
FT                   ATTGQIEYAHCGSFDYIVESHGKLAHSSQPELGANAVTNLVKFINKESRAFDDAAVSPT
FT                   LGKLIHSVTVFHGGEQLNSIPDFAYLKGNVRTIPECDNVETQKRLQDIIDGLNKKPKIQ
FT                   LKLKVVASFMPVVTNKQDRFIALAQTAIKKVSGRQPDVVISHGATDASRYVLDNHNFPI
FT                   IEYGPGIEKLSHQIDERIALDDYLTAQQAYVEIAKQYLNNTKDDEQASS"
FT   gene            427369..428253
FT                   /locus_tag="Lreu_0378"
FT   CDS_pept        427369..428253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0378"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82647"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIH3"
FT                   /protein_id="ABQ82647.1"
FT                   /translation="MKKKIINFELVLILLLPLIVFTSGFKIQNENYRANHTDTWERIKK
FT                   RGTLLIGVDDTFVPMDFRKKNGQLVGYDVDLSRAVAKVLGLKADFQSIDWSMKETELKN
FT                   GTIDCIWNGYTATPSRQKRIAFSRVYELSGQSLVVRKNSKIKNFKDMKGKVLGIQESST
FT                   AQTDFDKYPQVLKRLVKGQKPILYQDNSSAFMDLQAGRTQGVLAGTVYAGYYATHIANN
FT                   NNYKLISASAYPADRVAIGMRKGDRTLINKINYALGVLQKDGTLRRINKKWLGINSNYL
FT                   GPVAEFQKSNNNR"
FT   sig_peptide     427369..427437
FT                   /locus_tag="Lreu_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.746) with cleavage site probability 0.337 at
FT                   residue 23"
FT   gene            428299..428805
FT                   /locus_tag="Lreu_0379"
FT   CDS_pept        428299..428805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0379"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82648"
FT                   /db_xref="GOA:A5VIH4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIH4"
FT                   /protein_id="ABQ82648.1"
FT                   /translation="MGAIKCNDTLAVSIHRIRNSDLNEHGTVYGGRILELIDGQASVAA
FT                   MRVARTTVATVSMDEIQFLRPFDLQDSMCMEAYVTGFGKRSIEVFTKVIGEHLMTGERF
FT                   LGFYCFMTFVILDPEKQTAFNKLIPETEEQKTLMATYSQRVKQRQNQRQKQQEFLPHIS
FT                   ISKPW"
FT   gene            428895..430619
FT                   /locus_tag="Lreu_0380"
FT   CDS_pept        428895..430619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0380"
FT                   /product="alpha-phosphoglucomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82649"
FT                   /db_xref="GOA:A5VIH5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIH5"
FT                   /protein_id="ABQ82649.1"
FT                   /translation="MSWKDTYKVWQERTDLEPDLKQELAAMSDDKEIEDAFYGPLSFGT
FT                   AGMRGLMGPGINRMNVYTVRQATEGLATLMDSLGDDIKKRGVAIGYDSRHNSRKFAHDA
FT                   ARVLGAHGIKVYIYDNLRPTPELSFAVRHMGTYAGIMITASHNPKEYNGYKIYGEDGGQ
FT                   MPPKESDMMTGYIRKIDDIFDIALADEQEMLDNGLETIMGEDVDAAYLANAKGVTVNPE
FT                   LAKEYGKDMKFVFTPLCGTGRMLGERALRQAGFTNYEMEPTEAQPNGDFPGLEHPNPEF
FT                   PEAFVRSIALGKKVGADVLIATDPDADRLGCAVRQPDGEYQLLTGNQIASIMLAYILEA
FT                   HKQAGTLPKNAAAVKSIVSTNFAAKIAESYGVDMINVLTGFKWIADQIHQYETGKADHT
FT                   FMFGFEESYGYLIKPFVRDKDAIQSLTLLAEVAAYYRSRNMTLYDGLQELFKKYGYFRE
FT                   KTIANTYAGVDGPAKIKALMKKFREEAPTHFAGHQVVVTEDFANGTKTTADGEVSELGI
FT                   PESNVLRYILDDDTWIAIRPSGTEPKLKFYIGTSADTLDKANEKLADFEKALQEFAE"
FT   gene            430786..431424
FT                   /locus_tag="Lreu_0381"
FT   CDS_pept        430786..431424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0381"
FT                   /product="hydrolase of HD superfamily-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82650"
FT                   /db_xref="GOA:A5VIH6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIH6"
FT                   /protein_id="ABQ82650.1"
FT                   /translation="MGMHEYLKSLSDLEMINRAPGYFKFEEHNVAAHSFKVTQAAQMLG
FT                   DIEEQAGNEIDWRSLYEKALNHDYTERFIGDIKTPVKYATPELRSMLARVDKSLTENFI
FT                   QSEIPAEFRAAYERRFAEGKDDTLEGKILAVADKIDLMYESFGEIQKGNPEPVYMDIYK
FT                   SSLTAIMDFRDMASVQYFLKKILPELLKDNADGNAKNQLAIITTQIIQQ"
FT   gene            431529..431801
FT                   /locus_tag="Lreu_0382"
FT   CDS_pept        431529..431801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82651"
FT                   /db_xref="GOA:A5VIH7"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIH7"
FT                   /protein_id="ABQ82651.1"
FT                   /translation="MTPSLFAGTFAILVLWLIVDIIWELSRPRDIVMRRLCAWLNLIAI
FT                   IGGFSVFYGVTHFDNANLVPWFICLNWINVVAAGLQFYFGYFRHS"
FT   gene            431966..434038
FT                   /locus_tag="Lreu_0383"
FT   CDS_pept        431966..434038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0383"
FT                   /product="Excinuclease ABC subunit B"
FT                   /note="TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase
FT                   domain protein; UvrB/UvrC protein; type III restriction
FT                   protein, res subunit; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82652"
FT                   /db_xref="GOA:A5VIH8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIH8"
FT                   /protein_id="ABQ82652.1"
FT                   /translation="MKLRFHFILFNCDVREEILLIYRQPDKKFELVSEYKPTGDQPQAI
FT                   NQLTKGIEDGEKAQILLGATGTGKTFTISNVIANVNKPTLILSHNKTLAGQLYGEMKKF
FT                   FPHNAVEYFVSYYDYYQPEAYVPSSDTYIEKDASINDEIDKLRHSATTSLLERNDVIVV
FT                   ASVSSIFGLGDPREYQNSVLSLRVGQEIERDRLLTELVNIQFDRNDIDFQRGRFRVRGD
FT                   VVEIFPASRDERALRVEFFGDEIDRIREVDALTGEVIGDRDHVSIFPATHFMTNEEVMD
FT                   RALPQIEADMKKQVKKFTDEGKLLEAERIQQRTTYDIEMMREMGYTNGIENYSRYMDGR
FT                   KPGEPPYTLLDFFPKDFLLVVDESHQTMPQVRGMYNGDRARKQMLIDYGFRLPSALDNR
FT                   PLKLPEFEQHVNQVVYMSATPGPYEMEQTDHVAQQIIRPTGLLDPTVEVRPVMGQIDDL
FT                   VGEINKRIEKNERVFVTTLTKKMSEDLTDYLKDMGLKVKYLHSDIKTLERTQIIRDLRL
FT                   GKFDVLVGINLLREGLDVPEVSLVAILDADKEGFLRNERSLIQTIGRAARNENGAVIMY
FT                   ADTVTDSMQKAMDETKRRRTIQMKYNEEHHITPHTIIKPIQEAITVTKKATDETEADNS
FT                   AEFTDKDFAKLDKEAQAKMLDELTEQMRSAAKRLDFEQAATLRDTIMELKTKAKK"
FT   gene            434054..436918
FT                   /locus_tag="Lreu_0384"
FT   CDS_pept        434054..436918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0384"
FT                   /product="Excinuclease ABC subunit A"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82653"
FT                   /db_xref="GOA:A5VIH9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIH9"
FT                   /protein_id="ABQ82653.1"
FT                   /translation="MANDKIIIHGARAHNLKNIDITIPKNKLVVVTGLSGSGKSSLAFD
FT                   TLYAEGQRRYVESLSAYARQFLGQMDKPDVDSIDGLSPAISIDQKTTSHNPRSTVGTVT
FT                   EINDFLRLLWARVGTPICPNDNIPITSQSPEQMVDRVLELPERTRLQILSPVVRDKKGT
FT                   QKKVFETIKREGFVRVQVDGETYDLDSVPELDKNKKHTVNVVIDRIIIKEGIRSRLFDS
FT                   FESALRLSDGYAIADVIGGDPIPFSEQYACPICGFTVGELEPRLFSFNAPTGACPECEG
FT                   LGLKLEVDIDLVVPDQTKTLKEGAIVPWNPISSQYYPQMLEQFCKSVGIDMDTPFNKLS
FT                   KKQQQQILYGNGEIPFHFHYENDFGGIRDVDVPFEGVINNISRRYRETNSDFTREQMRK
FT                   YMTELPCPVCHGYRLNQRALAVKIDGRNIGEVSALSISDSLEFFKNIKLSAQKNEIAKP
FT                   ILKEIIDRLTFMKNVGVEYLTLSRSARTLSGGEAQRIRLATQIGSNLSGVMYVLDEPSI
FT                   GLHQRDNDRLIESLKAMRDLGNTLIVVEHDEDTMRAADYIVDIGPGAGENGGQVMAAGT
FT                   PKQVMRSRKSLTGQYLSGKKFIPVPQERRIGNGKKITITGAAENNLKDITVDFPLGEFI
FT                   CVTGVSGSGKSTLVNMILKRVLAQKLNNNSAKPGKYKSISGVENIEKVINIDQSPIGRT
FT                   PRSNPATYTGVFDDIRELFAQTNQAKMRGYTKGRFSFNVKGGRCEACRGDGIIKIEMNF
FT                   LPDVYVPCEVCHGTRYNSETLEVEYKGKNIAEVLNMTVSEALDFFSAIPKIKRKLQTIE
FT                   DVGLGYVHLGQPATTLSGGEAQRMKLAAELHRQSHGKSFYILDEPTTGLHMDDIKRLLA
FT                   VLQRLVDAGNTVLVIEHDLDVVKSADWLIDLGPEGGAGGGNVVATGTPEQVAEVKGSYT
FT                   GKYLKEMLERDQKWAEEREAKQKK"
FT   gene            437157..438518
FT                   /locus_tag="Lreu_0385"
FT   CDS_pept        437157..438518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0385"
FT                   /product="serine/threonine exchange transporter, LAT
FT                   family"
FT                   /note="PFAM: amino acid permease-associated region; TC
FT                   2.A.3.8.12"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82654"
FT                   /db_xref="GOA:A5VII0"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A5VII0"
FT                   /protein_id="ABQ82654.1"
FT                   /translation="MPNIKNGGMMMNQQPTDELKRSLGFWSAISIVIGTIIGSGIFFKQ
FT                   GSVLDSAGTSTLAIAAWVFGGIITLTGGLTVAEIGAQMPYTGGLYVYIENLYGRLLGFL
FT                   AGWMQVIVYGPAIIASVAGFMSILMANFFGLGTQWRIPLAVITVIAIGVMNLFENKVGA
FT                   IFSIITTAGKMIPIAAIIIFGLFWGHQDAFGQTVTEIHQSTGGFGVAVLATLFGYDGWI
FT                   LIANLGGEMKNPQKLLPRAIILGITAVLIIYTLITVGILKFLPVNTIHRLGENATAYLA
FT                   VKAFGAIGGKLLSAGIIISMMGTLNGKMITFPRIVYAMARRHDLPFSRYLAYITPKGKS
FT                   PVVATMFIIILATIMMFFFDPDHLSDLCVFTVYCFYLLAFFGIFILRHKNKGPRPFSTP
FT                   LYPLVPIIAIAGGIFVLVSEVMNDPAGVILFIGIVIVGLPILYIVKRMDQRRMH"
FT   gene            438605..439498
FT                   /locus_tag="Lreu_0386"
FT   CDS_pept        438605..439498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0386"
FT                   /product="uncharacterized P-loop ATPase protein UPF0042"
FT                   /note="PFAM: uncharacterised P-loop ATPase protein UPF0042"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82655"
FT                   /db_xref="GOA:A5VII1"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VII1"
FT                   /protein_id="ABQ82655.1"
FT                   /translation="MRKEELVMVDKKLKVVIITGMSGAGKTVAVHSLEDLGYFVIDNML
FT                   PGLAERFVDVIEDSREFDKIAMVMDMRSRGFYDEVLPNFEKLKKRADLDVKLLFLDAND
FT                   VTLISRYKETRRSHPLSPQGRILDGVELERKLSTDLKSQADIVIDTTNVTPRNLKLRLN
FT                   KLFGHGEGNDFYVEVMSFGFKYGLPLDADIVMDVRFLPNPFYIPELKHLTGNDPAVQNY
FT                   VMQSPLAKEFYQHLRSLLEIALPGYIKEGKSSLTIAIGCTGGQHRSVTIANKLSADLKE
FT                   KGYKVNTYHRDIEKAK"
FT   gene            439514..440500
FT                   /locus_tag="Lreu_0387"
FT   CDS_pept        439514..440500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0387"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82656"
FT                   /db_xref="GOA:A5VII2"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:A5VII2"
FT                   /protein_id="ABQ82656.1"
FT                   /translation="MLHKPKIVVIGGGTGLPVVLRGLRDQNVDVTAVVTVADDGGSSGI
FT                   LRNYINVVPPGDIRNVLVALSELPDLELDIFQYRFRSSDQFFAGHAIGNLIISALSEMK
FT                   GGIFTAVQELSEMMKINGHIYPVANEPLTLNAEFTDGTKLSGESEITAAHKQIKRVWVT
FT                   PSKDNDGHPARPVSEVITAIKNADQIVLGPGSLFTSILPNLMISEVGQAVCESKAEVVY
FT                   ICNIMTQKGETDNFTDADHVRVLNHHLGKNFINTVLVNIQPVPENYLDFQEWNEISQPV
FT                   KHDFQGLRAQHCRVISSNFLRLKDNGAFHDRDKVVAELMNRIHQVHE"
FT   gene            440519..441460
FT                   /locus_tag="Lreu_0388"
FT   CDS_pept        440519..441460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0388"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82657"
FT                   /db_xref="GOA:A5VII3"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VII3"
FT                   /protein_id="ABQ82657.1"
FT                   /translation="MSYASEVKKELTGITVHRDNAKAELMALIRMNGSIGIADHQLVLN
FT                   VQTENPAIARRIYSLLKQFYGVESEIVVRRKMKLKKNNQYIVRLRYHAQHVLDDLGILQ
FT                   NYQIKEQVPVELLKDEWMVRSYLRGAFLAGGSVNNPETSRYHLEIYSLYEEHNEIIAQM
FT                   MNKFGLNAQTTARRSGFIVYLKEAEKIANFMSLIGATNSMLQFENVRIVRDMRNSVNRL
FT                   VNCENANLNKIANASTRQIENIEFIDSRVGLSSLPDKLREIAETRLAHQEVSLKELGEL
FT                   VPGGPISKSGVNHRLRKLNAYADELRASEVKQ"
FT   gene            442357..442950
FT                   /locus_tag="Lreu_0389"
FT   CDS_pept        442357..442950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0389"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, proteolytic
FT                   subunit ClpP; PFAM: peptidase S14, ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82658"
FT                   /db_xref="GOA:A5VII4"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VII4"
FT                   /protein_id="ABQ82658.1"
FT                   /translation="MNLVPTVIEQSSRGERAYDIYSRLLKDRIIMLSGPIEDEMANSIV
FT                   AQLLFLDAQDSTKDIYLYINSPGGVVTSGMAIYDTMNFIKADVQTIVIGMAASMASVLV
FT                   SSGAKGKRFGLPHSQVLIHQPSGGAQGQQTEIEIAATEILKTRKMLNGILAKNSGQPIE
FT                   KIQADTERDHYLTAQEAVDYGLLDGVMENNSKLK"
FT   gene            443355..444737
FT                   /locus_tag="Lreu_0390"
FT   CDS_pept        443355..444737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0390"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82659"
FT                   /db_xref="GOA:A5VII5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A5VII5"
FT                   /protein_id="ABQ82659.1"
FT                   /translation="MKKSAPELNRSMTAGQMEMISLGGAIGVGLFMGSTSTIKWTGPSV
FT                   ILAYAFVGLILYIVMRALGEMIYINPGTGSFADYATEYVHPVAGYLAKWANVFEYIVVG
FT                   MSEVVAATEYLKYWWPHLHTWVAGVVIIIFLVLANLASAKAYGSLEFWFAMIKVVTIIF
FT                   MILLGFMIIFFGFGNGGHPTGFSNLWSHGGFFTGGWSGFFFSMSIIVGSYEGIELLGIS
FT                   AGEVANPQKAIVKSVKSVLFRILIFYVGAIFVIVTIYPWNELSSVGSPFVSTFAKVGIT
FT                   AAASIINFVVLTAALSGANSGIYSSSRMLFKLSHEGDAPKIFGRLSKRIVPDAAILGIS
FT                   GGILIGFIIDMISATYNHSTADMFVVVFSSSVLPGMIPWFVILLAELRFRRNNKDLMVD
FT                   HPFKLPLYPFSNYFAFLMLIVIVIFMFINPDTRVSVIVGAAVLILAVAVYLIRHGFTNE
FT                   KA"
FT   gene            444855..446405
FT                   /locus_tag="Lreu_0391"
FT   CDS_pept        444855..446405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0391"
FT                   /product="Chloride channel, core"
FT                   /note="PFAM: TrkA-C domain protein; Chloride channel, core"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82660"
FT                   /db_xref="GOA:A5VII6"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A5VII6"
FT                   /protein_id="ABQ82660.1"
FT                   /translation="MESRKEAFHRYNQFNQLIRAIIIGILTGLVVSVFRLIIQHFLQLV
FT                   TASFAYFHSHPLWLIPWTIGSIILALLLGWLAQSYPDIKGSGIPQVEGQLTNQFDEKWW
FT                   PVLWRKFLGGIFAIGSGLYLGREGPSIQLGATIGQGVEEKAKVGHLNRQIGIASGAAAG
FT                   LSAAFNAPIAATIFILEEVYHNFSPVIWLATFVSSLCSNMVSMQFFGLRPVLNVPYNHM
FT                   LPNNLYWHLIALGILLGILGRLYQIVILHLNGWTARIPKLSPIAYPIIPFLLVIPIAWY
FT                   FPITLGGGNELIIILRSLPFSLALFVGLFVLRFVFSMISYGSQLPGGIFLPILTLGAIL
FT                   GAVYCALMVRLGLMPVRYLPNFIIYGMAGYFACISKAPFTAILLITEMVGSLAHLMPLA
FT                   LVAVVAYLVVDALHGEPVYTAMFNAFIGNNPQPARHKEDVTMSITIYAGARLDGCKIKD
FT                   FPWPTDCIVMVIYRGEEKIIPNGQTKLQAGDTLILRANSATTRQAYHEISRAAHYAQG"
FT   gene            446472..446711
FT                   /locus_tag="Lreu_0392"
FT   CDS_pept        446472..446711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0392"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecG subunit; PFAM:
FT                   Preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82661"
FT                   /db_xref="GOA:A5VII7"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A5VII7"
FT                   /protein_id="ABQ82661.1"
FT                   /translation="MYNTLMTLFLIDCVVLIACVMMQPAKNDNDAMSALTGGAGDLFSR
FT                   RKARGFEAVMQIVTTICGALFFILALAMIYVSSH"
FT   gene            446790..447566
FT                   /locus_tag="Lreu_0393"
FT   CDS_pept        446790..447566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0393"
FT                   /product="Esterase/lipase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82662"
FT                   /db_xref="GOA:A5VII8"
FT                   /db_xref="InterPro:IPR012354"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5VII8"
FT                   /protein_id="ABQ82662.1"
FT                   /translation="MITYTGESFFFPHSGRRGVILLHAYTGNTNDVRMLGRQLNWQGYT
FT                   VFAPLLSGHGGDPRKVLESNGPGDWWDDTRMAIFRLRDAGIDQIAIFGLSLGGLLATRA
FT                   LENDPQLLGGGVFASPITTWGQSNVPEYFPKIAAEYYRRQKITPLITKEKVAKLTERLP
FT                   KQLAQIQTMAHQICDQLDQIHQPFFIAQGGADEMIDPVSGLQLKARLQANGVVVDYHYY
FT                   PTATHLLTVNTAHRQLFADVEKYLQNLFEVSSNDNK"
FT   gene            447553..449958
FT                   /locus_tag="Lreu_0394"
FT   CDS_pept        447553..449958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0394"
FT                   /product="RNAse R"
FT                   /EC_number="3.1.-.-"
FT                   /note="TIGRFAM: VacB and RNase II family 3'-5'
FT                   exoribonuclease; ribonuclease R; PFAM: ribonuclease II; RNA
FT                   binding S1 domain protein; Ribonuclease B, OB region
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82663"
FT                   /db_xref="GOA:A5VII9"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A5VII9"
FT                   /protein_id="ABQ82663.1"
FT                   /translation="MTTNNLKEKILTHLTDNAGVSYSAEKLAHQLGMDDAEQFTPIVQS
FT                   LAQLEREKKVQVTDRGEFEAVIKQQPLIGTFHGNDKGFGFVDYDPDLPDMYINPDHTLY
FT                   ALNGDQVEVKVLRPAKAGSDQGPEGQVTRIVEHKYENVVGEFKQATIGDDYIGEILLKD
FT                   KKLSQYHFYVTDKGLKPLDGQVVTATVETYPSDEAPEVMTGAVTEVIGDKDEPGIDIMS
FT                   VIYAHDVPHEFPKEVMEQANKIPLHVLPEEKKGRVDITDQPLVTIDAIESKDLDDAVVA
FT                   WKMDNGHYHLGVHIADVTHYVKPGTPLDQEAFKRGTSVYLTDRVVPMLPKRLSNGICSL
FT                   NPNEERLAMSCEMEIDEQGKIVNHRIFQSVMKSHARMTYKAVNKILESHDAKTMKQYED
FT                   LVPMFETMGEIHKLLLKNRKKRGAIDFEAPEAKIIVDEKGHPTDIQLRNRGLSERMIES
FT                   FMLAANETVAEHYFKERVPFLYRIHETPDSDRIKSFVDFLAVFGIDVHGDIKNVKPGML
FT                   QKVLKDVAGTPEEQMVQVMMLRSMQQAKYSDEELGHFGLGAKYYTHFTSPIRRYPDDTV
FT                   HRLIKWYEEHGKNEPAKDHWRDKLPEIAEHTSVTERRGIDTERDVDSMKKAEYMEDHVG
FT                   ETFDAVVSSVMKFGLFVELPNTVEGLVHISVMKDDYYEYSEKHMALIGRNSHRIFQMGQ
FT                   PIKVKLVRADKDLREVDFEIVNPEEAPKTKIRVPRNDEYRGRGRGRKGRTNNNSRHENN
FT                   NGNYYRNTQGKWRRTHQENGHQNNRQINRGQTRHHNNSRDHEGVRRHH"
FT   gene            449976..450449
FT                   /locus_tag="Lreu_0395"
FT   CDS_pept        449976..450449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0395"
FT                   /product="SsrA-binding protein"
FT                   /note="TIGRFAM: SsrA-binding protein; PFAM: SmpB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82664"
FT                   /db_xref="GOA:A5VIJ0"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIJ0"
FT                   /protein_id="ABQ82664.1"
FT                   /translation="MAKKSHQENNDNLIAQNKKARHDYFVTDTVEAGLVLTGTEIKSVR
FT                   AHRVNLKDGFAQVRNGEAWLMNVHISEYDNGTYFNQDPLRNRKLLLHKKEINKLVGALQ
FT                   DKGVTLIPLKMYIKHGYAKVLLGLAKGKHQYDKREAIKRREQNREIERVMKHY"
FT   gene            complement(450506..451090)
FT                   /locus_tag="Lreu_0396"
FT   CDS_pept        complement(450506..451090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82665"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIJ1"
FT                   /protein_id="ABQ82665.1"
FT                   /translation="MRQLYIRDRSSDLHGTTVIRDKNGKSCYLLVGKWGMRYDALSLYA
FT                   IDGALLAEVKQLTLGLLPKFALYVNRQRVGTIGKGLGFVQQVIYIRGINWIVVGSPLTS
FT                   RYRVFSGSHLVFSIQPVKLSSGYCHELKINKKEDEPLAILIASILNHWARRSEQEPLLA
FT                   RLMKRSPNLNTSMSFSISNQLNLNCKERRNK"
FT   gene            451241..451930
FT                   /locus_tag="Lreu_0397"
FT   CDS_pept        451241..451930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0397"
FT                   /product="Uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="TIGRFAM: uracil-DNA glycosylase; PFAM: Uracil-DNA
FT                   glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82666"
FT                   /db_xref="GOA:A5VIJ2"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIJ2"
FT                   /protein_id="ABQ82666.1"
FT                   /translation="MKQLIHNDWWEVLKPQFESAYYAQLHNFLKEEYTHQTIYPEMHHI
FT                   FEAFEWTPFSKVKVVILGQDPYHGPNQAHGCSFSVLPGVPVPPSLQNIYKELQSDLGCT
FT                   PVNHGYLKKWADQGVLLLNSVLTVRAGQAYSHRGHGWEQLTDAAIHALSERPKPVVFIL
FT                   WGRAARNKKQLINTKTNIVLESAHPSPLSANRGFFGSRPFSKTNEALQAMGEQPIDWQL
FT                   PAEPNYR"
FT   gene            451991..452965
FT                   /locus_tag="Lreu_0398"
FT   CDS_pept        451991..452965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0398"
FT                   /product="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /note="TIGRFAM: phosphate acetyltransferase; PFAM:
FT                   phosphate acetyl/butaryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82667"
FT                   /db_xref="GOA:A5VIJ3"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR012147"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIJ3"
FT                   /protein_id="ABQ82667.1"
FT                   /translation="MELFDEIAAKIKGQNKTIVFPEGEDKRILGAAVRLKKDNLVEPIL
FT                   LGDEEAIKEVASKNGFDLAGLQIIDPATYPEDDKQAMFDSLMERRKGKNTPEEIQKMLE
FT                   DVSYFGTMLVYMGKADGMVSGAVHSTGATVRPALQIIKTKPGAHRISGAFLMIKGDQRY
FT                   IFADCAINIELDAPTMAEVAIQSAETARLFEIDPKVALLSFSTKGSAKGEMVTKVADAA
FT                   KLVHELDPDLPADGELQFDAAVVPSVGELKAPDSKVAGHANVFIFPSLEAGNIGYKIAQ
FT                   RFGGFTAVGPILQGLNAPIADLSRGCSEDDAYKVAMITAAQAL"
FT   gene            453085..453543
FT                   /locus_tag="Lreu_0399"
FT   CDS_pept        453085..453543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0399"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82668"
FT                   /db_xref="GOA:A5VIJ4"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIJ4"
FT                   /protein_id="ABQ82668.1"
FT                   /translation="MESLTLTNRDATIALGKKIGQQLVAGDVLVLDGDLGAGKTTFTKG
FT                   LAAGLEIPDIIKSPTFTIIHEYQDGRLPLYHMDAYRLENGGAEDLGLEEYFDGDGVSVV
FT                   EWAEFVEDELPADFLAIHFKRTDDDNTRVLEFEPHGQHFDQIVKSVVG"
FT   gene            453543..454052
FT                   /locus_tag="Lreu_0400"
FT   CDS_pept        453543..454052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0400"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82669"
FT                   /db_xref="GOA:A5VIJ5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIJ5"
FT                   /protein_id="ABQ82669.1"
FT                   /translation="MADDISIKLATSEDAGAVLQFLRVTATESDAVLVPHLNEISEKTE
FT                   AKNIDLINQFDDCVILLAMLGEEIVGMVTVMVLDHQPTTGELGVVVRKKYWRNGIGRLL
FT                   VDEAEYWFNTYSSLENLVLTVFEDNIPAINLYQQLHFVTIGKTVEQGRNVLQMQYDNKK
FT                   EETMEK"
FT   gene            complement(454085..454507)
FT                   /locus_tag="Lreu_0401"
FT   CDS_pept        complement(454085..454507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0401"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82670"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIJ6"
FT                   /protein_id="ABQ82670.1"
FT                   /translation="MTDINLKGGKLSIEQLNTIFETIPVEFDFVDENDIIRWSSANRHR
FT                   LFKRTDADLGKHVLEVHPGHSQNHVKQVLHDMHSGDRDSISIMIKHHGQPVNIAFYALR
FT                   DDQNKYLGCVEVTQDVSKQQAKGSFWRNIMQVLHKK"
FT   gene            complement(454519..455058)
FT                   /locus_tag="Lreu_0402"
FT   CDS_pept        complement(454519..455058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0402"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82671"
FT                   /db_xref="GOA:A5VIJ7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIJ7"
FT                   /protein_id="ABQ82671.1"
FT                   /translation="MMNFIAMDFETANGKRYSACSLALTIVRNGQIADEFYTLINPHTK
FT                   FFWRNTQIHGIHERDVQNAPDFPEVWEHINQFYTPDKLVIAHNNRFDNSVLRNTLEHYN
FT                   IEVPAYQTLDTVASSRQLIPGLTNYKLNTVCDALNIDLHHHHNALDDAQACANILLYQS
FT                   KHFTPQQIQPFINLIG"
FT   gene            455183..456079
FT                   /locus_tag="Lreu_0403"
FT   CDS_pept        455183..456079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0403"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82672"
FT                   /db_xref="GOA:A5VIJ8"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIJ8"
FT                   /protein_id="ABQ82672.1"
FT                   /translation="MANLMNEFPDIEIKQDEPLMNYTYTKTGGPADWLAFPETIDQVKE
FT                   LVDYVREHEMGLTVLGNASNLIVGDGGIDDLTIILTRLNKIEVHDNKVTAQAGASYIAT
FT                   TEAARDSELTGLEFAAGIPGSIGGAVFMNAGAYGGETKNVVSEATVMLPDGTIKHLTNE
FT                   ELDFGYRHSSIQDNNGVVLDATFALEPGKYDEIKARMDDLNERREAKQPLDLPSCGSVF
FT                   KRPEGYYAGKLIHDAGLQGYTSGGAQVSTKHAGFIVNIDHGTAADYVNVIHHVQKTVKE
FT                   KFGVDLETEVRIIGRQD"
FT   gene            456412..457335
FT                   /locus_tag="Lreu_0404"
FT   CDS_pept        456412..457335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0404"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82673"
FT                   /db_xref="GOA:A5VIJ9"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIJ9"
FT                   /protein_id="ABQ82673.1"
FT                   /translation="MSNNVVVLGSINVDTTYHVDRFPQPGETISAVSKSSAPGGKGANQ
FT                   AVAAARSGAKTAFIGAVGSDKEGAYMLESLADDHIDTRHIMTDELHGTGSAAITLDANG
FT                   QNDIMVYGGANQAMATDVLNGIDDVLEDADFLISQFETPQEVALNAFKQAKKYGVTTLL
FT                   NPAPAHEILPELLKYTDVITPNESECALLTGIEITDEESMLKSADYFRERGVKHLLITL
FT                   GSKGVFYSTPTAHGLVPAFKVKAVDTTAAGDTFLGALSSQLEKDLSNVDKALVYAQRAS
FT                   SLTVQQMGAMPSIPNHDAVIKALAEN"
FT   gene            457347..457742
FT                   /locus_tag="Lreu_0405"
FT   CDS_pept        457347..457742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0405"
FT                   /product="RbsD or FucU transport"
FT                   /note="PFAM: RbsD or FucU transport"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82674"
FT                   /db_xref="GOA:A5VIK0"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIK0"
FT                   /protein_id="ABQ82674.1"
FT                   /translation="MKKTGIINSEVSAVVANMGHMDWLSIGDAGMPVPFGTKKIDLAVD
FT                   KELPSFMDVLNNVLKEMKVQKIYLAEEIKDQNPAQLENIKKALPDVEVAFMPHSELKKS
FT                   LTKTHAFIRTGEMTPYSNIILESGVTF"
FT   gene            457761..459116
FT                   /locus_tag="Lreu_0406"
FT   CDS_pept        457761..459116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0406"
FT                   /product="L-fucose transporter"
FT                   /note="TIGRFAM: L-fucose transporter; PFAM: major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82675"
FT                   /db_xref="GOA:A5VIK1"
FT                   /db_xref="InterPro:IPR005275"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIK1"
FT                   /protein_id="ABQ82675.1"
FT                   /translation="MENEVKKENGQSWVQLSDGYLSRTPMFQFVILCLIFPLWGAAASL
FT                   NDILITQFKTVFTLNDTATAFVQSAFYGGYFLMAIPASILIKKTSYKLAILIGLLFYII
FT                   GCGMFFPASHVATYSMFLVAIFAIAIGLSFLETSCDTYATMFGPKETANKRLNVANVLI
FT                   PLGDIMGIVLGKYLIFGEGGNIADKVAKMSKSEAEAYNEHLLQLTLQPYKYILIVLIII
FT                   FIVLAVTKMPRAKAFSTGSETKEDQPSLGETFNYLFHNKRYMKGVLCQFIYAGMQTTVW
FT                   SFTIRLALRLDSHISDAAASTFMIYSYIAWFFGKLVANWFLDRYSITKVLTWFSLLGTI
FT                   SLVITFTVPNITAVIAAIATSFFFGPEWPTIYAHTLDQIHEKKYTETGGAFIVMSLIGG
FT                   AIVPTIQGRVSDLTGSMQLSFIVPAICFALITIYFWTEHRWEKAHPNEVQEH"
FT   gene            459276..460127
FT                   /locus_tag="Lreu_0407"
FT   CDS_pept        459276..460127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0407"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82676"
FT                   /db_xref="GOA:A5VIK2"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIK2"
FT                   /protein_id="ABQ82676.1"
FT                   /translation="MQFIISLLTWQNLIHLIDILVIWFLIYELLMLIRGTRAVQLFRGI
FT                   LIIILVKIVSWYVGLSTVSWVMDQIINWGVIAIVIIFQPEIRRGLEHLGRGTFFTHNQT
FT                   ANEKEEDMIKQLDQAIQYMSKRRIGALMSIQMKTGLEEYIETGIPLDADISGALLINTF
FT                   IPNTPLHDGAVIIKNNRIAVAAAYLPLSDSKLIPKELGTRHRAAVGISEVTDALTIVIS
FT                   EETGEVSITKDNELIRNMSRDEYLKFLRAQLYTHEPQHENLVTELYAKFQRKGGGRHGQ
FT                   GH"
FT   gene            460111..461010
FT                   /locus_tag="Lreu_0408"
FT   CDS_pept        460111..461010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0408"
FT                   /product="YbbR family protein"
FT                   /note="PFAM: YbbR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82677"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIK3"
FT                   /protein_id="ABQ82677.1"
FT                   /translation="MGKDTKGFFRRKWFLRIISLILALFLFMYVNGSKSGFLRQNTRNN
FT                   NQSSALMSNKSVTLRMPLDVTIDNNKYIVSGYPQYVKVKVTGPSALVTTTSNTQNFKVY
FT                   ADLSDLTPGKHRVKLKTSGLNSELTSKIEPQYINVNIQPRKTITMKVTIRLSTRDLDNG
FT                   YKLGRPHSDIQTVQVTGSRDEVNKVNRIVAFVAIPHDAKDNIARQVTLQAIDRNGQTLN
FT                   VVTSPTTTNVSIPISAGSQSSSSNDSSSSSSGSEESEEAKSNSRATSRNDSSDSSSETS
FT                   QSSSSISNEDSSSSSRNQ"
FT   sig_peptide     460111..460209
FT                   /locus_tag="Lreu_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.956) with cleavage site probability 0.905 at
FT                   residue 33"
FT   gene            461038..462393
FT                   /locus_tag="Lreu_0409"
FT   CDS_pept        461038..462393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0409"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase C terminal;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82678"
FT                   /db_xref="GOA:A5VIK4"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIK4"
FT                   /protein_id="ABQ82678.1"
FT                   /translation="MKLKYFGTDGVRGVANQDLSPELAFRVGRAGGYVLTRHSERKQPQ
FT                   VLVARDTRISGEMLENALIAGLLSVGIEVLRLGVVTTPGVAYLVRAQEADAGVMITASH
FT                   NPIKYNGIKYFGGNGFKLSDELEYEIEQLLDAEEDTLPRPSDAGLGTVADYHEGALKYT
FT                   SFLEQTVSSDLEGLKVVVDAANGATSGFISNLFADMNVDFIPINDQPDGLNTNLNCGST
FT                   HPESLQKAVVENNADLGVAFDGDGDRCIAVDNEGNIVDGDKIMYICGKYMDKKGLLKKD
FT                   TVVTTVMSNLGMYKALEAHNLKSVKTKVGDRYVVEEMLKNGYNLGGEQSGHIIFLDHNT
FT                   TGDGMLTALQLLSVVKDSGKTLAELANDVTTYPQELLNIKVADKTTAMENQKLKEIIAQ
FT                   VEKEMNGDGRVLVRPSGTEPLLRIMAEAATPELVHEYVERIGDVARAELEVE"
FT   gene            462602..464422
FT                   /locus_tag="Lreu_0410"
FT   CDS_pept        462602..464422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0410"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS)"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82679"
FT                   /db_xref="GOA:A5VIK5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIK5"
FT                   /protein_id="ABQ82679.1"
FT                   /translation="MCGIVGVTGTDKSLSILIDGLKRLEYRGYDSAGVYVNDQQGHDYL
FT                   VKRPGRIANLEAALGEEVHGLAGIGHTRWATHGEPNEANAHPQYSQDERFYLVHNGVIE
FT                   NYADLKKEYLSDINFVSQTDTEVIVQLVDKFVVESGMSTEAALLKVLRLISPDSSYAFV
FT                   LMDKEQPDTLFVAKNKSPLLVGIADGYNMVGSDAMSMIKETNTFMEIGDHELVIVKPDH
FT                   VTVKDFDGNEIDRPTFKVDMDANAADKGAYPYYMLKEIDEQPAVMRKLVQEYFGDNDIA
FT                   QINEEMLKDMANADHLYIVGAGTSYHAGLVGARIFEKLCGIPTSVHISSEFAYEQPLLS
FT                   KKPFFIFLSQSGETADSREVLVNVNKHNWPSLTITNVDKSTLSREATYTELLYAGPEIA
FT                   VASTKAYTAQIAVEAILAQALGVYMDKQAAKDFDVKHQLGLVANGMQSITDSKKKVEEI
FT                   ASRYLSKSPSAFYIGRGMDWSVSLEAALKLKEISYVQAEGFASGELKHGTIALIEDQTP
FT                   VIGIITQDRTAGLTRSNLEETQARGANAITIVSRHLAKEDDTFVLPDVDEVLTPLLSVI
FT                   PAQLLAYYTSLGKGLDVDKPRNLAKSVTVQ"
FT   gene            464683..464994
FT                   /locus_tag="Lreu_0411"
FT   CDS_pept        464683..464994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82680"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIK6"
FT                   /protein_id="ABQ82680.1"
FT                   /translation="MEEQHETLTLIEEITRNDGSKYYEIGNMVQNGRAELAAERGFIKE
FT                   VRILELNIPHSKNVIKYEHFINTHYKMQTEAMDHWEEWKRPPEIEEVVQTILKENHIG"
FT   gene            465056..466921
FT                   /locus_tag="Lreu_0412"
FT   CDS_pept        465056..466921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0412"
FT                   /product="peptidoglycan-N-acetylmuramate
FT                   O-acetyltransferase"
FT                   /note="PFAM: acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82681"
FT                   /db_xref="GOA:A5VIK7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIK7"
FT                   /protein_id="ABQ82681.1"
FT                   /translation="MKPNFNPSQGMKSHYFVTGIDGLRTLAVLGVIIYHLLPNVLMGGY
FT                   LGVPLFLLVSGYFVTYQFSRQLKYGGHINLGHFYLKRFRRLYPTLIAMLILTAAYITLF
FT                   ARELLHNIRAVIVTNLTWVYNWWEISHGQSYFDQFGGVSPFTHLWTLGVEAQFYLLWPL
FT                   IITLLFVIFKKLQNVRRVVFILAVLSAIEMAVLYDPANINRVYYGTDTRAFSLLLGSWL
FT                   GLAWPLNRLRPNLQANSRRLLNTIGIIATVLTIVGFLSLNGQSSFTYRGGMFLYSFIGM
FT                   ILMATIIHPGAGMNKWFTNPVFHWVGQRSYGIYVYQYPVMVFYERLINVGNHPLLNAFV
FT                   EIIIILVVSEVSYRLIERPFAQYQWSKLPADLQHVLETHHFSWQSGAKMMVSALVVVIA
FT                   FIGFCQPNRAPKKTAVQQRIEQNHQAAEEHNKKIAKGDNVAEASGNTSKLQKQYDLTPA
FT                   QIKAAQKLKVTAIGDSVMADAADSIQKLMPNAYVDAQVGRQGSAAPDVIKQLKADGHLN
FT                   KIVILNLGTNGPMTQDTLDNILSAIGSGHQIYWVTAHVPTKPWQQTVNNEIKDLAKKHK
FT                   NIHVVDWNKASQGHSDWFASDNVHMGPSGNDHFARLIAKTILTKK"
FT   gene            466932..467387
FT                   /locus_tag="Lreu_0413"
FT   CDS_pept        466932..467387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0413"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82682"
FT                   /db_xref="GOA:A5VIK8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIK8"
FT                   /protein_id="ABQ82682.1"
FT                   /translation="MTHEGQLLDKAINIYLTGLKGIESFISEPASEYNLSFEQFLILRK
FT                   IINHPNIKLMDIAEQRQVTRSAVSRQLKVLFQQKYVEQKADPADRRRMFLVATKKGKDA
FT                   ESEIWQRINHRFANWVQIYGEDRADQFLTLFEDFNQQIIQGNIRKKE"
FT   gene            467392..468198
FT                   /locus_tag="Lreu_0414"
FT   CDS_pept        467392..468198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0414"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase, type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82683"
FT                   /db_xref="GOA:A5VIK9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIK9"
FT                   /protein_id="ABQ82683.1"
FT                   /translation="MIKMIALDLDNTLLNSNKEISQRNEHVLKQLHQEGIKVVLCTGRP
FT                   INAIWPYIEQLGLTDSDDYTITFNGGLVINNESREHLFELGMKKSDLLPLFSYVKRKKI
FT                   PLNVLDFERVYELNDYPGSIYRTVLKNIEFQSLPMSDMPEKTYSKAVMAITPEKLSTII
FT                   GELPANLKAQYHAVQSQPMIMEFLPKKLNKAVGLKALLDHFGDDFSNLMTFGDADNDLE
FT                   MIKAAAQGIVMENGLPNVKAVATAITDTNDNDGVARYCERYFATLL"
FT   gene            468521..469132
FT                   /locus_tag="Lreu_0415"
FT   CDS_pept        468521..469132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0415"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82684"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIL0"
FT                   /protein_id="ABQ82684.1"
FT                   /translation="MISKKNFAKVSATLGAVALGVSATATAANADTIYTVQSGDTLSGI
FT                   SYKFAKDNSMVNDLAKKNNIQDINKIYVGQKLIIKSDGEIQEYNAQNAANANVADNNTQ
FT                   ATQQQTAQPQQAQSQASQSYTSNASGSEAAAKAWIAARESGGNYGATNGQYIGKYQLSA
FT                   SYLNGDYSAANQERVADQYVASRYGSWQNAQAHWQANGWY"
FT   sig_peptide     468521..468604
FT                   /locus_tag="Lreu_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.546 at
FT                   residue 28"
FT   gene            469226..469596
FT                   /locus_tag="Lreu_R0019"
FT   tmRNA           469226..469596
FT                   /locus_tag="Lreu_R0019"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 148.97"
FT   gene            469742..470461
FT                   /locus_tag="Lreu_0416"
FT   CDS_pept        469742..470461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0416"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82685"
FT                   /db_xref="GOA:A5VIL1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIL1"
FT                   /protein_id="ABQ82685.1"
FT                   /translation="MEILMIEDNHSVCEMMAMFFKKEKWHCEFAYDGVEAEEKFNADPH
FT                   KWDIILLDLNLPKKDGMQVAADIRRVSPTVPLIMLTARDTESDQVLGLEIGADDYVTKP
FT                   FSTITLIARIKALYRRTHLNKLEDVQDTDSDDTFDIQTKNFKMNTKTREVFLYGKPVGD
FT                   LTPKEFDLLKTLASKPRQVFTRSQLLQLVWDYEYYGDERTVDAHIKKLRQKLENIGPQV
FT                   IKTVWGVGYKFDDEGND"
FT   gene            470461..471948
FT                   /locus_tag="Lreu_0417"
FT   CDS_pept        470461..471948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0417"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82686"
FT                   /db_xref="GOA:A5VIL2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIL2"
FT                   /protein_id="ABQ82686.1"
FT                   /translation="MKLMYRLMLSFFAIILTLMVIVSISFINVTNNTMYHNTWQQLKSY
FT                   SDSLIQDSIRYNMATQSFEGFATESLNSNANLLTRQNVHFAIYDTTHRKIFASNGFAPS
FT                   MSKSDWKKLKKGETVCTKLITPKINSRVSKGASPRMTEVSRPYFYKGKMIAVVSIATFV
FT                   STIEQNMHQIKINLIMALLTASLVTLAVSYFLARSITKRIDRLRMATHQIAQGNYNVEV
FT                   DDNGRDEVADLGRSFNQMTASLRESQQEIRRQEERRRQFMANAAHEMRTPLTTINGILE
FT                   GLQYDAIPEEDKKHSIQLMQNDTRRLIRLVNDNLDYEKIRTNQIAMERKVFDASAVLEN
FT                   LREQLAKKAKEKKDTLHLDVEKNLRVYADYDRFVQIMFNIIQNAIQFTDNGIIDIRGKR
FT                   VEKGSQFEVQDNGIGMTPEQLENIWERYYKADRSRMNTKYGESGLGLAIVRQLVLLHGG
FT                   KIDVKSQYGKGTTFTIFFPDREYAPHNIQPTNNKDKK"
FT   sig_peptide     470461..470538
FT                   /locus_tag="Lreu_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.924) with cleavage site probability 0.344 at
FT                   residue 26"
FT   gene            472117..472977
FT                   /locus_tag="Lreu_0418"
FT   CDS_pept        472117..472977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0418"
FT                   /product="sugar transport family protein"
FT                   /note="PFAM: sugar transport family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82687"
FT                   /db_xref="GOA:A5VIL3"
FT                   /db_xref="InterPro:IPR010651"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIL3"
FT                   /protein_id="ABQ82687.1"
FT                   /translation="MNYLLALIPAIGWGIMPLITGKIGGSTINQMFGIGAGATIVGLVA
FT                   FIIGHPTVTTTGFWFSVLCGALWTIGQIGQFVSFKRMGVSNTIPLSTVFQLVGNSLIGV
FT                   IIFGEWRGARALTIGFIALAIVIVGALMTSVTDQSSGKKVTVQNFLFLLITSIGYWVYS
FT                   AFPKMPMVANDSSLGIFLPEMLGILLGSVIYAICSGNIDSFKQKEQYLNIWGGISWGIA
FT                   ALAYIFAGRALGINTAFVFTQMNVIIATIGGILVLHEHKTRREMSFTIAGIIFIVAGSI
FT                   LTIFA"
FT   gene            complement(473052..473666)
FT                   /locus_tag="Lreu_0419"
FT   CDS_pept        complement(473052..473666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0419"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82688"
FT                   /db_xref="GOA:A5VIL4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIL4"
FT                   /protein_id="ABQ82688.1"
FT                   /translation="MDKNTENMLAGKPYRPGTPELNKFSHLAHRLCRDYNLTTDEDTVE
FT                   RGMIIDRLFPQHDDGIYLQGPIHIDYGRFTKIGKNFYANFNFTILDTCPVTIGDNVMCG
FT                   PNVSIITAMHPLMYQQRNIRQQADGQFDDVEYGKPVTIGDNCWLASNVTVCPGVTIGNG
FT                   CVIGAGTVVTKDIPDNSLVLGVPGKVIRPITEKDRLENFPY"
FT   gene            473847..475205
FT                   /locus_tag="Lreu_0420"
FT   CDS_pept        473847..475205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0420"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI)"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82689"
FT                   /db_xref="GOA:A5VIL5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIL5"
FT                   /protein_id="ABQ82689.1"
FT                   /translation="MTHIKFDSSALKQFVHENELGEMQAMVNAANDELRNGTGAGADFR
FT                   DWLHLPTEYDKEEFARIKKAADKIQRDSDVLVVIGIGGSYLGAQMAIDFLHNTFYQAQN
FT                   AKDRKAPLVVFAGNSLSSTYVHDLIQLIGDKDFSINVVSKSGTTTEPSIAFRIFKGLLI
FT                   KKYGENEANKRIYATTDKTKGALKTEADAHGYETFVIPDGVGGRYSVLSAVGLLPIAAS
FT                   GADIDKLMEGAAQAEKDYVDPDLTKNEAYQYAAYRNILYRKGYETELLENYEPNMRMFA
FT                   EWWKQLAGESEGKDQKGIYPSSANFTTDLHSLGQYIQEGRRFLMETVVKLDKPNYDMEI
FT                   PTEPDNLDGLGYLEGKTMDYVNTKAYEAVVAAHTDGGVPVMTVHIPQEDEYTLGYLIYF
FT                   FEVAMGISGYLNGINPFNQPGVEAYKTNMFGLLGKPGYEEIGKELRAKMDKND"
FT   gene            complement(475692..475991)
FT                   /locus_tag="Lreu_0421"
FT   CDS_pept        complement(475692..475991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82690"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIL6"
FT                   /protein_id="ABQ82690.1"
FT                   /translation="MIAYKNCTPNELDYTVRKGGKTTISVNGKDIVLTFEDIPAENPKY
FT                   MDIKILSVPKHVMASIIINAYLKDDTDNLDINKKVKEKLANCINTAVRNRFGLI"
FT   gene            476129..476335
FT                   /locus_tag="Lreu_0422"
FT   CDS_pept        476129..476335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0422"
FT                   /product="Sugar (pentulose and hexulose) kinase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82691"
FT                   /db_xref="GOA:A5VIL7"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIL7"
FT                   /protein_id="ABQ82691.1"
FT                   /translation="MNEYVIGVDLGTSAVKVSAMDRDGKIVAQQSYGYDLHQPYPGYSE
FT                   QDPRDWLYETTIVIDRLILKELR"
FT   gene            complement(476481..476939)
FT                   /locus_tag="Lreu_0423"
FT   CDS_pept        complement(476481..476939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0423"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82692"
FT                   /db_xref="GOA:A5VIL8"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIL8"
FT                   /protein_id="ABQ82692.1"
FT                   /translation="MANKLNSLAHTKWLCKYHIVFIPKYRRKAIFNQYRRDLRDYIRLL
FT                   CKYKGVEIIEGHMMPDHVHLLVSISPKLSVSQFMGYLKGKSALMMFDRHANLKYKYGNR
FT                   HFWAEGYYVSTVGLNESTIKKYIRDQEKHDIAMDKLTSVEYSDPFKGK"
FT   gene            complement(477160..477999)
FT                   /locus_tag="Lreu_0424"
FT   CDS_pept        complement(477160..477999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0424"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; YcbB domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82693"
FT                   /db_xref="GOA:A5VIL9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013972"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIL9"
FT                   /protein_id="ABQ82693.1"
FT                   /translation="MNFYILDNDSKIIHLLSNIIENDFNNTVVGTTSNPQQAYDDAMRL
FT                   GIDIMFIDYAMPTMDGVQLIQKIQDSHHYPHFIMTAQAILPSVKTSAYQHGIDFFIEKP
FT                   LNIAEVKSVIKLAAQNINMSNRLLQVLDLVSGAATNNNTVTISGKTKKKENAQSILRFL
FT                   GITAGNGAPAINKLVNTMIEREISFDEVNFEEFFQCDEHGKKIIFQRIRRDIKTGLNNL
FT                   AHMCMDYPENDIILEYANNLYEYKNVHNEISFLKGERTNGGQVSLKHFFNGLIQEIN"
FT   gene            478252..479259
FT                   /locus_tag="Lreu_0425"
FT   CDS_pept        478252..479259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0425"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82694"
FT                   /db_xref="GOA:A5VIM0"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIM0"
FT                   /protein_id="ABQ82694.1"
FT                   /translation="MAFNLRNRSFLTLADFNTREMEYMLDLAEDLKKAKYAGYEGKNLK
FT                   GKNIALIFEKSSTRTRCSFEVGAKDEGAHVTYLGPSGSHIGHKESVKDTARVLGGMFDG
FT                   IEYRGFSQRNVEILAKYSGVPVWNGLTDEDHPTQVLADFLTAHEVLKKPYKDIKFAFVG
FT                   DGQDNVSNALMLGAAVMGMEYHVVTPKELEPTKETLDKANEIAAKTGAKIVVTNDIKEG
FT                   VKGMDVIYADVWVSMGESDDMWEKRINLLKPYQVTMDVMKATENPNVLFEHCLPAFHNL
FT                   DTEVGKEIEKKFGLKEMEVTDEVFESEHSVVFREAENRMHTIKAVMVATLGEQN"
FT   gene            479276..480208
FT                   /locus_tag="Lreu_0426"
FT   CDS_pept        479276..480208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0426"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="TIGRFAM: carbamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82695"
FT                   /db_xref="GOA:A5VIM1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIM1"
FT                   /protein_id="ABQ82695.1"
FT                   /translation="MAKVVVALGGNALGKSPEEQLKLVKNTASSLIGLIAAGNQVVISH
FT                   GNGPQVGAINLGMNFAAEHGKTAAFPFPECGAMSQGYIGYHLQQSLENELHRRWMNKSV
FT                   ATIVTQIAVDPNDPAFENPSKPVGDFYTKEQADEIAKEKGYTFKEDAGRGYRQVVPSPL
FT                   PMKIMELDSIKTLIDADKLVIAGGGGGVPVIITDKGLEGVPAVIDKDRSSALLADKIDA
FT                   DKLIILTAVDHVYVNYGKPDEKALKTLNVAEAQKYMKEGQFAAGSMLPKIEACLSFVEG
FT                   HPEREALITSLDGLDDALAGKVGTVIRDN"
FT   gene            complement(480252..481166)
FT                   /locus_tag="Lreu_0427"
FT   CDS_pept        complement(480252..481166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0427"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82696"
FT                   /db_xref="GOA:A5VIM2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIM2"
FT                   /protein_id="ABQ82696.1"
FT                   /translation="MSNKKVLGTAMIITACTFWGISGLFAKALFNVSSSITSMWLTQVR
FT                   MVSAGIILVLLSQIRGKHPFQIFKDLHSAWIIFAYGVFGLVPVQYAYFMAVQYGNASIA
FT                   TILQFIGPFFIIAYQAMFRHLPPRRIEIISAIIAFLGVFIIATHGQFNHLAMTLSVLIW
FT                   GLISAIGVATNTLIPQNMLREGRVPSLIITGWGLLFAGLTLVLIHPSQPHIPNVPSVWL
FT                   YVLGILVIGTLIPFQLANNSLKYIDATTFSLMDAFEPLSATIGSVLIFHLQMTGADILG
FT                   SILVIVAVLAINIRIPQKKLKSN"
FT   sig_peptide     complement(481086..481166)
FT                   /locus_tag="Lreu_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.974 at
FT                   residue 27"
FT   gene            complement(481250..481831)
FT                   /locus_tag="Lreu_0428"
FT   CDS_pept        complement(481250..481831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0428"
FT                   /product="peptidase M10A and M12B, matrixin and adamalysin"
FT                   /note="PFAM: peptidase M10A and M12B, matrixin and
FT                   adamalysin"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82697"
FT                   /db_xref="GOA:A5VIM3"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIM3"
FT                   /protein_id="ABQ82697.1"
FT                   /translation="MLTQSWLHRITGKEVATPTKQNADQQTGAQDTPADARWEQNSATI
FT                   YVNISNPVLKNATETAIAQWNNTKAFTFKIVNDKNANISVSAVNDPNNGAAGLTNTSMN
FT                   SATGYYLHATVELNSYYLLNPAFGYSQERIVNTAEHELGHAIGLQHTNKISVMQPAGSY
FT                   YPIQSRDIEAVKALYSRTPQPIIAENNSNR"
FT   gene            482107..482475
FT                   /locus_tag="Lreu_0429"
FT   CDS_pept        482107..482475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0429"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82698"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIM4"
FT                   /protein_id="ABQ82698.1"
FT                   /translation="MRIAVIIIALLLIAFIVWWFFGKHTESAGKSTIVNDEQTATIVVN
FT                   GGYSPSTVILKKGIPAQVNFDMHDSTACLSHVVFEQLGVNKDLTKQKITTINIPTDKAQ
FT                   TFNFACGMDMFHGKVIVK"
FT   gene            482475..482762
FT                   /locus_tag="Lreu_0430"
FT   CDS_pept        482475..482762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82699"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIM5"
FT                   /protein_id="ABQ82699.1"
FT                   /translation="MSIFSKDQTKKVVVNAENHGYKPETVTFKQGKPAQLKFIPSDNMG
FT                   CMNEVVFKELGIDEKLDGKKEVTVDIPTDKPGTYNYACGMDMFHGKVVVK"
FT   gene            482762..484699
FT                   /locus_tag="Lreu_0431"
FT   CDS_pept        482762..484699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0431"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase, type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82700"
FT                   /db_xref="GOA:A5VIM6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIM6"
FT                   /protein_id="ABQ82700.1"
FT                   /translation="MKLTNIQRFWISFVLSIPMLIQMLAMPFHWMMPAYNWIALITTTI
FT                   IMAISAFPYWKSAIAAFKKHSANMNTLVATGTAVAYFYSIFAMITDRAVYFESAAFVTV
FT                   FVLLGDAMEEKMHNNASNALGKLMGLQAKDAEVLKDGKFVKVPLDQVQVGDLIRVKPGE
FT                   KVPVDGTILEGVTSLDESMVTGESMPVMKKVGDTVVGSTINNNGTITFKATKVGADTML
FT                   AQIVDLVKKAQTSHAPIQNLTDKISNVFVPAVMIIAILTFMIWYSFVGATFVQALLFAV
FT                   SVIVIACPCALGLATPTALMVGTARSAKMGVLIKNGEVLQEVSNIDTVVFDKTGTITVG
FT                   KPVVTDIVGDAKKVLTIAASLEESSEHPLASAILQKAKNKEISPVKVDKFEAIEGKGVR
FT                   ADYNGQVAFVGSNRLLVDVNISREMASRAEKLQNEAKTVVYVGLDGEIIGLVAIQDVPK
FT                   SSSKDAIAELKARGLMTVMLTGDNKRVAQAIADEVGIDRVIAEVMPNDKAQQIKELQDK
FT                   GKKVAFVGDGINDAPALSTADVGIAMGSGTDIAIDSGGIVLVQNDLRGVVRALDISKKT
FT                   FNRIKLNLFWALIYNVIGIPIAAGLFAFMGFTLSPELAGLAMAFSSVSVVSSSLLLNKA
FT                   KIAGEHVVQA"
FT   gene            484818..485294
FT                   /locus_tag="Lreu_0432"
FT   CDS_pept        484818..485294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82701"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIM7"
FT                   /protein_id="ABQ82701.1"
FT                   /translation="MATAFLVHTQLNWGKTCDYLIANDVEPGLMHRYETREDWQEVILD
FT                   ALINVPLAPYLPSGQPIPPIGTAKVIGVEAVDPARVKKTVQRTRSQFIMATIWKKQSAL
FT                   KNYNFLHHDYDKWTQKQIWADVDYWCDSKKHPVIDLITKWRCVRQHQRLRAEEK"
FT   gene            485359..485431
FT                   /locus_tag="Lreu_R0020"
FT                   /note="tRNA-Gln2"
FT   tRNA            485359..485431
FT                   /locus_tag="Lreu_R0020"
FT                   /product="tRNA-Gln"
FT   gene            485523..485852
FT                   /locus_tag="Lreu_0433"
FT   CDS_pept        485523..485852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82702"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIM8"
FT                   /protein_id="ABQ82702.1"
FT                   /translation="MASNSDSIYYVLTKLKHHPELIKSIRPRYTNTVLILFDDSLKIAD
FT                   ASFYFPVDRFMVNRLSNDFVAKNGDLLDSYFSMTNGTKKNYHDVWATTCHIPEKKVYLL
FT                   ELSFE"
FT   gene            485914..487471
FT                   /pseudo
FT                   /locus_tag="Lreu_0434"
FT   gene            487534..487606
FT                   /locus_tag="Lreu_R0021"
FT                   /note="tRNA-Glu1"
FT   tRNA            487534..487606
FT                   /locus_tag="Lreu_R0021"
FT                   /product="tRNA-Glu"
FT   gene            complement(488117..488326)
FT                   /locus_tag="Lreu_0435"
FT   CDS_pept        complement(488117..488326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82703"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIM9"
FT                   /protein_id="ABQ82703.1"
FT                   /translation="MNLRLRGNKMALTESQHKAINKYRSKNKAQVQYINRRSVAKNFIL
FT                   KSATQEDLDMLLGCIKQRQEKLND"
FT   gene            complement(488749..489996)
FT                   /locus_tag="Lreu_0436"
FT   CDS_pept        complement(488749..489996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0436"
FT                   /product="transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase, IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82704"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIN0"
FT                   /protein_id="ABQ82704.1"
FT                   /translation="MSHNDSILNILGIKDKNIKIISVEEAEHNDDSVKEYITLITATLS
FT                   YPINRCRNCGFPTVNKDGFRKTHVRLASLNGRRYELELRKQRYKCKSCHTTFGAITNLT
FT                   KENQTLSSNLKNQIMLLARKGLSGQLIAEMCHCSPSSVRRTILERMEPHYRVAKLPKHL
FT                   CFDEFRSTKSVMSFICCDAETHQIVTKLQDRLSPTIIDYFESRYSKAERECVQSVVIDL
FT                   NAQYQSFIYRLFPNASIIIDRFHLVQLAGRALDNCRISILKQLDKQSREYKIMKSHWKL
FT                   FHKKAEDLHPEEVVFLRGVKQYMTRQNAVDLITSKFSKFAEVYQTYQDITKALNERNSE
FT                   LLESTILDYQKTNTEMDTAIQTLRQNRKYVLNSAKFEYSNGPLEGINRKIKTLKRTCYG
FT                   FANQKFFFLRIDCIFS"
FT   gene            complement(491172..491537)
FT                   /locus_tag="Lreu_0437"
FT   CDS_pept        complement(491172..491537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82705"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIN1"
FT                   /protein_id="ABQ82705.1"
FT                   /translation="MSWYRGRYVFSKRSLAQWMAESKKDYHFRVRNKGKADPTVVSFVF
FT                   SDGVKKDRRFYCACRVLYNHYKEYCQQQAIIPLSNRQFKHNMELLGFVYQKHHRFYTGY
FT                   YQNKVTTAYKNIGIVKQ"
FT   gene            complement(492089..492490)
FT                   /locus_tag="Lreu_0438"
FT   CDS_pept        complement(492089..492490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82706"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIN2"
FT                   /protein_id="ABQ82706.1"
FT                   /translation="MNFNIKYPPLVEQAYSHFLSIGLRPNKDKLYKMLVDEGMIDELGN
FT                   PTQRAINEGLVEVAGNNPIERFKAENPLVAHIPDEHFKVQGNQVLMDCYAVRVAATTIL
FT                   NDPTAPQEQKENAQSLLDKVNSLDHNEWH"
FT   gene            complement(492957..493916)
FT                   /locus_tag="Lreu_0439"
FT   CDS_pept        complement(492957..493916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82707"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIN3"
FT                   /protein_id="ABQ82707.1"
FT                   /translation="MANRRLISKSIHQSNKFLQLSVEDRYLYDELVLYADDDGFCSELT
FT                   MINVLNHFTEKNYQELEKAGLIIVSDSVVIIVDWLNNQDLKNHTNTQQIELTKITYIRT
FT                   DWRYTTNLNDENVAMTLNDFLHKYNSKKTGIDLENLKETRNKLIKAESASNSPKPALVM
FT                   EDKIGENRLKKAEKASPQNNDVQALERQGIDTHSNEAGGNRREKPKTAFLSTKSASNIN
FT                   KYNINKENINKEKESLPQESSTVNQKEIEQLIKFINSKFKTTFSTNNDQLIYFLSNELK
FT                   VSSIDEIKDTLTVIKEKSSITPETDNLCLSYIKNEYPK"
FT   gene            complement(494157..494627)
FT                   /locus_tag="Lreu_0440"
FT   CDS_pept        complement(494157..494627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82708"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIN4"
FT                   /protein_id="ABQ82708.1"
FT                   /translation="MQLVTLTAPDGHRERWDMKTTYLALLSWYSYLKDTENSKKPTELA
FT                   TRISKFVGDDIKQVHTFLVYLDGFNGDLYSKLSLLTNNDDKNTTRLYFIMKSLNNPNYL
FT                   AHNKREERERQKIVERIEQVTNNDVEMLKRLIALTKLFIDGQLSYKNMEVCK"
FT   gene            complement(494784..495548)
FT                   /locus_tag="Lreu_0441"
FT   CDS_pept        complement(494784..495548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0441"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82709"
FT                   /db_xref="GOA:A5VIN5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIN5"
FT                   /protein_id="ABQ82709.1"
FT                   /translation="MIKDGYTVSELVKAAKVSRQAYYKWLKRELTTKDIQDQEILNLIK
FT                   EIEKTNKQSIGYGKMTRLIKRAGLGYLVNKKRVIRIMKEHGIKADYRQAKRKRDKERQT
FT                   YQAENILNRQFKQEAANQVWVTDTTELAYNIHNYKVRLHVVLDLYGQFPISWLITPTET
FT                   SEGAIQVFKKAQKQEGVLAPLIHTDRGAAYTSKAFNQYLTSNNSQHSYSAPGTPADNAV
FT                   IEHWWADFKAIWLAHSSKPQTLDELQTLVAEG"
FT   gene            complement(495545..496144)
FT                   /locus_tag="Lreu_0442"
FT   CDS_pept        complement(495545..496144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82710"
FT                   /db_xref="GOA:A5VIN6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIN6"
FT                   /protein_id="ABQ82710.1"
FT                   /translation="MTKWIKQFLLAGLAGLIRPKHNQKYSLKTKIAAVKDYQLNGLASR
FT                   EVLIKYKIRHISQLKQWIIQYNSDKLTVAYATRKRVKKMGRKVSFDEKKQIVQWTINHQ
FT                   NNYKEAASKYDISYQRVYSWVRKYLHDHNWEVLKDNRGRNKDKEPTNELERLRKRVREL
FT                   EAEKRESEVQIAFAKKLVEIRNREVHRPDDIKRFKK"
FT   gene            complement(496370..496963)
FT                   /locus_tag="Lreu_0443"
FT   CDS_pept        complement(496370..496963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82711"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIN7"
FT                   /protein_id="ABQ82711.1"
FT                   /translation="MMKMTNKVLASSLVILAALGLAGCTNSAAAPTKTSTSATKVSQQT
FT                   SKKAASSTSSEKAKGQASTSTPTSVQSTSSTNTSSTSANSKVTNSSAKSTNQTVKAPSS
FT                   SVTSNPSSQSATTTSSSQNDQQVLTSFVKTSGIQQDGNHYYMTKNNQNNNYQIEVRNNQ
FT                   GGDPNVAHLTGTYQYDPTTNQIHEMNPITGNYDN"
FT   sig_peptide     complement(496874..496963)
FT                   /locus_tag="Lreu_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.972 at
FT                   residue 30"
FT   gene            497154..498173
FT                   /locus_tag="Lreu_0444"
FT   CDS_pept        497154..498173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0444"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82712"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIN8"
FT                   /protein_id="ABQ82712.1"
FT                   /translation="MNKYDLTITKLHQMVKEGIVPGVSYVIFDRQHTIKEVTGMAQVYP
FT                   ETELLKPGMLYDVASLTKVIGTVPVIAMLIQKGALSLDDPIKKYLPEFNDNRPTIRNLL
FT                   THTSGIAGYIPHRNELTASELKTAFLTRMQVEDSLNHQIKYADVNYLYLGWIIERIYNQ
FT                   PVQKVIAEQVLKPLNMPTATFNPHPANCVPTEVQEKRGLIRGETHDPKGYILGESCGCA
FT                   GLFASLKDLEIFSHALIENNLNGLLTSETIDLFFTDQTRIPGPHSRSLGWKLFHAKDHH
FT                   LLISHTGFTGTWMVLDRQTDQGFIVLTNRVHPSAKNQEFLAARDQLFAIYLTEKEKTL"
FT   gene            498381..499613
FT                   /locus_tag="Lreu_0445"
FT   CDS_pept        498381..499613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0445"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="TIGRFAM: arginine deiminase; PFAM:
FT                   amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82713"
FT                   /db_xref="GOA:A5VIN9"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIN9"
FT                   /protein_id="ABQ82713.1"
FT                   /translation="MQSPIHVTSEIGKLKTVMLHRPGKEIENVYPEILHRMLVDDIPYL
FT                   PIAQEEHDLFAQTLRDNGAEVLYLEDLLTDALADDNIKDEFLEKIIAESGYAAGAIHDG
FT                   LKEFLLSFSTKDMVNKIIAGVRKDEIKTKYASLAELAEDKDYPFYMDPMPNAYFTRDQQ
FT                   ACIGDGITINHMTFKARQRESLFTEYIIKHNKRFADKGVEVWRNRYPEGRIEGGDELVL
FT                   SDHVLAIGISQRTSAKAITELAESLFEKSDYDTVIAIHIPHNHAMMHLDTVFTMINYDQ
FT                   FTVHPAILRDGGHVDAYIMHPGNNGEISITHETNLKEILKKALDKPEIDLIPTGGGDPI
FT                   IAPREQWNDGSNTLAIAPGVVVTYDRNYVSNDLLRKHGILVHEVRSSELSRGRGGPRCM
FT                   SCPIVREDLKK"
FT   gene            499724..500185
FT                   /locus_tag="Lreu_0446"
FT   CDS_pept        499724..500185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0446"
FT                   /product="transcriptional regulator, ArgR family"
FT                   /note="PFAM: arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82714"
FT                   /db_xref="GOA:A5VIP0"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIP0"
FT                   /protein_id="ABQ82714.1"
FT                   /translation="MDRKARRKYIEQVVNDRKIETQEELLKFLTEAGFETTQATISRDI
FT                   HALNIVKANDGDGHTHYVQLHVTPEHNFERLYQGIHDNVRTIETVQFMNVIKTALNSSY
FT                   ATILAGMFDELDIPEVVGTLAGNDTLIIISKDNDDAKMVYDLIIQHMHS"
FT   gene            500206..501627
FT                   /locus_tag="Lreu_0447"
FT   CDS_pept        500206..501627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0447"
FT                   /product="arginine:ornithine antiporter, APA family"
FT                   /note="PFAM: amino acid permease-associated region; TC
FT                   2.A.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82715"
FT                   /db_xref="GOA:A5VIP1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIP1"
FT                   /protein_id="ABQ82715.1"
FT                   /translation="MDEQKKGIGRGELIALIVSSCIGTGIFGITSDVAAAAAPGPALLA
FT                   WIFVGIGFLMLVLSLNNLSEKRPDLTSGIFSYAGAGFGPLGEFISGWSYWLSAWLGNIA
FT                   FATMLMSSIGTFFPTFKGGQNLPSIIIAIIFCWLLTILVNNGVESASFVNMIGTICKVL
FT                   PLVIFIIMMVVCFKAGMFTADFWGRVANNASHGTTTGSVWEQMKGTLMTLIWVFIGVEG
FT                   ASVMASRAKSLTAAREASLISFGLLVVIYVLISILPYGALTRAELAGMGQPAIGHVLQA
FT                   TVGSWGSILINVGLIISTIVSWLSWTMLPAETTMLVADDKAMPKIWGKVNAKKAPTASL
FT                   MITAVLQTIFLFSLLFTDKAYEFAYSLCSAAILFSYLFVGLYQMKYSSAHQEWGQFTIG
FT                   LLSAAFMFACMFLAGWQEVLLVSISFIPGFYIYYLACKENNRKVTTAEKWTMALILILS
FT                   VIAIWLVANGTIAIG"
FT   gene            501685..503082
FT                   /locus_tag="Lreu_0448"
FT   CDS_pept        501685..503082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0448"
FT                   /product="arginine:ornithine antiporter, APA family"
FT                   /note="PFAM: amino acid permease-associated region; TC
FT                   2.A.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82716"
FT                   /db_xref="GOA:A5VIP2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIP2"
FT                   /protein_id="ABQ82716.1"
FT                   /translation="MKEKKLNLFLLITLIVGTIIGGGIFNSPTDLILKANPMAALVTWL
FT                   IGGFGILMLVLVFYKLSVIKPEMNGGIYTYAKEGFGNYIGFNSFWGYWMGAVFGNIAFI
FT                   SLFFKTLNSMLGTHQLSPLMCFIGGSIILWGYTAITWFGVREASILNAVITIIKILPLL
FT                   LVVIVGVFAFQPHIFNVPDWTNILAVNQTQVPFKDQISGAMSTIVWCFVGIEAAVSMSR
FT                   RAKQPRDVGLATIISFVIVLVLYISISIIPMGILPAKELSQTSVPLAAALSHTALGIVG
FT                   SLIIKIGLLISLLGALLSWFMIGPEIAYVTSYDRDMPRAFKLVNRHGVPGFALIVYTII
FT                   MQVCLLVLLLPQLQMAYTIAYTLAATMTLVAYLLSALYGLKLAISEKMGLGFKIIATLA
FT                   SLYSVYMLVASGLEYVFASAIIFALGIPLFAGAPNKMSKKERWLATIIALAAVIALMLI
FT                   ITGKINF"
FT   sig_peptide     501685..501765
FT                   /locus_tag="Lreu_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.659) with cleavage site probability 0.598 at
FT                   residue 27"
FT   gene            complement(503465..504172)
FT                   /locus_tag="Lreu_0449"
FT   CDS_pept        complement(503465..504172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0449"
FT                   /product="CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /note="PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82717"
FT                   /db_xref="GOA:A5VIP3"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIP3"
FT                   /protein_id="ABQ82717.1"
FT                   /translation="MAKYHLHLAHLYGDLLNTYSDVGNIIALQYYAKQMDADIDVKVIS
FT                   IDNDFNPQDFDLALFGGGQDYEQLVVSKDLPNKKAGIDKFINDGKPLLAICGGYQLLGH
FT                   YYIGADGEKIPGLGILDHYTLSQDNHRFIGDITIKNEESNQEYHGFENHNGRTFLGKGE
FT                   RPLGKVISGNGNNGEDHTEGAIYKNTYCSYFHGPILTRNGEIAKKILLAALEHKYPDAD
FT                   LSSQKALKIKPTF"
FT   gene            complement(504172..505509)
FT                   /locus_tag="Lreu_0450"
FT   CDS_pept        complement(504172..505509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0450"
FT                   /product="domain of unknown function DUF1727"
FT                   /note="PFAM: Mur ligase, middle domain protein; domain of
FT                   unknown function DUF1727"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82718"
FT                   /db_xref="GOA:A5VIP4"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIP4"
FT                   /protein_id="ABQ82718.1"
FT                   /translation="MTVRSSFAEFAGRSSYWFLHTFMNGGSSLPGKLTLKLDPNILQAF
FT                   SKKYDLVIVTGTNGKTLTTALSVRVLREKYDQVLTNPTGSNMEQGIVTTFITAPRPKKK
FT                   GLAVLEVDEANVVKVCKYITPIAFVFTNIFRDQMDRYGEIYTTYNKILKGVKLAPKATI
FT                   IANGDEQLFNSKDLPNPIIYYGFNHEEKEPFNAPANTDGLLCPKCQHILKYRMRTYAGL
FT                   GNYFCPNCGFHRPELTYAVTKIDKLTPTHSTFEIDGQKYTIGIGGLYNIYNALAAYSLG
FT                   RFLGVSQAQIKDAFESDERVFGRQEVINIDGKQVTLILVKNPVGLNQVLDMIETDDKPF
FT                   SFAFLLNANYADGIDTSWIWDGDFEKLTQHQIPQYMTGGERYKDITTRLTMAGVKDMWH
FT                   EPDLTQVIDKIKEMPTEHVYILATYTAVLQLRKQLAEKGYIKGGMD"
FT   gene            505739..506314
FT                   /locus_tag="Lreu_0451"
FT   CDS_pept        505739..506314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0451"
FT                   /product="thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="PFAM: thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82719"
FT                   /db_xref="GOA:A5VIP5"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIP5"
FT                   /protein_id="ABQ82719.1"
FT                   /translation="MAQLFFKYGAMNSGKSIDILKVAHNYEEQGKPVVLMTSGVDDRSG
FT                   RGIIASRIGLERKVKPIMDDTNIYDYVNKMDRKIYCVLIDEAQFLKKEHVLQLIKIVDE
FT                   LNIPVMAFGLKNDFRNELFEGSKYLLIYADKIEEMKTICWFCPHKATMNLRIHNGKPVY
FT                   EGEQVQIGGNESYYPVCRKHYFHPQLKQ"
FT   gene            506330..507418
FT                   /locus_tag="Lreu_0452"
FT   CDS_pept        506330..507418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0452"
FT                   /product="bacterial peptide chain release factor 1 (bRF-1)"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82720"
FT                   /db_xref="GOA:A5VIP6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIP6"
FT                   /protein_id="ABQ82720.1"
FT                   /translation="MEMEEIFDKLQAVADRYDELNELISDPEVIADSQRFMKLSKEEGS
FT                   LRETVEKYNQYKKVTQTISDDEELLRETNDDDLTALTKEELAEAREEQAQLEKELEVLL
FT                   IPKDPNDDKNIIMEIRGAAGGDEASLFAADLYNMYLRYAEKQGWKVEVVDRNETEVGGF
FT                   KEIALMITGDKVYSKLKFENGAHRVQRVPVTESAGRVHTSTATVGVMPEAEDVDVDIDP
FT                   KDIRVDVYRSSGAGGQHVNKTSSAVRMTHLPTGIVVAMQDERSQQQNRAKAMRILKSRV
FT                   YDYYQQQEQSAYDQKRKDAIGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDKIMAGDL
FT                   DEIIEALIVADQTQKLEQLRNE"
FT   gene            507411..508277
FT                   /locus_tag="Lreu_0453"
FT   CDS_pept        507411..508277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0453"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82721"
FT                   /db_xref="GOA:A5VIP7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIP7"
FT                   /protein_id="ABQ82721.1"
FT                   /translation="MSSFVPTNYFMAQRWAKEQLQGKDIDPSAPQFLLQQSHGWDATHL
FT                   LLHNRDEMPADEVDWWKDAITRLLNHEPAQYIVGQAPFYGRTFKVNKNVLIPEAETAEL
FT                   IDWVLQEMPSRPLKVLDLGTGSGVIGITLALERPNWHVSLSDISPAALAVAQENMAKFN
FT                   LELPLIKSDLFENIDQQYDLIVTNPPYIDPDDTGEIDQAVLENEPALALFANERGLGFY
FT                   HRLFKQAGQYLTTTGQIFGETGYDQEESIQELLHQTDEHAQICPRHDVAGKMRMIHAWD
FT                   FSNAGGR"
FT   gene            508283..509311
FT                   /locus_tag="Lreu_0454"
FT   CDS_pept        508283..509311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0454"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82722"
FT                   /db_xref="GOA:A5VIP8"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIP8"
FT                   /protein_id="ABQ82722.1"
FT                   /translation="MDTKIFRHGEIAQAAAAIKRGELVAFPTETVYGLGADATNEKAVK
FT                   NVYLAKGRPSDNPLIVHVNSIAMVEKYAAEIPDNARKLMDAFWPGSLTIILKIKKGALS
FT                   KTVTGGLKTVAFRYPDCQPTLDLIEEAGVPMVGPSANTSGKPSPTTAQHVYHDLHGKIS
FT                   GIVDNGPTRVGVESTVLDMSTDHPVILRPGAVTKKDIEKVIGSIDLNHHKVGKNETPKA
FT                   PGMKYKHYAPKAQVYIVDEDTDWDKVVEWIRQQPFDVGMMAEEKVLQQEVLPMNAIQFS
FT                   LGKNVQDASARLFDGLRQFDDQPNVKAIVTQAFPAHDLGGAYMNRLNKSAGGMHFDSNA
FT                   VK"
FT   gene            509425..510660
FT                   /locus_tag="Lreu_0455"
FT   CDS_pept        509425..510660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0455"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase, major region;
FT                   glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82723"
FT                   /db_xref="GOA:A5VIP9"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIP9"
FT                   /protein_id="ABQ82723.1"
FT                   /translation="MNYGKKSPQLWAAIENEEQRQQDTIELIASENIVSDAVREAQGSV
FT                   LTNKYAEGYPNKRYYGGCEFIDQVEQLAIDYAKKLFNAAYVNVQPHSGSQANMAVYQAL
FT                   LKPGDVILGMGMDAGGHLTHGATVNFSGKLYKTYGYGLNPDTEELDYDEIMALAKKVKP
FT                   QLIVAGASAYSRIIDWQAFRKIADEVGAYLMVDMAHIAGLVATGTHPSPLPIADVVTTT
FT                   THKTLRGPRGGMILSKSTELGRKINSAVFPGIQGGPLEHVIAGKAQAFYEDLQPEYAEY
FT                   IQQVVKNAQAMEKVFNTSKQIRVVSGKTENHLLVLDLTKTGLTGKDAQNLLDRVHITTN
FT                   KEAIPNDPRSPFITSGLRIGTPAITSRGFKEEDAQKVAELISTALTNPTDEERLQEVAK
FT                   GVHELTTKYPLN"
FT   gene            510753..511388
FT                   /locus_tag="Lreu_0456"
FT   CDS_pept        510753..511388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0456"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82724"
FT                   /db_xref="GOA:A5VIQ0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIQ0"
FT                   /protein_id="ABQ82724.1"
FT                   /translation="MGKFEVLDHPLIQHKLTMIRDKNVGTKFFRETVKEISTLMAYEVA
FT                   RDMPLKDVEIETPIAKTTQKELAGKKVAIIPILRAGIGMVDGMTDLIPAAKIGFIGMYR
FT                   DEETLKPHEYFVKLPNDITERQLFIVDPMLATGGSAMMAIEALKKRGCSEKNMKFACLV
FT                   AAPEGVKAVRDAYPDVDIYTAGLDDHLNEDGYIVPGLGDAGDRLFGTK"
FT   gene            511519..513246
FT                   /locus_tag="Lreu_0457"
FT   CDS_pept        511519..513246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0457"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein, mobile region; PEP-utilising protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82725"
FT                   /db_xref="GOA:A5VIQ1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIQ1"
FT                   /protein_id="ABQ82725.1"
FT                   /translation="METQINGIAASDGVGIAPAYLLTKPNLSFEKYHISDPDSEKARLH
FT                   RAFEKIIQKLKETKKKLVDKLNAEDLTIFDTHIAILNDPEMIKQVENRITNQRLNAESA
FT                   FAEVITKMIKTLQAMTGNEYMQERASDFQNIQDQVLAELEEKKLPNLRELDHPVIVVAH
FT                   SIGPADTSQMDGRFVKGIITDLGGRTSHAAIMARSLQIPAIVGCNDITKKVQNGQRVIV
FT                   DGFEGSAIVEPSTNDVKQYQKIADKFMNVRQQWKKMINQPSATADGQRYKISANIGSSV
FT                   DISSAIENGADGVGLFRTEFLYMKSDHLPTEEEQFNAYRRAVEQLNGKRLVVRTLDIGG
FT                   DKPLQFMPLPKEMNPFLGYRAIRIALDQPEMFRTQLRALLRASEFGKINIMFPMITTLE
FT                   ELRAAKKIYYEEQQKLAVDHPGIGRDVHLGIMIEVPLAALNADRLAAEVDFFSIGTNDL
FT                   IQYCFAADRGNDSVSYLYQPLNPTFLKLIKHIIDAGHAHDTTVAMCGEMAGDRYALPLL
FT                   IGMGLDVYSMSASSILRTRSMMKQLDSKKCQKLYQQAVTTCDSMTGVKKLVQDWLVAN"
FT   gene            513348..514463
FT                   /locus_tag="Lreu_0458"
FT   CDS_pept        513348..514463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0458"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82726"
FT                   /db_xref="GOA:A5VIQ2"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIQ2"
FT                   /protein_id="ABQ82726.1"
FT                   /translation="MIKQYWTKQRIWLLIFLVVVGIGALLFTSHNEQFYQQPIAKVISE
FT                   KTVNRQRVKDQFDNVDHQYNQQLQVKLMNGKYRGQELTVQNTYSDSQPMDQRYRAGNEV
FT                   FLTQLRKRGGKLTANVNGYKRDTVIVFLLWLVVLMLLLLMGRSGLFAFLSVVINALLFI
FT                   IAIEIDLKQNGQHIMLLFSVLAIIFTFISLLLVLGFSKRMLATFAATVIGTFVALGVSM
FT                   LVFMWTHERGIYYESMEYVTQVPRPLFLAETLLGSLGAVMDESSDIIATLFELKQLNPA
FT                   VTRKQLFISGRNVGKSIMGPLINVLFLIFMVDTFTGSLLYIKNGNSWGYTYAMNMSLGT
FT                   IQSLISGIGIVLSVPLVSLFGALLLGKKVQR"
FT   sig_peptide     513348..513443
FT                   /locus_tag="Lreu_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.756) with cleavage site probability 0.726 at
FT                   residue 32"
FT   gene            514460..515233
FT                   /locus_tag="Lreu_0459"
FT   CDS_pept        514460..515233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0459"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82727"
FT                   /db_xref="GOA:A5VIQ3"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="InterPro:IPR014564"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIQ3"
FT                   /protein_id="ABQ82727.1"
FT                   /translation="MTTITGLGLVLLILMVLVGGKQGWTAFLSLLLNFGFLYFAIILVA
FT                   FHVPPLFVTVTIGITILAITIFMGEDDLRTTVTAFYASLSVLCLILVLIFIVEHWAMVQ
FT                   GFGTEDSDELEGMSILIGISYFKVSVTTTILSSLGAIAEAAMAISSGLTEILENHPERT
FT                   NRQLIHSGMAIGQQIIGTTFNTLFFGFFGGFLALFIWFLGLHYSFGTIMNNKIFVAEMI
FT                   EILISFIGVLITVPMTAWVMTKRRKSVIDNHPKTK"
FT   sig_peptide     514460..514522
FT                   /locus_tag="Lreu_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.854) with cleavage site probability 0.739 at
FT                   residue 21"
FT   gene            515393..516664
FT                   /locus_tag="Lreu_0460"
FT   CDS_pept        515393..516664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0460"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82728"
FT                   /db_xref="GOA:A5VIQ4"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIQ4"
FT                   /protein_id="ABQ82728.1"
FT                   /translation="MAHRDNVVLDVDERPAPWQWFGLSLQHMFSMFGSTVLVPILVGLN
FT                   PGIALFSSGVGTLMYLLITKHKIPAYMGSSFSFVVPMMALMKTTGYPGIVQGTIAVGCV
FT                   YLIMSVIVTLVGSQWIDRILPPIVVGPIVVVIGLSLAGTAAKDATINSATGHYDLRFFA
FT                   VAMLTMAITVIFNMYFKGFLGLIPILMGIVAGYIIAILFGIVNFSPVAHAHWFSLPDFQ
FT                   IPFVDYHPQLYWGAILSMAPIAFVTMTEHLGHIMVLNELTERNYFKEPGLNHTLAGDGT
FT                   ASIIAGFVGGPPVTSYGENIGVMAITRVHSVYVIAGAAVFAIFFSFIGKLSALIESIPS
FT                   PVIGGISFLLFGVIASSGLRVMIENKIDFNEKRNLMISSVILVIGIGNAYLQLGKYQFS
FT                   GLAVAAVLGIIMNLILPQKAKSEM"
FT   gene            516979..517686
FT                   /locus_tag="Lreu_0461"
FT   CDS_pept        516979..517686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0461"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82729"
FT                   /db_xref="GOA:A5VIQ5"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIQ5"
FT                   /protein_id="ABQ82729.1"
FT                   /translation="MGGDALTFKLFGLTFNTTNIVSGLIIYAIVFFTLYGMSRKIQMKP
FT                   TGAQNVFEWLVDFTNGIVRSQMPASEQGHYSFFAFVLFVFIFFANQFGLIFQFHWNGAE
FT                   VLRSPTADPVVTLTLSLMVMVLAFAAGVAHNGLGGYLKGYTKPFTLMLPVNIIEDFANF
FT                   LTLGLRIFGNIFAGELLMSLIANMAFSHGILTIIPGLFLELAWQGFSVFIGSIQAYVFV
FT                   TLTTVYISRKISE"
FT   gene            517711..517929
FT                   /locus_tag="Lreu_0462"
FT   CDS_pept        517711..517929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0462"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82730"
FT                   /db_xref="GOA:A5VIQ6"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIQ6"
FT                   /protein_id="ABQ82730.1"
FT                   /translation="MALGAIAAGLAAMGAAIGGGIGDGILIGHTVDSIARQPELQSRLQ
FT                   ATMFIGVGLIEAMPIIAIVIGFLVMNK"
FT   sig_peptide     517711..517767
FT                   /locus_tag="Lreu_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.877) with cleavage site probability 0.801 at
FT                   residue 19"
FT   gene            517975..518493
FT                   /locus_tag="Lreu_0463"
FT   CDS_pept        517975..518493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0463"
FT                   /product="ATP synthase F0 subcomplex B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82731"
FT                   /db_xref="GOA:A5VIQ7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIQ7"
FT                   /protein_id="ABQ82731.1"
FT                   /translation="MFVNSVLAESNSLYIGDLVFYIVTFIILMLLVKHFAWKPVTDMMK
FT                   KRADKIANDIDNAARSRESAEKMAAKRQAELQSSRQEAAEIVSNAKKSGETQRAQIVET
FT                   AQKDAQALKQQAQKDAEQARRDALNSAKDDVANLSIEIASKLIQKELKADDQKELIDSY
FT                   IEGLVEHES"
FT   gene            518483..519025
FT                   /locus_tag="Lreu_0464"
FT   CDS_pept        518483..519025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0464"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82732"
FT                   /db_xref="GOA:A5VIQ8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIQ8"
FT                   /protein_id="ABQ82732.1"
FT                   /translation="MSLDKKTVADRYAKALFELVDADNELDQTYQELIALRQVFEDNEG
FT                   LDAALAGVQLSLDEKKSLIKDLQQGASKYVANLIQMVFDYGRIDCMVAIIDEFERRYDR
FT                   KMKRMHADVTTAIQLDKQQEDQLKANLAKRFGANEVTLTKHVDPEILGGVIVHVDNKTL
FT                   DGSLSSKIKQIRRLLVR"
FT   gene            519057..520586
FT                   /locus_tag="Lreu_0465"
FT   CDS_pept        519057..520586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0465"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82733"
FT                   /db_xref="GOA:A5VIQ9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIQ9"
FT                   /protein_id="ABQ82733.1"
FT                   /translation="MSIKTEEISSLIKKQLANYQDKVSVEETGTVTYVGDGVARADGLD
FT                   NAMAGELLEFSNGVYGMAQNLESNDVGIVILGDYTGIREGDTVKRTGRIMEVPVGDALL
FT                   GRVVDSLGRPIDGLGEIKTDKTRPIERKAPGVMERKSVSVPLQTGIKVIDALVPIGRGQ
FT                   RELIIGDRKTGKTAIALDTIINQKNQDVICIYVAIGQKESTVRASVETLRKYGALDYTI
FT                   VVSASASNPAPMLYIAPYAGAAMGEEFMFNGKDVLIVYDDLSKQADAYRELSLILRRPP
FT                   GREAYPGDIFYTHSRLLERAARLSDDLGGGSMTALPIIQTQAGDVSAYIPTNVISITDG
FT                   QIFLDSDEFYAGQRPAIDAGTSVSRVGGDAQIKAMKKVAGTLRLDIASYNELASFAQFG
FT                   SDLDAATQAKLARGQRTMEVLKQGLHDPLPVEEQVVTLFALSRGFIDKVEIEDVQRYES
FT                   ELAAYMHANHQDLYDTIKKTGKLPEGDDLQNAVAKFSETFQGTKKQVAEEK"
FT   gene            520622..521566
FT                   /locus_tag="Lreu_0466"
FT   CDS_pept        520622..521566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0466"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82734"
FT                   /db_xref="GOA:A5VIR0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIR0"
FT                   /protein_id="ABQ82734.1"
FT                   /translation="MPASLAAVKHKIDSTKSTRQITSAMQMVSTAKLNQIQHHTQTYEV
FT                   YAEKVKQMLSDLVKSHSATSAASQDDVYAALFKKRAVKKTGVLVITSDRGLVGSYNSNI
FT                   IKQTLDMMAKHNLDKDNTVFLTVGKTGTEFFKKRGMNVVYEYSGVSDVPTYREVHSIVK
FT                   TAVQMYSDQVFDEMYMVYSHYVNRITSNVIVHDVLPITEKSLLDDENEAQENTELNNSD
FT                   VSTAHVSAEYEFEPSDTEIISALVAQYAESLIYGAILDAKTSEHSSSANAMRSATDNAD
FT                   DIISTLELQYNRARQAAITTEITEITGGMTAQE"
FT   gene            521593..523020
FT                   /locus_tag="Lreu_0467"
FT   CDS_pept        521593..523020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0467"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82735"
FT                   /db_xref="GOA:A5VIR1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIR1"
FT                   /protein_id="ABQ82735.1"
FT                   /translation="MSSGKVLQVIGPVVDVEFPLDEKLPEINDALKIKESDGKTLTTEV
FT                   ALELGDGVVRTIAMDGTDGLQRGMEVENTGASISVPVGDDTLGRVFNVLGEPVDNGPKF
FT                   GPDAKRMPIHRDAPKYDDLNNATEILETGIKVIDLLAPYVRGGKIGLFGGAGVGKTVLI
FT                   QELIHNIAQGHNGISVFTGVGERTREGNDMYYEMKASGVLEKTAMVYGQMNEPPGARMR
FT                   VALTGLTIAEYFRDVKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMG
FT                   QLQERITSTKKGSITSIQAVYVPADDYTDPAPATTFAHLDATTNLERRLTQIGIYPAVD
FT                   PLASTSTALTPEIVGKEHYEVATQVQHVLQRYHELQDIISILGMDELSDEEKTIVARAR
FT                   RIQNFLSQSFSVASQFTGLPGKYVPLKETIKGFKEILAGKYDDLPEEAFRLVGPIEDVV
FT                   EKAKKMKAETDEDSSED"
FT   gene            523032..523463
FT                   /locus_tag="Lreu_0468"
FT   CDS_pept        523032..523463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0468"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82736"
FT                   /db_xref="GOA:A5VIR2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIR2"
FT                   /protein_id="ABQ82736.1"
FT                   /translation="MAENTFKVTIITPDGTVYDNDKVTMLVMNTAGGQMGIMANHVPLI
FT                   AALEISTVRIKHSEGTDEVAAVNGGIIQFDGQNATIAADSAEMPEAIDVERAQRAKKRS
FT                   ESAIAEAKKKHNQSDLSRAEVHLKRAINRLNAASKQRNI"
FT   gene            523699..523929
FT                   /locus_tag="Lreu_0469"
FT   CDS_pept        523699..523929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0469"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: conserved hypothetical protein, integral
FT                   membrane YwzB"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82737"
FT                   /db_xref="GOA:A5VIR3"
FT                   /db_xref="InterPro:IPR009526"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIR3"
FT                   /protein_id="ABQ82737.1"
FT                   /translation="MQITGLRALIEIIVQLAFVWLAFFAIQGIHFEHFFNRPPRTLPLL
FT                   IVLMATGLGYLCATFFLNILSAIGNLTYLIR"
FT   gene            523948..525264
FT                   /locus_tag="Lreu_0470"
FT   CDS_pept        523948..525264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0470"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82738"
FT                   /db_xref="GOA:A5VIR4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIR4"
FT                   /protein_id="ABQ82738.1"
FT                   /translation="MEKIVVRGGQRLTGRVKVEGAKNAVLPIQAASILASSGNIKLSNV
FT                   PILSDVTTMNQLLRFLNIKVDFDKDKHVLTIDAADPVSSEAPLEYVSRMRASMVVLGPL
FT                   LARTGHAQIALPGGCAIGSRPIDLHLKGLRQLGAIIEQHDGYLEARAEHLIGDHIYLDF
FT                   PSVGATQNLMMAATLAQGITTIENAASEPEIVDLANLLNKMGARVHGAGTDIIRIQGVN
FT                   FLHGCEHTVMPDRIEAGTFMIATAITNGDVVVEGAIAEHNTSLIAKLEEMGVTVIVQED
FT                   GIRVLGTSVLIPTNIKTLPYPGFPTDLQPQMSILQLLANGTSTLDETIFEKRFMHLEEL
FT                   RRMNADFQINGPVAVLNGPTHFSGAEVAASDLRAGAALVLAGLVADGITQVRNLKYIDR
FT                   GYYHLHQKLQQLGAKIDRIDVEDKIKLAVKPSKNKTNQD"
FT   gene            525371..526363
FT                   /locus_tag="Lreu_0471"
FT   CDS_pept        525371..526363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0471"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82739"
FT                   /db_xref="GOA:A5VIR5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIR5"
FT                   /protein_id="ABQ82739.1"
FT                   /translation="MAKDIGIDLGTANVLIYVQGKGIVLNEPSVVAVDTKTNKVLAVGS
FT                   EAYRMVGRTPSNIRAIRPLKDGVISDFDVTQEMLSYFIGKLSVKGFMSKPNIMICAPTN
FT                   ITEIERKAIIQAAEQSGGGKVYLEYEPKVAAIGAGLDIFKPRGNMVIDMGGGTSDIAIL
FT                   SLGDIVSSQSIRMAGDKMNSDIASYIKNKHGLVIGEHTAEKIKMELGTALRVDDPETMD
FT                   VRGRDVATGMPKQITVNENEIEEALHDTLEQIVSAAVNVLETIPPELASDIIDRGIMLT
FT                   GGTSLLKGVDQLFSARLKVPVVVSQDPLDNVAKGAGEMLERMQKTERKK"
FT   gene            526369..526605
FT                   /locus_tag="Lreu_0472"
FT   CDS_pept        526369..526605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0472"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82740"
FT                   /db_xref="GOA:A5VIR6"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIR6"
FT                   /protein_id="ABQ82740.1"
FT                   /translation="MVRILCDLIRWYQQGISAQRPFRVCRFTPSCSQYMLEALQRFGLK
FT                   GILLGSWRLLRCQPFSRGGYDPVPNHFTFRRQG"
FT   gene            526629..526853
FT                   /locus_tag="Lreu_0473"
FT   CDS_pept        526629..526853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82741"
FT                   /db_xref="InterPro:IPR021351"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIR7"
FT                   /protein_id="ABQ82741.1"
FT                   /translation="MSKKDKKVEVSVKDIERHNQPVQQIFIGDRLIGEVVTDNERFKAM
FT                   LISNQSEFYVRSQEEGLEIVLQQYHLHQH"
FT   gene            526902..528095
FT                   /locus_tag="Lreu_0474"
FT   CDS_pept        526902..528095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0474"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82742"
FT                   /db_xref="GOA:A5VIR8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIR8"
FT                   /protein_id="ABQ82742.1"
FT                   /translation="MQRSQNDVESRIDWGIIFCVLLLALIGLASIYVAAVHDRQQTSVA
FT                   RQVITQLVWYAVGTILIIVIMQFDAEQLWKLAPIVYWLSVFLMFAILVFYSRAYYASTG
FT                   AKSWFAIGPFTFQPSEIMKPAYILMMGRVITTHNNRYSVHTVDSDWRLIGTMFLWLLPI
FT                   LVSLKFQNDFGTGLVFFAIFCGMVLVSGVTWRILAPAATILVVVGGSALAMVTSSVGRQ
FT                   ILEHVGFQAYQFDRVDTWLHPEQDTTNQGYQLWQSIKAVGSGGITGTGFNNSKVYVPVR
FT                   ESDMIFSVIGENFGFIGGVLLILIYLLLIYLMIRVTFDTKNEFYAYISTGVIMMILFHV
FT                   FENIGMNIGLLPLTGIPLPFISAGGSSLIGNLIGIGMVMSMRYHHHSYMFSSNREFR"
FT   gene            528108..528401
FT                   /locus_tag="Lreu_0475"
FT   CDS_pept        528108..528401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0475"
FT                   /product="glycine cleavage H-protein"
FT                   /note="PFAM: glycine cleavage H-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82743"
FT                   /db_xref="GOA:A5VIR9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIR9"
FT                   /protein_id="ABQ82743.1"
FT                   /translation="MAKDYFWVKEQADGTKRVGLNDEGRDELGEVSFIDVPAVGTTLKQ
FT                   ADKFIAVEAEKAVTDVDSPIDGKITKLNEAIIDDPAGLNSSDMEKNWIVEVK"
FT   gene            528593..529975
FT                   /locus_tag="Lreu_0476"
FT   CDS_pept        528593..529975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82744"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIS0"
FT                   /protein_id="ABQ82744.1"
FT                   /translation="MDILTEIEQNLVKSGSLFEAEQIILKGVLELGQVIMQNFLESLDR
FT                   SLKSQAPANYQVINKQPRTLNFIFGPVTFQRRYYQAGTKKREFYLDQQLKIKPRRRLSP
FT                   HYLMMMAKIAQTTTMRNTADILNLVFDSGITADSVMHAVHELGNQVAKQTQAKEHQATP
FT                   RHMPKNLTIEGDAFMIKGKKEAGQLTLVHHYRVYERVANQIINRHDFLSVGHQGRLEAR
FT                   LSDYLDRHYKLAGQTIFLASDAGPGYEPAKLLSLVPQGAHGEYFLDRYHCLQKIEHTLG
FT                   RHNELAMRAIKAVRHHDQAELTIILDTYESQNLTEKQADDLMRLRKYLQRNWRYILSPQ
FT                   MRGFKDIHLIGSVESSHRAFTYRMKKQGKSWTKQGAKAMIGLIEARMNGELQASLNTIL
FT                   EQLTVLPRVAQTSLLQEMHIRTGEFLRKAPTKPSIGVVQGIIPINTATSRPIGQLFKAL
FT                   TH"
FT   gene            530114..531250
FT                   /locus_tag="Lreu_0477"
FT   CDS_pept        530114..531250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0477"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="TIGRFAM: D-alanine--D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82745"
FT                   /db_xref="GOA:A5VIS1"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIS1"
FT                   /protein_id="ABQ82745.1"
FT                   /translation="MTQKLHIALLFGGNSSEHDVSKRSAHNIYDALDKEKYDVSLFMFT
FT                   KDGILLGNEDSQKIFDGEPEDQVVAEAYQKMDMSSPLAPIMALNEQKEIDFFFPVIHGN
FT                   LGEDGTIQGLFKLLNKPYVGSNIAASAMSFDKDLTKKIISQAGIRNTPYVVVTPENQAD
FT                   YSWGRIEEKLGNLTFVKPAKQGSSVGIHRVTNAEEYEKALDDAFKYDYKILVEQGIANP
FT                   QEIEISILGNEHPIASKLGAVRVPKDDPFYDYENKFVDASGVVFELPVKLPQYLVDEIT
FT                   DMALKAYKALGMKGMARIDFLVDSNNVPYLGEPNTLPGFTNISLYPQMWEVSGISYSDL
FT                   IDRLIQLGLQEFERNSKIKYDFRKLGTERVGQKKYNED"
FT   gene            531685..532530
FT                   /locus_tag="Lreu_0478"
FT   CDS_pept        531685..532530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0478"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82746"
FT                   /db_xref="GOA:A5VIS2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIS2"
FT                   /protein_id="ABQ82746.1"
FT                   /translation="MRLRGDVLKQIRRKRGLSQTALAEGICTQATISLMEKQNRLPKMD
FT                   ILTAICERLNISSDRIVENEVSGINETFNQIVDNLISRNFEDASALLKKVHVKNLESDF
FT                   DKQRYYYLVGMVQVENNQIDEAIFNFELVLTQFATTSANIYLAMTTAGMALAYLKRGDK
FT                   ERAARLTNRSVKLIDNKKLIGSLHQWASIDCQIAALYLQLEDPDNAIEVANKGIELCRE
FT                   HDSLFLLDELYLCIGRSYILKNDKEEAKKALKIAESLSIARNGSVAEDTILLELKNLEI
FT                   "
FT   gene            532927..534342
FT                   /locus_tag="Lreu_0479"
FT   CDS_pept        532927..534342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0479"
FT                   /product="sugar transporter"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: sugar transporter; PFAM: General substrate
FT                   transporter; major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82747"
FT                   /db_xref="GOA:A5VIS3"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIS3"
FT                   /protein_id="ABQ82747.1"
FT                   /translation="MAKAEKKISSAFIYFFGSFGGILFGYDIGVMTGALPFLQADWHLE
FT                   NAASLVGWITSAVMFGAIFGGALAGQLSDKFGRRKMILMSAIVFMVFSVLSGVSPDMGE
FT                   ASAYYLIIVRMLLGLAVGAASALVPAYMSEMAPAKARGRLSGLNQTMIVSGMLLSYVVD
FT                   FLLKDLPGEWAWRLMLGLAAVPALILFLGVLRLPESPRFLLRKGDEAQARKVLSYIRKN
FT                   PAEIDQELASIKETAKEERQANQKTSWSTLFSGKYRYLVIAGVGVAAFQQFQGANAIFY
FT                   YIPLIVQKATGQAASSNLMWPIVQGVILVVGSLVYMWIADKFNRRTLLMVGGAVMGLSF
FT                   ILPAVINWMMPNMNPMTIVVFLCIYVAFYSFTWAPLTWVLVGEIFPLAIRGRASGLASS
FT                   FNWIGSWLVGLIFPIMTASMPQEAVFAIFGIICILGVLFVKTCVPETRGHTLEEIEEQG
FT                   TNHGRVKASNPEN"
FT   gene            534355..535977
FT                   /locus_tag="Lreu_0480"
FT   CDS_pept        534355..535977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0480"
FT                   /product="carbohydrate kinase, FGGY"
FT                   /note="PFAM: carbohydrate kinase, FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82748"
FT                   /db_xref="GOA:A5VIS4"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042029"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIS4"
FT                   /protein_id="ABQ82748.1"
FT                   /translation="MNLRETATQVKNGQASLGIELGSTRIKAVLINPDFETISSGSYTW
FT                   ENQLKDGIWTYPLDQVWEGIQAAYAKIKADVQSKYHVSLDEISSIGVSAMMHGYLPFDK
FT                   NNQLLVPFRTWRNNITEESADKLTDLFDFNIPQRWSIAHLYQAILNKEPHVKDVDFITT
FT                   LAGYVHWKLSGEKVLGIGDASGVFPIDDQTLTYRQDFIEKFNSLPEVEQYPWQLKNILP
FT                   AVLVAGRDAGHLTADGAKLLDPSGTLQAGSLMAPPEGDAGTGMVGTNSVRKRTGNISVG
FT                   TSAFSMNVLDAPLKKLHRDIDIVTTPTGDPVAMVHINNCSSDINAWVGLFRDFANAIGA
FT                   KIDTNTLYETLFDSTVHSDPDAGGLINYSYLSGENITKIQEGRPLFVRTPNSKMNLANF
FT                   FLTQLYAAFAPLKIGMDILLNEEHVQTDVMVAQGGLFGTPVIGQQVLANALNIPITIMN
FT                   TASEGGPWGMAVLAKYAETYGKESLADYLDEKVFKNPESMTLTPESAGVKGYESFITRY
FT                   QAGLPVEALAGDDIKEREEKGSK"
FT   gene            535981..536709
FT                   /locus_tag="Lreu_0481"
FT   CDS_pept        535981..536709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0481"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="PFAM: class II aldolase/adducin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82749"
FT                   /db_xref="GOA:A5VIS5"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIS5"
FT                   /protein_id="ABQ82749.1"
FT                   /translation="MLEDLKKEVYEANMRLPKLGLVSFTWGNVSGIDREKGLFVIKPSG
FT                   VPYEEMKPEDMVVVNLDGEVVEGDLNPSSDTPTHTYLYNHFPKIGGVVHTHSPWAVAFA
FT                   AARMDVPAMNTTHADTFYTDVPAADALTKEEIEEDYEGNTGKVIVRSFKERGLDYEATP
FT                   AALVMQHGPFTWGPTPDKAVYNAKVLEVVAEEDYHAMQLTHQDLHLPQYLLDKHYYRKH
FT                   GANAYYGQNNAHSKDHAAHA"
FT   gene            536763..538184
FT                   /locus_tag="Lreu_0482"
FT   CDS_pept        536763..538184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0482"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="PFAM: L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82750"
FT                   /db_xref="GOA:A5VIS6"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIS6"
FT                   /protein_id="ABQ82750.1"
FT                   /translation="MDIKNYEFWFVTGSQFLYGEEQLKSVAADAEDIVNKLNESGKLPY
FT                   KVVFKGVMTTAEGITKFMKEANYNDNVAGVMTWMHTFSPAKNWIRGTKLLQKPLLHLAT
FT                   QYLNKIPYDTIDFDYMNLNQSAHGDREYAYINARLQKHNKIVYGFWGDEEVQEEIADWQ
FT                   NVAVAYNESFNIKIVRFGDTMRNVAVTEGDKVEAQMFLGWTVDYWPVSDLVEYVNGISE
FT                   EEIDAAYKDLASRYEMVQGDNTKEHYEHSVRYQLCEYLGLKKFMDEKGYTGFTTNFEDL
FT                   HGLEELPGLAAQLLMRDGYGFGAEGDWKSAGMDRLLKIAADNVATAFMEDYTLDLRPGH
FT                   QAILGSHMLEVDPTIASDKPRVEVHPLDIGGKDDPARLVFTGREGKAVDVTLSYFNDGY
FT                   KVIGYSVDCHKPEAETPHLPVAKQLWTPTVGLKEGAERWMHAGGGHHTILSFSLKPQQI
FT                   KDLFGMLDVKVDFIE"
FT   gene            538270..538839
FT                   /locus_tag="Lreu_0483"
FT   CDS_pept        538270..538839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0483"
FT                   /product="Maltose O-acetyltransferase"
FT                   /EC_number="2.3.1.79"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82751"
FT                   /db_xref="GOA:A5VIS7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIS7"
FT                   /protein_id="ABQ82751.1"
FT                   /translation="MKTEKEKMLAGEVFNVYDPELVKERQYARQLVERFNALGEMNPTA
FT                   SNTVIRQLFGHVGEKCEVHSQFKCDYGYNIYVDDDFFANYDCVMLDVSPIRIGKHCLLG
FT                   PRVQIYTVNHPLDPRLRRNGAYGQSKDVTIGDDAWIGGGAIICPGVTLGNNVIVGAGSV
FT                   VTKSFGDNVVIAGNPARIIKKNPYVE"
FT   gene            complement(538928..539770)
FT                   /locus_tag="Lreu_0484"
FT   CDS_pept        complement(538928..539770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0484"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82752"
FT                   /db_xref="GOA:A5VIS8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIS8"
FT                   /protein_id="ABQ82752.1"
FT                   /translation="MNNDVKQLLLADGQSMPQEGFGLYKITDQSTITSAIKYAYDAGYR
FT                   LFDTAQLYKNEAEVGNALQELGLPREELFITTKVSEPNQGFKQTIDSVKDSLQKLKLDY
FT                   VNLLLIHWPIERAFFDTWAALEELKKEGLTRSIGVSNYQMIHLQYLATQAHEMPVINQI
FT                   ERHPHLNQQPLLQYDKEHDIITQAWSPLGRGTILDNPTLNKIAANHHKSAAQVVLRWHL
FT                   QSGVAFIPKSVHEARIKQNINIYDFTLSDEEMTAINNLNNFTRVGKEPALVYEYNLKY"
FT   gene            complement(539763..540860)
FT                   /locus_tag="Lreu_0485"
FT   CDS_pept        complement(539763..540860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0485"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82753"
FT                   /db_xref="GOA:A5VIS9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033532"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIS9"
FT                   /protein_id="ABQ82753.1"
FT                   /translation="MEVKYETVKQTLRNEIIDGKYKINEKLPTESALMKRFNVSRYTIR
FT                   RAVGDLENEHYIYRIQGGGMFVQDWQRDWTKSEKNKIIGVISTHMADYIFPPIISGIDS
FT                   VVTEQGYSMIVGNTLNDHKRERQTILNMLDLQIAGLIIEPTESAMPNPNLDLYRQVQKY
FT                   KIPTILFHSTYPGFDFPSLLTKDREAEEELVKYLFSLGHTNILGVFQIDDQQGVDRMAG
FT                   MIKAYQDNNIPTTKSNVIMYQSSEDYEDIIKKVDMMLNSNNDITAIACYNDRLATRVIS
FT                   HLQKQGKQVPTDISVIGFDNYEMAQIISPSLTTANHPKRQLGEDAGKMILKMIAGEEVT
FT                   SKVYPPTIIKGQSTAPLITKENSNE"
FT   gene            complement(540972..541460)
FT                   /locus_tag="Lreu_0486"
FT   CDS_pept        complement(540972..541460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0486"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82754"
FT                   /db_xref="GOA:A5VIT0"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIT0"
FT                   /protein_id="ABQ82754.1"
FT                   /translation="MAQEYKHILVPVDGSKEAELAFKKAVAVAKRNGADTELRLLHVVD
FT                   TRAFQNISSFDTSMVEQVTETAKKTLDKYIDYAKEHGVENASYSIEYGAPKTIIARDMP
FT                   KEMGADLIMIGATGLNAVERILIGSVTEFVTRTAICDVLVVRTDLDNKPIENPKKRRF"
FT   gene            complement(541544..541840)
FT                   /locus_tag="Lreu_0487"
FT   CDS_pept        complement(541544..541840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82755"
FT                   /db_xref="GOA:A5VIT1"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIT1"
FT                   /protein_id="ABQ82755.1"
FT                   /translation="MLLPLLMTLFGLIALFEGIFLLTHIHKPFLVFDPTKSKYLAPQLK
FT                   NWGIVMTIVGILSIISGWTNNTGFLVIMVIIGCVSETLMAFAITADFRINHRK"
FT   gene            complement(542146..543450)
FT                   /locus_tag="Lreu_0488"
FT   CDS_pept        complement(542146..543450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0488"
FT                   /product="Recombination protein MgsA"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82756"
FT                   /db_xref="GOA:A5VIT2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIT2"
FT                   /protein_id="ABQ82756.1"
FT                   /translation="MQQPLAYRMRPRTLDEVVGQQHLVGPGKIISRMVKAKMLSSMILY
FT                   GPPGTGKTSIASAIAGSTKYAFRKLNAATDTKKDLQIVAEEAKMSGTVILLLDEIHRLD
FT                   KVKQDFLLPHLENGRIILIGATTENPYISINPAIRSRTQIFPVHPLSTAEMKTAIQHAL
FT                   VDKERGLGNLPLVLEENAEDQLVAATNGDLRSALNGLELAAKSTDPSEDGKIHLTLPII
FT                   EESVQKKALSADKDGDAHYDVISAFQKSIRGSDTDAALHYLARLIEAGDLPIIARRLMV
FT                   TAYEDIGLANMPAVQRAVTAVQTAERVGFPEARIPLADAVIELCLSPKSNSGINAIDEA
FT                   LAQVRQGGFGDVPAHLKDAHYKGAAKLGHGIDYDYPHDHPQDWVAQQYLPDRIKDAQYY
FT                   QPKNNGRFEASLGRQYWQLRKAQQHTLRGKHHPSK"
FT   gene            complement(543454..543942)
FT                   /locus_tag="Lreu_0489"
FT   CDS_pept        complement(543454..543942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0489"
FT                   /product="protein of unknown function DUF1694"
FT                   /note="PFAM: protein of unknown function DUF1694"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82757"
FT                   /db_xref="InterPro:IPR012543"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIT3"
FT                   /protein_id="ABQ82757.1"
FT                   /translation="MSEQEKSAAQQRIDNAVYGTPKIKPDEQRKYLGTFRERVCLTISV
FT                   QELQEQDWTKALTAELDRGIGNLVFINGNLPHDEIHPYIQTAAKDNAQFTLKTDPEYKT
FT                   DLDSLAVVVAAKTAVYQSPVDVKKRYPNLVNSNNSTTEKTNDQHQSFFHHLFHRKDRG"
FT   gene            544068..544349
FT                   /locus_tag="Lreu_0490"
FT   CDS_pept        544068..544349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82758"
FT                   /db_xref="GOA:A5VIT4"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIT4"
FT                   /protein_id="ABQ82758.1"
FT                   /translation="MIIMFSAVFWVLAFWFIVNLVWTIARLNNRMMSRTFAWINVVAVV
FT                   IGFWTFYAASNGGGGIAPWFRLMNWTNIVLAIFQFYNGYCPHQYGKKS"
FT   gene            complement(544407..544814)
FT                   /locus_tag="Lreu_0491"
FT   CDS_pept        complement(544407..544814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0491"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82759"
FT                   /db_xref="GOA:A5VIT5"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIT5"
FT                   /protein_id="ABQ82759.1"
FT                   /translation="MAFNKSLAGYFDDVQHIGIPTDDMAKTIAFWEKLGFKKLGEFDTD
FT                   DQGNEVVFMQYGHLTLEIWTGDGAVHETGAINHISLNTSDVDAAFKAAKAEGFKLKDNE
FT                   VQHLDFWDKGIKFFNIEGPNSETIEFCEIVK"
FT   gene            complement(544839..545582)
FT                   /locus_tag="Lreu_0492"
FT   CDS_pept        complement(544839..545582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82760"
FT                   /db_xref="GOA:A5VIT6"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIT6"
FT                   /protein_id="ABQ82760.1"
FT                   /translation="MEQEKVPVQGQVAERTISLTASWAYFALSIVINSMGNVLTLVTSS
FT                   HVHPQFLGSAYWTAAENNLGIAVLGNNSMTLFWAFMVLGMLTSVLNAILMHKWDWRRIG
FT                   GNFIFMLPFSIFIQWFSDIFNRIMPDATTLPMIILYVFINFLGVAFIGTAISIYQRVNL
FT                   VLHPADDLFQIIRFRYCHGNATIAMWLSYIPPTIMAIIAAFMQGGIYNFGLGTLFALAF
FT                   QGAITGWADRYIFPKLKHQALDIGN"
FT   gene            545835..546584
FT                   /locus_tag="Lreu_0493"
FT   CDS_pept        545835..546584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0493"
FT                   /product="protein of unknown function DUF328"
FT                   /note="PFAM: protein of unknown function DUF328"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82761"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIT7"
FT                   /protein_id="ABQ82761.1"
FT                   /translation="MKIIISPARTMQVDTDSLLYKDLPEFLQQTKDILGWMRSLSYDEL
FT                   HKVWGNCSSRLAMKNYQWLQQMDLQRKLTPAIIAFTGLQYQYMAPSVFSEDGLKYVQDN
FT                   LRILSGFYGILRPFDGIIPYRLGMGDMAPVNGYKNLYDFWGEQLYHELYKNNDLVISLA
FT                   SVEYEKAITPYLQTQDRFIKCIFGEEINGKIKQKATLAKMARGNMVRYLAENQIQTIEG
FT                   VKQFNIGGYRFREDLSTDEKLVFELVK"
FT   gene            546700..548430
FT                   /locus_tag="Lreu_0494"
FT   CDS_pept        546700..548430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0494"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein, central
FT                   region; thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82762"
FT                   /db_xref="GOA:A5VIT8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIT8"
FT                   /protein_id="ABQ82762.1"
FT                   /translation="MVGDSLNKTGANLLIKALQENNINRMYGIVGIPVTDLARLAELRG
FT                   MKYYGFRREDSAVNAAAATGYLTQKPGVALTVSAPGFLNGLTALAQATKNCFPLIMISG
FT                   SSERHIIDLSQGDYEGLDQYNAAKPFCKKAYRVDRAEDMGLAVARAIRTAVSGRPGGVY
FT                   LDIPADTIVQEDDADQSSLGVYKLVDPAPKQVPNDEAISRAVDLIKNAKKPLIILGKGA
FT                   AYDRTEKQVQQLVAETNIPFLPMSMAKGLIPDDSPHSAAAARSLSLRNADVVIVIGARL
FT                   NWMLSYGDAPQFNPHAKFVQLDIDATQFDSSQPISAPLQGDLKSILDKLVPALLATGYQ
FT                   APEEWLEQIAQDTEKNDKKFAQRIANGKVAQNFGYYGAIAPIAEYFQQHPDTYLVSEGA
FT                   NTLDIGRDMIGMQLPRHRLDTGTWGVMGVGLGYAIAAAVETGKHVVALDGDSAFGFDGM
FT                   EIETICRYKLPITVVIINNGGIYNGIGQVVPNQLGPTTLDPTARYDLMAKAFGGDNYFV
FT                   SDYDEMKNVFARAVDSGRPNIINVQIAPSMGKESGHIGNLNPKLNLQPLEENERSHHND
FT                   "
FT   gene            548423..549277
FT                   /locus_tag="Lreu_0495"
FT   CDS_pept        548423..549277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0495"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82763"
FT                   /db_xref="GOA:A5VIT9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIT9"
FT                   /protein_id="ABQ82763.1"
FT                   /translation="MTEQSENAPLKGIKVVDWTQVQSGPSCTQLLAWLGADVIKIERTN
FT                   TGDPTRNELLDIKDSWSLYYLQLNANKKSLTLDIKTPEGQKIMYDLLKKADVFVENIRP
FT                   GAATRAGFGWKKVHELNPRLIMASLKGFNKGSRFANVKAFEPVAQSAGGAASATGWNEG
FT                   DANIPTQSAAALGDSNSGMHLTIAILAALLQREHTGKGSYVYQSMQDAVINLCRIKLRD
FT                   QLMLDNLGALPFYAVYPNYKWGKAIPRSENSEGGQVIGWTYKAKGWETDPNAYVYINVF
FT                   RPS"
FT   gene            549420..549878
FT                   /locus_tag="Lreu_0496"
FT   CDS_pept        549420..549878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0496"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82764"
FT                   /db_xref="GOA:A5VHL3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHL3"
FT                   /protein_id="ABQ82764.1"
FT                   /translation="MANKLNSLAHTKWLCKYHIVFIPKYRRKAIFNQYRRDLRDYIRLL
FT                   CKYKGVEIIEGHMMPDHVHLLVSIPPKLSVSQFMGYLKGKSALMMFDRHANLKYKYGNR
FT                   HFWAEGYYVSTVGLNESTIKKYIRDQEKHDIAMDKLTSVEYSDPFKGK"
FT   gene            550020..550523
FT                   /locus_tag="Lreu_0497"
FT   CDS_pept        550020..550523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0497"
FT                   /product="acyl-CoA transferase/carnitine dehydratase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82765"
FT                   /db_xref="GOA:A5VIU1"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIU1"
FT                   /protein_id="ABQ82765.1"
FT                   /translation="MIVIQNKNKSWETIANTMGHPEWATDERFKDWEHRQLHKQEIYPL
FT                   IESYTKNYDKYELTKKLGAAGIPVGPVLDWHELENDPDLNEDGTLVKINQGGNRGEFKT
FT                   VGMPFTMSNYKPTYKRAPDLGENNKEILSSLGYDPEQIEELVAKGVISKVEKPHNPRTK
FT                   VIKD"
FT   gene            551030..552412
FT                   /locus_tag="Lreu_0498"
FT   CDS_pept        551030..552412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0498"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron, maturase-specific domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82766"
FT                   /db_xref="GOA:A5VHP4"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:A5VHP4"
FT                   /protein_id="ABQ82766.1"
FT                   /translation="MRQSQKTEQQADRLSRIGLENRKYTRARSTDYGEGKGMSVTIQDL
FT                   VLDRNNLNQAYLRVKRNKGAAGIDDMTVNDLLPYLRENKTELIASLREGKYKPAPVKRV
FT                   EIPKPNGGVRKLGIPTVVDRMVQQAVAQILTPIFERVFSDNSFGFRPHRGAHDAIAKVV
FT                   DLYNQGYRRVVDLDLKAYFDNVNHDLMIKYLQQYIDDPWTLRLIRKFLTSGVLDHGLFA
FT                   KSEKGTPQGGPLSPILANIYLNELDKELTRRGHHFVRYADDCNIYVKSQRAGERVMRSI
FT                   TQFLEKRLKVKVNPDKTKVGSPLRLKFLGFSLGVDHNGAYARPAKQSQQRVKKALRLLT
FT                   KRNRGISLTRMFEEIQRKMRGWLQYYSIGKLTDFIQRLDKWLRARIRQYIWKQWKKLKT
FT                   KVTNLQKLGLSQRDAYVFASTRKGYWRTAHSKTLSYSLTNRKLEQLGLMNMSKTLQSIQ
FT                   SD"
FT   gene            552661..553995
FT                   /locus_tag="Lreu_0499"
FT   CDS_pept        552661..553995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0499"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82767"
FT                   /db_xref="GOA:A5VIU3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIU3"
FT                   /protein_id="ABQ82767.1"
FT                   /translation="MEETRTIDFFDRTFHLSENNTNIKQECLAGLTTFVSMAYILFVNP
FT                   SVLGVAGMDKGAVFTATALSAIIGCFLMGILANYPIAIAPGLGDNAFFTYSVVLAMGIP
FT                   WQKAMAGVFVASVLFTILSFLKVREIVINAIPKDLKYAMAAGIGIFISFVGLQGGGIIV
FT                   SSKSSLVELGSLTVPTTWITIFGIFLIAILMVKKVPGAIFIGLVATTLLGLLTGLVKMP
FT                   DHLISMAPSLEPTFGVGIKFLPTMTDPKMWAVVLIFLLVAFFDTAGTLVGLAQEAGLMK
FT                   DNKMPRIGRALMADSLSMLGGAVMGTTPTSAYVESSAGIAVGGKTGLTAIVTGTLFILS
FT                   MAFSPLLEVVTTQVTAAALIVVGVLMVSALKDIEWDKFEIALPSFLVAIGIPLTYNISY
FT                   GIAFGFLTYPILMVAAGRRKEVNVVMWSMFFVFIALLYILNVLPK"
FT   gene            complement(554127..554732)
FT                   /locus_tag="Lreu_0500"
FT   CDS_pept        complement(554127..554732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0500"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82768"
FT                   /db_xref="GOA:A5VIU4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIU4"
FT                   /protein_id="ABQ82768.1"
FT                   /translation="MSRYTGPSWRVSRRLGVSLSGTGKELARRAYAPGDHGRDRRGKLS
FT                   EYGTQLREKQKLRFMYGMTERQFSNLFVRAGKIKEGTHGANFMALLERRLDNMVYRLGL
FT                   ATTRRQARQLVNHGHITVDGKRVDIPSYEVKVGQIIAVRDKSKNLDIIKNAVEAVVSRP
FT                   SYVDFDADKLEGKLNRIPAREDMNADIDEALIVEFYNK"
FT   gene            555123..556826
FT                   /locus_tag="Lreu_0501"
FT   CDS_pept        555123..556826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0501"
FT                   /product="Septation ring formation regulator, EzrA"
FT                   /note="PFAM: Septation ring formation regulator, EzrA"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82769"
FT                   /db_xref="GOA:A5VIU5"
FT                   /db_xref="InterPro:IPR010379"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIU5"
FT                   /protein_id="ABQ82769.1"
FT                   /translation="MVFQVLIGILIIVVAILACVYFYQRRAVKQINDLMESEKKLADQK
FT                   VDQQIKNVEELQLIGDAKKQFETTKNKYEKQVRPAITAFNKRAPQLLADSRTSKLLTIN
FT                   TQIRDLQADLAKLTTTLQQIQKDLQHLRQQQHTHKQAVEQIKNKYRQFHRQLNEKSFEY
FT                   GDSEKQLNSRLNELEDQFAQFTDLTNKGDIEAAQEILSNLQSENDKFEQDLKKIPQLYK
FT                   PIATEFPEQLSELKSGYETLVKQNFHFTEKNIDKQIEQLQAKLDQTIDQLNNLQLDVVE
FT                   QSNKDLSDQIDYLYGVMQKEIDAKNEAIHLIEVMKDFTKHAQRQNDELGVELDRLSLNY
FT                   TLTNHEQETVRELGEQIKAIIKQYRDDAEAVANKTAVYSQVLDRQKSNQKNLTEIEKSQ
FT                   EKLNDEVAKLQTDEQRARQMLQKYSTQIRTIHRQVEQLNLPGLPKDYLDYFFGVSDEIK
FT                   KLADELNEYKINMDEITKQLIIVESDLDTLNDKTDILRDSAELTERFQQYANRFSDNEK
FT                   IAAAAKKSQELFKQFNYTASLEAIATVLEEIEPGSYKRIEDTYYREIGKN"
FT   gene            557050..558198
FT                   /locus_tag="Lreu_0502"
FT   CDS_pept        557050..558198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0502"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82770"
FT                   /db_xref="GOA:A5VIU6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIU6"
FT                   /protein_id="ABQ82770.1"
FT                   /translation="MIYFDNSATTKILPDVLSTYETVSQKIWGNPSSLHNFGENAWNLQ
FT                   EQARQQIAKLFGVKPSEIIFTSGGSEGDNWVIKGTAMAKYRFGKHIITTSVEHAAVKNA
FT                   LEQLKDFGFEVTYLPVDKEGRINPADVKAAIRPDTILVSIMAVNNEIGTVQPIKEVGEI
FT                   LKDYPNIHFMVDAVQAIGKGLDDQVFSDRVDFATFSGHKFHAPRGTGFVYVKSGRKLEP
FT                   LIAGGGQERTLRNGTENTPGNVAMAKAIRLVKENEAESVKLEQAIKERIYDHLSKFDHV
FT                   KLISGRDQGFASHVLCFAIVGVRGETIVHAFEDKDIYISTTSACSSKKHSEAGTLAAMK
FT                   VPEDIATSAVRISLGDQNTLEEADQFNKTFDELYAGFKKIIE"
FT   gene            558220..559440
FT                   /locus_tag="Lreu_0503"
FT   CDS_pept        558220..559440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0503"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="TIGRFAM: thiamine biosynthesis/tRNA modification
FT                   protein ThiI; PFAM: thiamine biosynthesis protein; THUMP
FT                   domain protein; ExsB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82771"
FT                   /db_xref="GOA:A5VIU7"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIU7"
FT                   /protein_id="ABQ82771.1"
FT                   /translation="MQYTEIMVRYGELSTKGHNKKSFIDRLGVNVRKALHSFDQVKVHA
FT                   QRDRLHVELNGADYDQVMNRLKLVFGIQNFSPSIKVDKTFEATAEAAAQMIAEQVDKPI
FT                   TFKVETRRSDHQFAIDTFEMNNKLGGYLLDKFPDKLKVDVHHPDLTLRVEIRLNGIFLS
FT                   SETIKGAGGLPVGTAGKGMMMMSGGIDSPVAAYLGMKRGVSMEMVHFFSPPYTSPQALA
FT                   KAKQLTERLAKYSGSIKFIQVPFAEIQETVKEKVPEGYLMTIQRRMMLRLAAALMIKRH
FT                   GLAIFNGESLGQVASQTMESMLAINDVTSYPVLRPVLSFDKTEIIKIAQDIDTYDLSIL
FT                   PYEDCCTVFTPPSPKTRPNVKRAREYEKRLDIEGLMQRALDGIEITEIHPGEDYLNQNE
FT                   DVFAELL"
FT   gene            559767..562421
FT                   /locus_tag="Lreu_0504"
FT   CDS_pept        559767..562421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0504"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="TIGRFAM: valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82772"
FT                   /db_xref="GOA:A5VIU8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIU8"
FT                   /protein_id="ABQ82772.1"
FT                   /translation="MTEKDMSTKYDPAAVEEGRYQWWIDQGFFKPSGDKKAHPYSIVIP
FT                   PPNVTGKLHLGHAWDTTLQDMIIRQKRMQGYDVLWVPGMDHAGIATQAKVEARLRKQGI
FT                   SRYDLGRDKFVQQVWDWKDEYADIIHQQWAKMGISVDYDRERFTLDEGLNKAVRKVFVD
FT                   LYNKGLIYRGTYIINWDPQARTALSDIEVIHKDDKGAFYHVKYPFTDGTTFNGKDYIEI
FT                   ATTRPETMFGDEAVAVNPNDERYKDLVGKKVMVPLVNREIEIIADDYVTPEFGTGMVKI
FT                   TPAHDPNDFKVGKRHNLPELNTMNEDATMNENAGKYEGMDRFEAREAIVKDLQDQGYML
FT                   KVDPIVHSVGHSERTGVQVEARLSTQWFVKMKPLAEAALKNQDTDDRVNFVPERFEHTF
FT                   TQWMENIHDWVISRQLWWGHRIPAWYNKQTGEVYVGMEAPKDAENWEQDKDVLDTWFSS
FT                   ALWPFSTMGWPNTDSADFKRYFPTNTLVTGYDIIFFWVSRMIFQSLEFTGRAPFKNVLL
FT                   HGLIRDEQGRKMSKSLGNGIDPMDVIKKYGVDALRWFLITGSTPGQDIRFSYTKMDAAW
FT                   NFINKIWNASRYVIMNLGEMPAPVLPDKSKWDLADRWILSRLNATVKQVNEQFDKFEFG
FT                   EAGRALYNFIWNDFCDWYIEMTKEKLNNGTDEEKNNTKNILGYVLDQTLKMLHPIMPFV
FT                   TEKLWQSMPHDGESIMVADYPVANAELDDPAATEQMNSLIELIKAVRNIRNEANAPMSK
FT                   PVDILVKVDNDHLAQMLKDNRDYIERFCHPENLTIGKDVEAPRLAMSGILTGAEVYIPM
FT                   AELVDLDEERDRMEKEIAKLEKEVERSQKKLGNEKFVNNAPEKVVEAERQKATEWQQKL
FT                   AAAKERLQSLQQA"
FT   gene            562804..564222
FT                   /locus_tag="Lreu_0505"
FT   CDS_pept        562804..564222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0505"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82773"
FT                   /db_xref="GOA:A5VIU9"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIU9"
FT                   /protein_id="ABQ82773.1"
FT                   /translation="MTILSLARFQFAMTTVYHFFFVPFSIGTAFIVAIMESMYVSTKDE
FT                   TYKKMAKFWGNIFLLSFAVGVVTGLIQEFQFGMNWSDYSRFMGDIFGAPLALEALLSFF
FT                   IESTFIGLWVFTWKKVKPGLHLFFIWMTSFGSLTSALWILTANSFMQHPVGYEIKGGRA
FT                   VMVNFGALLKNPQLWYEFGHVILNAIMMGGIIIAGLTAFQLLKNQKLSEANKKFYKKSM
FT                   RLGLLVSLIFSIGGIALGDAQMQYLIKEQPMKFAATEDVFTTTGKHAPWTIVGIADMKD
FT                   HEVKGNIDIPYALSILSYHKTTGAVTGMNELNAQYKKKYGKNLDYYPPVNTLFYSFRIM
FT                   CAVGAWIFLVSLVGLIMTREKSKKPLAQRRWALWCIAITTFLPFIGNTAGWFVTEFGRI
FT                   PWTVYGLFTIAESVSPNVSVGSLLTSNIVYFVLFTTLAITLIWLIVLELRKDPSEAIEP
FT                   KFKKVLDPFDKEAF"
FT   gene            564223..565239
FT                   /locus_tag="Lreu_0506"
FT   CDS_pept        564223..565239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0506"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82774"
FT                   /db_xref="GOA:A5VIV0"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIV0"
FT                   /protein_id="ABQ82774.1"
FT                   /translation="MSFLQLLWFVLIGVLFAGFFFLDGFDYGVGMAVETLAHNESERDQ
FT                   LVRTIGPVWDANEVWLITAGGAMFASFPYWYASLFSGYYLILMIILAGLIIRGVSFEFR
FT                   KNSPMPQKRIWDWALAIGSAIVPFFLGIMFVSMIHGMPIDANGNFHAGFFDYFNWLSVV
FT                   GGIALLLLTYLHGINYIALKTTGPVQERARNYAEFLYWILYAGEVVFALLLIFMTDFMA
FT                   VHPVGTIIMLVLIVGFSVLAQAETFAGHELVAFISSGLTLVSLVVLIFIGLFPRVLISS
FT                   ISPKYSILIQNASSTEYTLTVMTIATCCLLPFVLAYTIWAYWIFCKRIAMPAIPEVK"
FT   gene            565291..566976
FT                   /locus_tag="Lreu_0507"
FT   CDS_pept        565291..566976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0507"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82775"
FT                   /db_xref="GOA:A5VIV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIV1"
FT                   /protein_id="ABQ82775.1"
FT                   /translation="MIKLVGLYVLQAFLILGQGLSLAALLTGLWQGHSLLSQIYGLGGF
FT                   IACYLLRHGLTEIGNDWLDKYSANAAQNFRQQLLKKVFALGPVIVQREGTGNMVTLALD
FT                   GIKEVENYIRLIYSKVISMMIIPVIILVVCFWLDWISGIVMLLVYPLIVLFMIILGYAA
FT                   KAKADRQFAAFQILSNHFIDSLRGIDTLKYFGLSKKYSQSIYRSSERFRKSTMSVIKVA
FT                   MLSTFALDFFTTLAIAILAVFLGLRLINGHLLLFPALAILILAPEYFLPIRNFASDYHA
FT                   TLNGKNSFHAVRRILEMPLPKKPTVELHQWTGVDELSFENVEFMYPQNGSELTNLDLTV
FT                   KGNQKIGIIGMSGAGKTTLINLLSGFLAPTSGQIIIQGKKVTTLDIHDWQKQILYIPQT
FT                   PYIFADTLKNNIAFYTPNVSEDKIKEAIHVVGLDDLVAELPQGLGTMIGSGHRALSGGQ
FT                   AQRIALARAFLDPERRVMIFDEPTAHLDIETELELKKRMLPLMENRLVFFATHRLHWMK
FT                   QMDYILVLKNGKLIEQGTYQQLLDEHGYFTELMDQTRGKEITHE"
FT   sig_peptide     565291..565362
FT                   /locus_tag="Lreu_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.850) with cleavage site probability 0.842 at
FT                   residue 24"
FT   gene            566969..568714
FT                   /locus_tag="Lreu_0508"
FT   CDS_pept        566969..568714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0508"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82776"
FT                   /db_xref="GOA:A5VIV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIV2"
FT                   /protein_id="ABQ82776.1"
FT                   /translation="MNKIPLLKAMKHDRWVKPFLKRYKWTLVLAITLGIVTFICASGLM
FT                   FTAGYLISKSATMPFNILLVYVPIVLTRAFGIFRPVTNYFERLVSHNWVLKMTSAFRKK
FT                   LYDSLEQDAVFFNSKYRIGDILGLLSEDVAHIQNLYLRTIFPMLVAFGLYAIIVIGMGI
FT                   ISPLMGLLMLVLFGLIIIAVPVWSVLVNGARQQLEKQYTNTLYADLTDNIMGITDWVFA
FT                   GRSADYLQHYDQSEKNVLASQKAMKRFEHWRDFILQVMILLVVVSLIIWGAARFGGHWG
FT                   GSANWIAAFVLCVFPLDEVLSSLPAAAQETNVYTDSLKRLNELPQPPAPSKVNVEIAAP
FT                   YHLKITDVYYRYPKTEKMILRGINLDVNPGEKLAILGRSGAGKSTLASLIRGDRKPTSG
FT                   TVTLNNVPTDEFGDEISNYIGIVHQSPYLFHTTILNNIRLGNEDATEDQVWDVLERVGV
FT                   AAMIKRLPKGLHTMVDEAGLRFSGGERHRLSLARILLKDAPIILLDEPTVGLDPVTEEK
FT                   VIETFMEQLQGKTLIWITHHLQGIEMMDQVVFIEDGKISMQGSPAELQKTNEHYRALKM
FT                   ADEGI"
FT   sig_peptide     566969..567130
FT                   /locus_tag="Lreu_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.763 at
FT                   residue 54"
FT   gene            568769..569983
FT                   /locus_tag="Lreu_0509"
FT   CDS_pept        568769..569983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0509"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82777"
FT                   /db_xref="GOA:A5VIV3"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIV3"
FT                   /protein_id="ABQ82777.1"
FT                   /translation="MKEVVVLGAGYAGLKTVVLLQKKLKNNVHITLVDRNNYHYEATDL
FT                   HEAAAGTQSASRITYPISDVINPQITTFIQDEVVKIDPDKKTVKLAGHEELLHYDYCVL
FT                   GLGFVSETFGIPGAEENALPMTNVKEALAIYDHIIAKMKDYRTTHNPDDLQIVICGGGF
FT                   TGIELAGALVDARASYAKIAGVSPDEIKITLIEASTRLLPMFSEKLAEYGVNLVKSLNV
FT                   QLLDGSRISKIEPGKVIYKHGDDDEESLNAGTIIWTTGVSGNPLMEECGFDAKRGRVIV
FT                   TDHLTDPKHDDIYIIGDVAAVMPPDGKRPYPTTAQIALAMADYTAEDIVSRIKTGKHEA
FT                   KPFTYKSLGTVASVGNTRAFGEAMGHELRGYPASAMKKIIADRSLLETGGLKELFAKGR
FT                   FDLYH"
FT   gene            570086..571399
FT                   /locus_tag="Lreu_0510"
FT   CDS_pept        570086..571399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0510"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82778"
FT                   /db_xref="GOA:A5VIV4"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIV4"
FT                   /protein_id="ABQ82778.1"
FT                   /translation="MIKTYDEALSFIHGRTQFKKIPTLTRMKRFLAELGNPQKGLNYIH
FT                   VTGTNGKGSTVAMMRSALLESGLTVGSFTSPFITRFNERIEYNGIPISDADLLRLVQKI
FT                   APVVKKLDNTLETGGPTEFEIDTALMFCYMAEKKPNVVLLEVGIGGLYDSTNVITPVVS
FT                   VITTVGWDHMKYLGDTLAKIAAQKAGIIKKSVPVVLGDLPTEARETILADAKEKKSPFF
FT                   ELGKDFTVHKLNGHQFHAKIRYQGKNLKKIETILGLPGDYQIENAAVALMAVELFMEKH
FT                   GLAIDRRALIAGLENAAWPGRLEEINTTPLVLLDGAHNLPGVQALVHTIKNDFADREVY
FT                   LLVAILADKQYELMLGELASLGNVHLTVTHFAGPGPKRPSADLAKAIADIPTKYPIQTI
FT                   NDWQLGIGQVASQMSADDVMIITGSLYFVSDVRKFFLN"
FT   gene            571466..572098
FT                   /locus_tag="Lreu_0511"
FT   CDS_pept        571466..572098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0511"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82779"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIV5"
FT                   /protein_id="ABQ82779.1"
FT                   /translation="MENEVINEYTKLVWTAIPDKLGTKKQELCQRFLRKCPTPLAIKRL
FT                   SRIEKNEINEWAPEMLNFFAAIELGKIVTKSHEEIIGHAYSSIELGRKMVDHFQSEEQE
FT                   SVCIACTDIHNEIIDWKILFVGGGCECILYPDKIFQYALRCSAQGIIMIHNHPTGDIHP
FT                   SKQDESFTRRLERGCEIIGLHLVDFMIVGRDTYHSWREASLVNELKK"
FT   gene            572234..573235
FT                   /locus_tag="Lreu_0512"
FT   CDS_pept        572234..573235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0512"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell division protein FtsA; cell shape
FT                   determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82780"
FT                   /db_xref="GOA:A5VIV6"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIV6"
FT                   /protein_id="ABQ82780.1"
FT                   /translation="MLGIGTKNLGIDLGTANTIVYLEGKGIVLREPSVVARNSKTNEVI
FT                   AVGSDARDMIGRTPESIVAIRPMKDGVIADYDTTVAMMKYYIDKALGNNGKPYVMVCVP
FT                   SGITEVEKRAVIDATRVAGARDAYVIEEPFAAAIGAGLPVMDPTGSMVVDIGGGTTDVA
FT                   TISLGGIVSSRSIRMAGDKMNDAIVQYVRQHMNLLIGERTAEKLKWDIGSASVEAAEEM
FT                   GTTQVRGRDLVTGLPKTMQVSAKDVSTALQDVVDSIITAIKGTLEETSPEIAADVIDHG
FT                   IVLTGGGALLKHLPDVIADATKVPVFIANDPLDCVAIGTGESLKSIDVMKKK"
FT   gene            573369..574226
FT                   /locus_tag="Lreu_0513"
FT   CDS_pept        573369..574226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0513"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82781"
FT                   /db_xref="GOA:A5VIV7"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIV7"
FT                   /protein_id="ABQ82781.1"
FT                   /translation="MQKFFSNRRLVIAVIILVVCFGLMAGSVSLRNRRNTPPIIQQFGN
FT                   DIVGFVDSAVALPVNWAQTSVSSINGLMNTYSENRELKQQVTELAQTKVRDQTLAHENK
FT                   QLKQQLKLNNSMTDYNTVTAAVLMRTPSSWQRQLVINKGQSSGIKKNMPVMSGSGLIGR
FT                   ITEVNKTNSKVELLSDTSESSNRFAITLNGQNGKVINGIITGYNARNNELEMGQVTSKA
FT                   KIKKGTRVVTSGMGGVTPKGLYVGRVSRVGKDDYGLAQKIYITPATDFNDINIVTVAEA
FT                   ASQE"
FT   sig_peptide     573369..573446
FT                   /locus_tag="Lreu_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.979 at
FT                   residue 26"
FT   gene            574233..574769
FT                   /locus_tag="Lreu_0514"
FT   CDS_pept        574233..574769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0514"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82782"
FT                   /db_xref="GOA:A5VIV8"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIV8"
FT                   /protein_id="ABQ82782.1"
FT                   /translation="MYRLSRLKYIFPIGLFVCLFLDGALSHVWAPLFFSYPYSMVSELV
FT                   LLWLVLSYFFQDDIEIPLIPFAIAAGAVYDLYFSGILGLYIFLYPLVVEITKILSRYFS
FT                   SSFLSMIMIFFVDIVIFETFNYWAYYLVNITNVGFGDYLIYTLAPTLALNLIYFVVLFW
FT                   PIRAIYRWALDDDQI"
FT   gene            575238..575885
FT                   /locus_tag="Lreu_0515"
FT   CDS_pept        575238..575885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0515"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82783"
FT                   /db_xref="GOA:A5VIV9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIV9"
FT                   /protein_id="ABQ82783.1"
FT                   /translation="MSMQYISEILPSLFQGAALTLQIFFWTLVGSLPLGILVSLGLTSK
FT                   IKPLKWILEIYVWLMRGTPLLLQLIFVFYGLPIIGIVFERYDAALVAFILNYAAYFAEI
FT                   FRGGFQSVDQGQFEAARVLRLSYWQTLRKIIIPQVIKIVIPSIGNEVINLVKDSSLVYV
FT                   IGLGDLLRAGNVATSRDVTLVPLMLVGLIYLILVGICTLILRQVEKCYAYFK"
FT   gene            575900..576550
FT                   /locus_tag="Lreu_0516"
FT   CDS_pept        575900..576550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0516"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82784"
FT                   /db_xref="GOA:A5VIW0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIW0"
FT                   /protein_id="ABQ82784.1"
FT                   /translation="MLEVRDLKKSFGDRQILDGVNLTVKDGEILCIVGPSGAGKTTLLR
FT                   CITGLETPDSGEFFINGRRFDPQGTDAADRVIGVVFQDFKLFPNLSVMENITLAPMMVL
FT                   KKDKQEAIAEAQKLLEELGLNTKGKLYPYQLSGGQKQRVAIARALAMKPKILCYDEPTS
FT                   ALDPNLRKDVANIILGLKKDGMTQLIVTHDLEFAEDIADDILRVQPLDQRQNK"
FT   gene            576568..577419
FT                   /locus_tag="Lreu_0517"
FT   CDS_pept        576568..577419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0517"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82785"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIW1"
FT                   /protein_id="ABQ82785.1"
FT                   /translation="MKKAKAIWLLILLVVPVLLLSGCESVTKRADTQDTWNRIERRKRV
FT                   IVGLDDSFVPMGFRQKNGKLVGYDVDLARAVFKQYGIKVDFQPIDWSMKETELKNGTID
FT                   LLWNGYSVNPSRAKKVAFSRYYLENRQILVTKKKSNIKNLNGMTGKTLGVQNGSTGVTV
FT                   LDEKPKLLKDKIKNHTPVLYDTFPNAFIDLNANRIQGILMDEVYANYYIKHQPNSNSYR
FT                   TYISKELPMEHFAVGMRKGDKTLKKKINQGLGNLQKNGELRKLNEKWFGQDSNYLGPDN
FT                   AK"
FT   sig_peptide     576568..576636
FT                   /locus_tag="Lreu_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.933) with cleavage site probability 0.625 at
FT                   residue 23"
FT   gene            577623..578870
FT                   /locus_tag="Lreu_0518"
FT   CDS_pept        577623..578870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0518"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82786"
FT                   /db_xref="GOA:A5VIW2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIW2"
FT                   /protein_id="ABQ82786.1"
FT                   /translation="MDFNLARGVDLHIIPTKQFKMNHVLIDFATPQTPTNATARNLLAN
FT                   LLETSTHRYPTQTALARQLASLYGAYVNLYVNRLGTLHTVRLRASFVNNRFVDEDLFEK
FT                   ISGLINEIIFHPLIDDGEFDGPTFRIQSNNLKSAIKSLYDDKQFLANQRLMDLYYQNDS
FT                   VMKVPSFGQIADLENLNAKSLVSTYHSMINEDKIDIFVLGDIDPMRAQQVIAKLPFEDR
FT                   DIVNKSPLYHQALYDQVQRKTEYQQVNQAKLNLAYSLPVYYHDADYYAGLVFNGLFGGT
FT                   PYSKLFTNVREKASLAYYASSRLLPFNGIVSVQTGIQASDQEKVQNMIQEQLIALQNGD
FT                   FTTETLSEVQDSLINQYRAGHDLASNVLEQQLVTKLVNESDKNFITEIKKVTVADVMRV
FT                   AKQMKLQAVYLLSGEK"
FT   gene            578875..580173
FT                   /locus_tag="Lreu_0519"
FT   CDS_pept        578875..580173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0519"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82787"
FT                   /db_xref="GOA:A5VIW3"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIW3"
FT                   /protein_id="ABQ82787.1"
FT                   /translation="MDREVYQNFNQSIYREQLSNGLKVQLLPMEGYHKTYAILTADFGS
FT                   IDNHFIPYHQKKAITVPDGVAHFLEHKMFEKKDHDAFDLFGKLGADSNAFTSFTQTSYL
FT                   FSTTSNLHENLDVLLDFVQDPYFTAETVKKEQGIIGQEIQMYEDDPSWRLYLGILGNLY
FT                   PKDPMRIDIAGTVESISHITPEILMDSYRTFYQPTNMNLFLVGRLDPEETMAWIKQNQE
FT                   QKIFAPAETPQRLFSLNDPTAHDVIPFRSLTMDIVRPKVMVGLRGTKQFDDGKERLHYK
FT                   LAIDLLLDVLFDDTSDNYLRLYNNETLDDTFSYNFEMQRGFHFAYFSSDTDQMERFADE
FT                   VIDILESADQQIEAARTRFEGIKKAELGRLIGLLDSPEAIANRYAGDLFAGASLMDEIA
FT                   TLETITIDDLYQVAKEFITPQGISVYQVVPQHQ"
FT   gene            580272..581309
FT                   /locus_tag="Lreu_0520"
FT   CDS_pept        580272..581309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0520"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82788"
FT                   /db_xref="GOA:A5VIW4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIW4"
FT                   /protein_id="ABQ82788.1"
FT                   /translation="MSENENDQKRLEIGKILRKAREEKGYTLDDLQQMTKIQKRYLIAI
FT                   EDENFDELPGDFYVRAFIKQYANTVGLDGNELLQKYDDQLPQTKTEEYSDHLAQAVETR
FT                   ANQRKTVSGSVDKVRNYMPTIIIACVIVLVLAAIWITAIARNHRDSSTRIDNSSVSVSG
FT                   ESRKKAATSAKKASTKQSKSTAIKLQEAPNRNDTSVTYTASQLTKDTTLQIEPSDRSWM
FT                   QVRANNNDLLNKTLNNNEKTSVKISRDTTSLVITVGNARATKLKLGNQEIYFTNNGRYQ
FT                   NTRNVTINFGNAQTSSSSASQSANSSSQASSSSARPNNATQPSAANNNSRPQTSASQQN
FT                   NQPTR"
FT   gene            581337..581924
FT                   /locus_tag="Lreu_0521"
FT   CDS_pept        581337..581924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0521"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="TIGRFAM: CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82789"
FT                   /db_xref="GOA:A5VIW5"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIW5"
FT                   /protein_id="ABQ82789.1"
FT                   /translation="MNLPNKLTVIRLIIIPFFLLLMVLPLQSWGAVSFWGATIPMAQLI
FT                   AAILFIAATITDNLDGQIARRHHLVTNFGKFTDPLADKLLVMTAFIVLTGNGVVPSWVT
FT                   SIIIWRELSVTGLRLLLVEQDGVVLAAKMPGKIKTTTQFIAIIFLLLNNVIFAIWNIPF
FT                   GQIMLYICLFFTIYSGVDYFIQGRDVFSDGFK"
FT   sig_peptide     581337..581429
FT                   /locus_tag="Lreu_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.906 at
FT                   residue 31"
FT   gene            582049..583296
FT                   /locus_tag="Lreu_0522"
FT   CDS_pept        582049..583296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0522"
FT                   /product="competence/damage-inducible protein cinA"
FT                   /note="TIGRFAM: competence/damage-inducible protein CinA;
FT                   PFAM: molybdopterin binding domain; CinA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82790"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="InterPro:IPR041424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIW6"
FT                   /protein_id="ABQ82790.1"
FT                   /translation="MDAEIISVGTEIVLGQIINTNAAYLANRLTQLDLPATYQTTVDDQ
FT                   SQRLERVINHALTRAQLVFVCGGLGPTADDITMPTVAKTLGKELQTDEEHWKWIQKTFE
FT                   QRQIKMEPENIRQAQYPRGGEPLANPVGLALGCWYETKGKVVVVLPGPPAEFKAMVEKS
FT                   LVPKLQQYFQTRKQITSRTLNFLGRPESQLMDEIEGATNDIPGISITSYVQPTAIQVRL
FT                   TVRDLPVIEAEEKIDQAQKAILAVEEPFFFGVGDDLTLAKVVVEQLKKRGWKLTAAESL
FT                   TGGMFQSAICSVPGASTVFNGGFVTYAASAKEKLLGIPHATIDRYGVVSSETAATMAEG
FT                   CQRKLNVEVGIGFTGVAGPDMLEGQPAGTVWIGLAMKGRSTKTVQLHLASYVGRQAIRT
FT                   LSVQYGLQLIYHELKK"
FT   gene            583386..584474
FT                   /locus_tag="Lreu_0523"
FT   CDS_pept        583386..584474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0523"
FT                   /product="RecA protein"
FT                   /note="TIGRFAM: recA protein; PFAM: RecA domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82791"
FT                   /db_xref="GOA:A5VIW7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIW7"
FT                   /protein_id="ABQ82791.1"
FT                   /translation="MADQRKAALDVAIRKIEKNFGKGSIMRMGDATDMKVASVSSGSLA
FT                   IDKALGIGGYPRGRIVEIYGPESSGKTTVALHAVAEVQRQGGTAAYIDAENALDPQYAE
FT                   ALGVNIDDLLLSQPDSGEEGLEIADALISSGAVDLVIVDSVAALVPRAEIDGDMGDTHV
FT                   GLQARLMSQALRKLSGEINKTKTIAIFINQIREKVGVMFGNPETTTGGRALKFYSTIRM
FT                   EIRRAEQIKNGTDVIGNKAKVKIVKNKVAPPFKRCEVDIMYGEGISKTGELLDMAVEND
FT                   LVDKSGAWYSYGSERIGQGRENAKKWLKEHPDSMNELMDKVRVANGMEPLNEKSTKETA
FT                   DDKASGKTGENKQETIEEASKE"
FT   gene            584710..586251
FT                   /locus_tag="Lreu_0524"
FT   CDS_pept        584710..586251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0524"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM: KH,
FT                   type 1, domain protein; metal-dependent phosphohydrolase,
FT                   HD sub domain; SMART: metal-dependent phosphohydrolase, HD
FT                   region; KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82792"
FT                   /db_xref="GOA:A5VIW8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR017705"
FT                   /db_xref="InterPro:IPR022711"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIW8"
FT                   /protein_id="ABQ82792.1"
FT                   /translation="MFAALAMVVGIIVGYVIRKVSYEKQVAEAHNDAKGIISKAKQEAV
FT                   TAKKEAILEAKEESHQYRERVEDELKQRRSEVQRQEDRLLQREASLDHKDSALEKRENA
FT                   VGVRERKLDQEKEQLHQSKEQAEALIEQRKQEVEKVAQMSQEDAKQLLLSEVKEQLKTE
FT                   RAVMIRDSEQEAELSAERNAKKLIVEAIQRSAADVVSETTVSVVNLPNDDMKGRIIGRE
FT                   GRNIRTLETLTGIDLIIDDTPEAVVLSGFDPVRREIAKIALEKLIQDGRIHPARIEEAV
FT                   DKARKQMDTQLRETGEQALFDLGIHSMHPDLIKTVGRMKYRTSYGQNVLDHSIEVAKLA
FT                   GIMAAELGEDVTLAKRAGLLHDIGKAIDHEVDGSHVELGVELTRKYKENKVVINTIASH
FT                   HGDVPANSVIAVLVQAADAISGARPGARSESLEQYIQRLKKLESIANSYDGVDHSYAIQ
FT                   AGRELRVIVKPKKISDLQATTLSHDIKNKIEKQLEYPGHIKVTVIREVRAVDYAK"
FT   gene            586413..589058
FT                   /locus_tag="Lreu_0525"
FT   CDS_pept        586413..589058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0525"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutS; PFAM: DNA
FT                   mismatch repair protein MutS domain protein; MutS III
FT                   domain protein; MutS II domain protein; MutS IV domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82793"
FT                   /db_xref="GOA:A5VIW9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIW9"
FT                   /protein_id="ABQ82793.1"
FT                   /translation="MAKKTTPMMEQYQKVKDQYPDAFLFYRLGDFYELFNDDAVKGAQL
FT                   LELTLTTRNHSAKNPIPMCGVPHRAVNNYIDILIDKGYKVAICEQMEDPKKAKGMVKRA
FT                   VTRLITPGTQMDLNGEQARDNNYLAAISGQNGVFSIAYTDLSTGELKTTSLNNANDAVN
FT                   ELVNLQSKEVVVDGELPVEITTQFKQRNILQSHQPTVLKNAEISYLTQDLDDQAQQHVV
FT                   ALLVSYLLTTQKRSLAHMQKAIAYQPSSFMKIDHYSKTNLELMRNMRSGKRQGTLAWLL
FT                   DETKTAMGSRLLKRWIDRPLINQNAISERQDKVQELLDHYFERSNLQQELIKVYDLERL
FT                   AGRVAYGSVNGRDLIQLKTSLKQVPKIKYVLETLDSPVFEELQKQLDPLDDVADLIDQS
FT                   IIEEPPIAVTEGGVIKDGYNDQLDQYRDAMNNGKQWIVDLQEHERKLTGINNLKIGYNH
FT                   VFGYYIEVTKVNLDKLPKDRYERKQTLVNAERFSTPELKEKEALIMGAQEKSTALEYDI
FT                   FVKIREQVKGQITRLQKLAQQLAELDVLQSFAVVSEDYHFVRPEMNTGHVLKIKDGRHP
FT                   VVEKFMGHQEYVPNDVLMGEDTDILLITGPNMSGKSTYMRQLALIAVMAQIGCFVPAKS
FT                   AELPIFDQVFTRIGAADDLISGESTFMVEMMEANNALTHATDRSLILFDEIGRGTATYD
FT                   GMALAQAIIEYVHQHVRAKTLFSTHYHELTALENSLARLKNVHVGATEKDGELVFLHKV
FT                   SAGPADKSYGIHVAKLAGMPSSLLKRADTILQKLEQKDVKLPNTPKPATDNYHTEPISA
FT                   KINEAAPVKKEAAPVVEDNGQLELFATQPEKKESSVDRRILHQLKELNLMGMTPMDVMN
FT                   QIYKWQQKLK"
FT   gene            589070..591076
FT                   /locus_tag="Lreu_0526"
FT   CDS_pept        589070..591076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0526"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   DNA mismatch repair protein, C-terminal domain protein;
FT                   MutL, C-terminal, dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82794"
FT                   /db_xref="GOA:A5VIX0"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIX0"
FT                   /protein_id="ABQ82794.1"
FT                   /translation="MGKIHELDNILANQIAAGEVIERPASIVKELVENSLDAHSHRVDI
FT                   IVENSGLDSVRVIDDGDGIAAEDISLAFHRHATSKINSRHDLFKVQTMGFRGEALPSIA
FT                   SVADVTLTTAQAGQEEGTMIHLRGGKELVVKPAGARQGTDIKVTDLFFNTPARLKYLKS
FT                   PQTELTRITDIINRLALANPAVAFSFTHNGRELFRSAGNNNLQQVVAAIYGVQAGRKML
FT                   EISGADDDFKVSGFVSLPELTRASRQYITITINHRYIRNFELTKAIIQGYESKLMVGRY
FT                   PIAVINIDLDPVLVDVNVHPAKREVRLSKEQQLIKLIAETIRQRIAVENLIPDVDADQF
FT                   IPNDDEVADLDRRLKEASPVYHAAPISAVPATEKAATEIPTPEADNPAHADALDSEIPA
FT                   PIVIHHLEDLNTPAMQKFDERYQNEGEVTPFSAPVPTMTKKPVKPANIELDVHDKQDQQ
FT                   QNRFPDLQYIGQLQGTFLLAQAGDGLYIVDQHAAQERINYEYYRQKIGEVSADQQNFLV
FT                   PLVLNYSTVDAMTINQHLDTLAAVGLELESFGQNSFILRSHPTWFKEGQEEDTAEEMID
FT                   WLIKNGKLTVKEFRMKTAIMMSCKRAIKANHHLDEREAKALLKRLPQCENPFNCPHGRP
FT                   VTVHFNDQDLEKMFKRIQDSHTPYADDFDDHEF"
FT   gene            591089..591688
FT                   /locus_tag="Lreu_0527"
FT   CDS_pept        591089..591688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0527"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA, domain
FT                   I; SMART: Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82795"
FT                   /db_xref="GOA:A5VIX1"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIX1"
FT                   /protein_id="ABQ82795.1"
FT                   /translation="MYEYLTGLVTVVAPQYIVVDVNGVGYKLLVANPYRYQEDRTKKVQ
FT                   VYVYQAVREDNISLFGFTDQNEKNLFMQLINVSGIGPKSALAILANPDHQGLVDAITNN
FT                   NVSYLTKFPGIGKKTASQIVLDLRDKLTNESSSSLFATTQLTVDATVNRELKDALEALA
FT                   ALGYKERDIKKVQKALMKEEQMATDEYLRQALRLLN"
FT   gene            591703..592719
FT                   /locus_tag="Lreu_0528"
FT   CDS_pept        591703..592719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0528"
FT                   /product="Holliday junction DNA helicase subunit RuvB"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   magnesium chelatase, ChlI subunit; AAA ATPase, central
FT                   domain protein; Holliday junction DNA helicase RuvB,
FT                   C-terminal domain; Holliday junction DNA helicase RuvB,
FT                   N-terminal domain; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82796"
FT                   /db_xref="GOA:A5VIX2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIX2"
FT                   /protein_id="ABQ82796.1"
FT                   /translation="MENDHGILSDHPSGEEESQVEITLRPQKLREYIGQPKIKHELEVY
FT                   IKAAQSREEALDHVLLYGPPGLGKTTLAMVIANEMGVNIRTTSGPAIEKPGDLVALLNE
FT                   LKPGDVLFVDEIHRLPKVVEEMLYSAMEDYYIDIVIGEGPTAHPVHFPLPPFTLIGATT
FT                   RAGMLSAPLRDRFGIVEHMNYYTQDELTKIIFRSAKIFHTSIQDEGAHELSLRSRGTPR
FT                   IANRLLKRVRDFAQVAGKQSIDSAIVKQALSLLQVDDRGLDEIDRKMLLTMINFYHGGP
FT                   VGLKTIAANIGEETNTIEEMYEPYLLQIGFISRTPRGRLVTPTAYEHLGIEYPTDKN"
FT   gene            592732..593820
FT                   /locus_tag="Lreu_0529"
FT   CDS_pept        592732..593820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0529"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; PFAM: Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82797"
FT                   /db_xref="GOA:A5VIX3"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIX3"
FT                   /protein_id="ABQ82797.1"
FT                   /translation="MCKLEFTINQSDHQARTGLLQVNGRQIETPALAASGDELAKLSPI
FT                   QLNQAGVSVVKTSGLKRWLKYDSMTEKLGDLHRFFQWDGLLLVDLETEEAYHLAKPRGK
FT                   KHDGVRFHDPATRQLKFWQPETALQVQEALGADIFQSFDQATDYYAPVDDLKAGVKQTS
FT                   DWLSVVKPQKGQSLGSIGGGGLKDLRTASIKAVDEAELSGYRLSGIPNNLDDQEFSRII
FT                   NEITPKLEEEKLRYLPAALSFDQMIEAILAGVDLIDSNLAAKKAANGIALVNQGATVLH
FT                   LDRQHFSFDSEVLDRQCACATCRAGYSRALLHSLITNHSFYGEQLLLQHNLFTLNKLMS
FT                   SLRQAIKYHQTKKFVQELLQNQ"
FT   gene            593892..594356
FT                   /locus_tag="Lreu_0530"
FT   CDS_pept        593892..594356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0530"
FT                   /product="protein translocase subunit yajC"
FT                   /note="TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82798"
FT                   /db_xref="GOA:A5VIX4"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIX4"
FT                   /protein_id="ABQ82798.1"
FT                   /translation="MNSLSSFVLGAASSNNASGYSGIILIILMVALMYFFMIRPQQKQR
FT                   KEHQEMMNELHPGDEVVTIGRMHGKIDSINKADRTVTLDCEGIYLTFDMVAIARVIKRA
FT                   DAPASEAPQDNKAVASSAADSSAAASADSAASEPASAASASDEQKDSEEK"
FT   sig_peptide     593892..593951
FT                   /locus_tag="Lreu_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.909 at
FT                   residue 20"
FT   gene            594483..595442
FT                   /locus_tag="Lreu_0531"
FT   CDS_pept        594483..595442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0531"
FT                   /product="phosphoesterase, RecJ domain protein"
FT                   /note="PFAM: phosphoesterase, RecJ domain protein;
FT                   phosphoesterase, DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82799"
FT                   /db_xref="GOA:A5VIX5"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIX5"
FT                   /protein_id="ABQ82799.1"
FT                   /translation="MADPLTAIFEQIKKYNKIIIHRHQRPDPDAIGSQVGLAEILRASF
FT                   PYKQIYVVGKHIPGFDWIGEMDTIDNQTFDDALVIVTDTANAPRIDDRRFDNGDELIKI
FT                   DHHPNDEPFGDIMWVEPDASSCSEMIYSFYQRFAKELTLPQKAAHALYAGIIGDTGRFL
FT                   YPATTPRTMLVAGSLMAAGANAAEISQHENEITLPVARLSAYVYENLQILDNGAAYVIL
FT                   TNEILEQFGLTEAGTSAIVSLPGRIHDVIAWAIFVEQEDGHYRIRLRSKGPTINELAKQ
FT                   HDGGGHPLASGAKAKDEAEIKQVIDELDQLTQSYANQK"
FT   gene            595456..596829
FT                   /locus_tag="Lreu_0532"
FT   CDS_pept        595456..596829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0532"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82800"
FT                   /db_xref="GOA:A5VIX6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030881"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIX6"
FT                   /protein_id="ABQ82800.1"
FT                   /translation="MSDKKFADFQLQPYLLTAIQKINFRQPTPVQQRVIPVIMAGRSVV
FT                   GQSATGSGKTHAFLLPIFSKIKPEDQTVQAVITTPSRELAYQIYNAAKQLNKYAPHPLT
FT                   IHNYVGGTDKQHQVDQLSRKQPQLVIGTPGRVLDLIKSQALDIHTAKMFVVDEADMTLD
FT                   MGFLHEVDQIASHFPNDLQMMVFSATIPQKLRPFLKKYMENPVVEEIPTEAVINPDVDN
FT                   WLMSTKGQDRNQLIYRLLTLGEPYLALVFANTKERAVKLTQYLENQGLKVAMIHGGLEA
FT                   RRRKRTMRQIRDLEYQYVVATDLAARGIDIDGVSLVINDDLPTDLEYFVHRVGRTGRNG
FT                   MKGTAITLYEPAEDDLIAKLEERGVKFVPKELKNGQLVTTHDRNRRKHYKRRQNELDPS
FT                   MKGYVKKTKKKVKPGYKKRIKKAIKEDEQQKRKLELRHKIRKAKRARQKQHRRERNAR"
FT   gene            597088..599742
FT                   /locus_tag="Lreu_0533"
FT   CDS_pept        597088..599742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0533"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="TIGRFAM: alanyl-tRNA synthetase; PFAM: alanyl-tRNA
FT                   synthetase, class IIc; phosphoesterase, DHHA1;
FT                   Threonyl/alanyl tRNA synthetase, SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82801"
FT                   /db_xref="GOA:A5VIX7"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIX7"
FT                   /protein_id="ABQ82801.1"
FT                   /translation="MKELKKLNSAQVRRMYLKFFEEHGHQVMPSASLVPVNDPTLLWIN
FT                   SGVATMKKYFDGKVVPDNPRMTSSQKSIRTNDIENVGKTARHHTMFEMLGNFSVGDYFK
FT                   NEVIPWAWELLTSDEWFGFDPERLYITYYPKDHDAYNRWREVGVAEDHLIADEDNFWDI
FT                   GQGPSGPDTEIFYDRGQEFNNLADDDPENYPGGENERYLEIWNIVFSQFNHTPEDTYEP
FT                   LPHKNIDTGMGLERVVSIFENAPTNFETDLFMPLIKQAEEFSGTKKYGQNKEDDIQFKI
FT                   IADHIRTITFAIGDGALPSNVGRGYVIRRLLRRAVVAGKKLGIDEPFLAKMVPTVGKIM
FT                   EDYYPDVLKNADYIASVIESEEDRFSATLNGGLNLLNNVIAEAKESKTNEIDGRTAFKL
FT                   YDTYGFPIELTKEYAEDEGLTVDEKGFQAAMTEQQNRARNARDMDNGMGVQTDLWTSFK
FT                   EDSKYVGYTDLTVDNAKVIGLAHDGQQADEAQPGDKNIELIFDVTPFYAEMGGQVADTG
FT                   DIIDNYGKKVGRVVDVQHAPNQQNLHRVELTAPIKKGARYKLVVDRIRHLKIEKNHTAT
FT                   HLLDQALRNVLGGHTQQAGSLVEEHYLRFDFNHFGQVTAEDLKKVENMVNEQIWKEIPV
FT                   KTVETDIDSAKEMGAIALFSDKYGDKVRVVKIGDFNTEFCGGDHVKNTNELGLFKIVSE
FT                   GGVGAGVRRIEAVTSSDAFKFLQDRDDLLTKSAASLKVAQIKEVPHQVETLQNELKEAQ
FT                   KQNESLQAKIAAQQANNVFENVQATKNGSLIAAEVQVAGMGQLRQLADAWRSKALSDVL
FT                   VLATASDGKANLLVAVSDDKTKEGLKAGDLIKAIAPAINGGGGGRPNLAQAGGKNPAGI
FT                   KEALSQAKGYLDK"
FT   gene            600012..600278
FT                   /locus_tag="Lreu_0534"
FT   CDS_pept        600012..600278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0534"
FT                   /product="protein of unknown function DUF965"
FT                   /note="PFAM: protein of unknown function DUF965"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82802"
FT                   /db_xref="InterPro:IPR009309"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIX8"
FT                   /protein_id="ABQ82802.1"
FT                   /translation="MATNDKTMFFDFGQERQEDIKQTLKTVYESLEEKGYNPINQIVGY
FT                   LLSGDPAYIPRLNDARNLIRQHERDEIIEELVRSYLKNNGETK"
FT   gene            600275..600718
FT                   /locus_tag="Lreu_0535"
FT   CDS_pept        600275..600718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0535"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase, RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82803"
FT                   /db_xref="GOA:A5VIX9"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIX9"
FT                   /protein_id="ABQ82803.1"
FT                   /translation="MRLMGLDVGSKTVGISVSDPLGWTAQAVEIIPIDEENEIFGIDRV
FT                   AELVKKEQVAGFVIGLPKNMNNTEGPRVEASQHYGKLLQQRFPDIPIDFQDERLTTVEA
FT                   HRMLVEEADISRAKQKKVIDEVAATFILQSYLDRHGRLVNKLK"
FT   gene            600728..601024
FT                   /locus_tag="Lreu_0536"
FT   CDS_pept        600728..601024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0536"
FT                   /product="protein of unknown function DUF1292"
FT                   /note="PFAM: protein of unknown function DUF1292"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82804"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIY0"
FT                   /protein_id="ABQ82804.1"
FT                   /translation="MSKQENNEDMITLIDENGNEQLFKELFTFDSDDYGKSYIFIYPAE
FT                   QENDDSVDIQAYIIADNEDNDGQDLVPIEDDKEWDMVEEVLNTFLDNDGNFKA"
FT   gene            601123..601659
FT                   /locus_tag="Lreu_0537"
FT   CDS_pept        601123..601659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0537"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82805"
FT                   /db_xref="GOA:A5VIY1"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIY1"
FT                   /protein_id="ABQ82805.1"
FT                   /translation="MILTTFIILILMGCFINGHRRGLLTMTLMLGTYIVAWIVARQGAQ
FT                   LIGGWLKSLLPSIGTPATFSESLLANVNSNLFFYNGIAFMIIFTIVSILCHWGIRQLNW
FT                   IKRIPVVGTVDKIAGGLISFLIGYLIIYVVLLIMQLFPAGWWQMQIANSELARFMINQT
FT                   PGIAHLVIDTLVQGG"
FT   gene            601661..604036
FT                   /locus_tag="Lreu_0538"
FT   CDS_pept        601661..604036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0538"
FT                   /product="MutS2 family protein"
FT                   /note="TIGRFAM: MutS2 family protein; PFAM: DNA mismatch
FT                   repair protein MutS domain protein; Smr protein/MutS2;
FT                   SMART: MutS III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82806"
FT                   /db_xref="GOA:A5VIY2"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR005747"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIY2"
FT                   /protein_id="ABQ82806.1"
FT                   /translation="MNSKILETLEFDRIKGQLAQYLVSAAGHRELTQLVPQTDYEAVKE
FT                   LLTETTDGADILRLEDGIPIPQLADIKPQLKRLKIKANLNGTELAQITKVLQTSMSVKN
FT                   FFDQMREKKIKLRVLTTQVDRLVTIPSITQRLVRSIDSDGRINDEASAKLHGIRQLITQ
FT                   TETEIHQQMERYTRGKNAKYLSDPIVTMRNDRYVIPVIARYRNKFGGVVHDQSASGQTL
FT                   YIEPAAVVETNNRLRQAQIEERQEMQRVLIELSQMIAPYRHDIGQNEAILGHLDFINAK
FT                   ARWAHDTKATLPLLSKENHVSLRKARHPLIDPQRVVTNDIKIGEDYQAIIITGPNTGGK
FT                   TITLKTLGIIQLMGQSGLFIPAEEGSTIGIFDNVFADIGDEQSLEQNLSTFSGHMDGVK
FT                   AILEQITSRSLVLLDELGAGTDPKEGAALAMAILDNIGSKGTMVVITTHYPELKVYGYD
FT                   RAKTINASMEFDQETLKPTYKLLLGIPGRSNGLEIAQRLGISLQVIDEARTFVSDNSQD
FT                   LNNMIGDLVEQRKKAREESEKLAKLVAKNEKVQRDLDEKLTRFNEQRDKLYEQARSKAN
FT                   HQVSMAKKKADRIIHHLRQLEVQQGGNVKENELIDAQGQLNALHHDNPRLQHNSVLQRA
FT                   KQKHDLHKGDAVLVKSYGQYGELLSKRGNHKWEVQIGILKMEIDENNLEKVAKKDLPRE
FT                   KDAKRRPRAAVRTTQTRKTSARLDLRGHRYEQAMSELSNFIDHALLNNLSTVTIIHGKG
FT                   TGALRKGTQQYLQSNPRVKSFSYASPNAGGDGATIVNL"
FT   gene            604127..604441
FT                   /locus_tag="Lreu_0539"
FT   CDS_pept        604127..604441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0539"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82807"
FT                   /db_xref="GOA:A5VIY3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIY3"
FT                   /protein_id="ABQ82807.1"
FT                   /translation="MAVNVTTDQTFEQDTATGVDLIDFWATWCGPCRMQSPVVDALSDK
FT                   MPDIKFFKMDVDQNPETAQKFRIMSIPTLMVKKDGKVVDQIIGYHSEDQLKQILQQYVD
FT                   "
FT   gene            complement(604496..605050)
FT                   /locus_tag="Lreu_0540"
FT   CDS_pept        complement(604496..605050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82808"
FT                   /db_xref="InterPro:IPR019642"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIY4"
FT                   /protein_id="ABQ82808.1"
FT                   /translation="MSQKLYNQLIAGHQGLGAGTMRDVILPAILGKETDEMLYWIGKDL
FT                   ARVYPVATAEDLVYLTNQLGFGRLALRKKSNTSQVWRLSGVIVKERIQRDEEETSFGLE
FT                   CGFLAQEVEFQLGTVAEAKIFDWHRDYVDILIQNDPQSSADNERSEMVTFITVDRPDEK
FT                   EDALKKETRHSLLKRRKKDKK"
FT   gene            605205..606008
FT                   /locus_tag="Lreu_0541"
FT   CDS_pept        605205..606008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0541"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; PFAM: Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82809"
FT                   /db_xref="GOA:A5VIY5"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIY5"
FT                   /protein_id="ABQ82809.1"
FT                   /translation="MDKRPIGVMDSGLGGLSVIRVLREQLPQESVIFVGDQGHFPYGTK
FT                   TKEQIQQLALRIGKFLLEQDVKMMIIACNTATAAALRLLQNELPIPVIGVIKPGAMAAT
FT                   QHHYKKIGVIGTESTIKNGAYAKTLAKLNPDLSVISSPAQPLVSIVEHGQTGTSEAQKA
FT                   VDTELEVFDNQSIEALILGCTHFPFLQKEIHNKLGSNVQLIDPAFETIRQAKELLTGKN
FT                   QLSDNLASSINLYSTGDAKDLVAGAQQWLPNGYSKCAHIELNEEG"
FT   gene            606010..606597
FT                   /locus_tag="Lreu_0542"
FT   CDS_pept        606010..606597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0542"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82810"
FT                   /db_xref="GOA:A5VIY6"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIY6"
FT                   /protein_id="ABQ82810.1"
FT                   /translation="MKTIVIATKNTGKAREYQEMLAPLGIEVKTLADFAPITINENGKT
FT                   FEENATIKATTAANQLQLPVMADDSGLMVDALGGAPGVHSARYAGDHDDAANNAKLLLA
FT                   LKEVPDEKRTAHFHTTIVGIKPDGTKLVANGRVDGHILHQLTGKNGFGYDPLFYVDELG
FT                   KSMAQLTADQKNQISHRGRALRSFMKQFNDWW"
FT   gene            606603..607121
FT                   /locus_tag="Lreu_0543"
FT   CDS_pept        606603..607121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0543"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82811"
FT                   /db_xref="GOA:A5VIY7"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIY7"
FT                   /protein_id="ABQ82811.1"
FT                   /translation="MKILVVSDNHREEKILTEIVQKMGNQVDLMIHCGDSELAPDQEPM
FT                   SNFKAVKGNNDYGLSYPNELVINAGQEQLYLTHGHLQRVNFSLTPLMLTGQEKGASIVC
FT                   YGHTHQLGAVYDHQMLIINPGSISFPRGEYAKLGGTFAIVDAQPERFIVDYYNRQMEAV
FT                   PELRCEFSR"
FT   gene            607142..607585
FT                   /locus_tag="Lreu_0544"
FT   CDS_pept        607142..607585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0544"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82812"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIY8"
FT                   /protein_id="ABQ82812.1"
FT                   /translation="MIDQRLQTLLLKNKQKFMIPASLVATVNQSNSLDHAFLVLTKDRY
FT                   AKIIVIDNKNHYCGQISLAMITDQLLETKRINVERLNELKVRDVMQTDAPVIQDPTDIE
FT                   ENLHLLIDQSFLPVVDDHNYFCGIVTRREVLKAVNYTMHTFGK"
FT   gene            complement(607691..608527)
FT                   /locus_tag="Lreu_0545"
FT   CDS_pept        complement(607691..608527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0545"
FT                   /product="Haloacid dehalogenase domain protein hydrolase,
FT                   type 3"
FT                   /note="PFAM: sucrose-6F-phosphate phosphohydrolase;
FT                   Haloacid dehalogenase domain protein hydrolase, type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82813"
FT                   /db_xref="GOA:A5VIY9"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIY9"
FT                   /protein_id="ABQ82813.1"
FT                   /translation="MSIKLIATDMDGTFLRDDHTYNHSLFAKVFRQLERHNIYFVAASG
FT                   SSFPRLQREFKDYTAKMGFISQNGSVIHLGSKLFKSFPINQESLARVIHVLDRFYGPQD
FT                   INQLVISTSEKSYVDQGMSAHDFNIVKLFYENVERIPDIRQIFTQRPTEDFTKISINFA
FT                   NHIDLKKVTTTLDGYLPPSLIMENSGFNTDLIGNAAATKQNALSLLQSHLNLKANEIVT
FT                   FGDNENDLGMLAMTSQSYAMQNAQPIIQMQAAHTTTIDNNHDGVLQTINQLIKNER"
FT   gene            complement(608517..609392)
FT                   /locus_tag="Lreu_0546"
FT   CDS_pept        complement(608517..609392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0546"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82814"
FT                   /db_xref="GOA:A5VIZ0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIZ0"
FT                   /protein_id="ABQ82814.1"
FT                   /translation="MITGATSLTSKQTEQLKKAFTDLSWHEISQQLLSKFLLIIVTFVL
FT                   FLILLWVGRVIIVHLFQESKKYNVLKNSNRMATVKALVLNIYRYTCYFFLLYAILSEIG
FT                   VPVGTLIAGAGIFSLALGLGAQSLVSDIVTGFFILLEQQLDVGDTVQIGQIKGTVTALG
FT                   IRTTQVTSSDGTLNFIPNRNITIVQNLSRNNMVSNVDIRITSKTPLSKVEEIVTQVNKK
FT                   LVPQIKALQLKPVIVGPVVTPDGALVFRVTITAVSGKQSTVASHFLAAYLKELRTNNIP
FT                   IAWEGAPNEY"
FT   gene            609535..609975
FT                   /locus_tag="Lreu_0547"
FT   CDS_pept        609535..609975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0547"
FT                   /product="protein of unknown function DUF948"
FT                   /note="PFAM: protein of unknown function DUF948"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82815"
FT                   /db_xref="GOA:A5VIZ1"
FT                   /db_xref="InterPro:IPR009293"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIZ1"
FT                   /protein_id="ABQ82815.1"
FT                   /translation="MTFGQLAGLIAAIAFLILVIFACILLNQLSKTMKETNKSITTLTR
FT                   DVHYLSQEMEDVLSNTNTLLDDINHKSEQLDPAVKAVADVSQSVSEVNASLQEMVEKAR
FT                   LHREKRQFDRSIFKFAGKTLVLDAFNKFRQHRKQKKGMTNNE"
FT   sig_peptide     609535..609603
FT                   /locus_tag="Lreu_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.916) with cleavage site probability 0.714 at
FT                   residue 23"
FT   gene            609968..610426
FT                   /locus_tag="Lreu_0548"
FT   CDS_pept        609968..610426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82816"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIZ2"
FT                   /protein_id="ABQ82816.1"
FT                   /translation="MSKKLLAGILLGGAATYAAWKKMAPAKKEALKESVDEKINKVADY
FT                   VTDYTLDALDIVDDLMSDSNLNDKVSGAADAVNNVKGKVKDSANKVVNHMTNDDFDKQT
FT                   ADIREELAKNKEADEDNNDIIIDATSDQKPASTENDEADQDDAKTADK"
FT   sig_peptide     609968..610024
FT                   /locus_tag="Lreu_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.951 at
FT                   residue 19"
FT   gene            complement(610467..611576)
FT                   /locus_tag="Lreu_0549"
FT   CDS_pept        complement(610467..611576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0549"
FT                   /product="Xaa-Pro aminopeptidase, Metallo peptidase, MEROPS
FT                   family M24B"
FT                   /note="PFAM: creatinase; peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82817"
FT                   /db_xref="GOA:A5VIZ3"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIZ3"
FT                   /protein_id="ABQ82817.1"
FT                   /translation="MNAVTKLNQLQSALAEKGLDAAYISDPMTINYLTGFYSDPVERVL
FT                   ALVLFADSEPFLFAPALEVEAIKDTGWKYPVYGYLDHEKPFELIAEHIKNHAGSPINWG
FT                   IEGESLTVDRLRALEEVLPNAHFNTDLSPLIAKMRMIKSDDEIAKLNEAGKWADFAFKV
FT                   GFESIQIGKTEQEVAADLEYALKQHGINKMSFDTLVQAGPHAAEPHGATSSNKIQNNEL
FT                   VLFDLGTIVDGYISDASRTVAVGKLNDKQKDIYKVCLEAQLVAQDAAKPGMTAEELDKI
FT                   ARDIIAAAGYGEYFIHRLGHGMGSSEHEFPSIMEGNQLVLEPGMCFSIEPGIYIPGFAG
FT                   VRIEDCVHITEDGCEPFTHTTKELLTFPH"
FT   gene            611728..612738
FT                   /locus_tag="Lreu_0550"
FT   CDS_pept        611728..612738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0550"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="TIGRFAM: catabolite control protein A; PFAM:
FT                   regulatory protein, LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82818"
FT                   /db_xref="GOA:A5VIZ4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR006377"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIZ4"
FT                   /protein_id="ABQ82818.1"
FT                   /translation="MEKQSVTIYTVAREARVSMATVSRVVNGNPNVKPETRQKVLDVIK
FT                   QLNYRPNAVARGLASKKTTTVGVVIPNITDPYFAELALGIDDVASMYKYNIILTNSDSD
FT                   DEKILKVVRSLLAKQVDGLIFMGHDVSDDLRNEFESTNTPVVVAGSVVNDDTLPSVRIN
FT                   YQAAAKEATEFLLKHGDQQVAYITGSLRYSINGKDRLDGYKEALANNNVAFNDSLVIET
FT                   DGSYQAGYAKAQEVIEKGLKAAYVTDDSLAAGLLNGLTDAGISVPADFELISSNDTNYT
FT                   KVVRPTITSITQPLYDLGAISMRLLTKLMDGDDSNDDEKNVILDHGFVERQSTRK"
FT   gene            612752..613597
FT                   /locus_tag="Lreu_0551"
FT   CDS_pept        612752..613597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82819"
FT                   /db_xref="GOA:A5VIZ5"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIZ5"
FT                   /protein_id="ABQ82819.1"
FT                   /translation="MTTRSELRAQRQEKVEKPIEETPEKRHFLYCLWGVICVTLLGLTL
FT                   LINSTLLNVNFVKEEVTSSSLESVMLSQVNSSLTQYGISTSVLKKSDTDKLINQAIDQV
FT                   YAGEKINLDLSPIVNNVGTSVNSQLAQYGLSTSMLPAGSSSAIAGNINSMVNSQLNTPE
FT                   VAQLINGIKIAKTVVNIILVISIISLVLLILKGLWQHHLIGSFRWICLWGTVLYTGIVM
FT                   TIHAITLQMGAGQPDISPFISQVANDFQQTGFHGSMMLIVISIVLFILQFVKRKWQPRQ
FT                   "
FT   gene            613672..614418
FT                   /locus_tag="Lreu_0552"
FT   CDS_pept        613672..614418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0552"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82820"
FT                   /db_xref="GOA:A5VIZ6"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VIZ6"
FT                   /protein_id="ABQ82820.1"
FT                   /translation="MSGHSKWHNIQGRKNAQDAKRGKIFQKISRDLYQAAKAGDPDPAN
FT                   NAQLRLVIDKAHAANMPKKNIDRAIAKASGIGGAKFEEVTYEGYGPGGVAVMVSALTDN
FT                   KNRTASAVRSAFSHSGGSLGASGSVSYMFDRKGLIEILRDDLDKSEDDMLMDALDAGAE
FT                   DMKATEEKFQIFTDPSSMTDVRDALQEQGYELDTAEVTMIPQNRTEVPADKAKQYRHLI
FT                   DELTENDDVADIYETGILPDEDDDEE"
FT   gene            614539..615516
FT                   /locus_tag="Lreu_0553"
FT   CDS_pept        614539..615516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0553"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82821"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIZ7"
FT                   /protein_id="ABQ82821.1"
FT                   /translation="MPSFEEELTRIIRKQPSDLYILPHDRYYQLSLAIKGTLFPFKQVT
FT                   RDYGQRFISYLKYCANMAVSEHRRPQLGAFKFTYAHQKINLRLSSVGDYQGRESLVIRF
FT                   IYPLNDIRFNFLVPHQWEILQKYRQQRGLILFAGPMGAGKTTTMYQLARQLLPKQIVLT
FT                   IEDPVEIDHPGFIQLQVNELAGMDYESLLKLGLRHRPDVFIIGEIRDSQTAAMSVQAAL
FT                   SGHLVLGTIHARNAYGVVSRLQQLGIDSYYLQQVLTAVSYQRLIPLVNGEQAILCDLLN
FT                   RHQFSDLLNGTKKGGMSNEWSKALQQAVENGEITENTARQYQQG"
FT   gene            615470..616504
FT                   /locus_tag="Lreu_0554"
FT   CDS_pept        615470..616504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0554"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82822"
FT                   /db_xref="GOA:A5VIZ8"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIZ8"
FT                   /protein_id="ABQ82822.1"
FT                   /translation="MEKLRRILHVNTNKVKFNHQQQADFFLLLADLLSVGFSVKEALGF
FT                   IKAVNPKLAPWIASIDKRMQKGASFAQSLQQEVKDDLFYQLLLAEKHGNLTKTLSEVGK
FT                   ILTARERQRKKLFSLLQYPLILLGMLGVVICGLILFVFPELKVWQGERQTLPLIHMIKL
FT                   GATYLFTVIFISAVFQWLRWHQMNKEQRLIKICTMPIIGKCYCYYFQYYLTSILGSMLQ
FT                   QGLSLAEICEITQSFDRKSILYIFGNKIMTTIQRDGDISEVVATYSFLPNELIVFMNKG
FT                   ATRENMGRDLIVFANLKFKALTTAIEHLLIFVQPVIFSIIAIIIVILYLSILLPIYHSF
FT                   QGVY"
FT   gene            616504..616815
FT                   /locus_tag="Lreu_0555"
FT   CDS_pept        616504..616815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0555"
FT                   /product="Competence protein ComGC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82823"
FT                   /db_xref="GOA:A5VIZ9"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR016940"
FT                   /db_xref="UniProtKB/TrEMBL:A5VIZ9"
FT                   /protein_id="ABQ82823.1"
FT                   /translation="MKILKKKQSGFTLLEMSIVLFIISLLVLIMLPNLSQQRKHANSIH
FT                   GKAMTSVIQTQIDAYENENGTDNVSLEELNKANYLTDAQVQQAHHEKIVIVDGKAIQR"
FT   sig_peptide     616504..616611
FT                   /locus_tag="Lreu_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.819) with cleavage site probability 0.731 at
FT                   residue 36"
FT   gene            616812..617246
FT                   /locus_tag="Lreu_0556"
FT   CDS_pept        616812..617246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82824"
FT                   /db_xref="GOA:A5VJ00"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ00"
FT                   /protein_id="ABQ82824.1"
FT                   /translation="MNLQEEGFTFLEAIIVLGIAALLLLITIPNFTKTRQKIAEEQFWQ
FT                   SLRQDWQWAQLKCESKHQFIVIRHDKNNEMITFRINDQTRETKEILIPSTLNVEWFGEL
FT                   YLTPNGYTRPCTQRFKSLIDGHYYYMKIQLGWGGYRVEKR"
FT   gene            617233..617523
FT                   /locus_tag="Lreu_0557"
FT   CDS_pept        617233..617523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82825"
FT                   /db_xref="GOA:A5VJ01"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ01"
FT                   /protein_id="ABQ82825.1"
FT                   /translation="MRNAKAKAFMMADSLISLFIVAMGINLFFICEKQLWLQNRNLQLK
FT                   MAATRLGKEASDLYAVKKQPVILSRGDLTAKATIQRVVVYNNDRCLYRVGK"
FT   gene            617520..617951
FT                   /locus_tag="Lreu_0558"
FT   CDS_pept        617520..617951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82826"
FT                   /db_xref="GOA:A5VJ02"
FT                   /db_xref="InterPro:IPR016977"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ02"
FT                   /protein_id="ABQ82826.1"
FT                   /translation="MKKGAFTLVEATCTLIISSLVIINISLITTSVRQVGKMNLESTIT
FT                   WHLFLRELESANHRFELMEARDDRLLLYSQTTDQKYELRENHALYLTCQNKGGYMPLLD
FT                   NIKNHEYSFTKLDSQRVLIKVTRKDGEKASAIVKFYPPK"
FT   gene            618366..619199
FT                   /locus_tag="Lreu_0559"
FT   CDS_pept        618366..619199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0559"
FT                   /product="Adenine-specific DNA methylase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82827"
FT                   /db_xref="GOA:A5VJ03"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR016843"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ03"
FT                   /protein_id="ABQ82827.1"
FT                   /translation="MQKIYQELNLQNVKPEIIRQIIQLSFLKVIRKDAIQANHQMTPDT
FT                   IGLIMAFLIEKVTKIKEIKTVFDPAVGTANLLTTVMNQLKVNGDKDIVGYGIDNDEDML
FT                   EVASVSTELQHLNVKLYHQDAVTALDIPQCDLAISDLPIGYYPLDENAKNYQTRAKEGH
FT                   SYVHHLLIEQSMNYLKPGAFGVFLVPSSLFQTKESQSFVKWIQSVAYLQGLINLPAELF
FT                   ANPNAQKSILLLQRQGGDSKQAAKVLLGEFPSFKDKAKFASFMDDVSKWVTTNLR"
FT   gene            619213..620409
FT                   /locus_tag="Lreu_0560"
FT   CDS_pept        619213..620409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0560"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82828"
FT                   /db_xref="GOA:A5VJ04"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ04"
FT                   /protein_id="ABQ82828.1"
FT                   /translation="MSKTIAVNAGSSTLKFKLFDMPSEDVVAEGTIERIGEKMGHAKIK
FT                   YGNGQKHEEDKPFADHAAAVNYLLDKLIELKIVASYDEITAVGHRIVAGGEFFKDSTII
FT                   DDDVISKIDELSEYAPLHEPAELVGIKAFRKVLPNAFAVAVFDTSFHVDMPEMNALYSV
FT                   PYDWYEKYGARKYGAHGTSHRYVSARAAEMLGKPIEELKLITMHIGAGASITAVKNGKS
FT                   FDTSMGFTPVAGITMATRSGDVDPSLIAFMQGKLNLSSDEMIDILNHKSGLLGISGISP
FT                   DMRDILAAAEKGDERAQLALDIYVNRIVRYIGAYIAEMGGADAIVFTAGVGENSVPVRK
FT                   MITDKLDYFGIKIDQEKNNCHGVERDLSADDAKIKTLLIPTNEELMIVRDIERLKKNN"
FT   gene            620524..621132
FT                   /locus_tag="Lreu_0561"
FT   CDS_pept        620524..621132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0561"
FT                   /product="phosphoesterase or phosphohydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82829"
FT                   /db_xref="GOA:A5VJ05"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ05"
FT                   /protein_id="ABQ82829.1"
FT                   /translation="MKFCTSDTHFFHDSLLGTNQFAPRPFKNVNEMNQIIIDNWNDKVG
FT                   ENDIVYHLGDIALYFTKPQRDAYQAILEVLLQLHGHLILVKGNHDNRALFKYLENNNYE
FT                   FNGLPKFQFHDVGVLLKYNHRQYYLTHYPLMLGIAPQIINLHGHIHHYSVPIKENINVG
FT                   VDAPELDYLEKRPKFGAPLNFHEIEEIVTKKTIKYPGQK"
FT   gene            621153..621698
FT                   /locus_tag="Lreu_0562"
FT   CDS_pept        621153..621698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0562"
FT                   /product="protein of unknown function DUF1027"
FT                   /note="PFAM: protein of unknown function DUF1027"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82830"
FT                   /db_xref="InterPro:IPR009370"
FT                   /db_xref="InterPro:IPR038141"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ06"
FT                   /protein_id="ABQ82830.1"
FT                   /translation="MNRAKIQDYIDQREEQRSLIYHIEEKDQTHFTINGHPYELVKDYR
FT                   DGFNSEKFAERFSSVLSKYDYIVGDWGYDQLRLKGFYDDDNPLFEPELGTDTIEDYLFE
FT                   YCNFGCAYFIVHNDDVSIPRQHGHSHRQRRKKTTPIIHERRRQVKQPNVRQRQNQRAER
FT                   VKNGHRQKFVIHQRKKRS"
FT   gene            621707..622477
FT                   /locus_tag="Lreu_0563"
FT   CDS_pept        621707..622477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0563"
FT                   /product="HAD-superfamily subfamily IIA hydrolase like
FT                   protein"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IIA hydrolase
FT                   like protein; HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82831"
FT                   /db_xref="GOA:A5VJ07"
FT                   /db_xref="InterPro:IPR006354"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ07"
FT                   /protein_id="ABQ82831.1"
FT                   /translation="MKDYQGYFIDLDGTTYKGKERIPAAGRFIKRLQEAGKEVLFVTNN
FT                   STRTPDFVAENLRKNHDINVTAENVYTTAIATADYLRSIAPAKSKIYVIGESGLKLALE
FT                   KRGFILTDDQPEYVVVGLDTSVTYEKLEKAVLLIRSGAKFIGTNADSNLPNERGMVPGA
FT                   GSIVKLIEYATQTKPVMIGKPEAIIMKMALERVQLPKEKVIMVGDNYHTDIEAAINVGM
FT                   DSLLVYTGLSRPEEVIKEKIQPTYKVNNLDEWKI"
FT   gene            622461..623114
FT                   /locus_tag="Lreu_0564"
FT   CDS_pept        622461..623114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0564"
FT                   /product="integral membrane protein TIGR01906"
FT                   /note="TIGRFAM: integral membrane protein TIGR01906; PFAM:
FT                   Integral membrane protein 1906"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82832"
FT                   /db_xref="GOA:A5VJ08"
FT                   /db_xref="InterPro:IPR010178"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ08"
FT                   /protein_id="ABQ82832.1"
FT                   /translation="MNGRFEFIQWGRAILLTLLSLVVAISIALFIVINISPFFITIPKH
FT                   LLGLSAAELMADYGNVIKYIQLPTQRVFKLRYLPIDPSAVHHFKDVKRLILLNEAVMLA
FT                   SIPLLVCGLKKQKRQNQLWRLILPFQMLFILLLFSGFMGITNFNAFFIKFHYLFFSNMD
FT                   WLFDPRTTPIILLMPEKFFTVLFGLWLGFTLIILLLIWGWIKLMLRIFFNKART"
FT   gene            complement(623082..623729)
FT                   /locus_tag="Lreu_0565"
FT   CDS_pept        complement(623082..623729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0565"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82833"
FT                   /db_xref="GOA:A5VJ09"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ09"
FT                   /protein_id="ABQ82833.1"
FT                   /translation="MATLIDFILHIDIHLIQIVNQFGDATYLILFAIIFIETGAVIMPF
FT                   LPGDSLLFAASALAADPRYHLNIWIFIFIFLCACLGGDSLNFLIGHKIGKSLSNHSLFG
FT                   KLIDKDSLERAEVFFEKHGAPAIILARFIPIIRTFAPFAAAGSGFPYKQFIRYSVIGCV
FT                   VWVALCCGCGYFFGNLPFVQEHFSVIILAIIVVTLIPAVIGALRSRFVKEDA"
FT   gene            624382..625950
FT                   /locus_tag="Lreu_R0022"
FT   rRNA            624382..625950
FT                   /locus_tag="Lreu_R0022"
FT                   /product="16S ribosomal RNA"
FT   gene            626044..626118
FT                   /locus_tag="Lreu_R0023"
FT                   /note="tRNA-Ile1"
FT   tRNA            626044..626118
FT                   /locus_tag="Lreu_R0023"
FT                   /product="tRNA-Ile"
FT   gene            626122..626194
FT                   /locus_tag="Lreu_R0024"
FT                   /note="tRNA-Ala1"
FT   tRNA            626122..626194
FT                   /locus_tag="Lreu_R0024"
FT                   /product="tRNA-Ala"
FT   gene            626354..629276
FT                   /locus_tag="Lreu_R0025"
FT   rRNA            626354..629276
FT                   /locus_tag="Lreu_R0025"
FT                   /product="23S ribosomal RNA"
FT   gene            629357..629472
FT                   /locus_tag="Lreu_R0026"
FT   rRNA            629357..629472
FT                   /locus_tag="Lreu_R0026"
FT                   /product="5S ribosomal RNA"
FT   gene            629476..629548
FT                   /locus_tag="Lreu_R0027"
FT                   /note="tRNA-Val1"
FT   tRNA            629476..629548
FT                   /locus_tag="Lreu_R0027"
FT                   /product="tRNA-Val"
FT   gene            629567..629639
FT                   /locus_tag="Lreu_R0028"
FT                   /note="tRNA-Lys1"
FT   tRNA            629567..629639
FT                   /locus_tag="Lreu_R0028"
FT                   /product="tRNA-Lys"
FT   gene            629683..629755
FT                   /locus_tag="Lreu_R0029"
FT                   /note="tRNA-Thr4"
FT   tRNA            629683..629755
FT                   /locus_tag="Lreu_R0029"
FT                   /product="tRNA-Thr"
FT   gene            629765..629836
FT                   /locus_tag="Lreu_R0030"
FT                   /note="tRNA-Gly1"
FT   tRNA            629765..629836
FT                   /locus_tag="Lreu_R0030"
FT                   /product="tRNA-Gly"
FT   gene            629853..629938
FT                   /locus_tag="Lreu_R0031"
FT                   /note="tRNA-Leu2"
FT   tRNA            629853..629938
FT                   /locus_tag="Lreu_R0031"
FT                   /product="tRNA-Leu"
FT   gene            629947..630020
FT                   /locus_tag="Lreu_R0032"
FT                   /note="tRNA-Arg1"
FT   tRNA            629947..630020
FT                   /locus_tag="Lreu_R0032"
FT                   /product="tRNA-Arg"
FT   gene            630026..630099
FT                   /locus_tag="Lreu_R0033"
FT                   /note="tRNA-Pro1"
FT   tRNA            630026..630099
FT                   /locus_tag="Lreu_R0033"
FT                   /product="tRNA-Pro"
FT   gene            630130..630203
FT                   /locus_tag="Lreu_R0034"
FT                   /note="tRNA-Met1"
FT   tRNA            630130..630203
FT                   /locus_tag="Lreu_R0034"
FT                   /product="tRNA-Met"
FT   gene            630219..630295
FT                   /locus_tag="Lreu_R0035"
FT                   /note="tRNA-Met2"
FT   tRNA            630219..630295
FT                   /locus_tag="Lreu_R0035"
FT                   /product="tRNA-Met"
FT   gene            630345..630432
FT                   /locus_tag="Lreu_R0036"
FT                   /note="tRNA-Ser1"
FT   tRNA            630345..630432
FT                   /locus_tag="Lreu_R0036"
FT                   /product="tRNA-Ser"
FT   gene            630441..630514
FT                   /locus_tag="Lreu_R0037"
FT                   /note="tRNA-Met3"
FT   tRNA            630441..630514
FT                   /locus_tag="Lreu_R0037"
FT                   /product="tRNA-Met"
FT   gene            630519..630593
FT                   /locus_tag="Lreu_R0038"
FT                   /note="tRNA-Asp1"
FT   tRNA            630519..630593
FT                   /locus_tag="Lreu_R0038"
FT                   /product="tRNA-Asp"
FT   gene            630603..630675
FT                   /locus_tag="Lreu_R0039"
FT                   /note="tRNA-Phe1"
FT   tRNA            630603..630675
FT                   /locus_tag="Lreu_R0039"
FT                   /product="tRNA-Phe"
FT   gene            630691..630761
FT                   /locus_tag="Lreu_R0040"
FT                   /note="tRNA-Gly2"
FT   tRNA            630691..630761
FT                   /locus_tag="Lreu_R0040"
FT                   /product="tRNA-Gly"
FT   gene            630771..630845
FT                   /locus_tag="Lreu_R0041"
FT                   /note="tRNA-Ile2"
FT   tRNA            630771..630845
FT                   /locus_tag="Lreu_R0041"
FT                   /product="tRNA-Ile"
FT   gene            630848..630935
FT                   /locus_tag="Lreu_R0042"
FT                   /note="tRNA-Ser2"
FT   tRNA            630848..630935
FT                   /locus_tag="Lreu_R0042"
FT                   /product="tRNA-Ser"
FT   gene            630940..631011
FT                   /locus_tag="Lreu_R0043"
FT                   /note="tRNA-Glu2"
FT   tRNA            630940..631011
FT                   /locus_tag="Lreu_R0043"
FT                   /product="tRNA-Glu"
FT   gene            631022..631095
FT                   /locus_tag="Lreu_R0044"
FT                   /note="tRNA-Met4"
FT   tRNA            631022..631095
FT                   /locus_tag="Lreu_R0044"
FT                   /product="tRNA-Met"
FT   gene            631100..631174
FT                   /locus_tag="Lreu_R0045"
FT                   /note="tRNA-Asp2"
FT   tRNA            631100..631174
FT                   /locus_tag="Lreu_R0045"
FT                   /product="tRNA-Asp"
FT   gene            complement(631363..631854)
FT                   /locus_tag="Lreu_0566"
FT   CDS_pept        complement(631363..631854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82834"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ10"
FT                   /protein_id="ABQ82834.1"
FT                   /translation="MLTKISLTFGSRQILQSIIDKYPERHFKLMQATTHTRKLALFDLS
FT                   GKDTIFQSPVKLTTLDSTLDAQLNGMFYYQSFQVNGDRQKLLYNTLQKVLTEPADMNGG
FT                   YMLSVDNKAEATTLVLLTAWADFEALTAWKESETFTSLKNFTSMGSDNSYYDEIYKPIF
FT                   "
FT   gene            632102..632503
FT                   /locus_tag="Lreu_0567"
FT   CDS_pept        632102..632503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0567"
FT                   /product="arsenate reductase-like protein"
FT                   /note="PFAM: arsenate reductase and related"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82835"
FT                   /db_xref="GOA:A5VJ11"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR023731"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ11"
FT                   /protein_id="ABQ82835.1"
FT                   /translation="MVTLYTSPSCTSCRKARAWLKEHDIAFKERNIFSEPLSLNEIKNI
FT                   LRMTEDGTEDIISKRSKAYQKLSVDLNDLSMKALFKLISKNPGLLRRPIIIDDKRLQVG
FT                   YNEDEIRRFLPRKVRELELVEAQEKANMI"
FT   gene            632629..633300
FT                   /locus_tag="Lreu_0568"
FT   CDS_pept        632629..633300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0568"
FT                   /product="Negative regulator of genetic competence"
FT                   /note="PFAM: Negative regulator of genetic competence"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82836"
FT                   /db_xref="GOA:A5VJ12"
FT                   /db_xref="InterPro:IPR008681"
FT                   /db_xref="InterPro:IPR038471"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VJ12"
FT                   /protein_id="ABQ82836.1"
FT                   /translation="MEMERINENTIRVLVDNDDLSARGITILDLLGDHQQIEDFFYSIL
FT                   KEVDTDHQFQNNDAVTFQVMPTNNGLELFISKNDSNFAGNEQHGPINDQVSKYIKQHLI
FT                   QKNSPDQDQRKTAINDSEDNEIQHTNWQVITFDSFEDLIDFAKIAESDDVSSYLYKYND
FT                   LYYLAIAYSDSILNSNDVKDQLALAYEYGNPTATTVDFLSEHGKKIMSVSALHLIRHYF
FT                   E"
FT   gene            633384..634418
FT                   /locus_tag="Lreu_0569"
FT   CDS_pept        633384..634418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0569"
FT                   /product="Competence CoiA family protein"
FT                   /note="PFAM: Competence CoiA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82837"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ13"
FT                   /protein_id="ABQ82837.1"
FT                   /translation="MLIAVHNDQLVLAGNAKSDMAYYCPGCGQGVILRRGKHKITHYAH
FT                   KKGNDCGFSEGETLEHLKGKKQIYQWAQKHHWNPQLEVYFPTIAQRPDILLEINGHTVA
FT                   VEFQCSPLSLEKLLARNEGYRQLRIPVWWILGSPYLRNLRNKKIVQFTQIFRKQFVLLF
FT                   WDVKRAQLVINQKYWRCSYSRLKYDKKTILMEQIEMLEKKQYHFPSKEIRELSLTTLRL
FT                   TGHALSECPLVCHDLIASWPAMSIPIIIWRIGVILEIEKFPLFYSWGDKEWKNLLMKVN
FT                   KSDWLFPGCLPPETIRNIIINQYTNELIAFKVIYREDNHLILIHRPQWFNDAQLKLQLV
FT                   KRRS"
FT   gene            634420..635796
FT                   /locus_tag="Lreu_0570"
FT   CDS_pept        634420..635796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0570"
FT                   /product="dipeptidase A, Cysteine peptidase, MEROPS family
FT                   C69"
FT                   /note="PFAM: peptidase U34, dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82838"
FT                   /db_xref="GOA:A5VJ14"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ14"
FT                   /protein_id="ABQ82838.1"
FT                   /translation="MQHTCTMFLAGKNATIDGSTIVCREEDYGNAFNPQRFVLVKPERQ
FT                   PRQYQSKTTDFKIDLPVPKLKYTSTPDADDKDGIFGAGGINGVNVAMSATETITTNARI
FT                   LAIDPYNTLSGIGEEDFVTLVLPYIKSAQDGVKKLGSLLEKYGTYEANAIAFSDNNEVW
FT                   YMETIGGHHWAAVKIPDSAYVIAPNRFNITNFDFDGPNTMSSPNLKQWIDQNKLNPSEN
FT                   EYNLRRICGSATATDTVYNNPRAWYVQQQLGTINANPQSNNLPFICYAKEKLTVTTIKK
FT                   LMSSHYQGTAFDPYHLERDKAPFRSIALNRNLELHILQIRNNVPASIAGVHWLAFGPNT
FT                   FNAVVPFYANIDDTPIPYRNTSTEYSIDDMYWLTHTIAALGDQNYRQAQSIEENFELQV
FT                   MAKTMNVQKNTDKEIAEHQDVSAFLTTINNRMAETAVDESKKLLGKLVKLTFSRERLQF
FT                   "
FT   gene            complement(635868..636506)
FT                   /locus_tag="Lreu_0571"
FT   CDS_pept        complement(635868..636506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82839"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ15"
FT                   /protein_id="ABQ82839.1"
FT                   /translation="MLELHLFVNPLGMRCLRCEKDVLKIDRDLNTKISYQFVPLFNMKT
FT                   IDSTLKYYHLNPHDLAARQQVSKTLNQVILDYKAALFQGRKRGRHYLLQLQSALINQGL
FT                   DYNDGLINKIAHDSHLDLEMFFEDRQSQLAKQAFRQDQKIASNLGVSETATAVVFNTED
FT                   SDYGLMIPNFDYNTLINAFKSRKLARSASLDEFVNQYRPPKLQIIQNNN"
FT   gene            636671..637324
FT                   /locus_tag="Lreu_0572"
FT   CDS_pept        636671..637324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0572"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82840"
FT                   /db_xref="GOA:A5VJ16"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ16"
FT                   /protein_id="ABQ82840.1"
FT                   /translation="MIEDWQHFLLPYQQAVNELKVKLRGMRKQFQDQTQHSPIEFVTGR
FT                   VKPVDSIKEKMIRRHVQEDRLEQDMQDIAGLRIMCQFVEDIYKVVDLLRQRSDMTILEE
FT                   RDYITNVKPSGYRSYHIVIEYPVQLITGEKRILAEIQVRTLAMNFWATVEHSLNYKYQG
FT                   EFPEELSARLQRAAEAAFKLDNEMSEIREEIKEAQTLFSKRRSTNSINEDELKE"
FT   gene            637328..638140
FT                   /locus_tag="Lreu_0573"
FT   CDS_pept        637328..638140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0573"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="PFAM: ATP-NAD/AcoX kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82841"
FT                   /db_xref="GOA:A5VJ17"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VJ17"
FT                   /protein_id="ABQ82841.1"
FT                   /translation="MRIGIYNNETAESQRVTKVLKTEMKRAGLTYVEKNPEVVITIGGD
FT                   GTLLSAFHHYQKDLNNIRFVGIHTGHLGFYTDWRSFEIDDLVDSLVKDSGQAVSYPLLD
FT                   MKATYSDGQIENYIALNESTIRNVTRTMVCDVFINNHLFENFRGDGLCISTPTGSTAYN
FT                   KSVGGAIVDPNSVGFQLAEMASLNNRVFRTLGSPIIFGADAELILRLRDENGHVLTCDR
FT                   DQWMLKSEKERYLTELSYKVSKQRIYFAQYRHNNFWNRVKDSFIGGVH"
FT   gene            638140..639045
FT                   /locus_tag="Lreu_0574"
FT   CDS_pept        638140..639045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0574"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="3.2.1.17"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82842"
FT                   /db_xref="GOA:A5VJ18"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ18"
FT                   /protein_id="ABQ82842.1"
FT                   /translation="MKFNWIYDHRTPRKLRSALKMYGVSSSLLKVAIYHGGKMQINGVD
FT                   KWAVDTVNYLDKVTLILPPETANDNVDVSEAPIDIIYEDQDFLIMNKPAGVATVPAHNV
FT                   PVADSLVNRVKGYYKRQNYENQVTHVATRLDRDTSGLVVFPKHRFAHAVLDEQLKKHLV
FT                   KKNYLALIKGKVPAEHGYIDAPIQRDPNSFVKRMVGKEGKASVTEYWRQECNVQASLIK
FT                   IRLHTGRTHQIRVHFASLGFPLIGDKMYGEESGLIARQALHCYWLSFYSPFKGKNITVS
FT                   APLPSDFKNAKDDLLSTKNY"
FT   gene            639563..641131
FT                   /locus_tag="Lreu_R0046"
FT   rRNA            639563..641131
FT                   /locus_tag="Lreu_R0046"
FT                   /product="16S ribosomal RNA"
FT   gene            641225..641299
FT                   /locus_tag="Lreu_R0047"
FT                   /note="tRNA-Ile3"
FT   tRNA            641225..641299
FT                   /locus_tag="Lreu_R0047"
FT                   /product="tRNA-Ile"
FT   gene            641303..641375
FT                   /locus_tag="Lreu_R0048"
FT                   /note="tRNA-Ala2"
FT   tRNA            641303..641375
FT                   /locus_tag="Lreu_R0048"
FT                   /product="tRNA-Ala"
FT   gene            641535..644457
FT                   /locus_tag="Lreu_R0049"
FT   rRNA            641535..644457
FT                   /locus_tag="Lreu_R0049"
FT                   /product="23S ribosomal RNA"
FT   gene            644539..644654
FT                   /locus_tag="Lreu_R0050"
FT   rRNA            644539..644654
FT                   /locus_tag="Lreu_R0050"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(644837..646373)
FT                   /pseudo
FT                   /locus_tag="Lreu_0575"
FT   gene            complement(646444..646800)
FT                   /locus_tag="Lreu_0576"
FT   CDS_pept        complement(646444..646800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0576"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82843"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ19"
FT                   /protein_id="ABQ82843.1"
FT                   /translation="MLVNWHDPDHIYLVCGKTDMRKGIDGLAMVIAENYGLELYNNSLF
FT                   LFCGGRNDRFKGLFWDGEGFIMLYKRFENGHLSWPRNSNEAKELSAQQLDWLLQGLNPL
FT                   PIRKIQAVRPGSFY"
FT   gene            complement(646790..646978)
FT                   /locus_tag="Lreu_0577"
FT   CDS_pept        complement(646790..646978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82844"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ20"
FT                   /protein_id="ABQ82844.1"
FT                   /translation="MTEQNEIITPVFKNRPSNLQKHSFTARPAVKINVNEVELTIFKGT
FT                   NSVLASDIVKVVIRYAR"
FT   gene            complement(647399..648427)
FT                   /locus_tag="Lreu_0578"
FT   CDS_pept        complement(647399..648427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0578"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82845"
FT                   /db_xref="GOA:A5VJ21"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ21"
FT                   /protein_id="ABQ82845.1"
FT                   /translation="MIEQFLIGTYTKKASKGIYKVTLDTAQEKITNVELAIPSQKPAYL
FT                   QVGQDDRIYAIKQVDDKGGVASYSLSDDNAKMLSDVLAAGAPPAYVGVDNKRHLLFSAN
FT                   YHTAKIDVFKINEDGTLTQTDSVLHEGATGPEPEQEAPHVHYADLTPDNRLVVCDLGMD
FT                   LVVVYDVSDDGKLTAVSRYKCEDGFGTRHIAFHPNGNYAYLLGELSSKLEVLKYNSNDA
FT                   SFKHLQTLKTIPEDWTAHNGAAAIRISNDGKFVYTSNRGENTIAVFEVQPDFTVKHIQS
FT                   ISTEGDFPRDFNLNQDENYLLASNQNSDNLTLYKRNPSTGKLTLLQKDVSCPEPVCVMK
FT                   WK"
FT   gene            648542..649399
FT                   /locus_tag="Lreu_0579"
FT   CDS_pept        648542..649399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0579"
FT                   /product="23S rRNA m(1)G-748 methyltransferase"
FT                   /note="PFAM: Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82846"
FT                   /db_xref="GOA:A5VJ22"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ22"
FT                   /protein_id="ABQ82846.1"
FT                   /translation="MKKVERQREMVKNNLALFQCPVCEQPMERIEGNSIICGNSHRFDF
FT                   NRHGYLHFLNGAANTEYDRSMFESRRQLLNAGLFKPIIENIGKFLPSKSLRILDVGTGE
FT                   GTPLLQLETIRANCNDTMIGFDISKPGITLATQLPLKAFFCVADLRKLPFNDESFDCIL
FT                   ELFSPSDYQEFKRVLTKDGTLIKVIPNANYLVELRHLLYETGERNYHYDNSRVIELFKQ
FT                   HYPHSKVETVTYQFRIPDGLQQAMLEMTPLHWGANAKRLSKEELTQLKTITVDVSLLIA
FT                   KKAN"
FT   gene            649571..650080
FT                   /locus_tag="Lreu_0580"
FT   CDS_pept        649571..650080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0580"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82847"
FT                   /db_xref="GOA:A5VJ23"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ23"
FT                   /protein_id="ABQ82847.1"
FT                   /translation="MTNHIVLFEPLFPANTGNIARTCAGTNTELHLIKPLGFSTDDKHM
FT                   KRAGLDYWDKVKITYHEDLPSFMKTIPDINRLYIVSKFATHDYSDVDYTGEGDHYFLFG
FT                   KETTGLPERFMQKYPENAIRIPQNDNNIRALNLSNSAAIVIYEALRQQNFPNLARVHKY
FT                   EFDKLK"
FT   gene            650102..652432
FT                   /locus_tag="Lreu_0581"
FT   CDS_pept        650102..652432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0581"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82848"
FT                   /db_xref="GOA:A5VJ24"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ24"
FT                   /protein_id="ABQ82848.1"
FT                   /translation="MARRKKASSRRTRGKKQQYRLMDNLLGIIVCLLMLVGLFNLGVLG
FT                   TFLDNCFKIFVGSSFPIAMIIVFLYGLCFALYGHRPHFKKRWIAGTIIAYIGLLMWLQT
FT                   VMFQRLNLHAKVIETTWNSLSKVIFNGDSTVPVGGGMIGAYLYNGSNILISEVGTAVLS
FT                   WLLMIIGIIVFFALPWREFLVKCGIGIKKSGAAMANAHDQLMKKRTERATKTTTVPSIS
FT                   VPLAKASRQVKDFFADQESAEPTSTPPVSPAMPIQDPVEPTIRVASESQVEGTHSGTQD
FT                   EQTSKQHDDTEIKLAGIDAKEDNDYQLPPVSLLSQVKATDQQEDLNNIKKNTKTLQQTL
FT                   KSFGVDATVENVNLGPSVTKYELRPAVGVKVSRITHLADDLALALAAKDIRIEAPIPGK
FT                   SLIGIEVPNQQIATVGFRDMVENAPSNDNPMEVPLGRSVTGDIKMADLTKMPHLLIAGA
FT                   TGSGKSVAINVIITSILLKAKPHQVKMLMIDPKKVELSVYNGIPHLLSPVVSEPKKAAR
FT                   ALGKVVAEMERRYELFAKFGVRNLDGYNKLVKQQNDDHPDEVQANLPLILVIVDELADL
FT                   MMTVSHDVEDAIVRIAQMGRAAGIHMILATQRPSVDVITGLIKANVPSRIAFAVSSGVD
FT                   SRTIIDTNGAEKLLGRGDMLFEPIDQNKPVRIQGAFISDHDVESVVDFIKNERAAEYDD
FT                   NMVVTDNEIEQEEQAEEEDELFPEALDFVVDQQKASTSLIQRRFRIGYNRAARIIDDME
FT                   QRGFIGPANGSKPREVYKQKSEE"
FT   sig_peptide     650102..650239
FT                   /locus_tag="Lreu_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.617 at
FT                   residue 46"
FT   gene            complement(652494..652640)
FT                   /locus_tag="Lreu_0582"
FT   CDS_pept        complement(652494..652640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82849"
FT                   /db_xref="GOA:A5VJ25"
FT                   /db_xref="InterPro:IPR025270"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ25"
FT                   /protein_id="ABQ82849.1"
FT                   /translation="MIKMEGWLIMQRKKKTRFQKITMVAIWLMLIAMLGSLIFGAVASL
FT                   NLI"
FT   sig_peptide     complement(652518..652640)
FT                   /locus_tag="Lreu_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.985 at
FT                   residue 41"
FT   gene            652715..653095
FT                   /locus_tag="Lreu_0583"
FT   CDS_pept        652715..653095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82850"
FT                   /db_xref="GOA:A5VJ26"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ26"
FT                   /protein_id="ABQ82850.1"
FT                   /translation="MKRRGLKRLMVSIQVIILEIILLLVIGIVERLLVRIFHHPKKTKH
FT                   LWWGWTIILWILIIFNIGFYWPAYPIALWMILALLLIALQIIHNHEFIYRRYWPVFWRY
FT                   SAYYALTIYIGSLIISPWLPLI"
FT   gene            653384..653812
FT                   /locus_tag="Lreu_0584"
FT   CDS_pept        653384..653812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0584"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82851"
FT                   /db_xref="GOA:A5VJ27"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VJ27"
FT                   /protein_id="ABQ82851.1"
FT                   /translation="MLMGEFTHTIDSKGRLIIPAKFREQLGAHFIVTRGLDGCLFGYPL
FT                   NEWAILEQKLKALPLTKRDARAFVRFLYSAATDCEIDKQGRINIPITLRTHASLEKKCV
FT                   IVGVSNRLEIWSAERWNKFTSETADNFDEIAEDLNIDF"
FT   gene            653828..654784
FT                   /locus_tag="Lreu_0585"
FT   CDS_pept        653828..654784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0585"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82852"
FT                   /db_xref="GOA:A5VJ28"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VJ28"
FT                   /protein_id="ABQ82852.1"
FT                   /translation="MAEFKHVTVLLKEAVAGLNVQPTGTYVDATLGGGGHTQAILQQLV
FT                   DGHLYSFDQDQTAIDYNKEHLKTAIEQQKLTLVEDNFRNLKAELNSYNVKHVNGILYDL
FT                   GVSSPQFDDAKRGFSYQHDAPLDMRMNQEQKLSAMEVVNEWPYERLVKILYRYGEEKFA
FT                   KSIARKIEQRRKVAPIKTTFELVDVIKEGIPAAARRHGGHPAKKSFQAIRIAVNDELGA
FT                   LEESLEQALDLLDVGGRISVITFQSLEDRLVKTMFREKTSLSGDVPQGLPVIPAGMEPN
FT                   FKLINKKPIVASDEELAANHRAHSAKLRIIEKIREGK"
FT   gene            654792..655163
FT                   /locus_tag="Lreu_0586"
FT   CDS_pept        654792..655163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0586"
FT                   /product="cell division protein FtsL"
FT                   /note="TIGRFAM: cell division protein FtsL; PFAM: Septum
FT                   formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82853"
FT                   /db_xref="GOA:A5VJ29"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ29"
FT                   /protein_id="ABQ82853.1"
FT                   /translation="MVSNAARQLAGEQQPQQAPRKKTYQQPKISPSPVRWSKFERSLVA
FT                   VGSLITLCLMISLLSTKISINNQQRRLQDTQTQITKAKSSNTSLQQEIAELTTQSHLKS
FT                   AAHKYGLSDKNSNVRNVNK"
FT   gene            655163..657322
FT                   /locus_tag="Lreu_0587"
FT   CDS_pept        655163..657322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0587"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; PASTA
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82854"
FT                   /db_xref="GOA:A5VJ30"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ30"
FT                   /protein_id="ABQ82854.1"
FT                   /translation="MNKKPQRTKNRGHRENRGTFGKWLFLITVGLFTLFIVRFAYIAIN
FT                   KDVQHVNLRSQAEQIYTQQRIIQARRGDIYDSEGNPLATDTSKYTLYAVLDRTQKSSDG
FT                   KPLYVKDRKKTAKVLSQYIDLTPKQIEKILKPKGQAYQVEFGNAGSNLSVSTMQKIKNR
FT                   HLPGINFIATPARQYPEGEFASQIIGMATPKVKNDNGTEETNLVGQLGLEGYFNKQLTG
FT                   INGLRKDKQDVYGYQIANSKQVTKKAINGDNIYTTLDSQTQHFLENKVNKVYKSSNANA
FT                   MTAVVMEAKTGKIIAATQRPTLHAENNPVWRNMLVQDAYEPGSVMKILSLAAAIDTGHF
FT                   NPNATFNSGTWTMGGGKITDWSSSGWGTISYKDAFDMSSNVGFAHVEQDMGAETWMKYI
FT                   KRFGLLKKVNVIGMSNEVNGYTSFKGILAQANTAFGQGITVNVMQMMQAFSAIGNNGKM
FT                   MKPYIVSKVVDGNSGKTIQKVKPKVVGQPIKASTAKKVLGYMQGVVYDQKGLGHDYQIK
FT                   GYRIAGKTATAQIGGAHGYSTGDTNYLYSFAGMAPAKNPKYIMYVTLRQPQNLKKPATK
FT                   QIASVFNPTMKMLLSQQKVAEKAKKKVITMPNVVGQASDEANKELSGKGMQVIVVGSGK
FT                   KVKQQSAVPDEQVLTDQHVILDTGGEYKMPDISGWSSADVQQLAKVLKLKVKENGNGYV
FT                   TQQSISPDTTIKRGTTLTVQYEAKN"
FT   sig_peptide     655163..655285
FT                   /locus_tag="Lreu_0587"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.673) with cleavage site probability 0.600 at
FT                   residue 41"
FT   gene            657347..658318
FT                   /locus_tag="Lreu_0588"
FT   CDS_pept        657347..658318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0588"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82855"
FT                   /db_xref="GOA:A5VJ31"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VJ31"
FT                   /protein_id="ABQ82855.1"
FT                   /translation="MNFLSAVLTILSSFLITFLLMPSLIKYFRAKKEGQQIRKEGPTWH
FT                   AKKAGTPTMGGLLFIFSAVVTILWVAAWQGLITNTLWALLFVLVVYGLIGMWDDSIKIF
FT                   HHQNEGFKPWQKALCQVLAAMVFTVIYQHEGFQMGFGTTQIGWLYGLFIIFWIVGFSNA
FT                   VNLTDGLDGLVSGLSIISFAAYLIIALVNLNQPGYPEIALFCLAMIGTLLGFFPYNHKP
FT                   AKIFMGDMGSLAIGASLAAVSLLLHHEWSLLVIGIVYVCETASVILQVASFKTTGKRIF
FT                   KMTPIHHHFEMSGWSEWKIDIVFWLVGLVAAIIAVTTILLVG"
FT   gene            658331..659701
FT                   /locus_tag="Lreu_0589"
FT   CDS_pept        658331..659701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0589"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82856"
FT                   /db_xref="GOA:A5VJ32"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VJ32"
FT                   /protein_id="ABQ82856.1"
FT                   /translation="MKKIDEYQGKKVLVMGFGISGINAAHLLVKLGANVTANDKATPKN
FT                   NDIVDDLEADGIKVITGDNPISLANEGFDVVVKNPGIPYDNPLVAAFVKQGTPIITEAE
FT                   LGWQIFDGHLVSVTGSNGKTTTTTLTQLMIAENAKHQVKYAGNIGISFSKIAEDLGPDD
FT                   TLVTELSSFQLLGAPTIHPHIAIITNIFSNHLDYHKTRENYINAKLNITRNQTKDDFLV
FT                   INWDRDEWQKIAQRSQATIVPFSRLNKSHEGSYVEDGMIYWRGQEVMPTKDIRLIGPQN
FT                   VENALAAIAAAKLSGVTNDAIKKVLTTFSGVRHRLQYVMEYQERLFYNDSKSTDIEATE
FT                   VALQGFDRPVILLAGGLDRGYTFERLVPYFKKHVKAMIVFGECKDKMKDAGNQAGVPVV
FT                   ESENAITAVPEAWKLSEPGDVILLSPANASWDQFPSFEVRGDKFIEAVEELTGKKEQ"
FT   gene            659703..660815
FT                   /locus_tag="Lreu_0590"
FT   CDS_pept        659703..660815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0590"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82857"
FT                   /db_xref="GOA:A5VJ33"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VJ33"
FT                   /protein_id="ABQ82857.1"
FT                   /translation="MRLLVSGGGTGGHIYPALALIERLKQVEPDTEVLYVGTTRGLENK
FT                   IVPDAGIELETMHMQGFKRSLSLENFKTIYLFLNSVHHAKKIISEFKPDVVLGTGGYVS
FT                   GAVLYAAAKKHIPTVIHEQNSVVGVTNKFLSRYVDQIAIAFEAARSQFPADKVTMAGNP
FT                   RAQQVAAKKDSDFSWTRYDLKDDVPTLMIFGGSQGAPKINKTVVDAIPEFNKRPYQVIF
FT                   ATGQKRYDDVKKQLAEGNIKPADNVKVVPYIKDMPAKMPRVAALVSRAGATTIAEVTAL
FT                   GVPTILIPSPYVTANHQVKNAQALVKNNAGLMITEDKLDARALLTQADKIMEDEEVRKE
FT                   MAHAAEKMGRPDAADRLIKILHKAIDEHEK"
FT   gene            660843..661691
FT                   /locus_tag="Lreu_0591"
FT   CDS_pept        660843..661691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0591"
FT                   /product="cell division protein FtsQ"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein, FtsQ-type"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82858"
FT                   /db_xref="GOA:A5VJ34"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026580"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ34"
FT                   /protein_id="ABQ82858.1"
FT                   /translation="MLDDRSAIEHHKYSQRLTELEKRSAAAQQRQQQRKPSKTHVGNKI
FT                   RGIKIKRYVSNGERVLKLVVLFSVILLFMLYIISPLSKITTLHVTGNHDLTKEQVEKNT
FT                   NIYPGRFIWGVYLARHQLTKQAIRKNPQIKDLRIKVTGPQSLQISVKENALLGTAVMDN
FT                   DTYAVLADGQLQRTKNADNGIAYKRFDGHKKVLATTAAQLGKLKPAIRNGISSVSYQPT
FT                   KDYPDRVIIYMRDGNTVYGDLNTIGDKMGYYPAIAASMKNKGIIDLQVGAYSYDYGSKD
FT                   K"
FT   gene            661812..663185
FT                   /locus_tag="Lreu_0592"
FT   CDS_pept        661812..663185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0592"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82859"
FT                   /db_xref="GOA:A5VJ35"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="InterPro:IPR021873"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ35"
FT                   /protein_id="ABQ82859.1"
FT                   /translation="MNNSEVYVGLDIGTTSIKALVCESVKGQLKVIGVGVERSAGLNRG
FT                   VIVDIDKTAQAISAAVAQAEEKSNVEIQSVVVGLPANYLQMQRVHGMITIATRGQSREI
FT                   VNQDVIDVAREALTQSIPPEREIIDLIPTEFTVDGFSGIKDPRGMVGVRLEMKATLYTG
FT                   PKTIIHNTKKAVQQAGYDIKDFVITPIATDFNLLNDGEQDFGTVVIDLGGGQTTTSIIH
FT                   DHQLKYTYVDPEGGKYITKDISTVMNTSLKNAEQLKLNHGYAMASLADEDVQVDVDVVG
FT                   QNDPVQYSEQYLSEIIEARVRQIFDRIQDKLKAIHAPELPGGVVLIGGVAALPGVKELA
FT                   EQYFTGNIKVNVPEQMGIRHPRYAVSLALGMYENQLSDIDRLIKQTVQRIDTIKSPHEE
FT                   KGQTVNQPRQQWTEKSDKLQRSQREAQQQPVTEEPAPKKKKQNGLSNRFKNIFNNLFD"
FT   gene            663203..664450
FT                   /locus_tag="Lreu_0593"
FT   CDS_pept        663203..664450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0593"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82860"
FT                   /db_xref="GOA:A5VJ36"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ36"
FT                   /protein_id="ABQ82860.1"
FT                   /translation="MDNETFANDNQFAEAQIKVIGVGGAGGNAVNRMITEKVQGVDFIV
FT                   ANTDLQALNNSQATTKIRLGPKLTKGLGAGSNPEVGEKAAQESEEQIKKALEGADMVFI
FT                   TAGMGGGTGTGAAPVVAKLAKDSGALTVGVVTRPFSFEGPRRARYAAEGLEKLKSNVDT
FT                   LIIVANNRLLEMIDKKTPMMEAFKEADNVLRQGVQGISDLIVTPGYINLDFADIKTLMS
FT                   NQGSALMGVGASTGENRATEATKKAISSPLLEVSIDGAQHVLMDITGGKDLSMFEAQEA
FT                   SDVIKQAAGTNVDISFGMSLNESMGDEVRVTVIATGIDKKKKIQQQKPAEKEAPRVTRS
FT                   IPQEEQPVEQPKQRDPFDGWNDPTADTSNQSRNSDNEFSHVTKPEFNVFNDDAANTDDN
FT                   DDTNLSTPPFFKNRRK"
FT   gene            664520..664936
FT                   /locus_tag="Lreu_0594"
FT   CDS_pept        664520..664936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0594"
FT                   /product="protein of unknown function DUF552"
FT                   /note="PFAM: protein of unknown function DUF552"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82861"
FT                   /db_xref="GOA:A5VJ37"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VJ37"
FT                   /protein_id="ABQ82861.1"
FT                   /translation="MAANFLKSLFGEEDIDEQDGLYETSEQVSTPANTSNKVVSINSGR
FT                   LNQMSQISLYEPRLYADVKQIASQLLEGHAVIVNFTQMDANVAARLVDFLNGTVFAIDG
FT                   EMKRIGKEIFLCTPKNYEISGSLTSNLKNDGDKF"
FT   gene            664955..665215
FT                   /locus_tag="Lreu_0595"
FT   CDS_pept        664955..665215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0595"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82862"
FT                   /db_xref="GOA:A5VJ38"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ38"
FT                   /protein_id="ABQ82862.1"
FT                   /translation="MIAFLLWALNQLVDAYILVIVVWCIMSWFPNARNSRLGDIINRLV
FT                   EPYMHWFDFIPPIGGISFAPMIAILVLYFVQAGLAQIAAII"
FT   gene            665238..666023
FT                   /locus_tag="Lreu_0596"
FT   CDS_pept        665238..666023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0596"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82863"
FT                   /db_xref="GOA:A5VJ39"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR040591"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ39"
FT                   /protein_id="ABQ82863.1"
FT                   /translation="MSEDNIKQHFRPDEATLIDQANDWVATAEGQYRPVLTPFLNPRER
FT                   FIVQTIVNRNNNVKITMYGGWQGAEMQRVLIYPPYYEPSIEDFALQALEINYPVKFSEL
FT                   HHRQIMGTLIGEGMERNAFGDILTDGSHWQVIVTKPMAEYLRKNVEHVGRIKVKWIPIA
FT                   TEAVVTPKEEWVPIVTTVSSLRLDVVIAAGFNYSRNRAKQLIEHGQVRLNWEEIDRPDY
FT                   QIVVHDLISVRHGGRLRIDMTNGKTKKDKERITISVVNA"
FT   gene            666045..666785
FT                   /locus_tag="Lreu_0597"
FT   CDS_pept        666045..666785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0597"
FT                   /product="DivIVA family protein"
FT                   /note="PFAM: DivIVA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82864"
FT                   /db_xref="GOA:A5VJ40"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ40"
FT                   /protein_id="ABQ82864.1"
FT                   /translation="MSLTVDQINNKQFNTKMRGYNPEEVQEFIQEVSQTVQQLITENNN
FT                   LQEQVRANDSKIKYFADLKDSLNKSILVAQEAADKVKNNAKREADIMIREAQKQATDIV
FT                   SEANDKSNQVIEDAANSTKKLTSETNDLRKQTRIFRQRLQVMLESQLEVIKSNEWDKLL
FT                   ENDDLSKYDEIEKILGSRLDSSSATSVESTATAISEEQPVESEQPVASAEQPEESAPAQ
FT                   PTAVNDDKGADAPETVVVFPDNNK"
FT   gene            666996..669878
FT                   /locus_tag="Lreu_0598"
FT   CDS_pept        666996..669878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0598"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82865"
FT                   /db_xref="GOA:A5VJ41"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ41"
FT                   /protein_id="ABQ82865.1"
FT                   /translation="MVPRRSFVPVMGGSFFIIKIQELMKGVVTMRVKDTLNLGRTKFPM
FT                   RGKLPVTEAQREQLWEENKVYELRQKLNEGKPTFVLHDGPPYANGNIHIGHAMNKISKD
FT                   FIVRYKSMSGYRAPYVPGWDTHGLPIEHQLTKSGYDRKKMSLTEFRDLCREYALKQVDK
FT                   QRTDFKRLGVSGEWDHPYLTLDKEFEAAQIRVFGEFAKKGLLYQAKKPVYWSWSSESAL
FT                   AEAEVEYHDVVAKTAFFVEQIKDGKGRLDNDTYLVVWTTTPWTVPASEAVAVNPKFDYS
FT                   VVNPANDDRKFVVATDLLEKLAEKLGWEDYEVVDHLMGQELEGMTTQHPYLDRDLLVGL
FT                   ADYVTADAGTGLVHTAPGYGDDDYNFGKKYDLPIFAPINDQGVLTKENGEGFEGVFYQD
FT                   ADDVSLQKLEENNALLLQEPLQHSYPFDWRTKQPIIFRATDQWFVSIEKMRQNILDALE
FT                   DVKYHPEWGKVRLRNMIKDRGDWVISRQRVWGVPLPIFYAEDGTPIMEEETINHVAELF
FT                   AKYGSNVWFEREAKDLLPEGYTNEHSPNGKFTKETDIMDVWFDSGSSHQGVLAERDYLT
FT                   YPADLYLEGSDQYRGWFNSSLITSVVCSGHAPYKEIVSQGFTLDKRGNKMSKSQGNVID
FT                   PNKVVQQMGAEIIRLWVMSADTSADVRVSMGTFQQISEAYRKLRNTFRFLLANTSDFNP
FT                   EENTVSYEKLQSVDKYMLVKLNHFLKTMREDFDNYDFLDAYKVLINFVNNDLSAFYMNI
FT                   AKDVLYIEAENSEVRRSMQTVFYDILLTLVKLLTPILPHTTEEVWSYMNEPEDFVQLTE
FT                   IPDPRTFAGEEELLSKWDDFMEVRSHVLKSLEEARNAKLIGKSLEAQVDLYLTDDQKQL
FT                   LDSLNENIQLLLGVSALHVHPADEAPADADQYNDGVAVKVTTANGETCARCRMVKEDVG
FT                   SDPAYPELCARCAAIVRENFPETAEDGLEE"
FT   gene            669991..670194
FT                   /locus_tag="Lreu_0599"
FT   CDS_pept        669991..670194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0599"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82866"
FT                   /db_xref="GOA:A5VJ42"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ42"
FT                   /protein_id="ABQ82866.1"
FT                   /translation="MLKGKVKSFDEQKGWGFITVPHEGEIFVHYSGIEGTRRRILHPDE
FT                   EVSLVIVQGQKGPQAAHVRVLR"
FT   gene            670207..670758
FT                   /locus_tag="Lreu_0600"
FT   CDS_pept        670207..670758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0600"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82867"
FT                   /db_xref="GOA:A5VJ43"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ43"
FT                   /protein_id="ABQ82867.1"
FT                   /translation="MEFEERPISSKTVFHGHLIDVEVQQVITPHGNKTQREIVHHAPAI
FT                   AILALTADNKMILEKQWRAPIAKTTLEIPAGKLDQRDADNALHAAKRELNEETRYEATS
FT                   LKKISSFYTSVGCMDEYMTLYLATGLKRVSNELPQDQDEQLMLKEVTLPQALEMIDQGE
FT                   IEDAKTIMAIYYWQGMNNRG"
FT   gene            670751..671020
FT                   /locus_tag="Lreu_0601"
FT   CDS_pept        670751..671020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82868"
FT                   /db_xref="GOA:A5VJ44"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ44"
FT                   /protein_id="ABQ82868.1"
FT                   /translation="MDNKQQDEQQSRMSRSQYRQQQRQTEQQPINEATENTTDQPYSRE
FT                   AVASQRHDETVAEKTARLKRRLNIAIIALIVAIIIVYLILFYVG"
FT   gene            671036..671731
FT                   /locus_tag="Lreu_0602"
FT   CDS_pept        671036..671731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0602"
FT                   /product="methylthioadenosine nucleosidase"
FT                   /EC_number="3.2.2.16"
FT                   /note="PFAM: purine or other phosphorylase, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82869"
FT                   /db_xref="GOA:A5VJ45"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ45"
FT                   /protein_id="ABQ82869.1"
FT                   /translation="MRFGIICAMPEEIKELTAKLSDKQEKKIGGKSYLFGKINNQDVVL
FT                   VESGIGKVEAGITTEHLITDCGADVVINSGSAGGIGEGLHVGDIVISTETAYHDVDATA
FT                   FNYRYGQLPGKEPRFKASDQWGQALEKAGEKTGLNVKRGLIVSGDQFIASSEAIKEILN
FT                   NFPDALSSEMEGAAVGQVATDHQIPYVVVRAMSDTGDEDAGVSFDDFIIDAGKRSANML
FT                   LQLFADLDK"
FT   gene            671751..672905
FT                   /locus_tag="Lreu_0603"
FT   CDS_pept        671751..672905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0603"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82870"
FT                   /db_xref="GOA:A5VJ46"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ46"
FT                   /protein_id="ABQ82870.1"
FT                   /translation="MSEIYLDNAATTPMTPEVIAEVTKQMQESWGNASTGYSYGRHAKL
FT                   VMEDSRHILAQSINADDNEIIFTSGGTESDNTAIIQTAFKRQNLGKHIITTAIEHEAVL
FT                   KPLHFLEEHGFEVTYLPVDENGNISIDDFKAALRDDTILVTIMMENNEVGSQMPIHEIG
FT                   EILKEHQAWFHTDAVQAYGLLPIDVKADHIDMLSTSAHKINGPKMMGFLYRRDGISFPS
FT                   FIKGGDQETKRRAGTENVPGIAGFAKAVELNTPEVKEERRDRYYVFKQKIVNALKENNV
FT                   DFEINGQINKTHVLNLWFKGISTYVIQTDLDLAGIAVSGGSACTAGSIEPSHVLTAMFG
FT                   ADSPRISESIRISFGGLNTEEDIDQLIATIVKTVENLKKINGDN"
FT   gene            672907..673245
FT                   /locus_tag="Lreu_0604"
FT   CDS_pept        672907..673245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82871"
FT                   /db_xref="InterPro:IPR014965"
FT                   /db_xref="InterPro:IPR035942"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ47"
FT                   /protein_id="ABQ82871.1"
FT                   /translation="MEFTKTVQISGDKDKYTISPEIKKYALLDLGFEQTNRGNFEYLGS
FT                   LDTDNPFKPVARLRILINSDLDGFKMETLSGNGLRKINIFNHQRAAEFIQQYHYILDEM
FT                   VARQIFTK"
FT   gene            673353..674486
FT                   /locus_tag="Lreu_0605"
FT   CDS_pept        673353..674486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0605"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="PFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   PP-loop domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82872"
FT                   /db_xref="GOA:A5VJ48"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VJ48"
FT                   /protein_id="ABQ82872.1"
FT                   /translation="MADNSHTRVVVGMSGGVDSSVTALLLKRQGYDVVGVFMKNWDDTD
FT                   ENGVCTATEDYKDVAKVASKIGIPYYSVNFEKEYWDRVFKYFIAEYKKGRTPNPDVICN
FT                   KEIKFKAFIEYANQLGADYVATGHYADVKRDENGRMHLMRAKDQHKDQTYFLSQLDYKQ
FT                   LDKVMFPLAGYTKPEIRKIAEEAGLATADKKDSVGICFIGEDGHFREFLSQYIPAQPGN
FT                   METLDGKVVGQHMGLMYYTIGQRRGLGLGGNKESNEPWFVIGKDMKKNVLYVGQGYENS
FT                   HLYATHLEASDIHWVDDVVSRYGRDFHCTAKFRYRQTDVGVTVHLSDDDQMVTVEFDDP
FT                   ARAITPGQAVVFYDGEECLGSAIIDRAYSHDRQLQYV"
FT   gene            674623..675279
FT                   /locus_tag="Lreu_0606"
FT   CDS_pept        674623..675279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0606"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82873"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ49"
FT                   /protein_id="ABQ82873.1"
FT                   /translation="MTKVYLIRHGKTQWNLESRYQGANGDSPLLKDSYREIELLASSLQ
FT                   RIPFEYAYTSPLKRARVTAQALLNHLNPEIPLTIDSRLKEFNLGKMEGMHFEDVAAKWP
FT                   EVLKNFRHHPDKYDESLVEGESFLEVIARFRAAIEEYCRQYPNGNILVISHGAALNAAI
FT                   NALIGTPLAHLKDRGGLSNTSTTILTTNDGRHFELEKWNDTSYLHKSKVDPTDTI"
FT   gene            675292..675975
FT                   /locus_tag="Lreu_0607"
FT   CDS_pept        675292..675975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0607"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82874"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ50"
FT                   /protein_id="ABQ82874.1"
FT                   /translation="MTEKKDFRDPKKKETEKLVHKLVEAIDEHPDKVNNYYDLGSLLTR
FT                   LNDYQQAEELFMKALGIFEAKGDKDAMNLLNYGLGNLYYEIGKVNEAIKLYNKIDDSKL
FT                   KADSYLMLAQSYMKKGQYKQAVAYGLTALELRPDDPEINQVIGDSLLALGEFKQAKAYY
FT                   DAILKYHPGRADTQFNRGIVAMVLGEPYKDYLAQAKQLDPNYYHKSEQRLNDIEKTLQA
FT                   TQKKD"
FT   gene            675997..678474
FT                   /locus_tag="Lreu_0608"
FT   CDS_pept        675997..678474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0608"
FT                   /product="ATP-dependent DNA helicase, RecD/TraA family"
FT                   /note="TIGRFAM: helicase, RecD/TraA family; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82875"
FT                   /db_xref="GOA:A5VJ51"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ51"
FT                   /protein_id="ABQ82875.1"
FT                   /translation="MAEEIDLFKTPTEPSFFIGQVQSEIFTSPDSFFKVLIVSVEEANF
FT                   DWHEPEITVTGSFGDLSDDQTYRFEGKIVEHPRYGQQFQATSYHVNRPTSKDGLIDFLS
FT                   GKQFTGIGKKTAEKIVDKLGTDAINKIIADPHVLDELKLRKAVKDSLVDNLRAHQGMDQ
FT                   IIIGLNDLGFGANLSSAIFDKYGEETLHIINENPYQLAAEIDGISFNRADQVAQKLGIA
FT                   TDDSRRIDAAIIQTLDDLTMETGDTFTTTKPLLQQTIQLLAQGSGGRVSTDLIANQIVE
FT                   LEKNQAISYADEKIYPTALYNAEWQIADHLHRLLTVDQEKVPATTIEKTVTKVADQSGI
FT                   TYDQVQKEAIKTALNSKVMLLTGGPGTGKTTIIKGIVASYAKIHDLSLDVNEYKEKSFP
FT                   VLLAAPTGRAAKRMSEATDLPASTIHRLLGLNGREMPTDMNARDLEGSLLIIDEMSMVD
FT                   TLLFKTLIQAVPTSMHVVLVGDKDQLPSVGPGQVFHDLLDFAELPKVELTNIHRQAADS
FT                   TIIPLAHAIKEGKLPSDLTNKMPDRSFISCHANQVPSVVQQIIDLSKKRDYSANDIQIL
FT                   APMYRGQAGIDRLNELAQQAYNPPANGKQEVDFRGLTFRVGDKVLQLVNVPEKNIFNGD
FT                   IGKITAIESGRTVGKKNESITVDFDGNEVSYSRMEWNQLRLAYCISIHKAQGSQFKMVL
FT                   LPIVQQFSRMLQRNLLYTAITRAAEKLVLIGEPYAAVTSVKNEAVNRKTSLVDRLGRVW
FT                   NRHGELKSNLDHQTDSLTKELASSQPVQKQTEQLINNDAQQYILTADLINSDTIDPLIG
FT                   MENISLQSLHQVK"
FT   gene            678544..679518
FT                   /locus_tag="Lreu_0609"
FT   CDS_pept        678544..679518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0609"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82876"
FT                   /db_xref="GOA:A5VJ52"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ52"
FT                   /protein_id="ABQ82876.1"
FT                   /translation="MTQIKNADNVRLFSLNSNPKLAEQISQRVGIPLSKASISHFADGE
FT                   IKITIDESIRGCEVYVIQSVSDPVNTNLMELLIMVDALRRASAAKINVVMPYYGYARQD
FT                   RKARSREPITAKLIANLLEMDQISRLVTIDLHAPQVQGFFDIPVDHLQATSLFTKYIEE
FT                   QNLGDDIVVVAPDHAGVNLARKYAERIKASIAIIDNRNDEVRERTEQEVPEYVIGDVKG
FT                   KTAIIVDDIVDTGVRMNLSAQALKNFGAAKVYGIATHAVLSADAVNTLQNSPLEKMIVT
FT                   DTIQLPKEKEFSKLVQLSVDDLLKEAIVRIHNNQSIDTLFNRK"
FT   gene            complement(679585..680586)
FT                   /locus_tag="Lreu_0610"
FT   CDS_pept        complement(679585..680586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0610"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82877"
FT                   /db_xref="GOA:A5VJ53"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ53"
FT                   /protein_id="ABQ82877.1"
FT                   /translation="MVQLLKVHGSQNAFFILDQTQLTNPLNDEELVSFTQQITDAQNGV
FT                   LGGADGVLVVNHPTRPGSAAQMRVINADGSEASMCGNGLRTVARYVAERDNLTDFKVDT
FT                   MNASLRVRQHEDLAPGVPAFAVEISPVKFDRTALPFDNLGHKRLLDTLVPELYPSLRFS
FT                   ALAVPNPHLISFVSMEELNGSALKELGTRLNSDNPYFSDGVNVNFGHILGHNKLFVKTF
FT                   ERGVGFTNACGTGMSATSLALALTHPDAASFNEPISVYNPGGMVKTILHRDDYNYWIEL
FT                   IGNATFTNIITVEESTIHQENLDELQSSSVETAENKAYLAFVNSLPSLKFEN"
FT   gene            complement(680599..681957)
FT                   /locus_tag="Lreu_0611"
FT   CDS_pept        complement(680599..681957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0611"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="TIGRFAM: aspartate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82878"
FT                   /db_xref="GOA:A5VJ54"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ54"
FT                   /protein_id="ABQ82878.1"
FT                   /translation="MKVVKFGGSSLANGEAFQNAINIITSDPQRRVIVTSAPGKRFADD
FT                   IKVTDLLIKYAQTVIAGQNPQEIVEQILNRYQEIAAYFGLPADKLIPLAERLEGLPNHT
FT                   YPNDNYLLAAFKAHGERLNAQLMAILLQHLGYEARFVTPSEAGIIVTGTPNNANVIPET
FT                   YANLSHFTFNENELLIFPGFYGLTLAGHIATFSRGGSDITGAILARGLHASTYENFTDV
FT                   DAIYSANPQIVDHPQPITTMTYREMRELSYAGFSVFHDEALIPAIQGNIPINVRNTNDP
FT                   EKPGTMIVPDKDFQPSDIVTGVVSGKHFAALYLHKYLLNKQAGFTLRILEILAKHNVSY
FT                   EHMPSGIDDITIILDRNAINDQLIDTICNEIQEEINPDRLEWIDNYAITMVVGEGMRNR
FT                   TGVIDDILMPLAEKHIAVPMINQGASRIAIMIGTYNEDADEAVRAIYHRFFAN"
FT   gene            682438..683748
FT                   /locus_tag="Lreu_0612"
FT   CDS_pept        682438..683748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0612"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82879"
FT                   /db_xref="GOA:A5VJ55"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A5VJ55"
FT                   /protein_id="ABQ82879.1"
FT                   /translation="MNEQISDQQINAAGHLTIGGCDAVDLAHRFGTPLVVYDVQQIRNQ
FT                   IRAFKQVFEENSVDYAVSYASKAFSAIAMYQVVAAEGAHVDVVSGGELYTAIKAGFPMA
FT                   NVSFHGNNKSREELEMAIDHHVGTIMIDNFHEIELLADVLEEHDAHVDVMLRITPGISA
FT                   HTNKYIQTGQVDSKFGFDLQSGQADEALTKVLENPRMQMKGLHAHIGSQIFELAGFEGV
FT                   AKKLVEVAAHWQEKFNYQAAVINVGGGFGIRYVKDDTPLAPEEFVAAIIKAIKTEIKET
FT                   NLAMPAIWIEPGRSIAGPAGYNLYTVGSRKDVPGLKPYVTVDGGMGDNIRPALYEAQYE
FT                   TVLANNPRAELVEHVRVAGKYCESGDILSQNQALPATKPGDVLAMLDTGAYGYSMASNY
FT                   NRNPRPAVVFAEKGTAQVVIKRETYDDLIHLDEPYQQ"
FT   gene            683785..684495
FT                   /locus_tag="Lreu_0613"
FT   CDS_pept        683785..684495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Lreu_0613"
FT                   /product="Tetrahydrodipicolinate succinyltransferase
FT                   N-terminal domain protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Tetrahydrodipicolinate succinyltransferase
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Lreu_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ82880"
FT