(data stored in SCRATCH zone)

EMBL: CP000712

ID   CP000712; SV 1; circular; genomic DNA; STD; PRO; 5959964 BP.
XX
AC   CP000712; AALM01000000-AALM01000120;
XX
PR   Project:PRJNA13909;
XX
DT   01-JUN-2007 (Rel. 92, Created)
DT   01-MAY-2017 (Rel. 132, Last updated, Version 6)
XX
DE   Pseudomonas putida F1, complete genome.
XX
KW   .
XX
OS   Pseudomonas putida F1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Pseudomonadaceae; Pseudomonas.
XX
RN   [1]
RP   1-5959964
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Lykidis A., Parales R., Richardson P.;
RT   "Complete sequence of Pseudomonas putida F1";
RL   Unpublished.
XX
RN   [2]
RP   1-5959964
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Lykidis A., Parales R., Richardson P.;
RT   ;
RL   Submitted (25-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; afd8694b7d0d8e3c025e91252e70a4a4.
DR   BioSample; SAMN00623058.
DR   EnsemblGenomes-Gn; EBG00001007169.
DR   EnsemblGenomes-Gn; EBG00001007170.
DR   EnsemblGenomes-Gn; EBG00001007171.
DR   EnsemblGenomes-Gn; EBG00001007172.
DR   EnsemblGenomes-Gn; EBG00001007173.
DR   EnsemblGenomes-Gn; EBG00001007174.
DR   EnsemblGenomes-Gn; EBG00001007175.
DR   EnsemblGenomes-Gn; EBG00001007176.
DR   EnsemblGenomes-Gn; EBG00001007177.
DR   EnsemblGenomes-Gn; EBG00001007178.
DR   EnsemblGenomes-Gn; EBG00001007179.
DR   EnsemblGenomes-Gn; EBG00001007180.
DR   EnsemblGenomes-Gn; EBG00001007181.
DR   EnsemblGenomes-Gn; EBG00001007182.
DR   EnsemblGenomes-Gn; EBG00001007183.
DR   EnsemblGenomes-Gn; EBG00001007184.
DR   EnsemblGenomes-Gn; EBG00001007185.
DR   EnsemblGenomes-Gn; EBG00001007186.
DR   EnsemblGenomes-Gn; EBG00001007187.
DR   EnsemblGenomes-Gn; EBG00001007188.
DR   EnsemblGenomes-Gn; EBG00001007189.
DR   EnsemblGenomes-Gn; EBG00001007190.
DR   EnsemblGenomes-Gn; EBG00001007191.
DR   EnsemblGenomes-Gn; EBG00001007192.
DR   EnsemblGenomes-Gn; EBG00001007193.
DR   EnsemblGenomes-Gn; EBG00001007194.
DR   EnsemblGenomes-Gn; EBG00001007195.
DR   EnsemblGenomes-Gn; EBG00001007196.
DR   EnsemblGenomes-Gn; EBG00001007197.
DR   EnsemblGenomes-Gn; EBG00001007198.
DR   EnsemblGenomes-Gn; EBG00001007199.
DR   EnsemblGenomes-Gn; EBG00001007200.
DR   EnsemblGenomes-Gn; EBG00001007201.
DR   EnsemblGenomes-Gn; EBG00001007202.
DR   EnsemblGenomes-Gn; EBG00001007203.
DR   EnsemblGenomes-Gn; EBG00001007204.
DR   EnsemblGenomes-Gn; EBG00001007205.
DR   EnsemblGenomes-Gn; EBG00001007206.
DR   EnsemblGenomes-Gn; EBG00001007207.
DR   EnsemblGenomes-Gn; EBG00001007208.
DR   EnsemblGenomes-Gn; EBG00001007209.
DR   EnsemblGenomes-Gn; EBG00001007210.
DR   EnsemblGenomes-Gn; EBG00001007211.
DR   EnsemblGenomes-Gn; EBG00001007212.
DR   EnsemblGenomes-Gn; EBG00001007213.
DR   EnsemblGenomes-Gn; EBG00001007214.
DR   EnsemblGenomes-Gn; EBG00001007215.
DR   EnsemblGenomes-Gn; EBG00001007216.
DR   EnsemblGenomes-Gn; EBG00001007217.
DR   EnsemblGenomes-Gn; EBG00001007218.
DR   EnsemblGenomes-Gn; EBG00001007219.
DR   EnsemblGenomes-Gn; EBG00001007220.
DR   EnsemblGenomes-Gn; EBG00001007221.
DR   EnsemblGenomes-Gn; EBG00001007222.
DR   EnsemblGenomes-Gn; EBG00001007223.
DR   EnsemblGenomes-Gn; EBG00001007224.
DR   EnsemblGenomes-Gn; EBG00001007225.
DR   EnsemblGenomes-Gn; EBG00001007226.
DR   EnsemblGenomes-Gn; EBG00001007227.
DR   EnsemblGenomes-Gn; EBG00001007228.
DR   EnsemblGenomes-Gn; EBG00001007229.
DR   EnsemblGenomes-Gn; EBG00001007230.
DR   EnsemblGenomes-Gn; EBG00001007231.
DR   EnsemblGenomes-Gn; EBG00001007232.
DR   EnsemblGenomes-Gn; EBG00001007233.
DR   EnsemblGenomes-Gn; EBG00001007234.
DR   EnsemblGenomes-Gn; EBG00001007235.
DR   EnsemblGenomes-Gn; EBG00001007236.
DR   EnsemblGenomes-Gn; EBG00001007237.
DR   EnsemblGenomes-Gn; EBG00001007238.
DR   EnsemblGenomes-Gn; EBG00001007239.
DR   EnsemblGenomes-Gn; EBG00001007240.
DR   EnsemblGenomes-Gn; EBG00001007241.
DR   EnsemblGenomes-Gn; EBG00001007242.
DR   EnsemblGenomes-Gn; EBG00001007243.
DR   EnsemblGenomes-Gn; EBG00001007244.
DR   EnsemblGenomes-Gn; EBG00001007245.
DR   EnsemblGenomes-Gn; EBG00001007246.
DR   EnsemblGenomes-Gn; EBG00001007247.
DR   EnsemblGenomes-Gn; EBG00001007248.
DR   EnsemblGenomes-Gn; EBG00001007249.
DR   EnsemblGenomes-Gn; EBG00001007250.
DR   EnsemblGenomes-Gn; EBG00001007251.
DR   EnsemblGenomes-Gn; EBG00001007252.
DR   EnsemblGenomes-Gn; EBG00001007253.
DR   EnsemblGenomes-Gn; EBG00001007254.
DR   EnsemblGenomes-Gn; EBG00001007255.
DR   EnsemblGenomes-Gn; EBG00001007256.
DR   EnsemblGenomes-Gn; EBG00001007257.
DR   EnsemblGenomes-Gn; EBG00001007258.
DR   EnsemblGenomes-Gn; EBG00001007259.
DR   EnsemblGenomes-Gn; EBG00001007260.
DR   EnsemblGenomes-Gn; EBG00001007261.
DR   EnsemblGenomes-Gn; EBG00001007262.
DR   EnsemblGenomes-Gn; EBG00001007263.
DR   EnsemblGenomes-Gn; EBG00001007264.
DR   EnsemblGenomes-Gn; EBG00001007265.
DR   EnsemblGenomes-Gn; EBG00001007266.
DR   EnsemblGenomes-Gn; EBG00001007267.
DR   EnsemblGenomes-Gn; EBG00001007268.
DR   EnsemblGenomes-Gn; EBG00001007269.
DR   EnsemblGenomes-Gn; EBG00001007270.
DR   EnsemblGenomes-Gn; EBG00001007271.
DR   EnsemblGenomes-Gn; EBG00001007272.
DR   EnsemblGenomes-Gn; EBG00001007273.
DR   EnsemblGenomes-Gn; EBG00001007274.
DR   EnsemblGenomes-Gn; EBG00001007275.
DR   EnsemblGenomes-Gn; EBG00001007276.
DR   EnsemblGenomes-Gn; EBG00001007277.
DR   EnsemblGenomes-Gn; EBG00001007278.
DR   EnsemblGenomes-Gn; EBG00001007279.
DR   EnsemblGenomes-Gn; EBG00001007280.
DR   EnsemblGenomes-Gn; EBG00001007281.
DR   EnsemblGenomes-Gn; EBG00001007282.
DR   EnsemblGenomes-Gn; EBG00001007283.
DR   EnsemblGenomes-Gn; EBG00001007284.
DR   EnsemblGenomes-Gn; EBG00001007285.
DR   EnsemblGenomes-Gn; EBG00001007286.
DR   EnsemblGenomes-Gn; EBG00001007287.
DR   EnsemblGenomes-Gn; EBG00001007288.
DR   EnsemblGenomes-Gn; EBG00001007289.
DR   EnsemblGenomes-Gn; EBG00001007290.
DR   EnsemblGenomes-Gn; EBG00001007291.
DR   EnsemblGenomes-Gn; EBG00001007292.
DR   EnsemblGenomes-Gn; EBG00001007293.
DR   EnsemblGenomes-Gn; EBG00001007294.
DR   EnsemblGenomes-Gn; EBG00001007295.
DR   EnsemblGenomes-Gn; EBG00001007296.
DR   EnsemblGenomes-Gn; EBG00001007297.
DR   EnsemblGenomes-Gn; EBG00001007298.
DR   EnsemblGenomes-Gn; EBG00001007299.
DR   EnsemblGenomes-Gn; EBG00001007300.
DR   EnsemblGenomes-Gn; EBG00001007301.
DR   EnsemblGenomes-Gn; EBG00001007302.
DR   EnsemblGenomes-Gn; EBG00001007303.
DR   EnsemblGenomes-Gn; EBG00001007304.
DR   EnsemblGenomes-Gn; EBG00001007305.
DR   EnsemblGenomes-Gn; EBG00001007306.
DR   EnsemblGenomes-Gn; EBG00001007307.
DR   EnsemblGenomes-Gn; EBG00001007308.
DR   EnsemblGenomes-Gn; EBG00001007309.
DR   EnsemblGenomes-Gn; EBG00001007310.
DR   EnsemblGenomes-Gn; EBG00001007311.
DR   EnsemblGenomes-Gn; EBG00001007312.
DR   EnsemblGenomes-Gn; EBG00001007313.
DR   EnsemblGenomes-Gn; Pput_R0001.
DR   EnsemblGenomes-Gn; Pput_R0002.
DR   EnsemblGenomes-Gn; Pput_R0003.
DR   EnsemblGenomes-Gn; Pput_R0004.
DR   EnsemblGenomes-Gn; Pput_R0005.
DR   EnsemblGenomes-Gn; Pput_R0006.
DR   EnsemblGenomes-Gn; Pput_R0007.
DR   EnsemblGenomes-Gn; Pput_R0008.
DR   EnsemblGenomes-Gn; Pput_R0009.
DR   EnsemblGenomes-Gn; Pput_R0010.
DR   EnsemblGenomes-Gn; Pput_R0011.
DR   EnsemblGenomes-Gn; Pput_R0012.
DR   EnsemblGenomes-Gn; Pput_R0013.
DR   EnsemblGenomes-Gn; Pput_R0014.
DR   EnsemblGenomes-Gn; Pput_R0015.
DR   EnsemblGenomes-Gn; Pput_R0016.
DR   EnsemblGenomes-Gn; Pput_R0017.
DR   EnsemblGenomes-Gn; Pput_R0018.
DR   EnsemblGenomes-Gn; Pput_R0019.
DR   EnsemblGenomes-Gn; Pput_R0020.
DR   EnsemblGenomes-Gn; Pput_R0021.
DR   EnsemblGenomes-Gn; Pput_R0022.
DR   EnsemblGenomes-Gn; Pput_R0023.
DR   EnsemblGenomes-Gn; Pput_R0024.
DR   EnsemblGenomes-Gn; Pput_R0025.
DR   EnsemblGenomes-Gn; Pput_R0026.
DR   EnsemblGenomes-Gn; Pput_R0027.
DR   EnsemblGenomes-Gn; Pput_R0028.
DR   EnsemblGenomes-Gn; Pput_R0029.
DR   EnsemblGenomes-Gn; Pput_R0030.
DR   EnsemblGenomes-Gn; Pput_R0031.
DR   EnsemblGenomes-Gn; Pput_R0032.
DR   EnsemblGenomes-Gn; Pput_R0033.
DR   EnsemblGenomes-Gn; Pput_R0034.
DR   EnsemblGenomes-Gn; Pput_R0035.
DR   EnsemblGenomes-Gn; Pput_R0036.
DR   EnsemblGenomes-Gn; Pput_R0037.
DR   EnsemblGenomes-Gn; Pput_R0038.
DR   EnsemblGenomes-Gn; Pput_R0039.
DR   EnsemblGenomes-Gn; Pput_R0040.
DR   EnsemblGenomes-Gn; Pput_R0041.
DR   EnsemblGenomes-Gn; Pput_R0042.
DR   EnsemblGenomes-Gn; Pput_R0043.
DR   EnsemblGenomes-Gn; Pput_R0044.
DR   EnsemblGenomes-Gn; Pput_R0045.
DR   EnsemblGenomes-Gn; Pput_R0046.
DR   EnsemblGenomes-Gn; Pput_R0047.
DR   EnsemblGenomes-Gn; Pput_R0048.
DR   EnsemblGenomes-Gn; Pput_R0049.
DR   EnsemblGenomes-Gn; Pput_R0050.
DR   EnsemblGenomes-Gn; Pput_R0051.
DR   EnsemblGenomes-Gn; Pput_R0052.
DR   EnsemblGenomes-Gn; Pput_R0053.
DR   EnsemblGenomes-Gn; Pput_R0054.
DR   EnsemblGenomes-Gn; Pput_R0055.
DR   EnsemblGenomes-Gn; Pput_R0056.
DR   EnsemblGenomes-Gn; Pput_R0057.
DR   EnsemblGenomes-Gn; Pput_R0058.
DR   EnsemblGenomes-Gn; Pput_R0059.
DR   EnsemblGenomes-Gn; Pput_R0060.
DR   EnsemblGenomes-Gn; Pput_R0061.
DR   EnsemblGenomes-Gn; Pput_R0062.
DR   EnsemblGenomes-Gn; Pput_R0063.
DR   EnsemblGenomes-Gn; Pput_R0064.
DR   EnsemblGenomes-Gn; Pput_R0065.
DR   EnsemblGenomes-Gn; Pput_R0066.
DR   EnsemblGenomes-Gn; Pput_R0067.
DR   EnsemblGenomes-Gn; Pput_R0068.
DR   EnsemblGenomes-Gn; Pput_R0069.
DR   EnsemblGenomes-Gn; Pput_R0070.
DR   EnsemblGenomes-Gn; Pput_R0071.
DR   EnsemblGenomes-Gn; Pput_R0072.
DR   EnsemblGenomes-Gn; Pput_R0073.
DR   EnsemblGenomes-Gn; Pput_R0074.
DR   EnsemblGenomes-Gn; Pput_R0075.
DR   EnsemblGenomes-Gn; Pput_R0076.
DR   EnsemblGenomes-Gn; Pput_R0077.
DR   EnsemblGenomes-Gn; Pput_R0078.
DR   EnsemblGenomes-Gn; Pput_R0079.
DR   EnsemblGenomes-Gn; Pput_R0080.
DR   EnsemblGenomes-Gn; Pput_R0081.
DR   EnsemblGenomes-Gn; Pput_R0082.
DR   EnsemblGenomes-Gn; Pput_R0083.
DR   EnsemblGenomes-Gn; Pput_R0084.
DR   EnsemblGenomes-Gn; Pput_R0085.
DR   EnsemblGenomes-Gn; Pput_R0086.
DR   EnsemblGenomes-Gn; Pput_R0087.
DR   EnsemblGenomes-Gn; Pput_R0088.
DR   EnsemblGenomes-Gn; Pput_R0089.
DR   EnsemblGenomes-Gn; Pput_R0090.
DR   EnsemblGenomes-Gn; Pput_R0091.
DR   EnsemblGenomes-Gn; Pput_R0092.
DR   EnsemblGenomes-Gn; Pput_R0093.
DR   EnsemblGenomes-Gn; Pput_R0094.
DR   EnsemblGenomes-Gn; Pput_R0095.
DR   EnsemblGenomes-Gn; Pput_R0096.
DR   EnsemblGenomes-Gn; Pput_R0097.
DR   EnsemblGenomes-Gn; Pput_R0098.
DR   EnsemblGenomes-Tr; EBT00001533128.
DR   EnsemblGenomes-Tr; EBT00001533130.
DR   EnsemblGenomes-Tr; EBT00001533131.
DR   EnsemblGenomes-Tr; EBT00001533132.
DR   EnsemblGenomes-Tr; EBT00001533134.
DR   EnsemblGenomes-Tr; EBT00001533136.
DR   EnsemblGenomes-Tr; EBT00001533137.
DR   EnsemblGenomes-Tr; EBT00001533139.
DR   EnsemblGenomes-Tr; EBT00001533141.
DR   EnsemblGenomes-Tr; EBT00001533143.
DR   EnsemblGenomes-Tr; EBT00001533145.
DR   EnsemblGenomes-Tr; EBT00001533147.
DR   EnsemblGenomes-Tr; EBT00001533149.
DR   EnsemblGenomes-Tr; EBT00001533152.
DR   EnsemblGenomes-Tr; EBT00001533157.
DR   EnsemblGenomes-Tr; EBT00001533159.
DR   EnsemblGenomes-Tr; EBT00001533160.
DR   EnsemblGenomes-Tr; EBT00001533163.
DR   EnsemblGenomes-Tr; EBT00001533166.
DR   EnsemblGenomes-Tr; EBT00001533169.
DR   EnsemblGenomes-Tr; EBT00001533172.
DR   EnsemblGenomes-Tr; EBT00001533174.
DR   EnsemblGenomes-Tr; EBT00001533176.
DR   EnsemblGenomes-Tr; EBT00001533178.
DR   EnsemblGenomes-Tr; EBT00001533179.
DR   EnsemblGenomes-Tr; EBT00001533181.
DR   EnsemblGenomes-Tr; EBT00001533183.
DR   EnsemblGenomes-Tr; EBT00001533186.
DR   EnsemblGenomes-Tr; EBT00001533187.
DR   EnsemblGenomes-Tr; EBT00001533189.
DR   EnsemblGenomes-Tr; EBT00001533191.
DR   EnsemblGenomes-Tr; EBT00001533192.
DR   EnsemblGenomes-Tr; EBT00001533195.
DR   EnsemblGenomes-Tr; EBT00001533198.
DR   EnsemblGenomes-Tr; EBT00001533202.
DR   EnsemblGenomes-Tr; EBT00001533205.
DR   EnsemblGenomes-Tr; EBT00001533208.
DR   EnsemblGenomes-Tr; EBT00001533210.
DR   EnsemblGenomes-Tr; EBT00001533211.
DR   EnsemblGenomes-Tr; EBT00001533214.
DR   EnsemblGenomes-Tr; EBT00001533216.
DR   EnsemblGenomes-Tr; EBT00001533217.
DR   EnsemblGenomes-Tr; EBT00001533219.
DR   EnsemblGenomes-Tr; EBT00001533223.
DR   EnsemblGenomes-Tr; EBT00001533225.
DR   EnsemblGenomes-Tr; EBT00001533227.
DR   EnsemblGenomes-Tr; EBT00001533228.
DR   EnsemblGenomes-Tr; EBT00001533230.
DR   EnsemblGenomes-Tr; EBT00001533233.
DR   EnsemblGenomes-Tr; EBT00001533235.
DR   EnsemblGenomes-Tr; EBT00001533237.
DR   EnsemblGenomes-Tr; EBT00001533238.
DR   EnsemblGenomes-Tr; EBT00001533240.
DR   EnsemblGenomes-Tr; EBT00001533242.
DR   EnsemblGenomes-Tr; EBT00001533243.
DR   EnsemblGenomes-Tr; EBT00001533244.
DR   EnsemblGenomes-Tr; EBT00001533247.
DR   EnsemblGenomes-Tr; EBT00001533249.
DR   EnsemblGenomes-Tr; EBT00001533250.
DR   EnsemblGenomes-Tr; EBT00001533252.
DR   EnsemblGenomes-Tr; EBT00001533253.
DR   EnsemblGenomes-Tr; EBT00001533255.
DR   EnsemblGenomes-Tr; EBT00001533257.
DR   EnsemblGenomes-Tr; EBT00001533258.
DR   EnsemblGenomes-Tr; EBT00001533259.
DR   EnsemblGenomes-Tr; EBT00001533264.
DR   EnsemblGenomes-Tr; EBT00001533267.
DR   EnsemblGenomes-Tr; EBT00001533271.
DR   EnsemblGenomes-Tr; EBT00001533275.
DR   EnsemblGenomes-Tr; EBT00001533278.
DR   EnsemblGenomes-Tr; EBT00001533281.
DR   EnsemblGenomes-Tr; EBT00001533283.
DR   EnsemblGenomes-Tr; EBT00001533285.
DR   EnsemblGenomes-Tr; EBT00001533288.
DR   EnsemblGenomes-Tr; EBT00001533292.
DR   EnsemblGenomes-Tr; EBT00001533295.
DR   EnsemblGenomes-Tr; EBT00001533298.
DR   EnsemblGenomes-Tr; EBT00001533302.
DR   EnsemblGenomes-Tr; EBT00001533306.
DR   EnsemblGenomes-Tr; EBT00001533308.
DR   EnsemblGenomes-Tr; EBT00001533311.
DR   EnsemblGenomes-Tr; EBT00001533313.
DR   EnsemblGenomes-Tr; EBT00001533315.
DR   EnsemblGenomes-Tr; EBT00001533318.
DR   EnsemblGenomes-Tr; EBT00001533322.
DR   EnsemblGenomes-Tr; EBT00001533324.
DR   EnsemblGenomes-Tr; EBT00001533326.
DR   EnsemblGenomes-Tr; EBT00001533329.
DR   EnsemblGenomes-Tr; EBT00001533333.
DR   EnsemblGenomes-Tr; EBT00001533335.
DR   EnsemblGenomes-Tr; EBT00001533338.
DR   EnsemblGenomes-Tr; EBT00001533342.
DR   EnsemblGenomes-Tr; EBT00001533345.
DR   EnsemblGenomes-Tr; EBT00001533350.
DR   EnsemblGenomes-Tr; EBT00001533353.
DR   EnsemblGenomes-Tr; EBT00001533356.
DR   EnsemblGenomes-Tr; EBT00001533359.
DR   EnsemblGenomes-Tr; EBT00001533363.
DR   EnsemblGenomes-Tr; EBT00001533366.
DR   EnsemblGenomes-Tr; EBT00001533371.
DR   EnsemblGenomes-Tr; EBT00001533375.
DR   EnsemblGenomes-Tr; EBT00001533378.
DR   EnsemblGenomes-Tr; EBT00001533384.
DR   EnsemblGenomes-Tr; EBT00001533387.
DR   EnsemblGenomes-Tr; EBT00001533390.
DR   EnsemblGenomes-Tr; EBT00001533392.
DR   EnsemblGenomes-Tr; EBT00001533394.
DR   EnsemblGenomes-Tr; EBT00001533399.
DR   EnsemblGenomes-Tr; EBT00001533400.
DR   EnsemblGenomes-Tr; EBT00001533403.
DR   EnsemblGenomes-Tr; EBT00001533406.
DR   EnsemblGenomes-Tr; EBT00001533408.
DR   EnsemblGenomes-Tr; EBT00001533410.
DR   EnsemblGenomes-Tr; EBT00001533411.
DR   EnsemblGenomes-Tr; EBT00001533414.
DR   EnsemblGenomes-Tr; EBT00001533417.
DR   EnsemblGenomes-Tr; EBT00001533419.
DR   EnsemblGenomes-Tr; EBT00001533420.
DR   EnsemblGenomes-Tr; EBT00001533422.
DR   EnsemblGenomes-Tr; EBT00001533425.
DR   EnsemblGenomes-Tr; EBT00001533430.
DR   EnsemblGenomes-Tr; EBT00001533432.
DR   EnsemblGenomes-Tr; EBT00001533433.
DR   EnsemblGenomes-Tr; EBT00001533435.
DR   EnsemblGenomes-Tr; EBT00001533437.
DR   EnsemblGenomes-Tr; EBT00001533439.
DR   EnsemblGenomes-Tr; EBT00001533441.
DR   EnsemblGenomes-Tr; EBT00001533443.
DR   EnsemblGenomes-Tr; EBT00001533445.
DR   EnsemblGenomes-Tr; EBT00001533448.
DR   EnsemblGenomes-Tr; EBT00001533449.
DR   EnsemblGenomes-Tr; EBT00001533451.
DR   EnsemblGenomes-Tr; EBT00001533453.
DR   EnsemblGenomes-Tr; EBT00001533455.
DR   EnsemblGenomes-Tr; EBT00001533457.
DR   EnsemblGenomes-Tr; EBT00001533458.
DR   EnsemblGenomes-Tr; EBT00001533461.
DR   EnsemblGenomes-Tr; EBT00001533465.
DR   EnsemblGenomes-Tr; EBT00001533467.
DR   EnsemblGenomes-Tr; EBT00001533470.
DR   EnsemblGenomes-Tr; EBT00001533474.
DR   EnsemblGenomes-Tr; EBT00001533478.
DR   EnsemblGenomes-Tr; EBT00001533481.
DR   EnsemblGenomes-Tr; EBT00001533486.
DR   EnsemblGenomes-Tr; EBT00001533490.
DR   EnsemblGenomes-Tr; Pput_R0001-1.
DR   EnsemblGenomes-Tr; Pput_R0002-1.
DR   EnsemblGenomes-Tr; Pput_R0003-1.
DR   EnsemblGenomes-Tr; Pput_R0004-1.
DR   EnsemblGenomes-Tr; Pput_R0005-1.
DR   EnsemblGenomes-Tr; Pput_R0006-1.
DR   EnsemblGenomes-Tr; Pput_R0007-1.
DR   EnsemblGenomes-Tr; Pput_R0008-1.
DR   EnsemblGenomes-Tr; Pput_R0009-1.
DR   EnsemblGenomes-Tr; Pput_R0010-1.
DR   EnsemblGenomes-Tr; Pput_R0011-1.
DR   EnsemblGenomes-Tr; Pput_R0012-1.
DR   EnsemblGenomes-Tr; Pput_R0013-1.
DR   EnsemblGenomes-Tr; Pput_R0014-1.
DR   EnsemblGenomes-Tr; Pput_R0015-1.
DR   EnsemblGenomes-Tr; Pput_R0016-1.
DR   EnsemblGenomes-Tr; Pput_R0017-1.
DR   EnsemblGenomes-Tr; Pput_R0018-1.
DR   EnsemblGenomes-Tr; Pput_R0019-1.
DR   EnsemblGenomes-Tr; Pput_R0020-1.
DR   EnsemblGenomes-Tr; Pput_R0021-1.
DR   EnsemblGenomes-Tr; Pput_R0022-1.
DR   EnsemblGenomes-Tr; Pput_R0023-1.
DR   EnsemblGenomes-Tr; Pput_R0024-1.
DR   EnsemblGenomes-Tr; Pput_R0025-1.
DR   EnsemblGenomes-Tr; Pput_R0026-1.
DR   EnsemblGenomes-Tr; Pput_R0027-1.
DR   EnsemblGenomes-Tr; Pput_R0028-1.
DR   EnsemblGenomes-Tr; Pput_R0029-1.
DR   EnsemblGenomes-Tr; Pput_R0030-1.
DR   EnsemblGenomes-Tr; Pput_R0031-1.
DR   EnsemblGenomes-Tr; Pput_R0032-1.
DR   EnsemblGenomes-Tr; Pput_R0033-1.
DR   EnsemblGenomes-Tr; Pput_R0034-1.
DR   EnsemblGenomes-Tr; Pput_R0035-1.
DR   EnsemblGenomes-Tr; Pput_R0036-1.
DR   EnsemblGenomes-Tr; Pput_R0037-1.
DR   EnsemblGenomes-Tr; Pput_R0038-1.
DR   EnsemblGenomes-Tr; Pput_R0039-1.
DR   EnsemblGenomes-Tr; Pput_R0040-1.
DR   EnsemblGenomes-Tr; Pput_R0041-1.
DR   EnsemblGenomes-Tr; Pput_R0042-1.
DR   EnsemblGenomes-Tr; Pput_R0043-1.
DR   EnsemblGenomes-Tr; Pput_R0044-1.
DR   EnsemblGenomes-Tr; Pput_R0045-1.
DR   EnsemblGenomes-Tr; Pput_R0046-1.
DR   EnsemblGenomes-Tr; Pput_R0047-1.
DR   EnsemblGenomes-Tr; Pput_R0048-1.
DR   EnsemblGenomes-Tr; Pput_R0049-1.
DR   EnsemblGenomes-Tr; Pput_R0050-1.
DR   EnsemblGenomes-Tr; Pput_R0051-1.
DR   EnsemblGenomes-Tr; Pput_R0052-1.
DR   EnsemblGenomes-Tr; Pput_R0053-1.
DR   EnsemblGenomes-Tr; Pput_R0054-1.
DR   EnsemblGenomes-Tr; Pput_R0055-1.
DR   EnsemblGenomes-Tr; Pput_R0056-1.
DR   EnsemblGenomes-Tr; Pput_R0057-1.
DR   EnsemblGenomes-Tr; Pput_R0058-1.
DR   EnsemblGenomes-Tr; Pput_R0059-1.
DR   EnsemblGenomes-Tr; Pput_R0060-1.
DR   EnsemblGenomes-Tr; Pput_R0061-1.
DR   EnsemblGenomes-Tr; Pput_R0062-1.
DR   EnsemblGenomes-Tr; Pput_R0063-1.
DR   EnsemblGenomes-Tr; Pput_R0064-1.
DR   EnsemblGenomes-Tr; Pput_R0065-1.
DR   EnsemblGenomes-Tr; Pput_R0066-1.
DR   EnsemblGenomes-Tr; Pput_R0067-1.
DR   EnsemblGenomes-Tr; Pput_R0068-1.
DR   EnsemblGenomes-Tr; Pput_R0069-1.
DR   EnsemblGenomes-Tr; Pput_R0070-1.
DR   EnsemblGenomes-Tr; Pput_R0071-1.
DR   EnsemblGenomes-Tr; Pput_R0072-1.
DR   EnsemblGenomes-Tr; Pput_R0073-1.
DR   EnsemblGenomes-Tr; Pput_R0074-1.
DR   EnsemblGenomes-Tr; Pput_R0075-1.
DR   EnsemblGenomes-Tr; Pput_R0076-1.
DR   EnsemblGenomes-Tr; Pput_R0077-1.
DR   EnsemblGenomes-Tr; Pput_R0078-1.
DR   EnsemblGenomes-Tr; Pput_R0079-1.
DR   EnsemblGenomes-Tr; Pput_R0080-1.
DR   EnsemblGenomes-Tr; Pput_R0081-1.
DR   EnsemblGenomes-Tr; Pput_R0082-1.
DR   EnsemblGenomes-Tr; Pput_R0083-1.
DR   EnsemblGenomes-Tr; Pput_R0084-1.
DR   EnsemblGenomes-Tr; Pput_R0085-1.
DR   EnsemblGenomes-Tr; Pput_R0086-1.
DR   EnsemblGenomes-Tr; Pput_R0087-1.
DR   EnsemblGenomes-Tr; Pput_R0088-1.
DR   EnsemblGenomes-Tr; Pput_R0089-1.
DR   EnsemblGenomes-Tr; Pput_R0090-1.
DR   EnsemblGenomes-Tr; Pput_R0091-1.
DR   EnsemblGenomes-Tr; Pput_R0092-1.
DR   EnsemblGenomes-Tr; Pput_R0093-1.
DR   EnsemblGenomes-Tr; Pput_R0094-1.
DR   EnsemblGenomes-Tr; Pput_R0095-1.
DR   EnsemblGenomes-Tr; Pput_R0096-1.
DR   EnsemblGenomes-Tr; Pput_R0097-1.
DR   EnsemblGenomes-Tr; Pput_R0098-1.
DR   EuropePMC; PMC2289816; 18307761.
DR   EuropePMC; PMC2647930; 19144133.
DR   EuropePMC; PMC2687292; 19329656.
DR   EuropePMC; PMC2829048; 20195500.
DR   EuropePMC; PMC2892462; 20504315.
DR   EuropePMC; PMC3656225; 23536173.
DR   EuropePMC; PMC3894933; 24465371.
DR   EuropePMC; PMC5099816; 27877169.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00166; PrrB_RsmZ.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00195; RsmY.
DR   RFAM; RF00444; PrrF.
DR   RFAM; RF00623; P1.
DR   RFAM; RF00624; P9.
DR   RFAM; RF00627; P15.
DR   RFAM; RF00628; P16.
DR   RFAM; RF00629; P24.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01669; P14.
DR   RFAM; RF01671; P18.
DR   RFAM; RF01673; P20.
DR   RFAM; RF01674; P27.
DR   RFAM; RF01675; CrcZ.
DR   RFAM; RF01676; P31.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01719; Pseudomon-1.
DR   RFAM; RF01720; Pseudomon-Rho.
DR   RFAM; RF01721; Pseudomon-groES.
DR   RFAM; RF01738; gabT.
DR   RFAM; RF01740; gyrA.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01755; rmf.
DR   RFAM; RF01756; rne-II.
DR   RFAM; RF01758; sucA-II.
DR   RFAM; RF01759; sucC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01772; rnk_pseudo.
DR   RFAM; RF01773; rpsL_psuedo.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; CP000712.
DR   SILVA-SSU; CP000712.
DR   StrainInfo; 268202; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000373
CC   Source DNA and bacteria available from Rebecca Parales
CC   (reparales@ucdavis.edu)
CC   Contacts: Rebecca Parales (reparales@ucdavis.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5959964
FT                   /organism="Pseudomonas putida F1"
FT                   /strain="F1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:351746"
FT   gene            385..1902
FT                   /locus_tag="Pput_0001"
FT   CDS_pept        385..1902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76178"
FT                   /db_xref="GOA:A5VWB8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWB8"
FT                   /protein_id="ABQ76178.1"
FT                   /translation="MSVELWQQCVELLRDELPAQQFNTWIRPLQVEAEGDELRVYAPNR
FT                   FVLDWVNEKYLGRLLELLGENGSGIAPALSLLIGSRRSSAPRAAPNAPVSAAVAASLAQ
FT                   TQAHKTAPAAAVEPVAVAAAEPVLVETSSRDSFDAMAEPAAAPPSGGRAEQRTVQVEGA
FT                   LKHTSYLNRTFTFDTFVEGKSNQLARAAAWQVADNPKHGYNPLFLYGGVGLGKTHLMHA
FT                   VGNHLLKKNPNAKVVYLHSERFVADMVKALQLNAINEFKRFYRSVDALLIDDIQFFARK
FT                   ERSQEEFFHTFNALLEGGQQVILTSDRYPKEIEGLEERLKSRFGWGLTVAVEPPELETR
FT                   VAILMKKADQAKVELPHDAAFFIAQRIRSNVRELEGALKRVIAHSHFMGRDITIELIRE
FT                   SLKDLLALQDKLVSVDNIQRTVAEYYKIKISDLLSKRRSRSVARPRQVAMALSKELTNH
FT                   SLPEIGDMFGGRDHTTVLHACRKINELKESDADIREDYKNLLRTLTT"
FT   gene            1943..3046
FT                   /locus_tag="Pput_0002"
FT   CDS_pept        1943..3046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76179"
FT                   /db_xref="GOA:A5VWB9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWB9"
FT                   /protein_id="ABQ76179.1"
FT                   /translation="MHFTIQREALLKPLQLVAGVVERRQTLPVLSNVLLVVQGQQLSLT
FT                   GTDLEVELVGRVQLEEPAEPGEITVPARKLMDICKSLPNDALIDIKVDEQKLLVKAGRS
FT                   RFTLSTLPANDFPTVEEGPGSLTCNLEQSKLRRLIERTSFAMAQQDVRYYLNGMLLEVS
FT                   RNTLRAVSTDGHRLALCSMSAPIEQEDRHQVIVPRKGILELARLLTDPEGMVSIVLGQH
FT                   HIRATTGEFTFTSKLVDGKFPDYERVLPKGGDKLVVGDRQALREAFSRTAILSNEKYRG
FT                   IRLQLAAGQLKIQANNPEQEEAEEEISVDYEGSSLEIGFNVSYLLDVLGVMTTEQVRLI
FT                   LSDSNSSALLQEAGNDDSSYVVMPMRL"
FT   gene            3062..4165
FT                   /locus_tag="Pput_0003"
FT   CDS_pept        3062..4165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76180"
FT                   /db_xref="GOA:A5VWC0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWC0"
FT                   /protein_id="ABQ76180.1"
FT                   /translation="MSLRRIMVTAVRNLHPVTLLPSPRINILYGSNGSGKTSVLEAVHL
FT                   LGLARSFRSTRLNPVIQYEQAACTVFGEVQLTEGGTSNLGVSRERQGEFTIRIDGQNAR
FT                   SAAQLAELLPLQLINPDSFRLLEGAPKIRRQFLDWGVFHVEPRFLPAWQRLQKALRQRN
FT                   SWLRHGTLDPASQAAWDRELCLASAEIDEYRRNYIKALKPVFERTLSELVELDGLTLSY
FT                   YRGWDKDRELQEVLASSLLRDQQMGHTQAGPQRADLRLRLAGNNAADILSRGQQKLVVC
FT                   ALRIAQGHLVSQARRGHCIYLVDDLPSELDDQHRRALCRLLEELRCQVFITCVDHELLR
FT                   EGWQTETPVALFHVEQGRITQTHDHRE"
FT   gene            4170..6590
FT                   /locus_tag="Pput_0004"
FT   CDS_pept        4170..6590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase,
FT                   subunit B domain protein; ATP-binding region, ATPase domain
FT                   protein domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase, type IIA, subunit B, region 2 domain
FT                   protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76181"
FT                   /db_xref="GOA:A5VWC1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWC1"
FT                   /protein_id="ABQ76181.1"
FT                   /translation="MSENQTYDSSSIKVLKGLDAVRKRPGMYIGDTDDGSGLHHMVFEV
FT                   VDNSIDEALAGHCDDITVIIHPDESISVRDNGRGIPVDVHKEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSEKLVLTVRRSGKIWEQTYVHGVPQAPMAVVGDSE
FT                   TTGTHIHFKPSAETFKNIHFSWDILAKRIRELSFLNSGVGILLKDERSGKEEFFKYEGG
FT                   LRAFVEYLNTNKTPVNSQVFHFNVQRDDGVGVEVALQWNDSFNENLLCFTNNIPQRDGG
FT                   THLVGFRSSLTRSLNSYIEQEGLAKKNKVATTGDDAREGLTAIISVKVPDPKFSSQTKD
FT                   KLVSSEVKTAVEQEMNKYFADFLLENPNEAKAVVGKMIDAARAREAARKAREMTRRKGA
FT                   LDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRRTQAILPLKGKILNVEKA
FT                   RFDKMISSQEVGTLITALGCGIGREEYNIDKLRYHNIIIMTDADVDGSHIRTLLLTFFF
FT                   RQLPELVERGYIYIAQPPLYKVKRGKQEQYIKDDEAMEEYMTQSALEDASLHLDESAPA
FT                   VSGVQLEALVNEFRSVMKTLKRLSRLYPEELTEHFVYLPEVTLEQLGDHAVMQAWLAQF
FT                   QARLNSSQKSGLAYNASLREDKERNVWLPEVEITSHGLASYITFNRDFFGSNDYRTVVN
FT                   IGAKLSSLLGEGAYVQRGERRKAIVEFKEGLDWLMNETTKRHTIQRYKGLGEMNPDQLW
FT                   ETTMDPTVRRMLKVTIEDAIAADQIFNTLMGDAVEPRRDFIESNALSVSNLDF"
FT   gene            7427..8065
FT                   /locus_tag="Pput_0005"
FT   CDS_pept        7427..8065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76182"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWC2"
FT                   /protein_id="ABQ76182.1"
FT                   /translation="MTVRKVVTRRSNHYRGYFPSLKNKKPVPWESQLEGALFRLLELSP
FT                   AVIGYVPQPSEERVPSLQGYFKYYPDVQVFLADGREWWFEVKPHDRLKIASVRQRLDAA
FT                   ERYFNATARNFSVITEKLIEAEPLATNLRRLMYHRRGPELSHQALEEVMATFNEWPPMT
FT                   VADLLYVVGEGKAWRLLGLGVVGIDLDRSIDTDSPVFLQGGHRHANLFP"
FT   gene            8046..10004
FT                   /locus_tag="Pput_0006"
FT   CDS_pept        8046..10004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0006"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76183"
FT                   /db_xref="GOA:A5VWC3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWC3"
FT                   /protein_id="ABQ76183.1"
FT                   /translation="MQTFSLRVKLVVIVRGVLMVLEKRLIDRKLLFFDELGEPTKLSEK
FT                   EFYEAYEKREIEISADQPYLGRVPYVRNVPPDISCFPKKHGDEALRRRKYLDDLTKRGK
FT                   YKLPGDEDMIKKLRDIAKKIGDACAPSVSTIRRWAAKYIGQNVVKLIPQHAKKGRAAAI
FT                   QGELEVILEGVINKTYLQDTIPAVSVVVSEFEDQIKERNKSRLPSDQLKIPSGMTVRRY
FT                   IAKLDPYLVDKERLGKHAADKKHRVAAGVLRVHEILERWEIDHTLLDVQLVDETSGLCI
FT                   GRPYLTIVLDRFSRMVMGYLLHLSAPNTETVLRVIERSIRPKAELLKRFPKVRNEWWAR
FT                   GLPARIVPDNAAEFHAGDLIMGFNELGIEIMYPASRAPQRKGAVERFFSTQNLGLIHNL
FT                   PGTTFSNIQQRGDYDSEKNACFTLPQLEAVVVKWIVDGYHQTPHRGLDNRTPAQVWGTS
FT                   EANHVISLPVDLDSLECILAKRASVKVHHYGIEVAKVGYHSTELAELRMRLADGEKVNV
FT                   RYRDEAGHVWVHDRFRNLFFKVPAKDERMAGKSREVWKAAEKALREKYNEQPSFEATHR
FT                   CYQEIMEDADEARRSQTLRKRRAAAIAKIDKEGRVTESTPPPKVLAEVEWTGDSIPNIP
FT                   PAAFKVSVRRPAGSSKP"
FT   gene            10001..10960
FT                   /locus_tag="Pput_0007"
FT   CDS_pept        10001..10960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0007"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76184"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWC4"
FT                   /protein_id="ABQ76184.1"
FT                   /translation="MNAINLYECYEHGEYSFTLRDRFIHSPQVERALTRLGDIHGDSRR
FT                   TRASKGLLIQGPSGVGKSTLVKEYIRSLEELESHDPQKRTVLFVEMPSSPTKKNLAAAI
FT                   LAELKDPFAEARGHSAEVKFARVVLLLKNLGVEMLVLDEAQHLVDYRRNGAYEAADWIK
FT                   SLMNETSIAFVLIGLKRTENLLLANEQLRRRFSATVAYDRFTFSANTSLHFVMLLQAIE
FT                   GELPVQTISFVEPAMIKRFYLASYGLIDYLIKIVDRAVWLVQVQDLVGIELPVLAQAFE
FT                   DEVWSYATEDRNPFSASFNFQPLFGKREPFETFEESST"
FT   gene            11036..12952
FT                   /locus_tag="Pput_0008"
FT   CDS_pept        11036..12952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76185"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWC5"
FT                   /protein_id="ABQ76185.1"
FT                   /translation="MFGLLINPRPHQDESLLGYLQRLAKANGLPRKELLTAFARADETD
FT                   VADWLQMMEGPLSWPAVSAEFRDPRPKGVKLWTTHHARYCPICLGEAGYWRESWGLTLV
FT                   TTCSVHGTELHGRCPNCLKETDPSAMSANSCQACGTSLSGTNFEIAPASDTAAWLTSGF
FT                   EDRFYADSLPADAGLAALTYEQFHELSSRLAVRSLPTERTQPLKVADSGSLEISRLMAN
FT                   AAGVVLMNWPLAFRELLSGLKAVHSDNEHWTLSRSFGPIYHDIHRDLDDSCFDFLRREF
FT                   ESFLQHAWEAPLAKRNRNLSEETIERHRWVSFDSAAEACGLGVSVIKRLHQEGQIAYRE
FT                   KVHEDRVFTVVDLDHLKAISQHLQGVADMKETSTLLSLCRNRVRQLLAGGTLQFFGGEP
FT                   RPGERWLIDCRSINELIDEKLPTSSDQSLVSINYLAKHSLPKGGGLVELVQAIRAGELR
FT                   AYGPAENGSVAVGAWLLKPQDFAAWQQARAENKSPVFPGLSVVKAAALLGVKEQCAYAF
FT                   VRLGLLWSTAVERGRRTQLMVKPQAIDRFRRGYILGPEIAVYLGKSTREAFKHLWEARF
FT                   RPVAGPSIPNAACRQYVWVRSKKLIDYLASEAAQIDDPEAITFLSTPIAQPRDCRFRHV
FT                   GSR"
FT   gene            13009..13368
FT                   /locus_tag="Pput_0009"
FT   CDS_pept        13009..13368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76186"
FT                   /db_xref="InterPro:IPR035616"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWC6"
FT                   /protein_id="ABQ76186.1"
FT                   /translation="MSRLAEFRLLEQQLAAQLAELEALKNDSALKQEMEFETKLRSLLN
FT                   EYGYGLRQVVLILDPQAVASTDMAPKTSRKPREVKVYKNPHSGEVVETKGGNQRTLKAW
FT                   KNEYGAEVVESWLAN"
FT   gene            13740..14072
FT                   /locus_tag="Pput_0010"
FT   CDS_pept        13740..14072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76187"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWC7"
FT                   /protein_id="ABQ76187.1"
FT                   /translation="MNTAKSIAALMLVIASSSALAEGGSDRLHGKMIQANEQAMRAYAA
FT                   ANGKKPPEVIHYRYGMKLDVARVISMTSLKGSCDVMPTQMNYEDSTGELKILEYRSAGI
FT                   NCRGQN"
FT   sig_peptide     13740..13805
FT                   /locus_tag="Pput_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(14170..14625)
FT                   /locus_tag="Pput_0011"
FT   CDS_pept        complement(14170..14625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0011"
FT                   /product="protein of unknown function DUF411"
FT                   /note="PFAM: protein of unknown function DUF411"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76188"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWC8"
FT                   /protein_id="ABQ76188.1"
FT                   /translation="MTSKRRFLGLSTAASLLIASAAFAAEPLTIDVHRDANCGCCKKWI
FT                   AHLEANGFKVVDHVETDMRAVKQELGVAPRLASCHTAVIDGKFVEGHVPAAQVQELIKR
FT                   NDLAGVAVPGMPAGSPGMEVDGMKHAYQVIGLTKSGDDQVVASYPDT"
FT   sig_peptide     complement(14551..14625)
FT                   /locus_tag="Pput_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(14615..15394)
FT                   /locus_tag="Pput_0012"
FT   CDS_pept        complement(14615..15394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76189"
FT                   /db_xref="GOA:A5VWC9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWC9"
FT                   /protein_id="ABQ76189.1"
FT                   /translation="MKKTITTLVAAGAVTSAAVLGAAYFGLVNVGADDPHFPAVHAFLA
FT                   MARDRSIEVRASDIEVPNLKDPALIQAGAGNYNAMCIGCHLAPGVEKTELSQALYPSPP
FT                   NLTEIGVSGDPAAAFWTIKHGIKATGMPAWGKSMDDQYIWGIVAFLDQLPQLNAEQYQM
FT                   MVASSGGHQHGGGESDMHNHEGQHGGAKSGHGNHDDSAANGVAEESHDHGSSHSESSSV
FT                   AEHHGEHESGEAHSDHHTGSTPKTHVHKDGKEHTHDK"
FT   sig_peptide     complement(15329..15394)
FT                   /locus_tag="Pput_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.647 at
FT                   residue 22"
FT   gene            complement(15404..16519)
FT                   /locus_tag="Pput_0013"
FT   CDS_pept        complement(15404..16519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0013"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76190"
FT                   /db_xref="GOA:A5VWD0"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWD0"
FT                   /protein_id="ABQ76190.1"
FT                   /translation="MANSVARPSLLAFAVSLGVLGVSPSFAAEMDHSGMDHSAMGHGAM
FT                   QMDHASSQAAMPGMDHSQMGASKQPTQPAPVDHSKMGHGQPKAKPASMDHSKMDHGSMK
FT                   GMDHGSMEGMDHGAMGHSTMGNGNADSPTPTSRTPIPVLTDADRQAAFPPLDGHKMDDS
FT                   GFNSFFLLDQLEYQDADEGSTLAWDASGWVGGDINRLWIRSEGERTNGVTEDAELQLLY
FT                   GRSVSPWWDVVAGVRQDFKPEDPQTWAAFGIQGLALYDFEAEATAFIGENGQTAARLEG
FT                   EYDILLTNRLILQPTAEANFYGKNDPERGVGSGLANTEVGLRLRYEIVRQFAPYIGVTW
FT                   SRSYGKTADFIRDEGGDVDEARFVAGIRMWF"
FT   sig_peptide     complement(16436..16519)
FT                   /locus_tag="Pput_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(16509..16850)
FT                   /locus_tag="Pput_0014"
FT   CDS_pept        complement(16509..16850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76191"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWD1"
FT                   /protein_id="ABQ76191.1"
FT                   /translation="MNWRYEMSKPMKRSAFFLSAAMVGLLAVYAPSSWSSDNHDQHSQK
FT                   SSNAAQSNGSKSKQAQGMNHEGMDHGSMKGMDHGSMEGMDHGSMEGMDHSKMMESHGSD
FT                   KAKAGKNGQ"
FT   sig_peptide     complement(16743..16850)
FT                   /locus_tag="Pput_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 36"
FT   gene            complement(16847..18862)
FT                   /locus_tag="Pput_0015"
FT   CDS_pept        complement(16847..18862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0015"
FT                   /product="copper-resistance protein, CopA family"
FT                   /note="TIGRFAM: copper-resistance protein, CopA family;
FT                   PFAM: multicopper oxidase, type 1; multicopper oxidase,
FT                   type 2; multicopper oxidase, type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76192"
FT                   /db_xref="GOA:A5VWD2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWD2"
FT                   /protein_id="ABQ76192.1"
FT                   /translation="MAADPAVWISAIYLIGRNGMQSKTTRRSFVKGLAATGLLGGLGMW
FT                   RAPVWAVTSPGQPNVLTGTDFDLYIGELPVNITGAARTAMAINGSLPGPILRWREGDTV
FT                   TLRVRNRLKQDTSIHWHGIILPANMDGVPGLSFHGIAPDGMYEYKFKVHQNGTYWYHSH
FT                   SGFQEQVGVYGALVIDAKDPEPFTYDRDYVVMLSDWTDEDPARVMSKLKKQSDYYNFHK
FT                   RTVGDFVDDVSEKGWSAAVADRKMWAEMKMSPTDLADVSGHTYTYLMNGQAPNGNWTGI
FT                   FKPGEKIRLRFINGSAMTYFDVRIPGLKMTVVAADGQYVKPVSIDEFRIAVAETYDVIV
FT                   EPENEQAYTIFAQSMDRTGYSRGTLAVREGLQAPVPAVDPRPLISMSDMGMDHGSMGGM
FT                   DHGSMAGMDHSKMAGMDHGSMAGMDHSKMAGMDHGSMAGMDHSKMAGMDHGSMAGMDHS
FT                   KMAGMDHGSMAGMDHSKMAGMDHGNMTGMDQSNMAASGAMQNHPASETNNPLVDMQTMT
FT                   PTPKLSDPGIGLRDNGRRVLTYSDLRSTFIDPDGREPGRTIELHLTGHMEKFAWSFDGI
FT                   KFSDAEPLRLKYGERLRITLVNDTMMTHPIHLHGMWSDLEDEDGNFMVRKHTIDMPPGS
FT                   KRSYRVTADALGRWAYHCHLMYHMEMGMFREVRVDE"
FT   gene            complement(18988..19194)
FT                   /locus_tag="Pput_0016"
FT   CDS_pept        complement(18988..19194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76193"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWD3"
FT                   /protein_id="ABQ76193.1"
FT                   /translation="MNMIKAIVMVVTFGMASLALAEGGADRTFARMEAARASSMQAYQV
FT                   AQEKKAEAPVTAQSQKHPGHESC"
FT   sig_peptide     complement(19129..19194)
FT                   /locus_tag="Pput_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            19361..20038
FT                   /locus_tag="Pput_0017"
FT   CDS_pept        19361..20038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0017"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76194"
FT                   /db_xref="GOA:A5VWD4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWD4"
FT                   /protein_id="ABQ76194.1"
FT                   /translation="MKLLVAEDEPKIGAYLQQGLTEAGFTVDRVVTGTDALQYALSEAY
FT                   DLLILDVMMPGLDGWEVLRMVRAAGKEVPVLFLTARDGVDDRVKGLELGADDYLVKPFA
FT                   FSELLARVRTLLRRGSSGYAQTTMKMADLEVDLLKRRATRNGKRIDLTAKEFSLLELLM
FT                   RRRGEVLPKSLIASQVWDMNFDSDTNVIEVAVRRLRAKIDDDFAPKLIHTVRGMGYLMD
FT                   VPE"
FT   gene            20038..21444
FT                   /locus_tag="Pput_0018"
FT   CDS_pept        20038..21444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0018"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76195"
FT                   /db_xref="GOA:A5VWD5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWD5"
FT                   /protein_id="ABQ76195.1"
FT                   /translation="MRAQSSLVKRLTLMFMFAVIAVLVVAGVSFYMLSQHHFQMLDEQA
FT                   LAEKLESTRHILSLSAARDELEDQEPQLRALLGAHQDLSAEILDADGTVLFSDSKASRI
FT                   PERFKQASSGAVWDWQIDSRNFRGITSQLAIAQAQAPVTVMLMLDVTSHAHFFKTLQWW
FT                   FGIGLVISALVSAGLGWIVAKSGLRPVGQITKVATSMSARSLRERIPLEPVPLELQELI
FT                   LSFNGMLARLEDAFVRLSNFSADIAHELRTPVSNLLTHTEVVLTKKRDLDAYEDNLYSN
FT                   LEDLKRMSRMIDDMLFLAKADNGLIIPEQVDIDLVGLVSRLIEYYQLAAEDRSIRLALQ
FT                   GEGTIRGDRLMIDRAVSNILSNALRYTPEGHDIAVRIVEAADQVNLSVQNNGATIDPEH
FT                   INKIFDRFYRADPARREGSPSNAGLGLAITRSIIEAHGGRIWCTSADGVTSFHIALPHA
FT                   KQSTSKPQTA"
FT   sig_peptide     20038..20118
FT                   /locus_tag="Pput_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.913 at
FT                   residue 27"
FT   gene            21481..21828
FT                   /locus_tag="Pput_0019"
FT   CDS_pept        21481..21828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76196"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWD6"
FT                   /protein_id="ABQ76196.1"
FT                   /translation="MNRLLRLFTILLLIASLPLNGMAGVDSAIEPCPMQTMGMEMMAGM
FT                   DHDCCQDTDPGSAADHSKACKVGQECRTASTVQVEIINPTLTYSAPRPVDTYAVSLVNR
FT                   APPDPWRPPRA"
FT   sig_peptide     21481..21552
FT                   /locus_tag="Pput_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.818 at
FT                   residue 24"
FT   gene            21915..23168
FT                   /locus_tag="Pput_0020"
FT   CDS_pept        21915..23168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0020"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76197"
FT                   /db_xref="GOA:A5VWD7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWD7"
FT                   /protein_id="ABQ76197.1"
FT                   /translation="MTPPRYRLGMACLAALISLLSTLPAQATPLSLEEALQLAERNAPI
FT                   LQARQEQMTAARHAVIPAGELPDPRLNLGVQNLPVDGSDRWSMNRDFMTMQVVGLSQEV
FT                   PNRDKREARVETARASVERADAEAVFERLKVRAATAQAWVAAYTVQRKLQQFEDFYKEN
FT                   RLLAAAIRARLAGGTGATADALAPDQEAAQLDEQKDVLLTQAAQARAALKRWIGEDADP
FT                   QAQAFPRWPVSAPDYLHAIHAHPELATYNALTREAQAQVHQALAEKKSDWGWQVDYQRR
FT                   GPEFSNMVSLQVSFQLPLFAGSRQDPMIAARRAQVRQLEDEQEAALREHKAQLETDLAD
FT                   YQRLQRAVQRSRETLLPLAEDRVRLALADYRAGKSPLSEVLTARRQRVETRLQDIDLQG
FT                   QLAATAARLHFAYGEVRA"
FT   sig_peptide     21915..21998
FT                   /locus_tag="Pput_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 28"
FT   gene            23165..24631
FT                   /locus_tag="Pput_0021"
FT   CDS_pept        23165..24631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0021"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76198"
FT                   /db_xref="GOA:A5VWD8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWD8"
FT                   /protein_id="ABQ76198.1"
FT                   /translation="MRNSTISLVVLAALAIGGGVGYQLAKRGQVSTASPETLQKVLYWY
FT                   DPMYPQQHFPAPGKSPFMDMPLVPKYQESTAAEVSPAVQVSQGLQQNLGVRLATVAKGQ
FT                   LARTLQVSGVLTFDERDFSVLQARTGGYVERTYGRATGDVVAKGAPLADVLTPEWAGLQ
FT                   EEYLALQRSGDNELRAAARQRLLLAGMPADLINRIDRTGRVQNSVTLLAPTAGVLQALE
FT                   LRPGMTMTPGATLAKINGIANVWLEAAVPEAQAQGLQEGQAVQANLAAFPGEPVPGKLT
FT                   ALLADADLQSRTLRLRIELPNPGGRLRPGMTAQVSLHPSGQQDDSLLVPAEAIIRTGKR
FT                   DLVMVSEDGGRFRPVEVVLGQESAGQVVVLRGLQAGQRVVASGQFLLDSEASLKGIEAV
FT                   TAGDAPLAQPVQPALHQANGRIVQIEGNQLTIAHGPFVTLGMPGMTMTFPVADPRLIAG
FT                   LKVGERIRFGVRERDEGMVIEQITQQENQP"
FT   sig_peptide     23165..23242
FT                   /locus_tag="Pput_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.989) with cleavage site probability 0.841 at
FT                   residue 26"
FT   gene            24628..27786
FT                   /locus_tag="Pput_0022"
FT   CDS_pept        24628..27786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0022"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76199"
FT                   /db_xref="GOA:A5VWD9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWD9"
FT                   /protein_id="ABQ76199.1"
FT                   /translation="MIANLIRWSVGNRVLVLLATLFAVAWGVFSLRSLPIDALPDLSDV
FT                   QVIIRTSYPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGFSAFGDSFVYVLFEDGTDLY
FT                   WARSRVLEYLSQVQSRLPASAKPVLGPDATGVGWIYQYALVDRSGTHDLAQLRSLQDWF
FT                   LRFELKTLPDVAEVATIGGMVKQYQVVLDPLRMASLGITQVEVSDAIAKANQETGGGVL
FT                   EQGEAEFMVRASGYLKSLDDFRAIPLRLAAKGIPVTLGDVATVQLGPEARRGIGELDGQ
FT                   GEAVGGVVILRSGKNAKDAIAHVKSKLESLEKSLPAGVELVTTYDRSQLIDRAVENLSQ
FT                   KLIEEFIVVALVCAAFLWHLRSSLVAIVSLPVGVLIALIVMRHQGINANIMSLGGIAIA
FT                   IGAMVDAAVVMIENAHKRVEAWHTWHPGKSLRGEDHWKVMTEAAVEVGPALFFSLMIIT
FT                   LSFIPVFTLQAQEGRLFAPLAFTKTYAMAAAAGLSVTLVPVLMGYWIRGRLPAEERNPL
FT                   NRTLIRLYRPALEIVLRRPKLTLAGALLILLSSVWPLSQLGGEFLPPLDEGDLLYMPTA
FT                   LPGLSAQKASELLQRTDRLIRTVPEVASVFGKAGRAESATDPAPLEMFETTVRLKPKDQ
FT                   WRAGMTTEKLIEELDRTVQVPGLTNIWIPPIRNRIDMLATGIKSPIGVKVAGSNLNEID
FT                   RVTLAIEKVAKTVPGVTSALAERLTGGRYIDLDIDRQFAARYGLNIADVQAIVAGAVGG
FT                   ENIGETVEGLARYPISVRYPREWRDSVDALRQLPIYTSQGGRITLGTVARVRIADGPPM
FT                   LKSENARPSGWVYIDVRRRDLSSVVADLRRLVDQQVKLDPGISLSYSGQFEYLERANAR
FT                   LAWVVPATLAIIFVLLYLTFGRLGEALLIMATLPFALTGGVWLLYMMGYNLSVATGVGF
FT                   IALAGVAAEFGVIMLIYLNNAWTERNGNGTQGQPALLDAIREGAVQRIRPKAMTVAVIV
FT                   AGLMPILWSSGTGSEVMSRIAVPMVGGMLTAPLLSLFVIPAAYWLVRRRGLAVHDNPQT
FT                   GVTR"
FT   sig_peptide     24628..24705
FT                   /locus_tag="Pput_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.699) with cleavage site probability 0.282 at
FT                   residue 26"
FT   gene            27783..28130
FT                   /locus_tag="Pput_0023"
FT   CDS_pept        27783..28130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76200"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWE0"
FT                   /protein_id="ABQ76200.1"
FT                   /translation="MKKLLISAGLVFAVAAAVQAQDMYGTDMKNMPMEGNETQGSQAAP
FT                   TASAEGTIKALEPGKVTLAHGPVSALKWPAMTMGFSATEQQLKGLKVGDKVSFDFRMNG
FT                   GTATIVGIRKQ"
FT   sig_peptide     27783..27845
FT                   /locus_tag="Pput_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            28362..28511
FT                   /pseudo
FT                   /locus_tag="Pput_0024"
FT   gene            complement(28545..29204)
FT                   /locus_tag="Pput_0025"
FT   CDS_pept        complement(28545..29204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0025"
FT                   /product="Putative protein-S-isoprenylcysteine
FT                   methyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76201"
FT                   /db_xref="GOA:A5VWE1"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWE1"
FT                   /protein_id="ABQ76201.1"
FT                   /translation="MNHGESAYGLWSLVFINSAIFIMFAFSFFKPATARDWRSFGAFSA
FT                   FIVALFVEMYGFPLTIYLLSGWLQARFPNLDLLSHESGHLWSTLLGDQGNPHFSVLHIA
FT                   SYLFLGFGFYLLSAAWNVLYHAQRRRSLATVGPYGWIRHPQYVAFVLILLGFLLQWPTL
FT                   LTLAMFPVLLVMYGRLAVSEEREMHKQFGAAYEAYTRVTPRFVPHLRERLGGGHRG"
FT   gene            complement(29201..29476)
FT                   /locus_tag="Pput_0026"
FT   CDS_pept        complement(29201..29476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76202"
FT                   /db_xref="GOA:A5VWE2"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWE2"
FT                   /protein_id="ABQ76202.1"
FT                   /translation="MNPHFDENGSPHSFWRSRYAIGLVVIGGIAVYFLLTEHLAHVVGA
FT                   LPYLLLLACPLMHVFMHRGHGGHHHQGQSKPAPSDKADIHKPGDPS"
FT   gene            complement(29502..29957)
FT                   /locus_tag="Pput_0027"
FT   CDS_pept        complement(29502..29957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76203"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWE3"
FT                   /protein_id="ABQ76203.1"
FT                   /translation="MNNVRNLLIGLCLAAASVGAMAQNTDEHSTHHPADAPSAAATEKT
FT                   PSQPMDKGQMAAMDQQMKAMQAMHEKMAAAKTPEARQALMAEHMALMKNGMAMMKSMEG
FT                   GMPEMGGMHGGMGGDMAARHQMMEKRMDMMESMMQMMMDRMPSAASK"
FT   sig_peptide     complement(29889..29957)
FT                   /locus_tag="Pput_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(30096..31118)
FT                   /locus_tag="Pput_0028"
FT   CDS_pept        complement(30096..31118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0028"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76204"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWE4"
FT                   /protein_id="ABQ76204.1"
FT                   /translation="MMTAKRFSSMALGISLLIPLGLVMANPTGNVYTANERSASISQVN
FT                   LATGDVSTVALPIAPHNLQVSPDGSLLLVVGVAGHAGHSSGEKPGGQLLVFSTSALDRP
FT                   PFSFPAGDHPAHVVTDVTGLRAFVTDSAANQVRVFDLEQRIELPGIPTGRYPHGLRLSP
FT                   DGRTLYIANMKSDSVSLIDVVTLKETAQIPVGKGPVQVGFAPDGRLAFVSLSATNQLGI
FT                   IDTARRKVISKVDVGRTPIQMMATVDGRQVYVANQGSGQNPDDRVSIVDLQTRSSLGTV
FT                   TTGKGAHGVAISSDGAYVFVSNIEAGTVSVIDTSSRKVVATHKVGAGPNGISFEPPSAQ
FT                   "
FT   sig_peptide     complement(31041..31118)
FT                   /locus_tag="Pput_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            complement(31384..31584)
FT                   /locus_tag="Pput_0029"
FT   CDS_pept        complement(31384..31584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0029"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76205"
FT                   /db_xref="GOA:A5VWE5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWE5"
FT                   /protein_id="ABQ76205.1"
FT                   /translation="MFVLEVSGMGCGSCVNKITKAIQAADGDAKVIVDRAAGTVSVQSN
FT                   IEAERVGALVQALGYPTKVSR"
FT   gene            complement(31922..34297)
FT                   /locus_tag="Pput_0030"
FT   CDS_pept        complement(31922..34297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0030"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; YHS domain
FT                   protein; E1-E2 ATPase-associated domain protein; SMART:
FT                   TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76206"
FT                   /db_xref="GOA:A5VWE6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWE6"
FT                   /protein_id="ABQ76206.1"
FT                   /translation="MHTESCQHDHDHDHSHPYEQPDGSQRDLVCGMTVPPDSRYFELYE
FT                   GRTYRFCSEKCLTKFRAAPVHYLSPPQDQEHAGHLHSAAPQPSNAADAEYTCPMHPQIR
FT                   QRGPGSCPICGMALEPVIPELEEDENPELKDFSRRFWWTLPLTVIVTVLAMTAHQLQLL
FT                   HGATQNWVELILATPVTLWAGWPFFVRGVASIRNRSPNMWTLIGLGTAAAYLYSVAATV
FT                   FPQVFPTTFMQDGRIGVYFEAAAVIISLTLLGQMLELKARSQTSAAIKSLLGLAPKTAR
FT                   RIGADGQEEDIPLTHVHTGDHLRVRPGEKVPVDGVVLEGESAIDESMLTGEPVPVMKKA
FT                   GDALIGATLNTHGSLVMAAQKVGAETVLSQIVQMVARAQRSKAPMQRMADTVAGYFVMG
FT                   VILVALVTLFGWGLFGPEPGWVFGLINAVAVLIIACPCALGLATPMSIMVATGKAASSG
FT                   VLFRDASAIENLCKIDTLIVDKTGTLTEGRPVFHSVVGTGQFMPPEVLRLAASLDQGSE
FT                   HPLAHAIVDHARAHGHSLSKPEAFESGSGIGVRGQVNGKRLQLGNTTLMEEAGLDTSPL
FT                   RDRAEQLRLEGMSIMYLAVDGVLAGLLAVSDPVKPTSKEAVTRLQAEDVKVIMATGDGL
FT                   TTARAVAKQLGIEEVHGEVKPEDKEQLVALLQGDKRRVAMAGDGINDAPALARADVGIA
FT                   MGTGTDVAMNSSQLTLVKGDLMGILRARTLSVATVKNMRQNLGFAFFYNAMGIPLAAGL
FT                   FYPLTGHLLSPMIAALAMSVSSASVVFNALRLKRVVTD"
FT   gene            complement(34482..34640)
FT                   /locus_tag="Pput_0031"
FT   CDS_pept        complement(34482..34640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76207"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWE7"
FT                   /protein_id="ABQ76207.1"
FT                   /translation="MASQLFKEMLSRLDNTAAADISHPAWELIMMEPIAVVQIWQYLFG
FT                   GLKAVLH"
FT   gene            34709..35038
FT                   /pseudo
FT                   /locus_tag="Pput_0032"
FT   gene            35432..36466
FT                   /locus_tag="Pput_0033"
FT   CDS_pept        35432..36466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76208"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWE8"
FT                   /protein_id="ABQ76208.1"
FT                   /translation="MPGNCMQAIDIENAIVLPWGLGSRSPHDLFSVCAEIINCPGDIVL
FT                   DASNLSYIDPLGMATLRALFENQLVQKRVSMQFLSRDLTSYLARMDFFKDIDVEGVDLS
FT                   GVGRRNDRSTSLVEITKISEHHQAEAAASRLARAITGRLTQSDPDAPVDEHTGRNEFDS
FT                   YRGPLEYSLKELLENSLTHARREGRGDAAVWLTCQFYPKLNLVRMAIVDNGCGFLATLR
FT                   NHPELHDRTHLHAIEAALKPRVSCNRGAMAQILGSENQGIGLTTTAKIADAAGGGLIIV
FT                   SGNGIHDTKRRQSQELHDALWNGVSIAFSCTRELLPTISISDLLPKDDAGQVDDDLDLD
FT                   LNFR"
FT   gene            complement(36650..37015)
FT                   /locus_tag="Pput_0034"
FT   CDS_pept        complement(36650..37015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76209"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWE9"
FT                   /protein_id="ABQ76209.1"
FT                   /translation="MSPDIRFSGRAMGATQDGYLLPGTNEKALNIEGLKFNADPSRGHF
FT                   LQLSNSIMDHKFNDSFDIVGAVFKGKARYHLATLLQNQRPDQLVDEGLSDIVPSEIYDN
FT                   ALTTAERAFDFGTVGDR"
FT   gene            37298..37546
FT                   /locus_tag="Pput_0035"
FT   CDS_pept        37298..37546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76210"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWF0"
FT                   /protein_id="ABQ76210.1"
FT                   /translation="MVFRFLTKREHARRANELHDQLNEVLGVARNLNDGLYFGGADVTV
FT                   LQDFTMLDAEDFVRYNLHDWLSVGDTDEDEEGADDAD"
FT   gene            37857..38780
FT                   /locus_tag="Pput_0036"
FT   CDS_pept        37857..38780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76211"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWF1"
FT                   /protein_id="ABQ76211.1"
FT                   /translation="MDVYKLRIEDTESKIIDKEGFEAETFRRDPWYQPGSAGKLAQFAV
FT                   CPACDNPVQLVGLYELPPNVKNPFGKHATKSIRGIAPFDSEARNDCPYFKPRQHKKTER
FT                   KTRFDGVPRKILKLLIEQFDRVVYILEKETQLVLSENALRGMLQRYKGERGYLYTGATL
FT                   RNVPWIFAYMSDATRLFGQKVSGNAELVKAIAAEVPGAEISSTGRLESKKVPGSKAAYF
FT                   DLKMSFIRHRIVKDSEASGLVESMEFVVSQPRGGELEHIHKEVIKFDSAWFESLIRMPV
FT                   DHPYRRMDRVKMAREELGDLLELTQA"
FT   gene            38986..39210
FT                   /locus_tag="Pput_0037"
FT   CDS_pept        38986..39210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76212"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWF2"
FT                   /protein_id="ABQ76212.1"
FT                   /translation="MEQNVVKRTFIGMVEAGEPLMRQALEAIRQAHEAEAAGLPDLEVQ
FT                   RLHLLADSLYQAVIDFQLLKAGKPPSTIQ"
FT   gene            39225..39431
FT                   /locus_tag="Pput_0038"
FT   CDS_pept        39225..39431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76213"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWF3"
FT                   /protein_id="ABQ76213.1"
FT                   /translation="MTKKIPALLPDHPMYTDAVDAMKQYHEAQASGSSAEEVERLRQIA
FT                   ESQFRAVSEYQLNALGYQSRRPH"
FT   gene            complement(39826..41523)
FT                   /locus_tag="Pput_0039"
FT   CDS_pept        complement(39826..41523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0039"
FT                   /product="phosphatidylethanolamine:Kdo2-lipid A
FT                   phosphoethanolamine transferase"
FT                   /note="PFAM: sulfatase; protein of unknown function
FT                   DUF1705"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76214"
FT                   /db_xref="GOA:A5VWF4"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWF4"
FT                   /protein_id="ABQ76214.1"
FT                   /translation="MTPSKSIVHTLLSKWIFAIRNARQKGISTNLLIGLVTFWLLLFAN
FT                   AELWNVLWKLVFKTDEVNWQLAASLPVIVFAWVFTVLSLLSWGRLAKPILCLVLISASF
FT                   ASYFMNAYGIVIDYTMFTNVVETDVAEATELLNWKLGLWVAMVGVLPVYLIARVPLRRK
FT                   PWAKALVSRFIALSLALLTLSGIALSQYQSYASLLRNNREIRLILVPTNLFAAGHGYLK
FT                   RQLASPKTLTAIGTDAVVNRQGAARKPRLLVLAVGETARSANFSLNGYSRETNPELEKR
FT                   NVISFTNVSSCGTATAVSLPCMFLDVGKAQYKDGLAKSREGLLDVLQRAGISVMWTDNN
FT                   SGCKGVCDRVPNHKAASHADSQLCTSEECKDGVLLTEMQDFIKRQEGDAVLVLHYKGSH
FT                   GPAYYKRYPSQFKKFAPVCETNELDKCKQEEVVNAYDNSILYTDYVTANLIDILAANTK
FT                   FDTALMYVSDHGESLGEGGLYLHGLPYAMAPDEQTKVPLVLWMSDSLAKSEKVNVGCLK
FT                   AQTTSPLSHDNLFHTVLGMMNVQTSSYRSALDFTAPCKPFVGGSYSGL"
FT   sig_peptide     complement(41383..41523)
FT                   /locus_tag="Pput_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.923) with cleavage site probability 0.823 at
FT                   residue 47"
FT   gene            42407..43312
FT                   /locus_tag="Pput_0040"
FT   CDS_pept        42407..43312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0040"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76215"
FT                   /db_xref="GOA:A5VWF5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWF5"
FT                   /protein_id="ABQ76215.1"
FT                   /translation="MGSNHDHGSAAVREGHQKKLIMALGLTGSFMIAEVIGAWITGSLA
FT                   LLSDASHMFTDTAALAISLIALQIAKRPADQKRTFGYARLEILASTFNAVLLFLVAMYI
FT                   LYEAYQRFFMPAEIATGAMMWIAIAGLIINLISMRLLASASNESLNVKGAYLEVWSDML
FT                   GSLGVIIAALIIRFTGWTWVDTIVAVAIGLWVLPRTWQLLRESLGILMEGVPRGLDVTA
FT                   IEATILGVDGVTDVHDLHVWAVSSGSNVMTSHVVVRDSADGDAVLAAVVDAVSDAFEIH
FT                   HCTIQIERAAFHESVPSPSH"
FT   gene            43470..43820
FT                   /locus_tag="Pput_0041"
FT   CDS_pept        43470..43820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76216"
FT                   /db_xref="GOA:A5VWF6"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWF6"
FT                   /protein_id="ABQ76216.1"
FT                   /translation="MAWIITKYLLTAGIVILVSELAKRSDKLGGLVAALPLVTVVTLVW
FT                   LYLENQSMEKISNHAWYTFWYVLPTLPMFIAFPLLLPKLGFWPTLISSILITMASFGGF
FT                   AILLRRFGIELL"
FT   gene            complement(43853..44179)
FT                   /locus_tag="Pput_0042"
FT   CDS_pept        complement(43853..44179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76217"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWF7"
FT                   /protein_id="ABQ76217.1"
FT                   /translation="MNTTVSAIAVFLLFTSLTANAQSGMEINKRIERTAREATADYAQR
FT                   VKKPMPQLEDYAYGMDLDVGKLVYVSPSVRYCGNVRSMMTYEDSKGELHMVRYLVKGEC
FT                   VNSR"
FT   sig_peptide     complement(44114..44179)
FT                   /locus_tag="Pput_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            44869..45543
FT                   /locus_tag="Pput_0043"
FT   CDS_pept        44869..45543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0043"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76218"
FT                   /db_xref="GOA:A5VWF8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWF8"
FT                   /protein_id="ABQ76218.1"
FT                   /translation="MRVLVVEDEIKTAEYLQQGLSESGYVVDIVHNGVDALHLFNTNVY
FT                   SLVLLDVNLPGIDGWDLLETIRKTSRVRIIMLTARGRINDKLKGLDGGADDYLVKPFEF
FT                   PELLARIRSLQRRGDELVEKSSLKIADLELDSVRHRVFRGGTRIDLTTKEFALLHLLMS
FT                   RTGEALTRSQIISLVWDMNFDCDTNVIDVAIRRLRSKIDDPFETKLIHTLRGVGYVFEE
FT                   RA"
FT   gene            45540..46958
FT                   /locus_tag="Pput_0044"
FT   CDS_pept        45540..46958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0044"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: heavy metal sensor kinase; PFAM:
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76219"
FT                   /db_xref="GOA:A5VWF9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWF9"
FT                   /protein_id="ABQ76219.1"
FT                   /translation="MRPFSLAAKLGLKVGLMSAALLLLFATFGYLMVGKALERNARADL
FT                   EVKMAGMAHNLSTIPDISGVNADAHQLVDLVMGHNNLYVSIFDTSQNQTPLLSIGSKQV
FT                   NLEVHKFQPAAQPKEHEWRDTQDRPLLSASRIMRLGDGTEVSVYMTMDQSSSEALLDAL
FT                   LTWALMMSPVILALILAIGWWTVRRGLLPLTKFLKIASKISTESLDHRLPTDGMPAELK
FT                   MLADGINIMLARLDDGVQQLSQFSDDLAHELRAPLSNLMGKAQVALTRERSLSEYREVL
FT                   ESCTEELDRMSRMVSDMLFLAQVSHPASMVEFESVSLVDEVQRVCELFSISAEEGEIQL
FT                   QISGSDDVVRGNRLMVQRAVSNLVSNAIRYCPRGRTVYVKVQHSASGTTLSVGNPGRGI
FT                   AKEHHAHLFERFYRVDKSRARSEGGTGLGLAIVQSIMSLHQGSASVEVTEENFTWFHLH
FT                   FPEAQQMQPAMTAA"
FT   sig_peptide     45540..45641
FT                   /locus_tag="Pput_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.406 at
FT                   residue 34"
FT   gene            complement(47016..47603)
FT                   /locus_tag="Pput_0045"
FT   CDS_pept        complement(47016..47603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76220"
FT                   /db_xref="GOA:A5VWG0"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWG0"
FT                   /protein_id="ABQ76220.1"
FT                   /translation="MNDIEPWAVAIGDFRRCTEKLTVQLDELTSQTRTSSAVLERSNEL
FT                   VEQVDAVGRQIQEEVRKAEKAWSNAEEVALRAAASAYSAACRGVDTAIQPLISELTAAT
FT                   KAADASIQELKRAPVLAKRYVMVVATAFFILALICVYSTMRLIDAAGSVSAQEKVNAQY
FT                   FSHLWKNANPDEQKIIKSVILRSPMDPVVLRH"
FT   gene            47870..48091
FT                   /locus_tag="Pput_0046"
FT   CDS_pept        47870..48091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76221"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWG1"
FT                   /protein_id="ABQ76221.1"
FT                   /translation="MKFVKSIAIGSLLLGLMGTAYAEGGFERTKQFNENFRTEQARLWS
FT                   DDSSDQNKQQVAQEQKKESKDGKEQADN"
FT   sig_peptide     47870..47938
FT                   /locus_tag="Pput_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(48174..49628)
FT                   /locus_tag="Pput_0047"
FT   CDS_pept        complement(48174..49628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0047"
FT                   /product="glycosyl transferase, family 39"
FT                   /note="PFAM: glycosyl transferase, family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76222"
FT                   /db_xref="GOA:A5VWG2"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWG2"
FT                   /protein_id="ABQ76222.1"
FT                   /translation="MLNLKNERTLWWVLGSILLLRLVGLGIYPLMDTSEARYAEMARKM
FT                   VELNDWITPMFDYGVPFWGKPPLSFWTQAASMTVFGVNEFAARFPAWLLHLASCFIIIK
FT                   LGTQQISRNAGIWAAIIFSSTTLGLVSSGVVLTDPVLSFSILLASYGFWRWMKCASKAD
FT                   AYLMFAGLGLGLLAKGPLTLVLMGAPAFAWFVIYKEWGRVLRLPWISGLVLMFGISVPW
FT                   YVAAEMKTPGFMEYFFVGEHWSRYVVSNWAGDLYGSAHAKPYGSIWIQLGLSLLPWALF
FT                   LPLLIRKRGSMQRFKAYLWLWALATPVFFTFAGNILWTYLLPALPAWALLLSARVSEVG
FT                   PKTTWAAAASALVLPIIGAGIIYAGVLEERPQNQRDVVQAWLNVQSAHSAPLIYPGRRS
FT                   YSSEFYSSGKSENIKDPAKWPRDGSFYLSRRLRDSKDGLPADLACTSITEANASQLLLC
FT                   HWKRPAQGAEGLAGESNAETPRKNEG"
FT   gene            complement(49622..50605)
FT                   /locus_tag="Pput_0048"
FT   CDS_pept        complement(49622..50605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0048"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76223"
FT                   /db_xref="GOA:A5VWG3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWG3"
FT                   /protein_id="ABQ76223.1"
FT                   /translation="MQTLHRFPERPDPLLTIVVPCFQEEETIPEFHQRITRVVKRLPVS
FT                   CEILYVDDGSNDRTADILRHYQDGSSVRCLSLSRNFGKEAALSAGIDHARGSALIFIDV
FT                   DLQDPPELIAAMVDYWQRGYDVVNMQRNLRIGDSWFKRMSARAYYWVMQRLVEKVDMPA
FT                   DVSDFRLIGPAPLAALRALDERSRILKGMIGWVGFRTIELPYNRTVRHAGSTKWNAAGL
FT                   FNLAIESIVSFSRKPLRIFSLISFGLFVSSICYMLASLVAGSFDIHHLIVGMASFMCVG
FT                   VAMVGEYLGVTLAEVKRRPLYFLKHSNKADPVSLHPSMASIEGKKC"
FT   gene            complement(50571..50990)
FT                   /locus_tag="Pput_0049"
FT   CDS_pept        complement(50571..50990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0049"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76224"
FT                   /db_xref="GOA:A5VWG4"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWG4"
FT                   /protein_id="ABQ76224.1"
FT                   /translation="MENQTPPLTTLLIRYLGIGFIATGVHYAVFLLLVTTEFVTPLLAS
FT                   ICGGMVGAIASFIGNRALCFVADGSRKFQPVRFALVALTTNFGNGVGMWFLIKSNLSPL
FT                   ISQVVVTLSLTALGFIAHRFWTFNHADITSLSRAP"
FT   gene            51248..52216
FT                   /locus_tag="Pput_0050"
FT   CDS_pept        51248..52216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0050"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76225"
FT                   /db_xref="GOA:A5VWG5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWG5"
FT                   /protein_id="ABQ76225.1"
FT                   /translation="MVTQNETYTSSVVPYSPDILDDLPIDDQLAVEFFATARCASFKQA
FT                   ARGLNVPVVGLRKRLEKLEEHIGAPVFVYKHNKLALTRTGERVSHYLCQLFGPDGLGKS
FT                   GEKEVPRLTIAITEPVLNDIVNRDLVAYVRDHAEMQLEIHSECTTQMLSECEVDVGIAL
FT                   VSPDDKGALDRHPTYRFERLGRIGHALFISSRYSRSVTLPVESLDLHNFMLVVPWDEEI
FT                   LAGSRKWASIMAEHQGGTTRVKSYNLSRGLVVGGACIGVLPDYSRKLERNILPVPGFLD
FT                   DLEEKDVYLVIKTKLVRNPQVLEIRRLIKKSFFDKKDWLVR"
FT   gene            52427..53734
FT                   /locus_tag="Pput_0051"
FT   CDS_pept        52427..53734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0051"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76226"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWG6"
FT                   /protein_id="ABQ76226.1"
FT                   /translation="MIRSSNMREKLLAAAIIGTFSSQAFSGTVTTDGADIVLKTKGGLE
FT                   VSTSDKEFSFKLGGRVQADYGRFDGVFTKNGDTADAGYFRRAYLELGGVLYRDWKYQLN
FT                   YDLSRNTGNDSDGYFDEASLTYTGFKPVQLRFGRFYTDFGLEKATSSKWTTAMERNLSY
FT                   DLADWINDNAGMGVQATSTIADMAYVSGSVFSETNNNSDGDSTKRYNVRGVFAPLHSDG
FT                   NVLHVGAQYAYRDLKNSAVDTRIRSRLGVRGVDTNGGGDAGTNGNRMLFGGAAAQDGLW
FT                   KDDSVWGLEGAWATGPFSVQAEYLRRKLKADQANNDMKASGYYAQMAYTLTGEPRIYKL
FT                   DGAKFDTIKPENKELGAWEVFYRFDDIKVEDGNLVTAADQSNERKAKSHTVGVNWYVNE
FT                   AVKVSANYINVRTDNNENTVGDDSGNAIVTRLQYVF"
FT   sig_peptide     52427..52507
FT                   /locus_tag="Pput_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            53754..53888
FT                   /locus_tag="Pput_0052"
FT   CDS_pept        53754..53888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76227"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWG7"
FT                   /protein_id="ABQ76227.1"
FT                   /translation="MRKPEALNVLPAFLFLEVIKHGAPSSYLLSLTDDRSCQSSANLM"
FT   gene            54033..55058
FT                   /locus_tag="Pput_0053"
FT   CDS_pept        54033..55058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76228"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWG8"
FT                   /protein_id="ABQ76228.1"
FT                   /translation="MSAKKLLQPLAAQLHASFSASGRPYSHLHLHQLFHAAIGSVAPQV
FT                   AIQDKLPIQVCRDNETRQYNLYAAVERAKTCLGLTDLQAVGVAEEVIEVLRTAGIGVNQ
FT                   VRLLLDPSFSSKTRKKAFKALCKNLDLNELGDRFVPKTATLAIAAGIAPPPKMSWKDRF
FT                   ALAANSPMRGPSELISMVNRDECYLWVFPPTDHHATAPATHDRFFGEKTHPSAEMGMGF
FT                   SIIDSGWTRPKYPLSRQSQETFIQYSLSAPMWSWRAQSDTWRLGNILRSRILDGAPWHN
FT                   EPLSDVLPSGLKSLPRIYGCETCRTLFIENHSDYPDVPTQCQCGEASSTGDQNESSALN
FT                   S"
FT   gene            55186..55410
FT                   /locus_tag="Pput_0054"
FT   CDS_pept        55186..55410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76229"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWG9"
FT                   /protein_id="ABQ76229.1"
FT                   /translation="MQKSKNKQDTLAAINALVEIAYDQGFADGHGVGNQVGFVAGVMSL
FT                   KAALACGLRHGSPECGKALESLKRIGIDE"
FT   gene            complement(55503..57500)
FT                   /locus_tag="Pput_0055"
FT   CDS_pept        complement(55503..57500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0055"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76230"
FT                   /db_xref="GOA:A5VWH0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWH0"
FT                   /protein_id="ABQ76230.1"
FT                   /translation="MKSLLERPDDQAGHEGHSHEHGGIFGMNTELIFALICGALLGAGA
FT                   LAGKLGLIDRLPLILYVSAYVFGGWFTTKEAVTNIRQKRFEIDSLMLLAAVGAASIGAW
FT                   AEGALLLFLFSLGHSLESYAMGRAKKAIEALSKLAPATAIVRRANGTVEMPVELLVPGD
FT                   VVIVRPNDRLPADGFVVVGSSSINQAPVTGESVPVDKQPVPDAELARSKPDAVDAASKV
FT                   FAGTINGETLIEVEVTRRSTESTLARVIKMVSEAEVRKSPTQRFTDRFQRIFVPLVLLL
FT                   VVGLLFAGIFLDEPFRDSFYRAMAVLVAASPCALAIATPSAILSGIARAARGGVLIKGG
FT                   APLEELGSLNAMAFDKTGTLTEGRPRITDVIPIGGTQIEDLLNVAIAVESMSDHPLAAA
FT                   IVRDGEEMIGTRRRFQAKNMSNMIGRGVRAELDGQFVWIGKVEMFGTNGIPALSKAALE
FT                   AAERLRQSGRTTMVVRRADKDLGAIGLLDTPREGAKEALQKLREMGIERMVMISGDHNR
FT                   VAEAVAKQVGLDEAWGDLMPEDKVKAIKNLRLSAKVAMVGDGVNDAPAMASSSVGIAMG
FT                   AAGSDVALETADIALMADDIRQLPFAVGLSRHTRSIIHQNLFVSLGIVAILVPSTIMGL
FT                   SIGAAVAIHEGSTLLVVFNALRLLAYRRST"
FT   gene            complement(57703..58026)
FT                   /locus_tag="Pput_0056"
FT   CDS_pept        complement(57703..58026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76231"
FT                   /db_xref="InterPro:IPR021245"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWH1"
FT                   /protein_id="ABQ76231.1"
FT                   /translation="MKKLIIAAALVVFSVASQANTFSESKQLQYTKEHQTAVAKYAEKN
FT                   GKPMPEIQDYKYGMKIDVAKFVRQSQDPRTCQVYPRLMTFEDSQGTLKTVRYSMYSQCI
FT                   NNK"
FT   sig_peptide     complement(57967..58026)
FT                   /locus_tag="Pput_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 20"
FT   gene            complement(58189..61350)
FT                   /locus_tag="Pput_0057"
FT   CDS_pept        complement(58189..61350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0057"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76232"
FT                   /db_xref="GOA:A5VWH2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWH2"
FT                   /protein_id="ABQ76232.1"
FT                   /translation="MFERIIRFAIEQRIVVMIAVLIMAGIGIYSYQKLPIDAVPDITNV
FT                   QVQINTAAPGYSPLETEQRITFPVETAMAGLPGLQQTRSLSRSGLSQVTVIFKDGTDIF
FT                   FARQLINERLQVAKEQLPEGVEAVMGPVSTGLGEIFLWTVEAEDGAVKEDGTPYTPTDL
FT                   RVIQDWIIKPQLRNVPGVAEINTIGGYAKQFLVAPDPKRLATYKLTLNDLVAALESNNA
FT                   NVGAGYIERNGEQLLIRAPGQVGNIEDIANIVITSVDGAPIRISSVADVSIGKELRTGA
FT                   ATENGREVVLGTVFMLIGENSRTVSQAVAAKLADINRTLPKGVVAVTVYDRTNLVEKAI
FT                   ATVKKNLVEGAILVIAILFLFLGNIRAALITAMVIPLSMLFTFTGMFNNKVSANLMSLG
FT                   ALDFGIIVDGAVVIVENAIRRLAHAQHKHGRMLTKTERFHEVFAAAREARRPLIFGQLI
FT                   IMVVYLPIFALTGVEGKMFHPMAFTVVMALLGAMVLSVTFVPAAIAMFVTGKVKEEEGV
FT                   VMRTARLRYEPVLQWVLGHRNIAFSAAVALVVLSGLLASRMGSEFIPSLSEGDFAMQAM
FT                   RVPGTSLTQSVEMQQRLEKAVIAQVPEVERMFARSGTAEIASDPMPPNASDAYIMLKPQ
FT                   DQWPNPKKPRDELIAEVQKAAAGVPGSNYELSQPIQLRFNELISGVRSDVAVKVFGDDM
FT                   DVLNNTANKIAAALKAVPGSSEVKVEQTSGLPVLTINIDREKAARYGLNIADVQNSIAI
FT                   AVGGRQAGTLYEGDRRFDMVVRLPETVRTDVAGMSSLLIPVPANAAQGANQIGFIPLSQ
FT                   VANLDLQLGPNQISRENGKRLVIVSANVRGRDLGSFVEEATASLDKKVQIPAGYWTTWG
FT                   GQFEQLQSAAKRLQIVVPVALLLVMTLLFLMFNNLKDGMLVFTGIPFALTGGVVALWLR
FT                   DIPLSISAGVGFIALSGVAVLNGLVMIAFIRGLREEGRTLRQAVDEGALTRLRPVLMTA
FT                   LVASLGFIPMALATGTGAEVQRPLATVVIGGILSSTALTLLVLPALYHWAHRKDEDGDE
FT                   AEVVS"
FT   gene            complement(61375..62625)
FT                   /locus_tag="Pput_0058"
FT   CDS_pept        complement(61375..62625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0058"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76233"
FT                   /db_xref="GOA:A5VWH3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWH3"
FT                   /protein_id="ABQ76233.1"
FT                   /translation="MDNKRKIALAVAAVAALGFGSLAWNNSSGQQAASTAEHGANDGHG
FT                   DEKKAASAAKEEGDEGHGEEGHSEEGGEEEGKLTLSAEQIKAAGVALEAAAPRDLGTVV
FT                   SFPGEIRFDEDRTAHVVPRVPGVVEAVQANLGETVKKGQVLAVIASQQISDLRSEQQAA
FT                   QRRVELARVTFEREKQLWQDKISAEQDYLQARQALQEAEISLANAKQKVGAIGASVNSV
FT                   GGNRYELRAPFDAVVVEKHLTVGEVVSEATNAFILSDLNQVWATFAVPPTDLGKVTTGR
FT                   AVKVSSPDMNVEVEGKVGYVGSLLGEQNRAATVRVTLTNPNGAWRPGLFVNIAVTSQTD
FT                   RVAVAVPEHAVQTVEDKPSVFVRTPDGFDTRPVKLGRRDNGYVEIIDGIEAGAQVATSG
FT                   SFTLKSELGKASAEHGH"
FT   sig_peptide     complement(62554..62625)
FT                   /locus_tag="Pput_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.600 at
FT                   residue 24"
FT   gene            complement(62694..63878)
FT                   /locus_tag="Pput_0059"
FT   CDS_pept        complement(62694..63878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0059"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76234"
FT                   /db_xref="GOA:A5VWH4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWH4"
FT                   /protein_id="ABQ76234.1"
FT                   /translation="MAPAALAQSISLPQALSTAMDANPDLAAARQEIGIADGARKQAGL
FT                   IPNPTISYDVEDTRRNTSQTTVSLSQTLELGGKRGARVDVATYGQTAAQLELDRRVNGL
FT                   RADVVQAFYAALRAQTGLDLAKQSLELTERGLRIVDGRVRAGKSSPVEATRAQVQLAEA
FT                   QLQVRRAETEKATAYQQLAQITGSSVTVFDRLESPTLSPGLPPRTEDLLAKLDQTAEMR
FT                   QAVVQIDKSDASLGSEKAQRIPNLTVSVGSQYDRSVRERVNTVGLSMPLPLFDRNQGNI
FT                   LSASRRADQARDQRNAVELRLRTETQTALNQWSTAMQEVESYDKTILPSAQQAVETATR
FT                   GFEMGKFGFIEVLDAQRTLIVARGQYLESLAAATNARAQVERVYGEVGSTAGTR"
FT   gene            64369..65712
FT                   /locus_tag="Pput_0060"
FT   CDS_pept        64369..65712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0060"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76235"
FT                   /db_xref="GOA:A5VWH5"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWH5"
FT                   /protein_id="ABQ76235.1"
FT                   /translation="MKIKVPLYLAAVSALSGSYAISAQAEDKPEGFIEGSSLTVLNRNF
FT                   YFNRDNRDSTAPTYNSGKGNTNGYSEAWAHAIISKFNSGFTQGTVGFGVDAFAMIGLKL
FT                   DTGDGRNGGRSSFDVLPVDNKGEARDEYTKVGGAAKVRLFDTIVKVGDVFPSTPVVASG
FT                   DSRLLPESFRGVTVENTSIQGLTLQGGRLHAMSQPVSSNLNDNFVTFYGGPVNSPWIGY
FT                   GGGDYSINDNWTVSVYASQLKDVWNQYYAGTSVVYPLSDDLALIGGFNYYKAVDEGKKR
FT                   LGEFDNNIWSAKVGVRYGAHTLALSHQRNNGDDDFDYLRQSDSIFVDNSIQYSDFNSPK
FT                   ERSWMLRYDLNFTSYGIPGLTFMTRYARGSGADYSNANQFYMRTDDNGNPLDNQKRWER
FT                   DVEVKYVVQTGPAKDLSFRLRQATTRATAFESDLDETRVIIEYPLSIL"
FT   sig_peptide     64369..64446
FT                   /locus_tag="Pput_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.988 at
FT                   residue 26"
FT   gene            66201..66875
FT                   /locus_tag="Pput_0061"
FT   CDS_pept        66201..66875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0061"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="TIGRFAM: heavy metal response regulator; PFAM:
FT                   response regulator receiver; transcriptional regulator
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76236"
FT                   /db_xref="GOA:A5VWH6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWH6"
FT                   /protein_id="ABQ76236.1"
FT                   /translation="MRILVIEDEVKTAEYVRQGLTECGYVVDCVHTGSDGLFLAKQHEY
FT                   ELIILDINLPEMDGWQVLELLRRKNCPSRIMMLTARSRLADKVRGLENGADDYLIKPFE
FT                   FPELLARVRALMRRSDHPASVEVIRVADLELDQSRHRAFRDGQRIDLTTKEFALLHYLM
FT                   RNTGVVLSRTQIISQVWDMNFDCDTNVVEVSIRRLRAKIDDPFETKLIHTLRGVGYVLE
FT                   KR"
FT   gene            66993..67316
FT                   /locus_tag="Pput_0062"
FT   CDS_pept        66993..67316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76237"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWH7"
FT                   /protein_id="ABQ76237.1"
FT                   /translation="MRYSIDYQQVSQGQSDASIDACPADIVFNSDHGLALIPCVGDVIN
FT                   LPSTAVKEGVCGIVRSRIFNYLRGPEELYCHVNILVEEADINFESLISEYMRNQSRARS
FT                   PSS"
FT   gene            complement(67418..68029)
FT                   /locus_tag="Pput_0063"
FT   CDS_pept        complement(67418..68029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76238"
FT                   /db_xref="GOA:A5VWH8"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWH8"
FT                   /protein_id="ABQ76238.1"
FT                   /translation="MKRHLSSGKSMTVIQRYNSVIPESIGRKMSIQGLKRYFGNKIHAV
FT                   IMMAPLKREMIRLGICTLMAIILNIILYTGVEVDGTIKPWAETPIKLFASSMLFAFMIK
FT                   AFLPVLGWTILKAMLLSANNAFSGILSFLGNQFTGVMYCTGIIMDSITIKLYMVSGVLD
FT                   SEFAYLSAIVFASGVLYFYVLQCAIQKTMSPALRTPAVPR"
FT   gene            complement(68135..69601)
FT                   /locus_tag="Pput_0064"
FT   CDS_pept        complement(68135..69601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76239"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWH9"
FT                   /protein_id="ABQ76239.1"
FT                   /translation="MPSPAGTLRGIDGMHFDGCRDQRMKEIAAPMFDLIALSLPRGLGF
FT                   GDSPPVGAWLSEDGISCAALTRNINSGSFGIVTLRRRVDSVWVLLSHGECTTGESEARA
FT                   SISHFLYTQAHPLPLPSGERRRAPLSRMGKRTPSVVFKSLFDPSRRIGAWALNQLYLAL
FT                   PSPDRNWVPDCQTENFHTRLWEAHLLAIFREQGLLVTQPKESPDFHIENRLGDEAWVEA
FT                   VTANPEERYEHFGASPVPPPADRHERFLGAAAERFARTIQNKLDKRYESLPHVEGKPLI
FT                   LALADFHAPSSMLWSRESLISYLYGFAVHSSAHRGTHLITVEEETSLLSGRPNGLFTLM
FT                   ENAHLSAVIFTNACTVPKLSRVPISGGAHLDGYRYLRFGEFFDRSPGASRGIPFLLDVA
FT                   SSDYGQLWPQYGYEPWSAEVEVFHNPMALYPVPNELIPEVTHWREVNGRVECESFFDVS
FT                   ILRSRTLVLSANAKVPSLDELLTAASPPEL"
FT   gene            complement(69614..70063)
FT                   /locus_tag="Pput_0065"
FT   CDS_pept        complement(69614..70063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76240"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWI0"
FT                   /protein_id="ABQ76240.1"
FT                   /translation="MDYADQLLSNLIVRSSMANPNLLALFRDEVLLTGPESSLPSNLSQ
FT                   FWLEELQSHLERYFDGLNSDSDAEEKDLDISLPLAAIIHILFAKNGGEEISESSEKLYE
FT                   YFQDYRLELALEEITRKTHVAAEAATIETIFTNRDVLVEQGPLLQ"
FT   gene            complement(70754..71161)
FT                   /locus_tag="Pput_0066"
FT   CDS_pept        complement(70754..71161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0066"
FT                   /product="integral membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76241"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWI1"
FT                   /protein_id="ABQ76241.1"
FT                   /translation="MKKALTVICAALMLSTPLASFAQPGPPDRHDGGPSHQGNPPQGQP
FT                   QHQGRHDNGRGPAYRDPNFHPQQGMPIPHKQWQRGHAVDPHYRGDRYWVTDWKARHLYA
FT                   PPRDHRWLYVNGDYVLVAIASGVIVNILTGY"
FT   sig_peptide     complement(71093..71161)
FT                   /locus_tag="Pput_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(71293..72585)
FT                   /locus_tag="Pput_0067"
FT   CDS_pept        complement(71293..72585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0067"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; PAS fold-4 domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76242"
FT                   /db_xref="GOA:A5VWI2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWI2"
FT                   /protein_id="ABQ76242.1"
FT                   /translation="MPEAHPLILALVSYLEHDALPTIVLDTDYNILAANAAYRRQFGRH
FT                   DQAPLGEKCHRVSHHYAVPCDQAGEHCPMRKAWDSKVPERVLHIHHTPRGPEHVDVELR
FT                   PILDEQGKVVAFVERLTTITLASAQPQEQGLVGRAPTFKAALASLQRAAPAQIPVLLQG
FT                   ESGTGKELFARAVHMGSPRANGPLVVVDCTGLTESLFESELFGYEKGAFTGANQRKIGL
FT                   AEAAHGGTLFLDEIGEVPLAMQVKLLRLIESGSFRPVGSLRTVHSDFRLISATHKPLKQ
FT                   MVADGSFREDLYYRISGFPIRLPALRERVEDLPLLAQSLLQRMAGQPTPRLSEDALQQL
FT                   ALHPFPGNIRELRNILERARLFADDGVIRPEHLPEDTGLTGAAKGSGRRNDLGELAQAL
FT                   EQFKGSRSELASHLGMSERTLYRRLKALGLN"
FT   gene            72808..73692
FT                   /locus_tag="Pput_0068"
FT   CDS_pept        72808..73692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0068"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76243"
FT                   /db_xref="GOA:A5VWI3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="PDB:4YSK"
FT                   /db_xref="PDB:4YSL"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWI3"
FT                   /protein_id="ABQ76243.1"
FT                   /translation="MIIGNNLHVDAFYDEATSTISYLVMDRETRQCALIDSVLDYDPKS
FT                   GRTCSASADRLVERVNELNASVRWVLETHVHADHLSAAAYLKEKLGGHTAIGAHITQVQ
FT                   KVFGALFNAEPGFARDGSQFDVLLEDEEGFRIGNLQARALHTPGHTPACMSFMIEDAGE
FT                   IAVFVGDTLFMPDYGTARCDFPGADARTLYRSIRRLLAFPDQTRLFMCHDYLPGGRDMQ
FT                   YVTTVAEQRASNIHIHQGIDEDSFVAMREARDKTLEMPVLILPSVQVNMRSGQLPPPEA
FT                   NGVSYLKIPLNKL"
FT   gene            73733..75001
FT                   /locus_tag="Pput_0069"
FT   CDS_pept        73733..75001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0069"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76244"
FT                   /db_xref="GOA:A5VWI4"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWI4"
FT                   /protein_id="ABQ76244.1"
FT                   /translation="MPALLSPANTDHHKVVIVGAGAAGIATASSLISRDPSLDVVLIDP
FT                   AEVHYYQPGWTMVGAGVFKAPSTARTMASTIPRGVRWVKARVKGFDPLGQLVILDDARA
FT                   ISYEQLIVCPGLKLDWAAIDGLSETLGRNGVTSNYRYDLAPYTWELVQKLKQGRALFSQ
FT                   PPMPIKCAGAPQKALYLSCDHWLRHGHLGAVKASFYNAGAVLFGVADYVPALMKYIEKY
FT                   AVDLNFSHRLVAVDGPGKRASFLRTLPDGSSETRIEAFDMLHVVPPQVAPDFIRESPLA
FT                   DSAGWVDVDPHTLRHRKYTNVHALGDVANTSNAKTAAAARKQAPVVANNVLVALGRLAT
FT                   LAQYDGYGSCPLTVERGKIVLAEFTYGGKLAPSFPNWLLDGRKPTRLAWLLKAQALPPL
FT                   YWQGMLKGREWLARPQLVAEGGQ"
FT   gene            74998..75816
FT                   /locus_tag="Pput_0070"
FT   CDS_pept        74998..75816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0070"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76245"
FT                   /db_xref="GOA:A5VWI5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWI5"
FT                   /protein_id="ABQ76245.1"
FT                   /translation="MIEHQLLGAGLGAIIGAVLALTGAGGGILAVPLLVFGLGLSMVEA
FT                   APVGLLAVGLAAAVGAVLGLRQGLVRYRAALFIALVGVAAAPFGLMLAHRLPNAPLQVV
FT                   FAGVLVYACLRIWRKAAKELRGEANDAHRFIEPCVLNPLQGRLRWTLPCARALAFTGAL
FT                   SGLLSGLLGVGGGFVIIPALNRYTNLRMASIVSTSLAVIALVSTGSVVSASLAGVMHWQ
FT                   VGAPFAVGAVLGLLLSRPLAARLAGPRLQQMFAVAGWAAALLLAGKALLG"
FT   sig_peptide     74998..75060
FT                   /locus_tag="Pput_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.936) with cleavage site probability 0.692 at
FT                   residue 21"
FT   gene            complement(75805..76692)
FT                   /locus_tag="Pput_0071"
FT   CDS_pept        complement(75805..76692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0071"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76246"
FT                   /db_xref="GOA:A5VWI6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWI6"
FT                   /protein_id="ABQ76246.1"
FT                   /translation="MFDWNDLRFFLELQRSGRLLTAAKRLNTTHSTVARHIESIEQSLG
FT                   TALFVQHAQGYELTPSGQALLKHAEAMENVALLAQEEITQAITPLGKIRLGVTEGIGIM
FT                   FFTPRMNALFERYPGLEVELVAVPRFVSILNREAEISIHLERPNADLLITRKLTDYRLA
FT                   LYASQDYLDRAPPLRNREDLARHSWIGYVDDLLFSQELLFLNSFCRAPNVVFRSTSVIA
FT                   QQAAARAGLGIAVLPNYMARHDPTLVRVLPGETIQRSYWICTRRELHKSVRLRVVWDYL
FT                   LALCAAEQSELLAE"
FT   gene            76927..78573
FT                   /locus_tag="Pput_0072"
FT   CDS_pept        76927..78573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0072"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76247"
FT                   /db_xref="GOA:A5VWI7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWI7"
FT                   /protein_id="ABQ76247.1"
FT                   /translation="MPSADSIFDYVVVGAGPAGCLLANRLSADPSCRVLLLEAGGRDNY
FT                   PWIHIPVGYLYCIGNPRTDWCFKTEAQPGLGGRALGYPRGKVLGGCSSINGMIYMRGQA
FT                   ADYDHWAAQGNDGWAWKDVLPLFKASENHFAGASEHHGAEGEWRVERQRYSWPILDAFR
FT                   DAAEQSGIGKVDDFNTGDNQGCGYFQVNQRSGVRWNASKAFLRPIKDRANLTVLTGVQV
FT                   DQVLLDNTRARAVKALWQGTWHEFAARREIILCAGAVGSPGILQRSGIGPRQLLESLGI
FT                   GVRHDMPGVGGNLQDHLQLRLIYQIRNTRTLNQMANSLWGKMGMGLRYLYDRSGPLAMA
FT                   PSQLGAFVRSSPEQATANLQYHVQPLSLERFGEPLHQFPAFTASVCNLRPVSRGRIDIC
FT                   STDMNSTPLIDPNYLSAPQDLRVAADAIRLTRRIVQAPALAAFEPKEYLPGPALQSEEE
FT                   LFEAAGKIGTTIFHPVGTCRMGNGAMDVVDNQLRVHGIPGLRVADASIMPQITSGNTCS
FT                   PTLMIAEKAAQLILKGAATQTYLNEDALPTP"
FT   gene            78671..80290
FT                   /locus_tag="Pput_0073"
FT   CDS_pept        78671..80290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0073"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76248"
FT                   /db_xref="GOA:A5VWI8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWI8"
FT                   /protein_id="ABQ76248.1"
FT                   /translation="MSDYIQEQGAAASSSSRREERKIIFASSLGTVFEWYDFFLYGALA
FT                   AVISKQFFAGVNDTTAFIFALMAFAAGFLVRPFGALVFGRLGDMIGRKYTFLVTIVLMG
FT                   LSTFAVGLLPTYASIGIAAPIILVILRMLQGLALGGEYGGAATYVAEHAPPGKRGLHTG
FT                   FIQSTATLGLLLSLLVVLGSRYVSGDQFETWGWRLPFLLSIVLLAISTWIRMSMHESPA
FT                   FVKMKAQGKVSKSPIRESFTSWPNLKVVLTALFSINAGQAVTFYTAQFYVLFFMTQMLK
FT                   MDSAQANTLLIISVVIGAPFFVFFGWLSDRIGRKPILMLGLLLATVLYFPLFKALSHYA
FT                   NPQIDAASRQAPIVVTADPQGCTFQFDPVGKARFDSPCDKVKTFLVKQGLPYSSVSVAG
FT                   SEVVVNIGDKTINGFDETAMRAAIEQAGYPAKADPAQVNQVMVVVLIVAMILIATMTYG
FT                   PLAAVMVELFPTRIRYTSMSLPYHIGNGWFGGFLPTVSFALVVYTGDIFYGLWYPVLVT
FT                   GISLVVGIFCLRETKDVDIDKV"
FT   gene            complement(80465..81250)
FT                   /locus_tag="Pput_0074"
FT   CDS_pept        complement(80465..81250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0074"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76249"
FT                   /db_xref="GOA:A5VWI9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWI9"
FT                   /protein_id="ABQ76249.1"
FT                   /translation="MVQATMSILQAIRIFLFYLLLGTSSLLWCSLSFFVAPFLSFPKRY
FT                   KFINVYWCRCALFLVRTILGIDYKITGAENVPAEPCVILSNHQSTWETFFLSQYFSPLS
FT                   QVLKRELLYVPFFGWAMAMLRPIAINRDNPKEALRQVASKGDELLKQKTWVLIFPEGTR
FT                   VPFGTIGKFSRGGTALAVNAGLPVLPIAHNAGKFWPKTGWGKRAGTIEVVIGEPMYANG
FT                   TGPRAIAELNDRAAAWNEATQRAMGSLPPAAEKPQEQMA"
FT   gene            complement(81297..81824)
FT                   /locus_tag="Pput_0075"
FT   CDS_pept        complement(81297..81824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0075"
FT                   /product="D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Polynucleotide kinase 3 phosphatase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76250"
FT                   /db_xref="GOA:A5VWJ0"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWJ0"
FT                   /protein_id="ABQ76250.1"
FT                   /translation="MKLLILDRDGVINYDSDAYIKTLEEWVPIPGSVDAIAQLSKAGWT
FT                   VAVATNQSGIARGYYPLATLEAMHARLRALVAEQGGEVGHIVYCPHGPDEGCDCRKPKP
FT                   GMLRAIAEHYQIGLEGVWFVGDSKGDLEAALAVGAQPVLVKTGKGERTLEKGVPETTLI
FT                   FDDLAAIARELI"
FT   gene            complement(81828..83882)
FT                   /locus_tag="Pput_0076"
FT   CDS_pept        complement(81828..83882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0076"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76251"
FT                   /db_xref="GOA:A5VWJ1"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWJ1"
FT                   /protein_id="ABQ76251.1"
FT                   /translation="MSAQDFLVELGTEELPPKALTSLGEAFLAGIEKGLQAAGLNYTGK
FT                   QVYAAPRRLAVLIRQLDVQQPDRSINIDGPPLQAAFNAEGEPTQAALGFAKKCGVELAE
FT                   IDQSGPKLRFSQHIPGKATTDLLPTIVEDSLNDLPIPKRMRWAASREEFVRPTQWLVML
FT                   LGDQVVDCTILSQKAGRESRGHRFHHPETVVITTPANYVEDLRKAHVLADFAERRELIS
FT                   KRTAELAMQQEGTAIVPPALLDEVTALVEWPVPLVCSFEERFLEVPQEALITTMQDNQK
FT                   YFCLLDSEGKLLPRFITVANIESRDPKQIVQGNEKVVRPRLTDAEFFFKQDKKQPLETF
FT                   NERLKNVVFQAQLGTVYDKAERVSKLAAFVAPLIGGDAQRAGRAGLLSKCDLATEMVGE
FT                   FPEMQGVAGYYYALNDGEPEDVALALNEQYMPRGAGAELPQTLTGAAVAIADKLDTLVG
FT                   IFGIGMLPTGSKDPYALRRAALGVLRILIEKQLDLDLTGAVEFAVKQFGAKVKAPGLAD
FT                   QVLEFIFDRLRARYEDEGIDVATYLSVRALQPGSALDFDQRVQAVQAFRKLPEAEALAA
FT                   VNKRVSNLLSKAEGAIAEQVEPKYFDNANEFSLYSAIQQADQAVQPMAAARQYSESLAR
FT                   LAALRDPVDAFFEAVMVNAEDAKVRANRYALLSRLRGLFLGVADISLLG"
FT   gene            complement(83879..84826)
FT                   /locus_tag="Pput_0077"
FT   CDS_pept        complement(83879..84826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0077"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76252"
FT                   /db_xref="GOA:A5VWJ2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWJ2"
FT                   /protein_id="ABQ76252.1"
FT                   /translation="MSQPTPAVRTFQDLILALQNYWAAQGCVVLQPYDMEVGAGTFHTA
FT                   TFLRAVGPETWNAAYVQPSRRPADGRYGENPNRLQHYYQFQVVLKPNPANFQELYLGSL
FT                   KAIGLDPLVHDIRFVEDNWESPTLGAWGLGWEIWLNGMEVTQFTYFQQVGGIECYPVTG
FT                   EITYGLERLAMYIQGVDSVYDLVWADGPFGKVTYGDVFHQNEVEQSTYNFEHANVDKLF
FT                   ELFDFYESEANRLIKLELPLPTYEMVLKASHTFNLLDARRAISVTERQRYILRVRTLAR
FT                   DVAQSYLQARARLGFPMATPELRDEVLAKLEAAQ"
FT   gene            84910..85461
FT                   /locus_tag="Pput_0078"
FT   CDS_pept        84910..85461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0078"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76253"
FT                   /db_xref="GOA:A5VWJ3"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWJ3"
FT                   /protein_id="ABQ76253.1"
FT                   /translation="MPRCFWCTDDPLYQAYHDQEWGMPQRDPALLFEMLLLEGFQAGLS
FT                   WITVLRKRERYRQVMYGFDPVRLAAMGDERIEELMQDAGIIRNRLKLKAARRNAQAWLA
FT                   VDNPAEWLWSFVGGSPKINHFKARGDVPAVTDEAKAMSKALQKAGFTFVGPTICYAFMQ
FT                   ATGMVMDHTTDCDRYAALLR"
FT   gene            85503..86390
FT                   /locus_tag="Pput_0079"
FT   CDS_pept        85503..86390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0079"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76254"
FT                   /db_xref="GOA:A5VWJ4"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWJ4"
FT                   /protein_id="ABQ76254.1"
FT                   /translation="MEKFKGALMVGVLRLFAKLPWGAVQRVGAGIGWLMWKIPNSSRNV
FT                   VRINLAKCFPEMDPVAREQLVGQALRDIGKSFVESACAWIWPPQRSLELVKEVHGLEVL
FT                   EQALASGKGVVGITSHLGNWEVLNHFYCNQCKPIIFYRPPKLKAVDDLLREQRVQMGNR
FT                   VAPSTKEGILSVIKEVRRGGQVGIPADPEPAESAGVFVPFLGTQALTSKFVPNMLAGGK
FT                   AVGVFLHALRLPDGSGFKVFLEAAPEEMYSTDVNVSAAAMSKVVERYVREYPSQYMWSM
FT                   KRFKKRPAGEPRWY"
FT   gene            complement(86488..86802)
FT                   /locus_tag="Pput_0080"
FT   CDS_pept        complement(86488..86802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0080"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76255"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWJ5"
FT                   /protein_id="ABQ76255.1"
FT                   /translation="MRESLEKMLAKGVDNPLLRFGLGKAWLDEGNGAEAAVHLARCVEQ
FT                   DPKYSAAWKLLGKAYQLQGELAAARKAWEDGIVAAQAHGDKQAEKEMTVFLKKLNKTSA
FT                   "
FT   gene            complement(86814..88187)
FT                   /locus_tag="Pput_0081"
FT   CDS_pept        complement(86814..88187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0081"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76256"
FT                   /db_xref="GOA:A5VWJ6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWJ6"
FT                   /protein_id="ABQ76256.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLASEANDITVVDTDGDRLRDLGDRLDI
FT                   RTVQGRGSLPTVLRQAGADDADMLVAVTNSDETNMVACQVAYSLFHTPTKIARVRESSY
FT                   LTREELFDNDHIPVDVLISPEQVVTNYIKRLIEHPGSLQVIDFAEGKAQLVAVKAYYGG
FT                   PLVGQQLRQIRAHMPNVDTRVAAIFRRDRPITPRGDTVIEADDEVFFIAAKKDIRAVMG
FT                   ELRRIDETNKRIVIAGGGQIGERLAEAIESRYQVKIIEMSPARCRHLSDTLESTVVLQG
FT                   SASDKDLMLEENIADADIFLALTNDDEANIMSSLLAKRLGAGKVMTIINNPAYVDLVQG
FT                   GDIDIAISPQLATIGTLLAHVRRGDIVSVHSLRRGAAEAIEAVAHGDSKSSKVVGKAIE
FT                   NIALPPGTTIGAIIRDEEVMIAHDDTVIESGDHVILFVVDKKHIRDVEKLFHVGLSFF"
FT   gene            complement(88211..89521)
FT                   /locus_tag="Pput_0082"
FT   CDS_pept        complement(88211..89521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0082"
FT                   /product="16S rRNA m(5)C-967 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76257"
FT                   /db_xref="GOA:A5VWJ7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWJ7"
FT                   /protein_id="ABQ76257.1"
FT                   /translation="MNPRLAAARALAAVLSGKASLNSSLPAQLDKVDERDRGLTQDLAF
FT                   GTARWQPRLDLLAAQLLQKPFKAADADVQALLLVGLYQLFYTRIPAHAAIGETVGCADK
FT                   LKKPWAKGLLNAVLRRAQREGEELLAGMERDPVVRTAHPRWLQKALKAFWPEQWEAICA
FT                   ANNAHPPMILRVNRRHHSRDAYLALLAEAGIGASACQYSRDGIVLAEACDVRGLPGFAE
FT                   GWVSVQDEAAQLSADLLELAPGQRVLDACCAPGGKTCHLLEAEAGLAHMVAIDLEAKRL
FT                   TRVRENLDRLQLDAELIACDARDTASWWDGKPFQRILLDAPCSATGVIRRHPDIKLTRQ
FT                   ADDIPALATLQGELLDALWPTLEVGGMLLYATCSSLPTENTEVIKAFLARTPGARELDL
FT                   ATEAGLRQPHGRQLLAQEGGHDGFYYAKLIKIAASRG"
FT   sig_peptide     complement(89456..89521)
FT                   /locus_tag="Pput_0082"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.884) with cleavage site probability 0.547 at
FT                   residue 22"
FT   gene            complement(89518..90450)
FT                   /locus_tag="Pput_0083"
FT   CDS_pept        complement(89518..90450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0083"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76258"
FT                   /db_xref="GOA:A5VWJ8"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWJ8"
FT                   /protein_id="ABQ76258.1"
FT                   /translation="MRIVFAGTPEFAAEHLKALLDSPYEIVAVYTQPDRPAGRGQKLMP
FT                   SAVKALAVAHDIPVFQPQTLRNADAQAELAALKPDLMVVVAYGLILPQVVLDIPRLGCI
FT                   NSHASLLPRWRGAAPIQRAVEAGDAESGVTVMRMEAGLDTGPMLLKVVTPISAEDTGGT
FT                   LHDRLAEMGPPAVVQAIAGLADGSLQGEIQDDALATYAHKLNKDEARIDWTRPAVELER
FT                   LIRAFNPWPVCHSMLDGESVKVLAANLSTGQGAPGEILSASKDGLVVACGDQALSLTRL
FT                   QLPGGKALSFSDLFNSRREKFAAGKVLGQ"
FT   gene            complement(90511..91017)
FT                   /locus_tag="Pput_0084"
FT   CDS_pept        complement(90511..91017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0084"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76259"
FT                   /db_xref="GOA:A5VWJ9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWJ9"
FT                   /protein_id="ABQ76259.1"
FT                   /translation="MAILNILEFPDPRLRTLAKPVTEFDDALRQLIDDMFETMYEAPGI
FT                   GLAATQVNVHKQVVVMDLSEDRSEPRVFINPSVEELTHDMGQYQEGCLSVPGFYENVDR
FT                   PLRVRVKAQDRDGKPFELECEGLLAVCVQHEFDHLNGKLFVDYLSQLKRDRIKKKLEKQ
FT                   HRQQA"
FT   gene            91224..92321
FT                   /locus_tag="Pput_0085"
FT   CDS_pept        91224..92321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0085"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76260"
FT                   /db_xref="GOA:A5VWK0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWK0"
FT                   /protein_id="ABQ76260.1"
FT                   /translation="MPSYHSSLCPPAELEARLRLHRLPETGLRRFRTLLDAFGSASSAL
FT                   SAPGSAWRALGIPQATIDARRSAEVREGALAAMAWLERPGQHLLMWDGPDYPALLAEID
FT                   DAPPLLFVAGEPALLDRPQLAIVGSRRATPPALDTARAFSRYLAQAGFTITSGLAVGVD
FT                   GAAHRAALQAGGCTIAVLGTGLQKLYPQRHQELAQAMIDNGSALVSEYPLDAGPLPGNF
FT                   PRRNRIISGLSLGVLVVEASLASGSLITARLAAEQGREVYAIPGSIHHPGAKGCHQLIR
FT                   DGALLVETVEQILESLQGWQNLPPAVVDRFDHPLLALLHAAPQTSESLAHCSEQPLADV
FT                   LAQLTELELEGRVSNEAGRWFARAG"
FT   gene            92364..92921
FT                   /locus_tag="Pput_0086"
FT   CDS_pept        92364..92921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0086"
FT                   /product="translation factor SUA5"
FT                   /note="PFAM: SUA5/yciO/yrdC, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76261"
FT                   /db_xref="GOA:A5VWK1"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWK1"
FT                   /protein_id="ABQ76261.1"
FT                   /translation="MVSSFRVQQAAREIRAGAVIAYPTEAVWGLGCDPWNEDAVYRLLA
FT                   LKSRPVDKGLILIADNIRQFDFLFEDFPEDWIDRMGSTWPGPNTWLVPHQDLLPEWVTG
FT                   QHDTVALRVSDHPVVRELCALVGPLISTSCNPGGRPAAKTRLRVEQYFHGQLDLVLGGA
FT                   LGGRKNPSVIRNLATGEVVRPG"
FT   gene            93301..93618
FT                   /locus_tag="Pput_0087"
FT   CDS_pept        93301..93618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76262"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWK2"
FT                   /protein_id="ABQ76262.1"
FT                   /translation="MMKKIVPDPPLPCTSTRPFGRCDAGHDPLFTVNPNISAEDALVHV
FT                   ALYLRSAYETGYKALDYMREEGRGMFWSNLHAIEMAEGVIEAILDGIESTPPLTNRPSQ
FT                   A"
FT   gene            complement(93745..94722)
FT                   /locus_tag="Pput_0088"
FT   CDS_pept        complement(93745..94722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0088"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76263"
FT                   /db_xref="GOA:A5VWK3"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWK3"
FT                   /protein_id="ABQ76263.1"
FT                   /translation="MAKRIQFSQHGGPEVLQFVEFEPTPPGPQQVRVRNHAIGLNFIDT
FT                   YFRSGLYAPPSLPSGLGTEAAGVVEAVGEGVSRLKVGDRVAHAGGPLGAYSEVHTLPEA
FT                   NLVKLPDTISFEQAAAVMLKGLTVQYLLKQTYEVKAGDVILFHAAAGGVGSLACQWAKA
FT                   LGAKLIGTVSSAEKAERAKALGAWATIDYSREDVAKRVLELTDGKKCPVVYDGVGADTW
FT                   LTSLDCLRPRGLMVSFGNASGAVSGVNLGILAQKGSLYVTRPTLATYANNAENTQAMAD
FT                   DLFAMIASGKLVVDIQQRYPLSEAAKAQAELSARRTVGSTVLIP"
FT   gene            94857..95768
FT                   /locus_tag="Pput_0089"
FT   CDS_pept        94857..95768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0089"
FT                   /product="coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76264"
FT                   /db_xref="GOA:A5VWK4"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWK4"
FT                   /protein_id="ABQ76264.1"
FT                   /translation="MTSRTEAVKAYLLDLQDRICSALETEDGGARFVEDAWVREAGGGG
FT                   RTRVIGDGKVIEKGGVNFSHVFGAGLPPSASAHRPELAGRGFEALGVSLVIHPYNPHVP
FT                   TSHANVRFFIAEKEGEEAVWWFGGGFDLTPYYGNEEDCVHWHRVAEQACAPFGADVYPR
FT                   YKAWCDRYFHLKHRGEPRGIGGLFFDDLNEWDFDTCFAFIRAIGDAYINAYLPIVQRRK
FT                   DTPYTPQQREFQEYRRGRYVEFNLVYDRGTLFGLQSGGRTESILMSLPPQVRWGYDWKA
FT                   APGSEEARLTEYFLQDRDWLGQ"
FT   gene            95794..96618
FT                   /locus_tag="Pput_0090"
FT   CDS_pept        95794..96618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0090"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76265"
FT                   /db_xref="GOA:A5VWK5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWK5"
FT                   /protein_id="ABQ76265.1"
FT                   /translation="MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLKYATLLAPLDEFSD
FT                   CARGFFKQGSGGNVTVPFKEEAYRLCDSLTPRAQRAGAVNTLSKLADGTLQGDNTDGAG
FT                   LVRDLTVNAGVELAGKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREF
FT                   DELGPVVASGFAWLQEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTP
FT                   FCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG"
FT   gene            complement(96748..98313)
FT                   /locus_tag="Pput_0091"
FT   CDS_pept        complement(96748..98313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0091"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76266"
FT                   /db_xref="GOA:A5VWK6"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWK6"
FT                   /protein_id="ABQ76266.1"
FT                   /translation="MHRLSLLLPFLTWLPRQSGRSLRQDLLVGLSGAILALPQSIAYAL
FT                   IAGLPAEYGLYAAIVPVLIACLWGSSWHLICGPTAAISIVLYASISPLAVAGSADYITL
FT                   VLLLTFLGGLFQLLLGLLRFGALVNFVSHSVVLGFTLGAAIVIALGQLPNLLGMALPSQ
FT                   ATALKTVQDLASHAGEVDLPSLLLGLATVVIGVAFKLWRPRWPSLLISLILVSLLAWLL
FT                   PGFFGHVPRVAAFTGQLPPFSPLPLLDVELMLRLLPSAVAVGMLGLVTSLSIARSLSAR
FT                   SEQLIDPDQEIRAQGLSNIAGAFFSGYLSAGSFTRSGLSYEAGARSPMAGVFSALWVAL
FT                   FAVTGAGLIAHLPIPAMAGSILLICWGLVDHRGIRALFRVSRSEFLVMALTAAATLLLE
FT                   LQTAIYAGVLASLFFYLKRTSRPRIQQSREGDADVLRVGGSIFFGAAHYLQVRLQRCQG
FT                   PHVVIDARQVNFIDYSGVDMLHREARRLRRLGGSLTLHRARPQVIEELQKLEGVELCPI
FT                   RFEE"
FT   sig_peptide     complement(98179..98313)
FT                   /locus_tag="Pput_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.793) with cleavage site probability 0.681 at
FT                   residue 45"
FT   gene            complement(98458..99381)
FT                   /locus_tag="Pput_0092"
FT   CDS_pept        complement(98458..99381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0092"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76267"
FT                   /db_xref="GOA:A5VWK7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWK7"
FT                   /protein_id="ABQ76267.1"
FT                   /translation="MHKFSAAVFVLALSATTAHAADSDAQCSTVKMADPGWSDIASTNA
FT                   VARLLLESLGYQVKIDSLAVPIIYGGLKDGQVDAFLGNWMPAQQGFHDKFIANGDVQQL
FT                   SRNLEGTEFTLAVPDYVWNAGVKDFADLQKHAGQFDKKLYGIGSGAPANLSLKKIIEEN
FT                   EFNLGQWKLVESSEQAMLAQVDRAVKKQQFITFLGWTPHPMNVKLKMHYLTGGEKWFGS
FT                   KGEVYTLTRKGYPQACPNAAKLLGNLKFTLDMENSIMAEVVDKKISFDEAAKAWVKAHP
FT                   ERLDGWLAGVTTKADGDALEAVKAKL"
FT   sig_peptide     complement(99319..99381)
FT                   /locus_tag="Pput_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(99396..100913)
FT                   /locus_tag="Pput_0093"
FT   CDS_pept        complement(99396..100913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0093"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76268"
FT                   /db_xref="GOA:A5VWK8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWK8"
FT                   /protein_id="ABQ76268.1"
FT                   /translation="MTRPNILFIMADQMAAPLLPIYGPSPIQMPHLGRLAEQAVVFDSA
FT                   YCNSPLCAPSRFTLVSGQLPSRIGAYDNAADFPADVPTYAHYLRRLGYRTALSGKMHFC
FT                   GPDQLHGYEERLTSDIYPADYGWAVNWDEPDVRPSWYHNMSSVLQAGPCVRTNQLDFDE
FT                   EVVFKARQYLYDHVRENDGRPFCLTVSMTHPHDPYTIAKRYWDRYEGVDIPMPRAEFSQ
FT                   AALDPHSQRLLKVYDLWNKPLPVDKVRDARRAYFGACSYIDDNIGQLLQTLEECNLADD
FT                   TLIVFSGDHGDMLGERGLWYKMHWFEMSARVPLLIHAPKRFAAGRVTASVSTCDLLPTL
FT                   VELAGGAVDKDLQLDGRSLLGHLQGQGGHDEVIGEYMAEGTVGPLMMIRRGPYKFVYSE
FT                   DDPCLLYDLSRDPHERENLTGSPDHQVLLQAFVDEAQQRWDIPSLRQQVLASQRRRRLV
FT                   AEALAIGKLKSWDHQPLVDASQQYMRNHIDLDDLERKARYPQPAPLD"
FT   gene            101022..101921
FT                   /locus_tag="Pput_0094"
FT   CDS_pept        101022..101921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0094"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76269"
FT                   /db_xref="GOA:A5VWK9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017786"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWK9"
FT                   /protein_id="ABQ76269.1"
FT                   /translation="MFDHLAGLSLDTLRVFEAAARLRGFTAAALELGTTQPAVSQQVKR
FT                   LEAQLGTRLFDRIYRGIELTEAGQVLFEQVHQGLQTMDDGIAQASGRGQREVLQVATDF
FT                   AFAAFWLMPRLQRFHQAYPQVDVSLVTGERSQGMLRPDIDVAVLFGDGRFHQGESRWLF
FT                   DEEVFPVCSPHLIHGKALSAVALQRLPLLHLKGEQASRWFDWAGVFRGFGVDSPPPAGQ
FT                   LRFDNYTLLIQAAIAGQGVAIGWAHLVDGLVEQGLLCRPLEGSLRSERGYYAVLPPRKR
FT                   RGALIERFVDWLEQERSL"
FT   gene            complement(102043..102660)
FT                   /locus_tag="Pput_0095"
FT   CDS_pept        complement(102043..102660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76270"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWL0"
FT                   /protein_id="ABQ76270.1"
FT                   /translation="MKNAETPVFKLVLFGPESSLGNALMVELLSRQHEVIAVVDDLNRH
FT                   SPRPGLHFKIGGLGDAHQAEQGAAGGSAVIALLPALAPGDLQGQARLSEALVAGLAHTT
FT                   IRRLLLVGDFDVLDEPSKYSEMERDCVAQVVDGLQRSALYWTLINAPQELAGLGMEHFR
FT                   NTEGTLEPGLAEPLRRLARIAAGIVDMLELDLHRGEHLNFVV"
FT   gene            102713..103045
FT                   /locus_tag="Pput_0096"
FT   CDS_pept        102713..103045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0096"
FT                   /product="Dopa 4,5-dioxygenase"
FT                   /note="PFAM: Dopa 4,5-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76271"
FT                   /db_xref="GOA:A5VWL1"
FT                   /db_xref="InterPro:IPR014980"
FT                   /db_xref="InterPro:IPR023389"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWL1"
FT                   /protein_id="ABQ76271.1"
FT                   /translation="MQRIKGYHAHVYYDAATMEQARELCEEAARLFPVTMGRMHQKPVG
FT                   PHPDWSCQLAFGPEVVGVVLPWLALYRKGLVVFMHPETGDELADHRDHAIWMGAVRPLN
FT                   LSIFGG"
FT   gene            complement(103166..103975)
FT                   /locus_tag="Pput_0097"
FT   CDS_pept        complement(103166..103975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0097"
FT                   /product="tryptophan synthase, alpha chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase, alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76272"
FT                   /db_xref="GOA:A5VWL2"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWL2"
FT                   /protein_id="ABQ76272.1"
FT                   /translation="MSRLEQRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGA
FT                   DVIELGMPFTDPMADGVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGYYN
FT                   PIHRFGVDTFVAEAKAAGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARL
FT                   PRVLERSSGFVYYVSVAGVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAAN
FT                   IARLADGVVVGSALVDKIAQAKSADQAVTDVLSLCSALAEGVRGARR"
FT   gene            complement(103972..105189)
FT                   /locus_tag="Pput_0098"
FT   CDS_pept        complement(103972..105189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0098"
FT                   /product="tryptophan synthase, beta chain"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76273"
FT                   /db_xref="GOA:A5VWL3"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWL3"
FT                   /protein_id="ABQ76273.1"
FT                   /translation="MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKAD
FT                   PKFLEELAYFQRDYIGRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVL
FT                   LAKRMGKKRLIAETGAGMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAE
FT                   IVPVTAGTGTLKDAMNEALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRA
FT                   QLQEKEGRLPDSLVACVGGGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHAASLNG
FT                   GVPGVLHGNRTYLLQDQDGQITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEA
FT                   LDAFHATCRLEGIIPALESSHALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQTVMNHMA
FT                   AQEKHA"
FT   gene            105300..106196
FT                   /locus_tag="Pput_0099"
FT   CDS_pept        105300..106196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0099"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76274"
FT                   /db_xref="GOA:A5VWL4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037418"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWL4"
FT                   /protein_id="ABQ76274.1"
FT                   /translation="MAHDLPPLNALRAFEAAARLNSVSQAAEALHVTHGAVSRQIKVLE
FT                   EHLGVALFVKDGRGIKLTDAGVRLRDASGEAFDRLRSVCSELSRDVSEAPFVLGCSGSL
FT                   LARWFIPRLGRLQADLPELRLHLSAGEGDLDPRRPGLDALLVYAEPPWPADMQVHVLAE
FT                   ECIGPVLSPHFAGFQRLQGAPAKALLGEALLHTTSRPQAWPTWAVQQGLDPTAIHYGQA
FT                   FEHLYYLLEAAVAGLGVAIAPQPLVADDLRAGRLSAPWGFSPTQAALALWVPRRAADGR
FT                   AEQLAQWLRAELARQSA"
FT   gene            complement(106193..106516)
FT                   /locus_tag="Pput_0100"
FT   CDS_pept        complement(106193..106516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0100"
FT                   /product="protein of unknown function DUF883, ElaB"
FT                   /note="PFAM: protein of unknown function DUF883, ElaB"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76275"
FT                   /db_xref="GOA:A5VWL5"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWL5"
FT                   /protein_id="ABQ76275.1"
FT                   /translation="MHRNSLRKTSLESMEAEIESLLKSLEHLKHDASEESQKSVKAIRS
FT                   NAESALRHSRSLLSDAYEEVKQRTRQTGIATRDYAQEHPYTTAGVAIGALGLLAAYLIC
FT                   KRN"
FT   gene            106667..106882
FT                   /locus_tag="Pput_0101"
FT   CDS_pept        106667..106882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0101"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76276"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWL6"
FT                   /protein_id="ABQ76276.1"
FT                   /translation="MTDHHTYKKIELVGSSPTSIEEAINNALAEAGKSIKHLEWFEVVD
FT                   TRGHIRDNKAAHFQVTLKVGFRIANS"
FT   gene            106983..107204
FT                   /locus_tag="Pput_0102"
FT   CDS_pept        106983..107204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0102"
FT                   /product="protein of unknown function DUF1161"
FT                   /note="PFAM: protein of unknown function DUF1161"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76277"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWL7"
FT                   /protein_id="ABQ76277.1"
FT                   /translation="MNKLILALGLMTLAGGALAAGKPCEELKAEIAAKLDAKGVTGYKL
FT                   EIVKKGDPAGKVIGSCEAGTKEIVYRRG"
FT   sig_peptide     106983..107042
FT                   /locus_tag="Pput_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(107277..108281)
FT                   /locus_tag="Pput_0103"
FT   CDS_pept        complement(107277..108281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0103"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76278"
FT                   /db_xref="GOA:A5VWL8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWL8"
FT                   /protein_id="ABQ76278.1"
FT                   /translation="MTQLRDLKISTLDLVPVRADAGPAQSLRNSLDLAQHVERFGYNRF
FT                   WVAEHHNMDGIASSATSVLIGYLAGGTSRIRVGSGGVMLPNHAPLVIAEQFGTLASLYP
FT                   GRIDLGLGRAPGSDQMTAYALRRDRAGGPDDFPDDVEELSRYLGPRTDDQKVIAVPGYD
FT                   TDVPMWLLGSSLFSAQLAGMRGMPYAFASHFAPRYMHEAIRVYRNHFKPSTTLDKPYVM
FT                   LGIPMVVAQTDEKAEYLATSVYQRILALIRGQSLMQKPPVESMDGLWLPHERETVASFL
FT                   GLAMIGSPQKVKAKVEVLLEQTGADELIFTCDLYEHADRIRSYELMAQALKAE"
FT   gene            108434..108859
FT                   /locus_tag="Pput_0104"
FT   CDS_pept        108434..108859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0104"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76279"
FT                   /db_xref="GOA:A5VWL9"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWL9"
FT                   /protein_id="ABQ76279.1"
FT                   /translation="MKKTASAIWQGGLKDGKGLLSTESGALKQNPYGFNTRFEGTPGTN
FT                   PEELIGAAHAGCFSMALSMMLGEAGLTAERIDTAAEVTLDKQADGFAITAVHLVLRAKV
FT                   PGASEAQFLEIANKAKEGCPVSKVLNAKISLDAALVG"
FT   gene            108935..109168
FT                   /locus_tag="Pput_0105"
FT   CDS_pept        108935..109168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0105"
FT                   /product="protein of unknown function DUF1161"
FT                   /note="PFAM: protein of unknown function DUF1161"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76280"
FT                   /db_xref="InterPro:IPR010595"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWM0"
FT                   /protein_id="ABQ76280.1"
FT                   /translation="MIRVAIAVLASLVATSALAAVKPCEELKTEIEAKIQAQGVSSYTL
FT                   EIVPNSEVKDQNMVVGTCDGGTKKIIYQKNDR"
FT   sig_peptide     108935..108994
FT                   /locus_tag="Pput_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(109204..109617)
FT                   /locus_tag="Pput_0106"
FT   CDS_pept        complement(109204..109617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76281"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWM1"
FT                   /protein_id="ABQ76281.1"
FT                   /translation="MRQPMMLIALSALGACASPLPPVDPKQAWVDLYTMTPGRVIMADR
FT                   LDGKRLDDGRYFQVTPGKHELVVRFDYEIYSGGIMSEPRDRTCYLTVRFDNFKAGERYR
FT                   LEARAPVMEPQVLLYDANRKVVVNEPSEVFCIP"
FT   sig_peptide     complement(109564..109617)
FT                   /locus_tag="Pput_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.992 at
FT                   residue 18"
FT   gene            complement(109673..110086)
FT                   /locus_tag="Pput_0107"
FT   CDS_pept        complement(109673..110086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76282"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWM2"
FT                   /protein_id="ABQ76282.1"
FT                   /translation="MRALLVAGSLLLISACSTLPDPDPNQAWIDLTRYDNTSLDAVQVD
FT                   ERDWADSRYFEVQPGSHELTVRYQFPVNPSNIGPVEEPLWRDCQVKLTFKDFSAGQRYQ
FT                   LQAGSIGFRPWIKLYDHQQKLLGQGLPAGCQRT"
FT   sig_peptide     complement(110030..110086)
FT                   /locus_tag="Pput_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.683) with cleavage site probability 0.513 at
FT                   residue 19"
FT   gene            110154..111245
FT                   /locus_tag="Pput_0108"
FT   CDS_pept        110154..111245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0108"
FT                   /product="aminopeptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76283"
FT                   /db_xref="GOA:A5VWM3"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWM3"
FT                   /protein_id="ABQ76283.1"
FT                   /translation="MLRLFLMQRSGLGALDRIFTRLVPLLAALLLNGCSNAAYYGQLAQ
FT                   GQWQLLRARQPVEQVLADPATPAPLRAHLQQAEQARLFASQQLKLPDNRSYRVYADLGR
FT                   PYVVWNVFATPELSLQPVTHCFPIAGCVAYRGYYQQGAARGAAALMRQDGLDVYVGGVE
FT                   AYSTLGWFDDPILSSMVGWGDERLATLIFHELAHQRFYVQDDTEFNESFASFVEQEGTR
FT                   QWRAARGLTAVGGDQGKQRDQFIRLVLASRERLQAIYAEPLDDAHKRRAKQAEFERLRR
FT                   EYRQVRDGQWGGDKRYDAWMYGPMSNAKLLPFGLYDQWVPAFAALFREVGGDWVRFYAR
FT                   VEHLGRLPIEARKAALQRLMVSR"
FT   sig_peptide     110154..110267
FT                   /locus_tag="Pput_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.915) with cleavage site probability 0.905 at
FT                   residue 38"
FT   gene            complement(111351..112064)
FT                   /locus_tag="Pput_0109"
FT   CDS_pept        complement(111351..112064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0109"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76284"
FT                   /db_xref="GOA:A5VWM4"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWM4"
FT                   /protein_id="ABQ76284.1"
FT                   /translation="MTAFAGMPAKKATQHSSGTLYMHQQNILFDLDGTLTDPRLGITRS
FT                   IQYALAKLGIDEPDLARLEHFIGPPLLQAFMQFYSFDEAKAWDAVNFYRERFRVTGLYE
FT                   NLVFEGVPELLEALNGQGRTLYIATSKPWEFAREIARHFAFDHHFKVIYGSELDGTRTN
FT                   KVELIRHLLDEEGLDPAHTLMIGDRKHDLIGARSNGLQAVAVGYGFGSREELMAEEPAF
FT                   HFATVADLHQAFSKA"
FT   gene            complement(112061..112609)
FT                   /locus_tag="Pput_0110"
FT   CDS_pept        complement(112061..112609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0110"
FT                   /product="Carbonic anhydrase/acetyltransferase isoleucine
FT                   patch superfamily-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76285"
FT                   /db_xref="GOA:A5VWM5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWM5"
FT                   /protein_id="ABQ76285.1"
FT                   /translation="MAIRSFQQHTPKVGPRAFVDRSAVVLGDVEIGEDSSVWPLTVVRG
FT                   DMHRIRIGARTSVQDGSVLHITHAGPFNPDGFPLIIGDEVTIGHKVMLHGCTLGNRILV
FT                   GMGSTIMDGAIVEDEVIIGAGSLVPPGKRLVSGYLYMGSPVKQARLLNDKERAFFSYSA
FT                   GNYVKLKDQHLAEGYDQPE"
FT   gene            112676..114763
FT                   /locus_tag="Pput_0111"
FT   CDS_pept        112676..114763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0111"
FT                   /product="oligopeptidase A, Metallo peptidase, MEROPS
FT                   family M03A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B, thimet/oligopeptidase
FT                   F"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76286"
FT                   /db_xref="GOA:A5VWM6"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWM6"
FT                   /protein_id="ABQ76286.1"
FT                   /translation="MGQCFFCQGIQTVTANNPLLQSHDLPPFSQIRAEHVLPAIEAILA
FT                   DNRKAIAEILEKQGKNPTWAGLVLAMDELNDRLGAAWSPVSHLNAVCNSAELREAYESC
FT                   LPALSAYSTELGQNRALFEAYQALINSPEAAGFDVAQKTILEHALRDFRLSGIDLPADK
FT                   QQRYAEVQSKLSELGSRFSNQLLDATQAWTKHVTDEAALAGLTDSAKAQMAAAAQAKGL
FT                   DGWLITLEFPSYYAVMTYASDRALREELYAAYCTRASDQGPNAGQFDNGPVMREILDLR
FT                   QELAELLGYKNYAELSLATKMAESSDQVLSFLRDLAKRSKPFAAQDLQQLKAYAAEQGC
FT                   PELASWDAGYFGEKLREQRYSVSQEALRAYFPIDKVLGGLFSIVQRLYGIEIAELKGFD
FT                   SWHPDVRLFEIKENGQHVGRFFFDLYARANKRGGAWMDGARDRRRTAGGQLQSPVANLV
FT                   CNFTPAAPGKPALLTHDEVTTLFHEFGHGLHHMLTRIEHAGVSGINGVAWDAVELPSQF
FT                   MENWCWEPEGLALISGHYETGAALPQDLLDKMLAAKNFQSGMMMVRQLEFSLFDFELHA
FT                   SHGDGRSVLQVLEGVRDEVSVMRPPAYNRFPNSFAHIFAGGYAAGYYSYKWAEVLSADA
FT                   FSRFEEEGVLNAETGRAFREAILARGGSREPMELFVDFRGREPSIDALLRHSGLTEDAA
FT                   A"
FT   gene            114760..115041
FT                   /locus_tag="Pput_0112"
FT   CDS_pept        114760..115041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0112"
FT                   /product="nucleic-acid-binding protein containing a
FT                   Zn-ribbon domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76287"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWM7"
FT                   /protein_id="ABQ76287.1"
FT                   /translation="MSEVAVNKTKKRFIAGAVCPACSEPDKLMMWNDDGVPHRECVACG
FT                   FTDTLNEQGLSVPKELGTRVNHLAPKAAPAKVQTVQFFPNPKLKKPAE"
FT   gene            115166..117160
FT                   /locus_tag="Pput_0113"
FT   CDS_pept        115166..117160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0113"
FT                   /product="peptidase M3A and M3B, thimet/oligopeptidase F"
FT                   /note="PFAM: peptidase M3A and M3B, thimet/oligopeptidase
FT                   F"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76288"
FT                   /db_xref="GOA:A5VWM8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWM8"
FT                   /protein_id="ABQ76288.1"
FT                   /translation="MANPLLQDSHIPVDYSSITLENMQAAFAHVLQAHENGVERIIRDQ
FT                   RTMPTWDDMVLALDGLDSRLLAVLYAASPLVGRDTAWANVIIDFYRKVTARFEQKFANT
FT                   GLHDLYARLAGSDIGKQLDVGKRATLRWHLDKFAASGALLDTAGKAHLADLQAQIGTAR
FT                   EAFRSNIDRPGLNITDEAELSGIPQRVRDELAASAQQAGKQGWLIACDTVTTREVLKHA
FT                   ANRQFRERVYRAFHARGVSHDRQQDNSWYLQQLAQLLEEKALLLGYSGHLEQSLQVKSA
FT                   GSVDQVRGFLHDLADHVRPAMLRWRSQVECWAAEQGLGKPQPWDFEYLRCASRSVFPAE
FT                   ALRDYFPLNTVVSALQQLAQTLFGAVLQPKALPVWDDSVQPFEVWQDSAFIGFLYLDAV
FT                   QHAGKLPDAVFTTYVRNRRVDAEGICQAASVVVFSDVPQALSGSQPLLNHLSLRKLFHE
FT                   FGHALHHLLVRTTNHVMSNVTELGTDGVELFGKLFERWVWDADYLVAISARTHDGRQLS
FT                   RKQANECLRQLRQQGVEEIAGDLCLALFDMDLHGTPNDGRTFEQRLGDARARCGYWPLA
FT                   DFEHPAHAFDHLVNGYDAGYYAYLWSDVHAFDVFTRFEAEGLLNGATGRALQEALFAPG
FT                   ASRPLREGIEAFLGRQSSQAAYLSWHGLR"
FT   gene            117231..118289
FT                   /locus_tag="Pput_0114"
FT   CDS_pept        117231..118289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0114"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76289"
FT                   /db_xref="GOA:A5VWM9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWM9"
FT                   /protein_id="ABQ76289.1"
FT                   /translation="MIPPAPQKGRGTAHNPHNRFAPGHSVAEDDGWYQEVPQTQGTEVR
FT                   IETAKSVISRNTSPDLPFDRSINPYRGCEHGCIYCYARPSHAYWDLSPGLDFETKLIAK
FT                   TNAAEVLAQQLSKPGYVCAPINLGSNTDPYQPIEREQLLTRRLLEVLLRFRHPVTIVTK
FT                   GSLVLRDLDLLAEMARQRLARVMISLTTLDDGLKRVLEPRAASPGARLRAIRVLREAGV
FT                   PVGVLCSPMIPMINDSELERLLEAAKEAGAQSAAYMMLRLPLEVAPLFEQWLQDHYPQR
FT                   AAHVLSLIRQSRGGELYDSRFGVRMRGEGVFAELLAQRFAKAMKRLDFEGREAQALDCS
FT                   AFCPPGGQMALF"
FT   gene            118593..119312
FT                   /locus_tag="Pput_0115"
FT   CDS_pept        118593..119312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0115"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76290"
FT                   /db_xref="GOA:A5VWN0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWN0"
FT                   /protein_id="ABQ76290.1"
FT                   /translation="MPVKDPSKVVPQVPAESADAALKHIVDGFLRFHHDVFPDQQELFK
FT                   KLATAQTPRAMFITCADSRIVPELITQSSPGDLFVTRNVGNVVPPYGQMNGGVSSAIEY
FT                   AVMALKVHHIIICGHSDCGAMRAVLNPQSLTKMPTVGAWLRHAEVARTVVENNCSCGSE
FT                   HETMQVLTKENVIAQLHHLRTHPSVASRLAAGELFIHGWVYDIETSKIEAYDAASDSFL
FT                   PLAAGEPVPCATPRGRY"
FT   gene            119505..121037
FT                   /locus_tag="Pput_0116"
FT   CDS_pept        119505..121037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0116"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76291"
FT                   /db_xref="GOA:A5VWN1"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWN1"
FT                   /protein_id="ABQ76291.1"
FT                   /translation="MNITQLKAALPRELLASVVVFLVALPLCMGIAIASGMPPAKGLIT
FT                   GIIGGIVVGFLAGSPLQVSGPAAGLAVLVFELVRQHGMAMLGPILLLAGLLQLLAGRLR
FT                   LGCWFRVTAPAVVYGMLAGIGVLIVLSQVHVMFDTAPQPSGLQNLLAFPATLSAALPQE
FT                   STGAGWMAGALGLGTIAIMWGWERLRPQRLRFVPGALLGVASMTAISLWLALPVNRVQV
FT                   PADLSEAIDWLRPADLMQLADPALLVAAFALAFIASAETLLSAAAVDRMHSGQRSDFDR
FT                   ELSAQGIGNMLCGVLGALPMTGVIVRSSANVQAGAQTRASAIFHGLWLLAFVVALSSVL
FT                   QQIPVASLAGVLVFTGVKLVDFKAFRGLGRYGRMPMFTYAATALAIIFTDLLTGVLLGF
FT                   ALTLLKLAFKAARLKINLVSLAKDGHMELRLSGAATFLKVPALTQVLDTVPAGTTLHVP
FT                   LGNLSYIDHSCLELLEDWSRSNSANGSRLLIEQRRLKRRIEGRLRTTAGVGA"
FT   sig_peptide     119505..119609
FT                   /locus_tag="Pput_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.909 at
FT                   residue 35"
FT   gene            complement(121015..121185)
FT                   /locus_tag="Pput_0117"
FT   CDS_pept        complement(121015..121185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76292"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWN2"
FT                   /protein_id="ABQ76292.1"
FT                   /translation="MPPPSITRIGGSAQAIVGAGSPAKGPALLANPHPPITVAAATVFA
FT                   GKPAPTPQPPP"
FT   gene            complement(121297..121938)
FT                   /locus_tag="Pput_0118"
FT   CDS_pept        complement(121297..121938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76293"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWN3"
FT                   /protein_id="ABQ76293.1"
FT                   /translation="MNIAAVREQVSQAHQHEGQTGQLKQRLELQLPHLHPSIQLPEQDA
FT                   QGTLARFVSAYIDQVPELLEAAHEVAREAGIESQIKPVLKIAEAYFLQPPSVMQGHVGL
FT                   DCLLDEAYLAHRLVEEVNDLYIRHFQQPLIPVDTTVANLIAHQLIGESFANQLDEVVHH
FT                   SVDEMLNDESFAVESVEAYREKLSSPATGEAWKRWPCLSRQLGVELGQPA"
FT   gene            122308..123435
FT                   /locus_tag="Pput_0119"
FT   CDS_pept        122308..123435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0119"
FT                   /product="Cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: Cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase, subunit II; cytochrome c, class I;
FT                   cytochrome C oxidase subunit II, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76294"
FT                   /db_xref="GOA:A5VWN4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWN4"
FT                   /protein_id="ABQ76294.1"
FT                   /translation="MMRHPHVWMGLLLWSVFGQANAAWTVNMHPGATEVSNAVFDLHMT
FT                   IFWICVIIGIVVFGAMFWSMVIHRRSTGQQAAHFHEHTWVEILWTVVPFLILVAMAIPA
FT                   TKTLIDIYDASDSDIDIQVTGYQWKWHYKYLGQDVEFFSNLATPTDQIHNKAPKDEHYL
FT                   LEVDQPLVLPVGAKVRFLVTAADVIHSWWVPAFAVKRDAIPGFVNEAWTRIEKPGIYRG
FT                   QCTELCGKDHGFMPVVVEVKSKADYDTWLGERKAEAAKLKELTSKEWTLEELVARGDKV
FT                   YHTTCVACHQAEGQGLPPMFPALKGSKIATGPKEDHLSIVFHGKPGTAMAAFGKQLSEV
FT                   DIAAVVTYERNAWGNNKGDMVTPKDVLALKQAEAK"
FT   sig_peptide     122308..122376
FT                   /locus_tag="Pput_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            123479..125068
FT                   /locus_tag="Pput_0120"
FT   CDS_pept        123479..125068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0120"
FT                   /product="Cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="TIGRFAM: Cytochrome c oxidase, subunit I bacterial
FT                   type; PFAM: cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76295"
FT                   /db_xref="GOA:A5VWN5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWN5"
FT                   /protein_id="ABQ76295.1"
FT                   /translation="MSAVIDDHAHGHDHAHGPAKGLMRWVLTTNHKDIGTMYLWFSFIM
FT                   FLLGGSFAMVIRAELFQPGLQIVEPAFFNQMTTMHGLIMVFGAVMPAFVGLANWMIPLM
FT                   IGAPDMALPRMNNFSFWLLPAAFLLLVSTLFSPGGGPNFGWTFYAPLSTTYAPASVTFF
FT                   IFAIHLMGISSIMGAINVIATILNLRAPGMTLMKMPLFVWTWLITAFLLIAVMPVLAGV
FT                   VTMMLMDIHFGTSFFSAAGGGDPVLFQHVFWFFGHPEVYIMILPAFGAVSSIIPAFSRK
FT                   PLFGYTSMVYATGAIAFLSFIVWAHHMFVVGIPVVGELFFMYATMLIAVPTGVKVFNWV
FT                   STMWEGSLTFETPMLFAIAFVILFTIGGFSGLMLAIAPADFQYHDTYFVVAHFHYVLVP
FT                   GAIFGIFASAYYWLPKWTGHMYDETLGKLHFWLSFIGMNMAFFPMHFVGLAGMPRRIPD
FT                   YNLQFADFNMVSSIGAFMFGATQIFFLFIVIKCIRGGAPAPAKPWDGAEGLEWSIPSPA
FT                   PYHTFQTPPEVK"
FT   gene            125078..125644
FT                   /locus_tag="Pput_0121"
FT   CDS_pept        125078..125644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0121"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76296"
FT                   /db_xref="GOA:A5VWN6"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWN6"
FT                   /protein_id="ABQ76296.1"
FT                   /translation="MNGLSVKRLVTRLLMLTVVMFAFGFALVPIYDVMCKAFGINGKTG
FT                   GQYEGSQVSDPTRAVRVQFMSTNASDMVWDFYSTADQLEVNPGAVNQMIFIAHNPTDRP
FT                   MSAQAIPSITPAEAAAYFHKTECFCFTQQVLQPGERIEMPVRFIVDRDLPASVKHLTLA
FT                   YTLFDITARHPPVAHVAAQDVQGAR"
FT   sig_peptide     125078..125158
FT                   /locus_tag="Pput_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.833) with cleavage site probability 0.555 at
FT                   residue 27"
FT   gene            125661..126548
FT                   /locus_tag="Pput_0122"
FT   CDS_pept        125661..126548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0122"
FT                   /product="cytochrome c oxidase, subunit III"
FT                   /note="PFAM: cytochrome c oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76297"
FT                   /db_xref="GOA:A5VWN7"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWN7"
FT                   /protein_id="ABQ76297.1"
FT                   /translation="MASHEHYYVPAQSKWPIIATIGMFITVFGLGTWFNDMKAGHPDSH
FT                   GPLIFFVGALFLAYMLFGWFGAVVKESHAGLYSPQLDRSFRWGMSWFIFSEVMFFLAFF
FT                   GALFYVRVLAGPWLGGEGAKGVTHMLWPTFEFTWPLLHTPDPKLFPPPKEVIDPWHLPL
FT                   INTILLVSSSVTITIAHHALRRDHRGPLKFWMALTIVLGISFIALQAFEYHEAYTKLGL
FT                   TLGSGIYGATFFMLTGFHGAHVTLGTIILIVMFVRILRGHFNPEKHFGFEAASWYWHFV
FT                   DVVWVGLFIFVYVL"
FT   gene            complement(126576..126779)
FT                   /locus_tag="Pput_0123"
FT   CDS_pept        complement(126576..126779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76298"
FT                   /db_xref="GOA:A5VWN8"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWN8"
FT                   /protein_id="ABQ76298.1"
FT                   /translation="MLKAAIVLMLLATIASLFSGLVFLVKDDENSTRLLKALTVRVTLA
FT                   ALTIGLVAWGLISGQLVSHAPF"
FT   sig_peptide     complement(126705..126779)
FT                   /locus_tag="Pput_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.685 at
FT                   residue 25"
FT   gene            126807..127568
FT                   /locus_tag="Pput_0124"
FT   CDS_pept        126807..127568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0124"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76299"
FT                   /db_xref="GOA:A5VWN9"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWN9"
FT                   /protein_id="ABQ76299.1"
FT                   /translation="MDKYSEAPVRPFRPGWVPTLVVLALLPGLIALGCWQLGRAEEKRV
FT                   LLATYAERRIEAPIATAQLLSKEDNAFRRVHLYGRFDAEHSVLLDNRMRDGKAGVELLQ
FT                   PFHDQASGLWLLINRGWLPWLDRRVPVHFETPAQALALDASVYVAPGSTFQLHPDPIGG
FT                   QWPHLLTAIDVAQLWQQLDREGFAQELRLEPGPASYRLDWPVVAMSPEKHVGYAVQWFA
FT                   LATALVLLYLYFGWHKNKEKRHGHRHSTGRA"
FT   gene            127537..128118
FT                   /locus_tag="Pput_0125"
FT   CDS_pept        127537..128118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76300"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWP0"
FT                   /protein_id="ABQ76300.1"
FT                   /translation="MATATPLDAPERSKPRARGRLQLLLILLVVLGPMVLATSMYKLKF
FT                   WVPEGRSYHGAMIGNGESRADLGVAGQDERWQLLVSAPQACTEDCQRLVYLARQIQVGL
FT                   GRDASRASHALAAAQPLSADYQALLGREYPQLQRYPLDAQRYQQKVAEPGPQLWIVDPH
FT                   GNLVLRYDGKVNGKHVLDDLRHLLKLSNIG"
FT   gene            128128..129207
FT                   /locus_tag="Pput_0126"
FT   CDS_pept        128128..129207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0126"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76301"
FT                   /db_xref="GOA:A5VWP1"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWP1"
FT                   /protein_id="ABQ76301.1"
FT                   /translation="MARPGFRLAVFATLLALLVVLLGAYTRLTHAGLGCPDWPGCYGFI
FT                   SVPKSEAQLAHAELHFPEHPVEAAKGWAEMVHRYFAGSLAVVIALLAFQAMRRHARDGQ
FT                   PYRLPMLLLGVVLAQAAFGMWTVTLKLWPQVVTAHLLGGFTTLSLLFLLSLRLSRAFAP
FT                   LPKLPLSLRRIAALALLVVIGQIALGGWVSANYAAVACIDLPTCHGQWWPAADFSNGFH
FT                   LTQHVGPNYLGGQLDSDARTAIHISHRLGALLVTCVLLMLSWKLHRCGLPGLARLVLLA
FT                   LALQVGLGISNVVFHLPLAVAVAHNAGGAMLLLSMVLVNYRIRVVDKVRMGVGHGWRLR
FT                   PVVGVGISHHMRNDSWRRF"
FT   sig_peptide     128128..128223
FT                   /locus_tag="Pput_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.979) with cleavage site probability 0.596 at
FT                   residue 32"
FT   gene            129192..130085
FT                   /locus_tag="Pput_0127"
FT   CDS_pept        129192..130085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0127"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76302"
FT                   /db_xref="GOA:A5VWP2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWP2"
FT                   /protein_id="ABQ76302.1"
FT                   /translation="MATLLSVRRARWRDYLELTKPKVVVLMLITSLAGMFLATRAGVSW
FT                   SVLLFGNLGIGLCAGGAAVVNHVVDRRIDALMARTHKRPLAQGRVEPLPALLFALALAL
FT                   LGMVLLLVFTNALTAWLTLASLLGYAVLYTGFLKRATPQNIVIGGLAGAAPPLLGWVAV
FT                   SGHVSAEPLLLVLIIFAWTPPHFWALAIHRKEEYAKADIPMLPVTHGERYTKLHILLYT
FT                   LILLAVSLLPYAIHMSGPLYLACALGLGLRFLHWAWVLYRSSRPHAAIGTFKYSIGYLF
FT                   ALFIALLLDHYLLLSL"
FT   sig_peptide     129192..129317
FT                   /locus_tag="Pput_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.912) with cleavage site probability 0.874 at
FT                   residue 42"
FT   gene            130082..130714
FT                   /locus_tag="Pput_0128"
FT   CDS_pept        130082..130714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0128"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76303"
FT                   /db_xref="GOA:A5VWP3"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWP3"
FT                   /protein_id="ABQ76303.1"
FT                   /translation="MTRTQKTVFILVALVALILGLTVNKVLNGRDQPNPAELIDAGIIL
FT                   LPQSRAVADVTMTNQDGQPVQMDDLKGKWSLLFFGYTYCPDICPTTLAQLRQVKSELPK
FT                   DTVDRLQVVLVSVDPNRDTPNQLKQYLGYFDKDFVGVAGSIEDTQKLANALSIPFIPAD
FT                   TSKPGYTVDHSGNLAIVGPDGRQRGFIRAPFNNQKLGAQLPGLVKRD"
FT   sig_peptide     130082..130159
FT                   /locus_tag="Pput_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.945) with cleavage site probability 0.535 at
FT                   residue 26"
FT   gene            complement(130844..131614)
FT                   /locus_tag="Pput_0129"
FT   CDS_pept        complement(130844..131614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0129"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76304"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWP4"
FT                   /protein_id="ABQ76304.1"
FT                   /translation="MKKLLAVAAAVAAFSAQADTLTVAATPVPHAEILNFVKPQLAKEG
FT                   VELKVKEFTDYIQPNVQVAEKRLDANFFQHQPYLDEFNKAKGTQLVSVAGVHIEPLGVY
FT                   SSKIKKLDELSSGATVVIPNDATNGGRALLLLDKAGVIKLKDNKNILSTVKDVAENPKN
FT                   VKFRELEAATIPRVLTQVDAALINTNYALEAKLNPEKDALAIEGSDSPYVNILVARPDN
FT                   KDSDDMKKLAAALHSPEVKQFIIEKYKGAVVPAF"
FT   sig_peptide     complement(131558..131614)
FT                   /locus_tag="Pput_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(131679..132350)
FT                   /locus_tag="Pput_0130"
FT   CDS_pept        complement(131679..132350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0130"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76305"
FT                   /db_xref="GOA:A5VWP5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWP5"
FT                   /protein_id="ABQ76305.1"
FT                   /translation="MDALNFFANVDWAEIWLATVDTMIMLFGSLFFTVLLGLPLGVLLF
FT                   LCGPKQMFEQKGVYALLSLVVNILRSLPFIILLIVMIPFTVLITGTSLGVAGAIPPLVV
FT                   GATPFFARLVETALREVDRGIIEATQSMGATTRQIITSALLPEARPGIFAAITVTAITL
FT                   VSYTAMAGVVGAGGLGDLAIRFGYQRFQTDVMVVTVVLLLVLVQVLQSVGDKLVVHFSR
FT                   K"
FT   gene            complement(132350..133357)
FT                   /locus_tag="Pput_0131"
FT   CDS_pept        complement(132350..133357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0131"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76306"
FT                   /db_xref="GOA:A5VWP6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWP6"
FT                   /protein_id="ABQ76306.1"
FT                   /translation="MIEFQQVHKTYRVAGREIPALNPTSLTIEDGQVFGLIGHSGAGKS
FT                   TMLRLINRLEEPSGGTIIVDGEDVTAFNASQLRGFRQQVGMIFQHFNLLASKTVADNVA
FT                   LPLTLAGELSRSEIDKRVTELLARVGLSDHAKKYPAQLSGGQKQRVGIARALSTNPKIL
FT                   LCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDVIRRVCDRVAVMDAGQIVE
FT                   QGSVAEVFLHPQHPTTKRFVQEDEQVDEGEQRDDFAHVPGRIVRLTFQGDATYAPLLGT
FT                   VARETGVDYSILAGRIDRIKDVPYGQLTLALIGGDMEAAFARFKAADVHMEVLR"
FT   gene            133585..135720
FT                   /locus_tag="Pput_0132"
FT   CDS_pept        133585..135720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0132"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76307"
FT                   /db_xref="GOA:A5VWP7"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWP7"
FT                   /protein_id="ABQ76307.1"
FT                   /translation="MPSKKTDAPKHSEAAGTQTPDRANTNAKLQSLEADRSDATGHALR
FT                   TNQGVRIADNQNSLKAGDRGPSLLEDFIMREKITHFDHERIPERIVHARGTGAHGFFQS
FT                   YGNHAELTKAGFLQDPEKITPVFVRFSTVQGPRGSGDTVRDVRGFAVKFYTDEGNFDLV
FT                   GNNMPVFFIQDAIKFPDFVHAVKPEPHNEIPTGGSAHDTFWDFVSLVPESAHMVMWAMS
FT                   DRAIPRSLRMMEGFGVHTFRLINAEGVASFVKFHWKPRQGVHSLLWDEAQKLAGKDTDF
FT                   QRRDLWEAIETGDYPEWELGVQIVPEADEHKFDFDLLDPTKIIPEELVPVTPLGKMVLN
FT                   RNPDNFFAEVEQVAFCPGHIVPGIDFTNDPLLQGRLFSYTDTQISRLGGPNFHQIPINR
FT                   PVAPNHNNQRDALHQHVVHKGRASYEPNSIDGGWPKETPPAAQDGGFESYQERIDAHKI
FT                   RQRSESFGDHFSQARLFFQSMSPTEQQHIIKAYSFELGKVEREHIRAREVNEILANIDL
FT                   KLAAAVAANLGLPAPKAGTVKVKGSQLAQSPALSQMNHPGSVGIKGRKIAVLVADGVDA
FT                   ASVDKLVKALEAHSARPMLLGPTSAPVKAADGKQLPVAASMEGMPSIMFDGIVVPAGKA
FT                   STDALAASGLAKHFVLEGYKHLKALVLTKELAKALGLKEDKGLLLGDEQKAVDAFVKAV
FT                   EGHRVWEREAAAEAVPA"
FT   gene            complement(135781..136488)
FT                   /locus_tag="Pput_0133"
FT   CDS_pept        complement(135781..136488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76308"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWP8"
FT                   /protein_id="ABQ76308.1"
FT                   /translation="MKPFASRYLLVAAFSLILAACSNAPVEQATAPAQADAWQQLQQNI
FT                   ASNELATAEDQLAALQAQSPDDARLEQYQRQLAEAYLQRSQIVLQKGDVNAAATALARA
FT                   RALMPQAPAVTGGDAVTQARKAELEKAEAALKAAEAKPKARIIDPTAPSTVVALKTTDS
FT                   RALRRQLDDIAADVVSYQCEVVFQVPRTEDAPWLKTLLEKRVRKIDSGFELKQKHQIQR
FT                   SLPAQVVLVPHQQ"
FT   sig_peptide     complement(136402..136488)
FT                   /locus_tag="Pput_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.593 at
FT                   residue 29"
FT   gene            complement(136615..137397)
FT                   /locus_tag="Pput_0134"
FT   CDS_pept        complement(136615..137397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0134"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76309"
FT                   /db_xref="GOA:A5VWP9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWP9"
FT                   /protein_id="ABQ76309.1"
FT                   /translation="MADFLLYALLAGLSLALVAGPLGSFVVWRRMAYFGDTLSHAALLG
FT                   VALGFALDVSPALAVTVGCLLLAILLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFM
FT                   HDVRIDLMAYLFGDLLAISTTDLAWILGGSALVLLLLAVLWRPLLAVTVHEELAMVEGL
FT                   PVAGLRMALMLLIAVVIAVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGV
FT                   TAVCGGLAMSWFKDTPAGPSIVVCAAVLFLLSLALPKR"
FT   sig_peptide     complement(137338..137397)
FT                   /locus_tag="Pput_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.828 at
FT                   residue 20"
FT   gene            complement(137390..138163)
FT                   /locus_tag="Pput_0135"
FT   CDS_pept        complement(137390..138163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0135"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76310"
FT                   /db_xref="GOA:A5VWQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWQ0"
FT                   /protein_id="ABQ76310.1"
FT                   /translation="MSDALIRLEQVGVTFGGEAVLDSIDLSVAPGQIVTLIGPNGAGKT
FT                   TLVRAVLGLLKPHRGKVWRKPKLRIGYMPQKIQVDATLPLSVLRFLRLVPGVDRVAALS
FT                   ALQEVGAEQVIDSPIQTISGGEMQRVLLARALLREPQLLVLDEPVQGVDVVGQTELYNL
FT                   ITRLRDRHGCGVLMVSHDLHLVMSATDQVVCLNRHVCCSGHPEQVSGDPAFVELFGKTA
FT                   PSLAIYHHHHDHSHDLHGSVVAPGTHVHGEHCKHG"
FT   gene            complement(138160..138645)
FT                   /locus_tag="Pput_0136"
FT   CDS_pept        complement(138160..138645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0136"
FT                   /product="putative ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76311"
FT                   /db_xref="GOA:A5VWQ1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWQ1"
FT                   /protein_id="ABQ76311.1"
FT                   /translation="MSITPLANRPHDHSHCVHSALAEADALCTRQGLRLTALRRRVLEL
FT                   VWQSHKPLGAYDILAVLSEQDGRRAAPPTVYRALDFLLENGLVHRIASLNAFIGCSHPE
FT                   HVHQGQFLICRACHVAIELEQSSISEAIINSAKGVSFTVETQTVEVVGLCGNCRSAA"
FT   gene            138712..139620
FT                   /locus_tag="Pput_0137"
FT   CDS_pept        138712..139620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0137"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76312"
FT                   /db_xref="GOA:A5VWQ2"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWQ2"
FT                   /protein_id="ABQ76312.1"
FT                   /translation="MSRFLALFVAFIALSAQADVRVLTSIKPLQQIAAAVQEGVGSPDV
FT                   LLPPGASPHHYALRPSDVRRVGDADLLYWIGPDMENFLPRVLGSRSKATVAVQSLPGMK
FT                   LRHFGEDSHSHEEEDHDDHDHDHRPGSLDAHLWLSSVNARVIAAKMAADLAQVDPANAA
FT                   RYQSNLKAFDERLDALDGRIKARVAGIAGKPYFVFHEAFDYFEAEYGLKHAGVFSVASE
FT                   VQPGAQHVAAMRKRLQEVGKTCVFSEPPLRPRLAETLTAGLPVRLAELDALGGTDPVDG
FT                   KGYERLLEKLGGDLAGCLEQL"
FT   sig_peptide     138712..138768
FT                   /locus_tag="Pput_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 19"
FT   gene            complement(139732..140682)
FT                   /locus_tag="Pput_0138"
FT   CDS_pept        complement(139732..140682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0138"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="TIGRFAM: homoserine kinase; PFAM: aminoglycoside
FT                   phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76313"
FT                   /db_xref="GOA:A5VWQ3"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWQ3"
FT                   /protein_id="ABQ76313.1"
FT                   /translation="MSVFTPVTRPELETFLAPYELGRLLDFQGIAAGTENSNFFVSLEQ
FT                   GEFVLTLIERGPSEDMPFFIELLDTLHGADMPVPYAIRDRDGNGLRELCGKPALLQPRL
FT                   SGKHIKAPNNQHCAQVGELLAHIHLATREHIIERRTDRGLDWMLASGVELLPRLTAEQA
FT                   ALLQPALDEISAHKAQILALPRANLHADLFRDNVMFEGTHLTGVIDFYNACSGPMLYDI
FT                   AITVNDWCLDEQGAVDVPRAQALLAAYAALRPFTAAEAELWPEMLRVGCVRFWLSRLIA
FT                   AESFAGMDVMIHDPSEFEVRLAQRQQVALHLPFAL"
FT   gene            complement(140752..141039)
FT                   /locus_tag="Pput_0139"
FT   CDS_pept        complement(140752..141039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76314"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWQ4"
FT                   /protein_id="ABQ76314.1"
FT                   /translation="MRTLNRLLLLGLLATTPVVTLAADDAPSADPEVTIRTEGDKTIQE
FT                   YRQNGFLYAIKITPKNGKPYFLVRADGTDANFIRSDQPDMLIPSWKIFEW"
FT   sig_peptide     complement(140971..141039)
FT                   /locus_tag="Pput_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.941 at
FT                   residue 23"
FT   gene            141115..143862
FT                   /locus_tag="Pput_0140"
FT   CDS_pept        141115..143862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0140"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase I; PFAM: DNA-directed DNA
FT                   polymerase; 5'-3' exonuclease; 3'-5' exonuclease; SMART:
FT                   Helix-hairpin-helix domain protein, class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76315"
FT                   /db_xref="GOA:A5VWQ5"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWQ5"
FT                   /protein_id="ABQ76315.1"
FT                   /translation="MSQAPLVLVDGSSYLYRAFHALPPLTTSKGMPTGAVKGVLNMLKS
FT                   LRKQYPDSLFAVVFDAKGGTFRDAMFAEYKANRPSMPDDLRVQIEPLHASVKALGYPLL
FT                   CVEGVEADDVIGTLARSSAALGRPVIISTGDKDMAQLVDGHITLVNTMTGSVLDVAGVH
FT                   EKFGVGPEHIIDFLALMGDKVDNIPGVPGVGEKTAVGLLTGIGGGLSDLYANLDKVPTL
FT                   AIRGAKTLPAKLEEHRDAAFLSYELATIKVDVPLDVEVEALVCGEPDREALLALYTEME
FT                   FKSWVAEVQRDAAKAGDDVGPAVEPAAKVEPKYETILDQARFDAWLEKLRQAPLFAFDT
FT                   ETTGLDAQQAQLVGLSFAVEPHEAAYVPLAHDYEGAPVQLDREAVLLALKPLLEDPAKA
FT                   KVGQNAKYDINILANGSPPIEMRGVAYDTMLESYVLNSTATRHDMDSLAQKYLDHTTIA
FT                   FEDIAGKGAKQLTFNQITLDKAGPYAAEDADITLRLHHALQARLAQTPSVQPVLMDIEM
FT                   PLVPVLARIERQGALVDAELLKVQSGELGVKMAELELRAYELAGETFNLGSPKQLGTIL
FT                   YDKLGMPVLSKTAKGQPSTAEAVLDELAEQGYPLPEVLMQYRSLSKLKSTYTDKLPGQI
FT                   NPRTGRIHTSYQQAVAATGRLSSSDPNLQNIPIRTAEGRRIRQAFIASPGYKLLAADYS
FT                   QIELRIMAHLAKDEGLLHAFRNDLDVHRATAAEVFGVALEDVTTDQRRSAKAINFGLIY
FT                   GMSAFGLAKQIGVDRKQSQDYIDRYFARYPGVLAYMERTRAQAAEQGFVETLFGRRLYL
FT                   PDINAKNPALRKGAERTAINAPMQGTAADIIKRAMVKVDNWLSESGLDARVILQVHDEL
FT                   VLEVREDLVEQVKDEIRQHMSQAAQLDVPLLVEAGVGANWDEAH"
FT   gene            complement(144265..144897)
FT                   /locus_tag="Pput_0141"
FT   CDS_pept        complement(144265..144897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0141"
FT                   /product="cell division checkpoint GTPase YihA"
FT                   /note="PFAM: GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76316"
FT                   /db_xref="GOA:A5VWQ6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWQ6"
FT                   /protein_id="ABQ76316.1"
FT                   /translation="MQVKNPILGLCQKAKFALSAAKVEQCPDDQGYEVAFAGRSNAGKS
FT                   SALNTLTHASLARTSKTPGRTQLLNFFSLDDERRLVDLPGYGYAKVPIPLKQHWQKHLE
FT                   AYLGSRECLRGVILMMDVRHPMTDFDKMMLDWAKASSMPMHILLTKADKLTHGAGKNTL
FT                   LKVQSEIRKGWGDGVTIQLFSAPKRLGVEDAYRVLADWMELEDKPVI"
FT   gene            145099..145401
FT                   /locus_tag="Pput_0142"
FT   CDS_pept        145099..145401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0142"
FT                   /product="Cytochrome c5-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76317"
FT                   /db_xref="GOA:A5VWQ7"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWQ7"
FT                   /protein_id="ABQ76317.1"
FT                   /translation="MAKWLLAVGMFLPFFSAQATQDPEVLYNRTCAACHTGQLPQAPRR
FT                   GDRAAWEPRLAQGMDVLVKHVTQGFKAMPPRGLCMDCSAEDYRLVILWMSGSPDT"
FT   sig_peptide     145099..145158
FT                   /locus_tag="Pput_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.951 at
FT                   residue 20"
FT   gene            145433..146050
FT                   /locus_tag="Pput_0143"
FT   CDS_pept        145433..146050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0143"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76318"
FT                   /db_xref="GOA:A5VWQ8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWQ8"
FT                   /protein_id="ABQ76318.1"
FT                   /translation="MNKLVVSLLLTLGVAGAATAAQPIKGDAAAGQAKTAVCGACHNPD
FT                   GNSLAPNFPKLAGQGQRYLEKQLHDIKSGKRTVLEMTGMLAAFSDQDLADIAAYFSSQK
FT                   GSVGAADPKLVERGRALFNGGDLEKGMPACTGCHSPNGAGIALAGFPHLGGQHSQYVAK
FT                   QLTDFREGNRTNDGDAMTMRTIAGKLSNHDIEALASYIQGLH"
FT   sig_peptide     145433..145495
FT                   /locus_tag="Pput_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 21"
FT   gene            146202..146834
FT                   /locus_tag="Pput_0144"
FT   CDS_pept        146202..146834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0144"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76319"
FT                   /db_xref="GOA:A5VWQ9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWQ9"
FT                   /protein_id="ABQ76319.1"
FT                   /translation="MRKLILSAALVAASVFGMTAVQAAEPVAGKEYIELSNPVPVSVPG
FT                   KIEVVELFWYGCPHCYHFEPTINPWAEKLPKDVNFKRVPAMFGGPWDAHGQMFLTLEAM
FT                   GVEHKVHAAVFDAIQNQHKRLTDKNDMADFLATQGVDKDKFLATFDSFAIKGQVKQAKE
FT                   LAKKYEITGVPSMVVNGKYRFDLGTAGGPEGVLNVADQLIDKERAAK"
FT   sig_peptide     146202..146273
FT                   /locus_tag="Pput_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            146847..147701
FT                   /locus_tag="Pput_0145"
FT   CDS_pept        146847..147701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0145"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76320"
FT                   /db_xref="GOA:A5VWR0"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWR0"
FT                   /protein_id="ABQ76320.1"
FT                   /translation="MPRFRATRGIGLHEPQVNEHHLQAPGLPEDGRLRLLSFNIQVGIS
FT                   TERYRHYLTRSWQHLLPHNGRAGNLQKIGRLLGDFDLVALQEADGGSLRSGYVNQVEHL
FT                   AHLGAFPYWYQQLNRNLGRFAQHSNGVLSRLKPQLLEDHPLPGPAGRGAILVRFGEGED
FT                   ALIVVMMHLALGAKTRALQLGYIRELIGGYRHQVLMGDMNTHATDLLEHSPLRDLGLVA
FT                   PQVEATFPSWRPQRCLDHILLSSSLTLERVEVLAQPISDHLPVAVEIRLPDALTVDTLP
FT                   VLS"
FT   gene            147729..149666
FT                   /locus_tag="Pput_0146"
FT   CDS_pept        147729..149666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0146"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76321"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWR1"
FT                   /protein_id="ABQ76321.1"
FT                   /translation="MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAE
FT                   GSDKVVDECMKEMRDVIRSDNMDAGLAGLIPRLEKAVLDSEQRRETRMNQVSDALTALV
FT                   GQLQGLPLPSDISRPLKKLAKKLDGGVAQSRELPPLLGELSGLQGRALSALGKPGEETR
FT                   PGFLQRLFGSREEDAQAGAELEPVALPAAEVVPQAAGSAEPSRPDDVDALQPLPAPAAP
FT                   TAEVAEAPELELEAFGPALIETAEMAPAPLPRDKAPLPEAAVSVSEPLAEAEPLQVLEE
FT                   TFGEDGPYALPYAVEPPYSQVAAHIEQTLIGLLDDLSLPERHKAQALEMRERVARGLNW
FT                   YELIPVLDDLAVLMLAITDSGQHEFETYLQQLNERLEGFQSHLHEASAGHADNSTAARE
FT                   LDSQLREHVDGLQSSVQGAADVDSLKHILENRLEGLLLTMDEHKHERDRREQELAGRLQ
FT                   GLSERVASMEHEALGYREHLEEQRQKALLDPLTGLPNRAAWSEQVEREMLDWQENGGHL
FT                   AMAILDLDHFKRINDNYGHLAGDKVLKIVADQLRKRLRGRDFIARFGGEEFVLLLPQTT
FT                   PAVAAQMAEVLRATVEACPFHFKGERVVITTSIGLGAFRSGERSDQVLKRADAALYRAK
FT                   EQGRNRVEHG"
FT   gene            149740..150528
FT                   /locus_tag="Pput_0147"
FT   CDS_pept        149740..150528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0147"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76322"
FT                   /db_xref="GOA:A5VWR2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWR2"
FT                   /protein_id="ABQ76322.1"
FT                   /translation="MLSTLKKTLISFLLLSVAGCSTGLRIDRSHPSANQDNRIQFVVLH
FT                   YTNASLERSLALLTQGEVSSHYLIGDGPATVYQLVDENRRAWHAGDSQWQGRTWLNSSS
FT                   IGIEIVNPGFTDTPNGRVWHPYSEAQIQSLIALLKDIVKRNNIEPRHIIGHSDIAPLRK
FT                   LDPGPLFPWKRLADAGLGIWPDANAVARQQAYFSVNPPSVGWYQQELARFGYQIEQTGV
FT                   LDVATRHVIAAFQMRFRPQRFDGMPDAQTAAMLQVLNRMR"
FT   sig_peptide     149740..149811
FT                   /locus_tag="Pput_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.885) with cleavage site probability 0.573 at
FT                   residue 24"
FT   gene            150719..152326
FT                   /locus_tag="Pput_0148"
FT   CDS_pept        150719..152326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0148"
FT                   /product="EAL domain protein"
FT                   /note="PFAM: EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76323"
FT                   /db_xref="GOA:A5VWR3"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWR3"
FT                   /protein_id="ABQ76323.1"
FT                   /translation="MPSMSAFIALLRQIFYRPWMLATLAALASAAVLLSASIGIALQQM
FT                   KQSESEQMNAQGERFLDRLEQVFGQLREGVDLLQAQPLRGCSPAMLAALQQVGLSSRFI
FT                   YEAAYVDDNVACSNRGDERAFVPLRAPDIQGPTYSYWLNTTTEPNENLAALMLGRGKFL
FT                   VSTSRGHLTDVVDLPPGGSLVVVLDNGARAIPVLGPPQVWPPPSAWSTSHKSLLELSDR
FT                   LIYRMPTKSPDYQLVLIAPRASLPLRMNGMLWLLFPGSVLAACCIGWLVLQLILQRRSM
FT                   SSELQNALRRGELQVLYQPIIELDSRRCVGAEALVRWRRPDGTLTSPDLFIPLAENTGQ
FT                   IRQITDFVLQRVLEQLGQLLRSHPKLYISINLAACDVMVPRIGRVAARLLALHRVAPSQ
FT                   IAFEVTERGLIDVVVARDNLQALRAVGHQVLIDDFGTGYCSLAYLQTLPVDCLKIDKAF
FT                   IDALGHDAASSGVAPHIIRMAHDLHLRVIAEGIEFEDQAVLLNSEGVNYGQGWLFARPL
FT                   NARQFAELVTRGHLPRRV"
FT   sig_peptide     150719..150829
FT                   /locus_tag="Pput_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.286 at
FT                   residue 37"
FT   gene            complement(152341..154122)
FT                   /locus_tag="Pput_0149"
FT   CDS_pept        complement(152341..154122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0149"
FT                   /product="Alginate biosynthesis sensor protein KinB"
FT                   /EC_number="2.7.3.-"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein domain protein; PAS fold-4 domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76324"
FT                   /db_xref="GOA:A5VWR4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038320"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWR4"
FT                   /protein_id="ABQ76324.1"
FT                   /translation="MKWPPMKLRTRLFLSISTLVTVALLGLLLGLVSMLQMATVQQQLV
FT                   RDTTHVLEVGLKLRQNLGEQLMLILDEDTAPESLRLLQENFQDLLNQGLEQGGERTGFS
FT                   KASSNYQAFLQTYRDSATPARSMGADQPLGAAFNQVRTDLIDSHKQALDLITRSEERTR
FT                   DRALLVSGVLGLMGLVVLVLGFITAHNIARRFGQPIEALAKAADQLGKGNFDVTLPVTQ
FT                   AAELNQLTRRFGLMADALRKHQATNVDELLAGQQRLQAVLDSIDDGLLIIDRQGRLEHL
FT                   NPVAQRQLGWNDSRVGSSLVEALQRPELEQQLRQVLRGGSLDRPPDDLNMEVDDESRLL
FT                   TYSLTPVSHPQGPILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAFGLL
FT                   RERVKFPPEARENDLLETIGEEMQRLTQLINDLLNFSRYQSGLQKLELAPCAIDDLLEH
FT                   AQLRFAEHAAHKQIELIKELDPPLPRIQADVAQLDRVLDNLLHNAIRHTANGGRIRLHA
FT                   RRHAERVIISVEDNGEGISYGQQARIFEPFVQVGRKKGGAGLGLALCKEIVQLHGGRMG
FT                   VFSRPGQGTQFYMALPV"
FT   sig_peptide     complement(154006..154122)
FT                   /locus_tag="Pput_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.884 at
FT                   residue 39"
FT   gene            complement(154119..155465)
FT                   /locus_tag="Pput_0150"
FT   CDS_pept        complement(154119..155465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0150"
FT                   /product="Two-component response regulator AlgB"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76325"
FT                   /db_xref="GOA:A5VWR5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWR5"
FT                   /protein_id="ABQ76325.1"
FT                   /translation="MESAQDNQGRILLVDDESAILRTFRYCLEDEGYSVATANSAAQAE
FT                   TLLQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAIDTAVDAIQAGAA
FT                   DYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEVRKPKDGLDSHSPAMMAVLETARQ
FT                   VAITDANILILGESGTGKGELARAIHGWSKRARKACVTINCPSLNAELMESELFGHTRG
FT                   AFTGASESTLGRVSQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVTRRADV
FT                   RILAATNLNLEEMVRESRFREDLLYRLNVITLHLPPLRERSEDILILADRFLARFVKEY
FT                   SRPARGFSDEARTALLNYRWPGNIRELRNVVERASIICPQERVEISHLGMGEQPAGNAP
FT                   RVGAALSLDELERAHIGAVLAASDTLDQAAKTLGIDASTLYRKRKQYNL"
FT   gene            155676..156497
FT                   /locus_tag="Pput_0151"
FT   CDS_pept        155676..156497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0151"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region, bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76326"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWR6"
FT                   /protein_id="ABQ76326.1"
FT                   /translation="MPFSLRTAVLAATLLPMFTPAFADPVQDARLEGALQTALSLNRML
FT                   DSFRIKVEVDGKQARLSGEVENEVERQLAEDVARATRGIEQVENLLQVNTQLVERPLEL
FT                   RAYAQRLEDVTLAAVIRARLLWSRTTEKAPIEVQSSEGVVTLRGKVDSAEAKELAGVVA
FT                   RTTDGVYLVNNLVSLDTAAMAKARETPAGAPTGPQPSDSWIVDKIQSSYRFSRNLDGLN
FT                   LKVASEAGMVRLSGEVVSAEQKTIAVEIARQIIGVRGVDADLLKVATKVEG"
FT   sig_peptide     155676..155747
FT                   /locus_tag="Pput_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            156670..156960
FT                   /locus_tag="Pput_0152"
FT   CDS_pept        156670..156960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76327"
FT                   /db_xref="GOA:A5VWR7"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWR7"
FT                   /protein_id="ABQ76327.1"
FT                   /translation="MNRQSVNRSQSAALPLRQMLTLGMAMLLTLAAGLFYYSLQTARLA
FT                   EQVAAQTALLTQIQATRANTLVKAADWQPAGQAIASPATVEKVVPQERWVF"
FT   sig_peptide     156670..156804
FT                   /locus_tag="Pput_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.919) with cleavage site probability 0.350 at
FT                   residue 45"
FT   gene            157004..157165
FT                   /locus_tag="Pput_0153"
FT   CDS_pept        157004..157165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0153"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76328"
FT                   /db_xref="GOA:A5VWR8"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWR8"
FT                   /protein_id="ABQ76328.1"
FT                   /translation="MLSWAITFLIIAIVAAVLGFGGIAGAATGIAKILFIVFLVLFVAS
FT                   FFFGRGRG"
FT   sig_peptide     157004..157084
FT                   /locus_tag="Pput_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.985 at
FT                   residue 27"
FT   gene            157168..157638
FT                   /locus_tag="Pput_0154"
FT   CDS_pept        157168..157638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0154"
FT                   /product="Inhibitor of vertebrate lysozyme"
FT                   /note="PFAM: Inhibitor of vertebrate lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76329"
FT                   /db_xref="GOA:A5VWR9"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWR9"
FT                   /protein_id="ABQ76329.1"
FT                   /translation="MSRKLRSAVVAALLLGGSAAAMAANDGQVRVDQLLGSDPEYRETW
FT                   QDTLEGEERLPDWVVNLTGSAQEQMSAVTEDGDKYLVGPLCEKQDNCTYKRLIVAFSWD
FT                   KDDAYGMLVEVPEGLPSDKSPTRHAQYRWLGKPDDGMKAMLQEQLKRDPNWY"
FT   sig_peptide     157168..157239
FT                   /locus_tag="Pput_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 24"
FT   gene            158382..159710
FT                   /locus_tag="Pput_0155"
FT   CDS_pept        158382..159710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0155"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76330"
FT                   /db_xref="GOA:A5VWS0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWS0"
FT                   /protein_id="ABQ76330.1"
FT                   /translation="MKKAKLSLAWQIVIGLVLGVAIGALLNHFSAEKAWWISNVLQPAG
FT                   DIFIRLIKMIVVPIVISSLIVGIAGVGDAKKLGSIGLKTIIYFEVVTTIAIVVGLVLAN
FT                   LFHPGAGIDMSTLGTVDISKYQATAAEVQHEHAFIETLLNLIPSNIFAALMRGEMLPII
FT                   FFSVMFGLGLSSLQAELRDPLVRTFQAVSETMFKVTHMIMNYAPIGVFALIAVTVANFG
FT                   FSSLLPLAKLVLLVYFAIAFFAFMVLGLVARLFGFSVIKIMRIMKDELILAYSTSSSET
FT                   VLPRVIEKMEKYGAPKSICSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSWSQQL
FT                   LLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRIMDMARTALNVVG
FT                   NALAALVIARWEGMYDAVKGEQYYASLLAEKQEAAVVGETAKR"
FT   sig_peptide     158382..158453
FT                   /locus_tag="Pput_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.740) with cleavage site probability 0.347 at
FT                   residue 24"
FT   gene            159858..161087
FT                   /locus_tag="Pput_0156"
FT   CDS_pept        159858..161087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0156"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76331"
FT                   /db_xref="GOA:A5VWS1"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWS1"
FT                   /protein_id="ABQ76331.1"
FT                   /translation="MLNGLWLGFFLVAAVSAMAQWLVGGNAGIFAAMVESIFAMAKLSV
FT                   EVMVLLFGTLTLWLGFLKIAEKAGIVEWLAKVLGPLFARLMPEVPPGHPALGLITMNFA
FT                   ANGLGLDNAATPIGLKAMRALQELNPGSTTASNAQILFLVLNASSLTLLPVTVFMYRAQ
FT                   QGAPDPTMVFLPILLATSVSTLVGLLSVAVMQRLRLWDPVVLAYFIPGALLLGGFMAFL
FT                   GTLSAAALASLSSLMGNLTLFGVIMLFLVVGALKRVRVYEAFVEGATEGFDVAKSLLPY
FT                   LVAMLVAVGVLRASGALELALDGIRHAVNWMGLDTRFVEGLPTALVKPFSGSAARAMLI
FT                   ETMQTQGVDSFPALVAATIQGSTETTFYVLAVYFGAVGIQRVRHAVGCALLAEFSGVVA
FT                   AIFVCYWFFT"
FT   sig_peptide     159858..159917
FT                   /locus_tag="Pput_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(161069..161704)
FT                   /locus_tag="Pput_0157"
FT   CDS_pept        complement(161069..161704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0157"
FT                   /product="ABC-type uncharacterized transport system
FT                   auxiliary component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76332"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWS2"
FT                   /protein_id="ABQ76332.1"
FT                   /translation="MNLSLRLLTLAASLSLVSACSILPKSEPVDLYRLPVNQPSRTAPP
FT                   LEWSLRLNKPLASEVLAGPRIAVIPQGDVISSYKGARWSDAAPVLLRNRLLDGFQRDGQ
FT                   VQRLSADDSNLQADYELAGELQAFQSEYRPGGAVEVVIRYDARLVNGRDQRIQASKRFE
FT                   IRQPLADKQVSAVVAGFGQASDQLVGQVVSWTIAQANQAQLKVQVKNQ"
FT   sig_peptide     complement(161645..161704)
FT                   /locus_tag="Pput_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.651 at
FT                   residue 20"
FT   gene            complement(161701..162639)
FT                   /locus_tag="Pput_0158"
FT   CDS_pept        complement(161701..162639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0158"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76333"
FT                   /db_xref="GOA:A5VWS3"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWS3"
FT                   /protein_id="ABQ76333.1"
FT                   /translation="METRAHHVLIGLVTVLVVAGAMLFGLWLAKSSVDDAFKDYEVVFN
FT                   EAVSGLSRGSTVQYNGIKVGDVSTLRLDPKDPRRVLARVRLSADTPVKEDTQAKLTLAG
FT                   VTGNSFIQLSGGTPQSPELKGKDGKLPVIIASPSPISRLLNDSSDLVTNINMLLHNANQ
FT                   MFSEDNIGHLSNTLANLDKTTGAFAGQHGSIAEAIEQLVKVGNQASATLAETQALMRNA
FT                   NGLLGSEGKQAIGSAEQAMQSLAQSTATINNLLQNNSEAIGDGAQSLNQLAPAIRELRE
FT                   TLNALKGISRQLEADPSGYLLGRDNNKEFQP"
FT   gene            complement(162643..163434)
FT                   /locus_tag="Pput_0159"
FT   CDS_pept        complement(162643..163434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0159"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76334"
FT                   /db_xref="GOA:A5VWS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWS4"
FT                   /protein_id="ABQ76334.1"
FT                   /translation="MSGQDCVIEARGICNRFGRQVVHENLDLDLYRGEILAVVGGSGSG
FT                   KSVLLRSIIGLRRPNEGQIKVLGQDLTGLREEQRSLVERRFGVLFQKGALFSSLTVTEN
FT                   VALPLIEHAGLSRSDAEHLAGVKLALAGLPISAADKYPASLSGGMIKRAALARALALDP
FT                   DILFLDEPTAGLDPIGAAAFDQLILTLRDALGLSVFLITHDLDTLYTITDRIAVLSQKK
FT                   VLVAGPLAEVEKTNDTWIQEYFHGPRGRAAEQAATRAGQER"
FT   gene            complement(163431..164564)
FT                   /locus_tag="Pput_0160"
FT   CDS_pept        complement(163431..164564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0160"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76335"
FT                   /db_xref="GOA:A5VWS5"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWS5"
FT                   /protein_id="ABQ76335.1"
FT                   /translation="MEPMTTPSATLDTSCQPACLRITGDWTLAHYANLKRESERLRTQC
FT                   AANTIADLSQLGRLDTAGASLLAELLGSERLSRCTHALPEASQALLKNVYCSVQDYCIP
FT                   VKEPERNVLLLLLERIGCAVGTLWQDSMQLLGFVGVILETLLRRAFQPHRWRFTPVVAH
FT                   IEQTGLDAAPIVALLTFLVGAVVAFLGATVLADFGATIFTVDLVAFSFLREFAVLLTAI
FT                   LMAGRTASAFTAQIGSMKANEEIDAIRTLGLNPMELLVVPRVLALLISLPLLTFVAMIC
FT                   GIVGGAVVCALTLDISPAMFLSLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVS
FT                   GSAESVGAHTTSAVVQSIFVVIVLDAVAALFFMEMGW"
FT   gene            complement(164766..165791)
FT                   /locus_tag="Pput_0161"
FT   CDS_pept        complement(164766..165791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76336"
FT                   /db_xref="GOA:A5VWS6"
FT                   /db_xref="InterPro:IPR016937"
FT                   /db_xref="InterPro:IPR022606"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWS6"
FT                   /protein_id="ABQ76336.1"
FT                   /translation="MPQIPHIVQRVIELLKRYPGIIALGGFLSGIGSFILVDRQAGLAS
FT                   WVAVLMLVSWVWLMLENTLTGLFARTFNREIPQPLLRYATQMIHQETLFFVLPFFFITT
FT                   TWNSGQLVFTGLLGAAGLVSITDPLYYKWLAPRRWLFLALHTLTLFAALLTALPIILHL
FT                   TTAQSFKLALIAAMALSFPSLASSFPINNWRRAVALVLVTLSVGAGGWLLRSWVPPATL
FT                   WMTEVAVSTEVMNRQPGDSLDEIAASRIRSSGLYAYTAINAPRGLNERIYHVWQKDGQE
FT                   VDRIALDIHGGRKEGYRAWTHKQNFPPNPVGKWQVRVLTEDGQVIGVLRFKVVNDAPAG
FT                   S"
FT   gene            complement(165885..167291)
FT                   /locus_tag="Pput_0162"
FT   CDS_pept        complement(165885..167291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0162"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76337"
FT                   /db_xref="GOA:A5VWS7"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWS7"
FT                   /protein_id="ABQ76337.1"
FT                   /translation="MRCLMFVCLLICSLPSFALDRSRVEGYLLPNGLQVILKNGYERDH
FT                   VAIRLVVGVGLDDFDCEQKELPHLLEHLLFSGIDETGEGGLEERLQALGGEWNAYTSSA
FT                   DTTFVIEAPARNQRKVLDLLLAVIRDTTIDAKALTTAKRIIEREDGGHYGHLQRWLDRQ
FT                   DIGHPANDQLATELGLKCPERSNLDDMTLEQVQALRDRWYAANNMTLIMVGGLDRLLPA
FT                   YLERSFGELPATEPEERRNLESISQQAEQRRNLTRGWLGDSVKLHWLFIEPVLDNDHQA
FT                   TLDLLSRYLDWALYDQLRLRNGLSYGPSVQRESFGDTGLLSLNADLERDDIDKAVKVMQ
FT                   ALFDHLRKEGLDPDTFARIKEASIAKESWSTQGNSALADYYWGALNDYTDGRFASPVRK
FT                   LRQVSLEQANEALKDLLKEDGYVRVEKPLLGYDELYGLMALLVGLCLAAGLLRWRRHGP
FT                   ERPSGATRQR"
FT   sig_peptide     complement(167235..167291)
FT                   /locus_tag="Pput_0162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(167322..168980)
FT                   /locus_tag="Pput_0163"
FT   CDS_pept        complement(167322..168980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0163"
FT                   /product="sodium-dependent inorganic phosphate (Pi)
FT                   transporter"
FT                   /note="TIGRFAM: sodium-dependent inorganic phosphate (Pi)
FT                   transporter; Na/Pi-cotransporter II-related protein; PFAM:
FT                   Na+/Pi-cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76338"
FT                   /db_xref="GOA:A5VWS8"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWS8"
FT                   /protein_id="ABQ76338.1"
FT                   /translation="MLTLLNLLSAVTLLVWGTHIVRTGILRVFGSNLRRIISQNMDKRP
FT                   LAFIAGILVTAMVQSSNATAMLVTSFVGQGLMAMTPALAIMLGADVGTALMARVLTFDL
FT                   SWLSPLLIFLGVIFFLSRKQTRAGQLGRVGIGLGLIILALELIVQAAAPITHAQGVKVL
FT                   FASLTGDIMLDALVGAMFAMISYSSLAAVLLTATLAGAELISLPVAIGLVVGANIGSGL
FT                   LAFISTSMQNAAGRRVALGSLLYKLIGLVLIIPVLHPLVAWMDSLSFSPQELVIGFHLL
FT                   YNTLRCLIMLPTVKPMGRLCNVLLPERENGNGQVRPRHLDASALETPSLALANAARETL
FT                   RLGDIVDSLLEAMLGALRGTQTALPQQVRALGEDAEALYSAIKLYLAQMSREDLSEQDN
FT                   RRWAEIIELAINLKLACDLIERMLRKVQQQKTSQRREFSQVGLEELTGLQEQLLANLRL
FT                   GLSVFLSADPESARLLLREKRRFRAQERRLAHAHVSRLQRKVVQSIETSSLHLELIADM
FT                   KRLNSLFCSSAYVVLGGSDTGGLMLDSVPDEARQP"
FT   gene            complement(169263..170033)
FT                   /locus_tag="Pput_0164"
FT   CDS_pept        complement(169263..170033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0164"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76339"
FT                   /db_xref="GOA:A5VWS9"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWS9"
FT                   /protein_id="ABQ76339.1"
FT                   /translation="MEWLTSPEIWVAFFTLTALEIVLGIDNIIMISILVSRMPKHMQPR
FT                   TRIFGLALAMVTRIMLLLSITWVMRLTADLFVVFGQGISGRDLILFFGGLFLLWKSSQE
FT                   IYHGLEGEDENAEEPKGAGGKFFYTIIQIAIIDIVFSLDSVITAVGMVSHVPVMIAAIV
FT                   VAVLVMMLCAGAISNFIDKHPSLKMLALSFLIVVGTVLIAEAFDVHVPKGYVYFAMAFS
FT                   LGVEAINIRMRTAMARKEGKDHEPVKLRKDIPGQ"
FT   gene            complement(170103..171410)
FT                   /locus_tag="Pput_0165"
FT   CDS_pept        complement(170103..171410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0165"
FT                   /product="citrate/H+ symporter, CitMHS family"
FT                   /note="TIGRFAM: citrate/H+ symporter, CitMHS family; PFAM:
FT                   C4-dicarboxylate anaerobic carrier; Citrate transporter;
FT                   TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76340"
FT                   /db_xref="GOA:A5VWT0"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWT0"
FT                   /protein_id="ABQ76340.1"
FT                   /translation="MLTFLGFAMVITFMYLIMTKRLSALIALILVPILFALFGGFSAKI
FT                   GPMMLEGISKLAPTGVMLMFAILYFALMIDSGLFDPAVRKILKLVKGDPLKVSVGTAVL
FT                   ALVVSLDGDGATTYMICCAAMLPMYSRLGMSPRIMAGLIILAGGVMNMTPWGGPTARAA
FT                   SALHVDPSDIFVPMIPAMLFGVLAILAIAYMYGKRERARLGELHLPTDDIDHSEITVSQ
FT                   YPDARRPKLLYFNGALTAALMVALIAGLLPLPVLFMIAFSIAMIVNYPCLQQQKDRIAA
FT                   HAGSVLAVTGLIFAAGIFTGILSGTGMVDAMSKSLLAVIPEALGPYLAVITAIVSMPFT
FT                   FFMSNDAFYYGVLPVLAEAASHYGITPVEMARASIVGQPVHLLSPLVPSTYLLVALAGI
FT                   EFGDHQRFTLKWAVLVCLCIMLGALLMGIFPLFSSL"
FT   sig_peptide     complement(171300..171410)
FT                   /locus_tag="Pput_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.616) with cleavage site probability 0.185 at
FT                   residue 37"
FT   gene            171678..172079
FT                   /locus_tag="Pput_0166"
FT   CDS_pept        171678..172079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0166"
FT                   /product="glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating,
FT                   GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76341"
FT                   /db_xref="GOA:A5VWT1"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWT1"
FT                   /protein_id="ABQ76341.1"
FT                   /translation="MQDVTEGGCHCGALRYRLEGNLTDIAHCHCSICRRVSGGLVVTWL
FT                   TLPRSGFQWLTGEPNCYVAPASCSRYFCGQCGAHVALVTTHSPQTIDVTVATLDHPERV
FT                   RANRHIWVGSRLPWLHLDEDLPSEDEERL"
FT   gene            complement(172118..174064)
FT                   /locus_tag="Pput_0167"
FT   CDS_pept        complement(172118..174064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76342"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWT2"
FT                   /protein_id="ABQ76342.1"
FT                   /translation="MRAWLLGCALTLLGTPALADLQLELQSSGLDPQQAQASQALLNEA
FT                   MGKLPPRFKQQLDRRVRVSWSDNMPADAYGQASLISTLELNRSLLPSLTDGSAATERTD
FT                   RPHGTVREELLATVLHELTHLYDRARLWPSVESSLIARCKRQQGTLGKVGLPEECRGQA
FT                   ERRFTLSDDPRLLDLAGWQQYVGRRGEREQHNGQFVRSPDSYELSSPKEYIAVNMEYFL
FT                   LDPSYSCRRPALYQYLREHFGWAPQQDTCAKGLPFINAGSDFARQPLGEIDPERVYEVD
FT                   YLLAEANQNLVSRWGHSMLRLVICKPGRPRGPDCRLDLDQSLVLSYRAFVNDVQLSSWD
FT                   GLVGNYPSRLFVLPLGQVIDEYTKTELRSLASVPLKLNRDEIENLVRQAAEMHWSYDGN
FT                   YWFLSNNCAVESLKLLRSGTANPRLNDLDSIMPNGLLAVLKGRGLADTSVLDNPREALR
FT                   LGYRFDSYRDRYQAMFEVLRKQLPIKQALVEDWLALNAEQRRSWFAKADLRTSAALLLL
FT                   EQASLRRQLLLAQDEVKQRYLNAAALKDGSINKADATLKQMLANSGFLSRPAELLDSKG
FT                   YGLPQPEERKRLEQVSRERQAQLLRLSTSLDKEVRALLEPSRAKEIAAVETNVKQIGEH
FT                   LRALHKAAGGLQL"
FT   sig_peptide     complement(174005..174064)
FT                   /locus_tag="Pput_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(174070..174390)
FT                   /locus_tag="Pput_0168"
FT   CDS_pept        complement(174070..174390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0168"
FT                   /product="conserverd hypothetical protein"
FT                   /note="TIGRFAM: conserverd hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76343"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWT3"
FT                   /protein_id="ABQ76343.1"
FT                   /translation="MRKPLIAASLGMLLLADLAQAQTLVATSNIIVRAFGRSIDFTSDT
FT                   TTSIRDSKVVREAHDDAASFVASNGDIRGVQLEAAFNTLRERVPEARGASDQVLAEAIL
FT                   AL"
FT   sig_peptide     complement(174325..174390)
FT                   /locus_tag="Pput_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.789 at
FT                   residue 22"
FT   gene            complement(174427..174720)
FT                   /locus_tag="Pput_0169"
FT   CDS_pept        complement(174427..174720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0169"
FT                   /product="conserverd hypothetical protein"
FT                   /note="TIGRFAM: conserverd hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76344"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWT4"
FT                   /protein_id="ABQ76344.1"
FT                   /translation="MRYLLPLLFAAAGMASAHAMDTTTQSLVITGYVTSQVTAAPFDRK
FT                   LVRQARDDAAAFVASDGLIRGARLEAALESLRHNCARHAVGDLELAQAILVQ"
FT   sig_peptide     complement(174661..174720)
FT                   /locus_tag="Pput_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(174810..175127)
FT                   /locus_tag="Pput_0170"
FT   CDS_pept        complement(174810..175127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0170"
FT                   /product="conserverd hypothetical protein"
FT                   /note="TIGRFAM: conserverd hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76345"
FT                   /db_xref="InterPro:IPR012661"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWT5"
FT                   /protein_id="ABQ76345.1"
FT                   /translation="MSRKHLLGAALLLGLAGTANATSFVVTTDAVVGAVAASTDATSDV
FT                   SSSFRDDKIVQAARDDAASFVGTQGAIRGARLESAFVHIRSNMPALQASDAQLAQAILA
FT                   L"
FT   sig_peptide     complement(175062..175127)
FT                   /locus_tag="Pput_0170"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.972 at
FT                   residue 22"
FT   gene            complement(175439..175654)
FT                   /locus_tag="Pput_0171"
FT   CDS_pept        complement(175439..175654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76346"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWT6"
FT                   /protein_id="ABQ76346.1"
FT                   /translation="MERTLSSGLVFESNAQQSNTSLPLRALSTLLLWQRRMTSRRQLAR
FT                   LDSRLLADAGISESQRYEELSKPFWR"
FT   gene            complement(176088..177581)
FT                   /locus_tag="Pput_0172"
FT   CDS_pept        complement(176088..177581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0172"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76347"
FT                   /db_xref="GOA:A5VWT7"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWT7"
FT                   /protein_id="ABQ76347.1"
FT                   /translation="MYRDRIRLSSLHSKVMSAADAAGLIEDGMTVGMSGFTRAGEAKAV
FT                   PHALAERAKQSPLKISLMTGASLGNDLDKQLTEAGVLARRMPFQVDSTLRKAINDGQVM
FT                   FIDQHLSETVEQLRNQQLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQVIVE
FT                   INLSHNTNLEGLHDIYIPTYRPTRTPIPLVKVDDRIGSTAIPIDPAKIVGIVISDQPDS
FT                   PSTVLPPDDETQGIADHLINFLKKEVDAGRMTNKLGPLQAGIGSIANAVMCGLIESPFE
FT                   DLTMYSEVLQDSTFDLIDAGKLSFASGSSITLSTRRNADVFGNLERYKDKLVLRPQEIS
FT                   NHPEVVRRLGIIGINTALEFDIYGNVNSTHVCGTRMMNGIGGSGDFARNAHLAVFVTKS
FT                   IAKGGAISSVVPMVSHVDHTEHDVDILVTEQGLADLRGLAPRERARAIIDNCVHPDYRA
FT                   ALNDYFDRACQRGGHTPHILREALSWHENLEETGRMLAS"
FT   gene            complement(177768..179204)
FT                   /locus_tag="Pput_0173"
FT   CDS_pept        complement(177768..179204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0173"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76348"
FT                   /db_xref="GOA:A5VWT8"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWT8"
FT                   /protein_id="ABQ76348.1"
FT                   /translation="MSMNLVTLLYLVASVCFIQALKGLSHPTTSRRGNLFGMIGMGLAI
FT                   LTTVGLIYKLGAELATAGIGYVIVGLLVGGTAGSIMAKRVEMTKMPELVAFMHSMIGLA
FT                   AVFIAIAAVLEPQSMGIVAAISDPIPTGNRLELFLGAAIGAITFSGSVIAFGKLSGKYK
FT                   FRLFQGAPVQFAGQHKLNLILGLTTIALGLLFTFTGHYSAFTLMLVLAFIMGVLIIIPI
FT                   GGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCKAMNRSFF
FT                   NVILGGFGGDTDTGAAQGSQEQRPVKSGSADDATFLLSNADSVIIVPGYGLAVARAQHA
FT                   LKELTEKLTHNGVTVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINAEFGQADV
FT                   VLVLGANDVVNPAAKNDPKSPIAGMPILEAFKAKTIIVNKRSMASGYAGLDNELFYLDK
FT                   TMMVFGDAKKVIEDMVKAVE"
FT   gene            complement(179207..179521)
FT                   /locus_tag="Pput_0174"
FT   CDS_pept        complement(179207..179521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0174"
FT                   /product="NAD/NADP transhydrogenase alpha subunit-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76349"
FT                   /db_xref="GOA:A5VWT9"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWT9"
FT                   /protein_id="ABQ76349.1"
FT                   /translation="MEDMLISHGIYNLIIFVLAIYVGYHVVWNVTPALHTPLMAVTNAI
FT                   SAIVIVGAMLAAALTVTPAGKLMGTLAVALAAVNVFGGFLVTRRMLEMFKKKTKNEAKK
FT                   "
FT   gene            complement(179533..180654)
FT                   /locus_tag="Pput_0175"
FT   CDS_pept        complement(179533..180654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0175"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76350"
FT                   /db_xref="GOA:A5VWU0"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWU0"
FT                   /protein_id="ABQ76350.1"
FT                   /translation="MHIGVPLETQTGETRVAATPETIKKLIGQGHQVTVQRGAGLNAAI
FT                   PDSAYEAVGASLGSAADAYGAQLVLKVVAPNDQELALINSGSLLVGMLNPFNGELIGKM
FT                   AERGITAFALEAAPRTSRAQSLDVLSSQANIAGYKAVLLAAHYYPRFMPMLMTAAGTVK
FT                   AARVLVLGAGVAGLQAIATAKRLGAVIEASDVRPAVKEQIESLGAKFIDVPYETDEERE
FT                   CAEGVGGYARPMPASWMQRQAQAVHERAKQADIVITTALIPGRKAPTLLSAETVAQMKP
FT                   GSVVIDLAAAQGGNCPLTVADQVVQENGVTIVGPTNLPAQVSADASALYARNLLDFMKL
FT                   LFDKDGALIINLEDDIVAACLMCRDGQIVRKNG"
FT   gene            complement(181074..181991)
FT                   /locus_tag="Pput_0176"
FT   CDS_pept        complement(181074..181991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0176"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76351"
FT                   /db_xref="GOA:A5VWU1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWU1"
FT                   /protein_id="ABQ76351.1"
FT                   /translation="MRRKIPSTAALICFEAAARNESFTKAAQELALTQGAVCRQIGGLE
FT                   AFLNVELFRRSRRGVRLTEAGLSYSRQVAAQLDAVERDTLSVMRQQGANVIELAVVPTF
FT                   GTQWLLPRLKDFQQRHPEVTVNLTNRTRPFLFADTTFDAAIYFGDADWSGTQSHQLMGE
FT                   NPVPVCSPALLNGQGMLEARHIAQLPLLQQSTRPYAWRQWFGSVGMNVERDMTGPRYEL
FT                   FSMLAQAAMHDMGIALIPPFLIQRELEEGRLVVANRHALSSDKAYYLMIPERKVESASL
FT                   RAFRDWLVSQAQAYLNRSGASATN"
FT   sig_peptide     complement(181935..181991)
FT                   /locus_tag="Pput_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.760) with cleavage site probability 0.557 at
FT                   residue 19"
FT   gene            182152..183333
FT                   /locus_tag="Pput_0177"
FT   CDS_pept        182152..183333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0177"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76352"
FT                   /db_xref="GOA:A5VWU2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWU2"
FT                   /protein_id="ABQ76352.1"
FT                   /translation="MAGKASFNWIDPLLLDQQLTEEERMVRDSAYQFAQDKLAPRVLEA
FT                   FRHEQTDPAIFREMGEVGLLGATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMSVQ
FT                   SSLVMVPINEFGTEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGSMITRARKVDGGYR
FT                   LTGSKMWITNSPIADVFVVWAKDDAGDIRGFVLEKGWQGLSAPAIHGKVGLRASITGEI
FT                   VMDNVFVPEENIFPDVRGLKGPFTCLNSARYGISWGALGAAEACWHTARQYTLDRQQFG
FT                   RPLAANQLIQKKLADMQTEITLALQGCLRLGRMKDEGTAAVEITSIMKRNSCGKALDIA
FT                   RMARDMLGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIQAFY"
FT   gene            183347..184567
FT                   /locus_tag="Pput_0178"
FT   CDS_pept        183347..184567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0178"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76353"
FT                   /db_xref="GOA:A5VWU3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWU3"
FT                   /protein_id="ABQ76353.1"
FT                   /translation="MGALSHLRVLDLSRVLAGPWSGQILADLGADVIKVERPGSGDDTR
FT                   SWGPPFLKDVEGEDTSEAAYYLSANRNKRSVTIDFTQPEGQRLVRELAAKCDIVIENFK
FT                   VGGLAAYGLDYQSLKAVNPQLIYCSITGFGQTGPYAKRAGYDFMIQGLGGLMSLTGRPE
FT                   GEEGAGPVKVGVALTDILTGLYSTVAMLAALAHRDQAGVGQHIDMALLDVQVACLANQA
FT                   MNYLTTGSPPRRLGNAHPNIVPYQDFPTADGDFILTVGNDSQFRKFAEVAGQPQWAEDP
FT                   RFITNKLRVANRAELIPLIRQATVFKTTAEWVAQLEAAGVPCGPINNLAQMFQDPQVLA
FT                   RGLALNIPHPLAGSVPQVASPIRLSETPVEYRRAPPLLGEHTEAVLGEVLGLDVGEVQR
FT                   LRGAGVL"
FT   gene            185131..186659
FT                   /locus_tag="Pput_R0001"
FT   rRNA            185131..186659
FT                   /locus_tag="Pput_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            186953..189846
FT                   /locus_tag="Pput_R0002"
FT   rRNA            186953..189846
FT                   /locus_tag="Pput_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            189979..190094
FT                   /locus_tag="Pput_R0003"
FT   rRNA            189979..190094
FT                   /locus_tag="Pput_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            190204..190319
FT                   /locus_tag="Pput_R0004"
FT   rRNA            190204..190319
FT                   /locus_tag="Pput_R0004"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(190384..192870)
FT                   /locus_tag="Pput_0179"
FT   CDS_pept        complement(190384..192870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0179"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; Secretin/TonB, short N-terminal
FT                   domain; TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76354"
FT                   /db_xref="GOA:A5VWU4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWU4"
FT                   /protein_id="ABQ76354.1"
FT                   /translation="MPTNPVLTHTFIPNDIRPVLQSAHLRHAIRAVLFGTALGLATAPQ
FT                   LSVAADTAEVSHDYAIPAGQLTDVLNKIARQAGITLSSTPQLTDGLHSNGLQGKFTTDQ
FT                   ALRQLLNGSGLEAVSQGGRNYVLQAQRQSAALALPDTDIRSFSLGNALGSMEGYNATHS
FT                   QVATKTSMPLVETSQSVSVVTRQQMDDQGSQTVAQAMRYTPGVLTNPYGATHRYDYVAM
FT                   RGFNDGSVDNIYVDGLKSMGDNGTYSTMQVDPYFLERIDILKGPSSVLYGRSSPGGLVA
FT                   LTTKKPLFAPYHQVQATVGTQGQRGVGFDFSGPVDDDKRIAYRLTGLADASDTQFDHNK
FT                   EERYAIAPAISVDFTEDTSLTLQAYLQHDPDGGYHGGNPADGMLHKRNGLRLSDHFFEG
FT                   EPSIDNYERTQQSFSYQFEHRFNDVFTARQNFRYQDSDVSMDQVYSAGWADVDSNKLNR
FT                   AYTGGDERLHSYIIDNMLQAEFFTGAAKHTLLLGADYQRRKADVAWRYGTVGPLDAGNP
FT                   QYGNGNLQVLGENRYQRRLQQTGVYLQDLVELDQWRFSLGLRQDWVKVSEENRDSDSKV
FT                   SDQRSRFTSRAGVLYLFENGIAPYISYSESFNPNTVSDQQGRPLAPTEGTQWEAGIKYQ
FT                   PPGSDNLFTASVFRIEQENLASKQPDEDFYRPVGEVRSQGLELEAHVQLTDSLKLLSGY
FT                   TFTDIEYSKSMPSLVSGNLDNKGNSPTQAPKQMLSLWADYNFRQGALDGLRLGGGVRYV
FT                   GYSWVDAENSMTVPSYTLFDASIGYDLGKVGLAGVDVRLNANNLTNENYITSCASLNYC
FT                   YMGEERNVSATVSYQF"
FT   sig_peptide     complement(192721..192870)
FT                   /locus_tag="Pput_0179"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.830) with cleavage site probability 0.799 at
FT                   residue 50"
FT   gene            complement(192964..193920)
FT                   /locus_tag="Pput_0180"
FT   CDS_pept        complement(192964..193920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0180"
FT                   /product="anti-FecI sigma factor, FecR"
FT                   /note="PFAM: FecR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76355"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWU5"
FT                   /protein_id="ABQ76355.1"
FT                   /translation="MTVARPDTKTVRQAIQWMLRLRESGHDPALQQQCAHWRSSHHENE
FT                   QAWQRVVHLHQDLDLRAIPGAGLALQTLETSQQRLRRRQALKLLGGVVMAGSASWLAKD
FT                   LDTVSAWTSDYATGTGERRVFTLPDGSLMQLNTCSAVDLAFHDQQRLVRLKLGELMINC
FT                   NPRHPLLVQTRDALLEGFEGRFVAYQDSDCTRVSVSHGKVAIHRPGTGQLQWIEGGQNW
FT                   RLDAQGAHRLAHMEMDAMAWTEGLIVTQDMRLSNFLAQVSRYRHGYLGCSNEIADLRLS
FT                   GVFRLEDPEQLLRLLPQTLPVRLRRRTRWWVHVESMT"
FT   gene            complement(193925..194446)
FT                   /locus_tag="Pput_0181"
FT   CDS_pept        complement(193925..194446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0181"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76356"
FT                   /db_xref="GOA:A5VWU6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWU6"
FT                   /protein_id="ABQ76356.1"
FT                   /translation="MPAPSSMPSNDSVQTLYSDHHGWLHTWLRSKLGNAADAADLAQDT
FT                   FVRLLQRREQLQLNAPRAFLRTVARGLVIDHWRREELHRAYLEALAHVPEALAPSVETR
FT                   ELLLELLERIARMLDGLKPKVRRAFLLAQCEGLKHQAIAEQMGISVRTVERYIADALYH
FT                   CYVLRYEDDC"
FT   gene            complement(194535..195224)
FT                   /locus_tag="Pput_0182"
FT   CDS_pept        complement(194535..195224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0182"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76357"
FT                   /db_xref="GOA:A5VWU7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWU7"
FT                   /protein_id="ABQ76357.1"
FT                   /translation="MAKKIKLSNVLASEQLLPHQARAVIEERLRSAILDGRLPPGTAVR
FT                   QQELATLYGVSRMPVREALRQLEAQSLLKVEMHKGAVVAPLIGEDAVDTYALRVLLESE
FT                   ALRQSIPLLDASDIASARGYIQQLENETSHTEIGRLNRLLHMALYSKAPNKKLLRLIEN
FT                   ELNEEERFLRFHLSSMGLGKLTQDDHNALVDAASDKLVDEAVAVLERHLNGGARVIRNY
FT                   LDTQLGR"
FT   gene            195428..196189
FT                   /locus_tag="Pput_0183"
FT   CDS_pept        195428..196189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0183"
FT                   /product="periplasmic protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76358"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWU8"
FT                   /protein_id="ABQ76358.1"
FT                   /translation="MPLSFAVASPTIAAFDWSEQGFAVAISWLLKTVVRYVGFAALLGS
FT                   LLLGGLHADWDFSQISRKSQALYGPLGAGQGRIDAWQSLMATQKQGTELERLQVVNRFF
FT                   NQQLRYVEDIDLWHEVDYWATPVQALIKGAGDCEDYAIAKYFSLRRMGIPSEKLRITYV
FT                   KALRQNRAHMVLTYYSSPQAQPLVLDSLMDAIKPASQRTDLLPVYAFNGEGLWLTGAAG
FT                   NKKVGDTKRLSRWQDLLKKMQAEGFPAEPVY"
FT   gene            196200..198146
FT                   /locus_tag="Pput_0184"
FT   CDS_pept        196200..198146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0184"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase,
FT                   HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76359"
FT                   /db_xref="GOA:A5VWU9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032244"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWU9"
FT                   /protein_id="ABQ76359.1"
FT                   /translation="MSLFKQLLLAICLFLVVAFSGSFMVSLESSRSQYVNQLRSHAQDA
FT                   ATALALSLTPNIDDPAMVELMVSSIFDSGYYASIKVVDLGSNAVLVERHAEPDPGGVPL
FT                   WFVRLIGLEAAGGDAIVSRGWQQAARVEVISHPMFAIAKLWQSALGSLGWLLLCGAASA
FT                   VLGALLLRRQLRPLDYMVEQSHAIARREFLSLPELPRTPELRRVVQAMNQMVEKLKALF
FT                   TEQAERSERLRAESYQDSLTGLSNRRYFEMQLNNRVSNLEDARAGYLLLLRVQGLAGLN
FT                   ARLGGQRTDQLLQAVGEQLRRTCASYPETNDLISRSRGGEFAVLAPGMVHEEAVHLAQA
FT                   LEATLQSLHETGASDIDPVACIGLAPFSPGDSPQALLKLADEALARAENQPTPGWVCLE
FT                   QGVAAVAADSQHAWHERLDQAFINGHFELFFQPVMECASSQRVLHHKVISRLRDGQGEA
FT                   LPAGRFLPWLERFGWMPRLDVLVLEKVLAHLRGHDQVLALNLSAATLADPKALQRIFEL
FT                   LGQNAALGPRLVFEIGEEQLPEQAALEQLTRRLHGLGFGLALQRFGGRFSMIGNLAHLG
FT                   LAYLKIDGSYIRNIDHEQHKRLFIEAIQRAAHSIDLPLIAERVETEGERLVLLEMGVGG
FT                   IQGQLVGEPAPWR"
FT   sig_peptide     196200..196283
FT                   /locus_tag="Pput_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.537 at
FT                   residue 28"
FT   gene            complement(198302..199678)
FT                   /locus_tag="Pput_0185"
FT   CDS_pept        complement(198302..199678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0185"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76360"
FT                   /db_xref="GOA:A5VWV0"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWV0"
FT                   /protein_id="ABQ76360.1"
FT                   /translation="MLHKLDMGQFKDGLRRYFKGSDSLGGQPLPEVNKALIEDAPRVVR
FT                   LTIWGVILFFVFLIVWASVAPIDEVTRGEGKAIPSSKVQKIQNLEGGIVAEIFAKEGQI
FT                   VEVGQPLLRLDETRFASNVGETEADRLAMALRVERLSAEVQDSPLIIDEKLRKAAPNQA
FT                   ASEESLYQSRRQQLQDEIGGLQQQLVQRQQELREYSSKRTQYANSLELLRKEISMSEPL
FT                   VATGAISQVEVLRLRRAEVENRGQLDSTALAIPRAEAAIREVQSKIEETRGKFRSEALT
FT                   QLNEARTELNKATATSKALDDRVHRTLVTSPVRGIVKQLLVNTIGGVIQPGSDIIEVVP
FT                   LDDTLVIEAKILPKDIAFLHPGQEATVKFTAYDYTIYGGLKAKLEQIGADTITDEDKKT
FT                   TYYLIKLRTDRSHLGTDEKPLLIIPGMVATVDIMTGKKTIMSYLLKPIMKARSEALRER
FT                   "
FT   gene            complement(199668..201824)
FT                   /locus_tag="Pput_0186"
FT   CDS_pept        complement(199668..201824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0186"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76361"
FT                   /db_xref="GOA:A5VWV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017750"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWV1"
FT                   /protein_id="ABQ76361.1"
FT                   /translation="MESEVSRVQLSHDPRSQHDDPLLDSLLSLCVLHQKPASRVMLTTG
FT                   LPLPAQRLSPELLPRAAARAGLQGRLLQRKLEQIPSIAMPAMLLLKEGRSAVLLGWEND
FT                   DTARLLLSESDGGEVHVSREALLSDYSGRVFFAQPQHKFDVNHGNLIPRAKSWFRDTLL
FT                   RSKWLYIDAIAASLVINLIALAAPLFVMNVYDRVVPNQATSTLWVLAIGIAGAYIFDLI
FT                   LKGLRGLCLDLAGKKTDLIISATLFERIVGMSMKYRPARVGSFAQNIHEFQGLRDFLAS
FT                   LTLTSLIDLPFTILILIVIAIIGGHLVWIPIIAFPLALGIGYALQRPLMATMERTMALA
FT                   SERQSSLIETLAGLDAVKVNNAESERQYMWEQTLGTLSRLELRVKVLSSLAMNITLLIQ
FT                   QLAGVAMICVGVYLIIDGNLSMGGLVACYMLSGRALGPLGQLNGLLARYQQAKVTMVST
FT                   DHMMDLPQERNFEERPLSRKVLQGSVEFRGVDFTYPNQQNLALKNINLTIRPGEKVGII
FT                   GRSGSGKSSLAKLIVGLYEADGGSLLVDGVDIRQIDVSELRHNIGYVPQDIQLLAGTLR
FT                   DNLVSGARYIEDELILQAAELAGVHEFARLHPDGYELQVGERGQNLSGGQRQNVALGRA
FT                   LLLNPQILLLDEPTSAMDNTGEERLKQRLQAVVEGKTVLLVTHRASLLSLVDRLIVIDR
FT                   GQIVADGPKAAVMDALKKGQISVA"
FT   gene            202214..202531
FT                   /locus_tag="Pput_0187"
FT   CDS_pept        202214..202531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76362"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWV2"
FT                   /protein_id="ABQ76362.1"
FT                   /translation="MLSCIQYSQAISHDREASICALVRHVFDLRQIAACGLRSVESLVC
FT                   LERASAPGSGWLSTSAWPHSGKVCAYSAISVRAFDSDLDIDASNADIAEGGQSRRMIYG
FT                   C"
FT   gene            202824..229916
FT                   /locus_tag="Pput_0188"
FT   CDS_pept        202824..229916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0188"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain; PFAM:
FT                   Hemolysin-type calcium-binding region; von Willebrand
FT                   factor, type A; Two component regulator propeller; SMART:
FT                   Pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76363"
FT                   /db_xref="GOA:A5VWV3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR019960"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWV3"
FT                   /protein_id="ABQ76363.1"
FT                   /translation="MSSVVAIVKSIVGQVIAVSPEGIRRVLIEGDRLLTGEEVLTGPGG
FT                   AVTLELADGRTLDLGRDSQWSADAPDSSTDLSQAAAQAAPSVEELQQAIAAGVDPTTEL
FT                   EATAAGPSSAGGGALGGGHSFVMLEETAGRVDPTVGFPTDGLGFAGVLDNEEVGLLDTN
FT                   GNNLVTTPTDTNVATELTLGATPSISEAGGVIVYTATVGQAPTTNLVITLSNGAVIVIP
FT                   AGQTSGSVNVAVPANDTPYIDGGQISATVTGSTGGGGLTVALPQTPAVTQVTDTIDTTT
FT                   ATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDV
FT                   YNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTEGGVITYT
FT                   VTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGN
FT                   FEQLTPNPTPAQTTINDSVDATTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNG
FT                   QTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDS
FT                   VDATTATLTASPSVTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQT
FT                   PANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTEGG
FT                   VITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSIDFQTPANDVYNNGSTVSVTIEN
FT                   ATGGNFEQLTPNPTPAQTTINDSVDTTTATLTASPSVTEGGVITYTVTLSNPAQTPVTV
FT                   TLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVSVTIESATGGNFEQLTPNPTPAQT
FT                   TINDSVDATTATLTASPSVTEGGVIIYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGS
FT                   VDFQTPANDVYNNGSTVSVTIENATGGNFEQLTPNPTPAQTTITDSVDTTTATLTASPS
FT                   VTEGGVITYTVTLSNPAQTPVTVTLSNGQTITVEAGKTQGSVDFQTPANDVYNNGSTVS
FT                   VTIENATGGNFEQLTPNPTPASTVINDSIDTVTVSIVSNGNVTEDQQPSFTVKVSQPLD
FT                   RPLTVTLSNGDTVTIEAGKTEVEYKTSVQGDDVYLDAGSITLSVTDATVPGATFEKLAL
FT                   GGPATVEISDTISEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGT
FT                   TVVVAANSTTGSATVAAPDNVYVGTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTEVT
FT                   DEPGTPGSEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAG
FT                   ETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGAAFENLELGGAASVQVTDTLDEVVA
FT                   KLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATVAA
FT                   PDNVYVGTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPGSEGDIVKVTI
FT                   TADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQ
FT                   DAGEISLGINSAVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYT
FT                   ITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSI
FT                   ATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGSEGDLVKVTITADQTSVAENVKPTFT
FT                   VHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVD
FT                   GRTFENLQLGGNASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSA
FT                   LTFTLSDGKTVITVPANGTVGTAIVTAPDNVYVGTNDPVVKSIATVEGADVGKFEQLTL
FT                   DKTPVSTQVTDEPGTPGSEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLS
FT                   NNAQVTIKAGETSAPYTHDAQGDDVYQDAGQISLGITSAVDATGAAFENLELGGAASVQ
FT                   VTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPA
FT                   NGTVGTAIVTAPDNVYVGTNDPVVKSIATVEGADVGKFEQLTLDKTPVSTQVTDEPGTP
FT                   GSEGDLVKVTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNAQVTIKAGETSAPY
FT                   THDAQGDDVYQDAGEISLGITSAVDATGATFENLELGGAASVQVTDTLDEVVAKLTATP
FT                   SVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATATAPDNVYV
FT                   GTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTQVTDEPGTPGSEGDIVKVTITADQTS
FT                   VAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGEIS
FT                   LGITSAVDATGAAFENLELGGAASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNK
FT                   DGLPINNHSELYFKLTDGTTVVVAANSTTGSATATAPDNVYVGTNAPVVNAIDAVSGAD
FT                   AWKFENLNLDKTPVSTQVTDEPGTPGSEGDIVKVTITADQTSVAENVKPTFTVHVNQPL
FT                   AHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGEISLGITSAVDATGATFENL
FT                   ELGGAASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTD
FT                   GTTVVVAANSTTGSATATAPDNVYVGTNQPVVNAIDAVSGADAWKFENLNLDKTPVSTQ
FT                   VTDEPGTPGSEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIK
FT                   AGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENLELGGAASVQVTDTLDEV
FT                   VAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATA
FT                   TAPDNVYVGTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTEVTDEPGTPGSEGDIVKV
FT                   TITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDV
FT                   YQDAGEISLGITSAVDATGATFENLELGGAASVQVTDTLDEVVAKLTATPSVTEGGEIT
FT                   YTITLTNKDGLPINNHSELYFKLTDGTTVVVAANSTTGSATATAPDNVYVGTNQPVVNA
FT                   IDAVSGADAWKFENLNLDKTPVSTQVTDEPGTPGSEGDIVKVTITADQTSVAENVKPTF
FT                   TVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGEISLGITSAVDA
FT                   TGATFENLELGGAASVQVTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHS
FT                   ELYFKLTDGTTVVVAANSTTGSATATAPDNVYVGTNQPVVNAIDAVSGADAWKFENLNL
FT                   DKTPVSTQVTDEPGTPGSEGDIVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLS
FT                   NNAQVTIKAGETSAPYTHDAQGDDVYQDAGEISLGITSAVDATGATFENLELGGAASVQ
FT                   VTDTLDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSELYFKLTDGTTVVVAAN
FT                   STTGSATATAPDNVYVGTNAPVVNAIDAVSGADAWKFENLNLDKTPVSTQVTDEPGTPG
FT                   SEGDIVKVTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNAQVTIKAGETSAPYT
FT                   HDAQGDDVYNDAGQISLGITSAVDVDGRTFENLQLGGNASVQVTDTTDEVVAKLTATPS
FT                   VTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVAAPDNVYV
FT                   GTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTIT
FT                   ADQTSVAENVKPTFTVHINTALAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQD
FT                   AGEISLGINSAVDATGATFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTI
FT                   TLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVAAPDNVYVGTNDPVIKSIA
FT                   TVEGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVK
FT                   PTFTVHINTALAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGEISLGINSA
FT                   VDATGATFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPIN
FT                   NHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGANDPVVKSIATVEGADVGKFE
FT                   QLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFTVHVNQPL
FT                   AHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGATFENL
FT                   ELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSD
FT                   GKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVST
FT                   SVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTI
FT                   KAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDVTGAKFENLQLGGAASVQVTDTTDE
FT                   VVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTA
FT                   TVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLV
FT                   KVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGD
FT                   DVYNDAGQISLGINSAVDATGATFENLQLGGAASVQVTDTTDEVVAKLTATPSVTEGGE
FT                   ITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPV
FT                   IKSIATVEGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSV
FT                   AENVKPTFTVHINTALAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGQISL
FT                   GITSAVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKD
FT                   GLPIDKHAALTFTLDDGKTTITIPANGTTGTATVTAPDNVYVGANDPVVKSIATVEGAD
FT                   VGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFTVH
FT                   INTALAHDLVVTLSNNAQVTIKAGETSAPYTHDAQGDDVYQDAGQISLGITSAVDATGA
FT                   TFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPIDKHAALT
FT                   FTLNDGKTAITIPANGTTGTATVTAPDNVYVGANDLVVKSIATVEGADVGKFEQLTLDK
FT                   TPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNN
FT                   AQVTIKAGETSAPYTHDAQGDDVYQDAGEISLGINSAVDATGATFENLELGGAAKVDVT
FT                   DTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANG
FT                   TVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGN
FT                   EGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTH
FT                   DAQGDDVYNDAGQISLGITSAVDVDGRTFENLELGGAAKVDVTDTTDEVVAKLTATPSV
FT                   TEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVG
FT                   TNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGSEGDLVKVTITADQTSV
FT                   AENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISL
FT                   GITSVVDVDGRTFENLELGGAAKVDVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKD
FT                   GLPIDKHAALTFTLDDGKTTITIPANGTTGTATVTAPDNVYVGTNDPVIKSIATVEGAD
FT                   VGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPL
FT                   AHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDTTGATFENL
FT                   ELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSD
FT                   GKTVITVPANGTVGTATVTAPDNVYVGANDPVVKSIATVEGADVGKFEQLTLDKTPVST
FT                   SVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTI
FT                   KAGETSAPYTHAAQGDDVYNDAGQISLGITSVVDVDGRTFENLELGGAAKVDVTDTTDE
FT                   VVAKLTATPSVTEGGEITYTITLTNKDGLPIDKHAALTFTLDDGKTTITIPANGTTGTA
FT                   TVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVIDEPGTPGNEGDLV
FT                   KVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGD
FT                   DVYNDAGQISLGITSAVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGE
FT                   ITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPV
FT                   IKSIATVEGADVGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSV
FT                   AENVKPTFTVHVNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISL
FT                   GINSAVDATGATFENLELGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKD
FT                   GLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGAD
FT                   VGKFEQLTLDKTPVSTTVTDEPGTPGNPGGSNEGDLVKVTITADQTSVAENVKPTFTVH
FT                   VNQPLAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGINSAVDATGA
FT                   TFENLQLGGAASVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALT
FT                   FTLSDGKTVITVPANGTVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDK
FT                   TPVSTSVTDEPGTPGNEGDLVKVTITADQTSVAENVKPTFTVHVNQPLAHDLVVTLSNN
FT                   AQVTIKAGETSAPYTHAAQGDDVYNDAGQISLGITSAVDVDGRTFENLQLGGNASVQVT
FT                   DTTDEVVAKLTATPSVTEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANG
FT                   TVGTATVTAPDNVYVGTNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGN
FT                   EGDLVKVTITADQTSVAENVKPTFTVHINTALAHDLVVTLSNNAQVTIKAGETSAPYTH
FT                   AAQGDDVYNDAGQISLGINSAVDVTGAKFENLQLGGAATVQVTDTTDEVVAKLTATPSV
FT                   TEGGEITYTITLTNKDGLPINNHSALTFTLSDGKTVITVPANGTVGTATVTAPDNVYVG
FT                   TNDPVIKSIATVEGADVGKFEQLTLDKTPVSTSVTDEPGTPGNEGDLVKVTITADQTSV
FT                   AENVKPTFTVHINTALAHDLVVTLSNNAQVTIKAGETSAPYTHAAQGDDVYNDAGQISL
FT                   GINSAVDVTGAKFENLQLGGAATVQVTDTTDEVVAKLTATPSVTEGGEITYTITLTNKD
FT                   GLPINNHSALTFTLSDGKTVITVPANGTVGTATVAAPDNVYVGTNDPVIKSIATVEGAD
FT                   VGKFEQLTLDKTPVSTAVTDEPGTGTPGTGNQGDVTIVGITGTSSLTEGETGQYTLTLS
FT                   NASKSEVTITLSYSGTAKNGDDFTGVATVKIPANSTGTTFNIATIDDKLVEGTENFVVK
FT                   IEAATGGNFENLQVDSSKSSVTTTILDNDHLPVSPGGAVFGVEDTDYVFAWSDFKVTDA
FT                   DGNTNLSVTITSLPAAGNLQFFNGTAWVNVAVGQVVSQADITAKNLKFVPALNQSGADN
FT                   YGGTGVGNQKADYAQFKFKPNDGTNLGSEVTMKVDISPVADKPTLSFGSADIESKGLTK
FT                   EVWTSLKGLGTGGNGITGEDLKTVFANSGSANSSSTTTNVQSDGSVTAGTGSKTSGLIY
FT                   LEAGKVYTFSGLADDSFVVTIGGKTVVTATWGAGGGVSGTFTPNTSGYYPIEVYHANQS
FT                   GPGSYDLNIQVGSGAVTDLSSSNVKMYQNVTEMANAGLGVSDLHTVNGQSYYDGYKLNE
FT                   GPEGGSVKLVGISTALTDTDGSESLNVTLSGIPKGTVLSDGAGHTVTVGTAPVDVTGWK
FT                   LSSLTLTPPAYYKGSFDITVTSTATESLGGSAITTGNIPVTVYAATYKASVGTSGNDTM
FT                   TGSEGNDIIVADVSGLNVVQGKNYNIAFMVDSSGSMSDKSIADAKTQLASVFNTLKASL
FT                   GSDTSGTVNIFLVDFDTQVNKNVAVNLADPDALSKLQAVLNSMVGGYYGGGTNYEDAFK
FT                   TTSNFFNSTMATGNKGAENLTYFITDGKPTYYQSGESTNPSLWKNGKSLDDVVNVNNYK
FT                   MGDTFSAWADATHKVEISSNGVVKVLTYTENRRGELVLDSTKTVGTLHAQGDGTYELSS
FT                   LDGTGYADYWNYVYSAAGSTESFAVLGGTNGLSKVQAIGLNSDVTLNDLKPYDSAGKPQ
FT                   TNIDPSDLAKAILGHSEATVPGADTIDSGNGNDIIFGDLITLNGVVSEGYQALQTYVAQ
FT                   KSGVEVGAVTTSNVHQYITEHYTEFDISGAKDGNDILSGGNGNDILFGQGGSDTLDGGK
FT                   GNDILLGGTGNDTLIGGQGDDILIGGSGADTFVWKAGDIGNDVIKDFNKAEGDRIDLKD
FT                   LLQGEKGSTIDNYLKLTTVEGTTTLQVSSEGKLNAEGGIANADVTIKLEGVNWSNQTIN
FT                   SLISGADPTIIIHNKDS"
FT   gene            230062..230403
FT                   /locus_tag="Pput_0189"
FT   CDS_pept        230062..230403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76364"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWV4"
FT                   /protein_id="ABQ76364.1"
FT                   /translation="MFYVQRNAAGQLLRVEAAAFDQFTEMLPSDHADIQEWFADDVVEN
FT                   SLNQLKQSDLDMIRVLEDLIDVLTAKGVFKITDLPAGAQAKLLNRSTARKALSSLNNLI
FT                   DEEEQGGLI"
FT   gene            230602..231501
FT                   /locus_tag="Pput_0190"
FT   CDS_pept        230602..231501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0190"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76365"
FT                   /db_xref="GOA:A5VWV5"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWV5"
FT                   /protein_id="ABQ76365.1"
FT                   /translation="MSAALNALSSIDSAQPQVFEVRPFSGAVGAEIIGLDLAKPVSAED
FT                   FTRIHRAHLDHHVLVFRDQRISPEQQIAFSRRFGELQIHVLKQFLLTGHPEILIVSNII
FT                   ENGQNIGLGDAGKFWHSDLSYKELPSLGSMLHAQELPSEGGDTLFADMHKAWDAVPDTL
FT                   RKVVEGRSAAHSYTARYAETKFEGNWRPTLTAEQLAQVKEVIHPVVRTHPENGRKALFV
FT                   SEGFTTRIVGLPDDESRDVLQQLYALSVLEQNIYRHQWQPHDLVFWDNRSLIHLATGCP
FT                   AHLRRKLYRTTIQGDAPF"
FT   gene            231519..232538
FT                   /locus_tag="Pput_0191"
FT   CDS_pept        231519..232538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0191"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76366"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWV6"
FT                   /protein_id="ABQ76366.1"
FT                   /translation="MRKSISRLAASIGLGASLVVGSLAAPAVAQAEGKIRIAEQFGIVY
FT                   LLLNVVRDQHLIEKHGKEQGIDIEVDWAQLSGGSAINDALLSGSVDIAGAGVGPLLTVW
FT                   DRTKGRQNVKAVASLGNFPYYLVSSNPNVKTIADISDKDRIAVPAVGVSVQSRFLQYAA
FT                   AQQWGDKEYNRLDKYTLAVPHPDATAALLAGGTELNGHFSNPPFQDQVLANKDVHVVLN
FT                   SYDLLGPNSPTLLFATEKFRKDNPKTYKAFVDALAEAADFAQKDKAAAADTYIRVTKAK
FT                   IDRDALIKLIDNPQYEFTVTPKNTYKLADFLYRVGAIKHKPQSWKDYFFQDERPLQGS"
FT   sig_peptide     231519..231608
FT                   /locus_tag="Pput_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.631 at
FT                   residue 30"
FT   gene            232545..233408
FT                   /locus_tag="Pput_0192"
FT   CDS_pept        232545..233408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0192"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76367"
FT                   /db_xref="GOA:A5VWV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWV7"
FT                   /protein_id="ABQ76367.1"
FT                   /translation="MTAPLPGHTASNLSRVAAPPLLKVDNLSLEYRTAQRVVRATHQVS
FT                   FEVDRTDRFVLLGPSGCGKSTLLKAVAGFIQPQEGQILLQGQTVRGPGPDRIVVFQEFD
FT                   QLPPWKTVKQNVIFPLLVSGQLKRAEAEERALHYLEKVGLAAFADAYPHTLSGGMKARV
FT                   AIARALATQPKILLMDEPFAALDALTRRKMQEELLLLWEEVRFTLLFVTHSIEEALVVG
FT                   NRILLLSPHPGRVRAEVHSHQYGLGSLGGSDFQASARRIHRLLFDEADIPEQPDNLGFN
FT                   DIRIAY"
FT   gene            233423..234286
FT                   /locus_tag="Pput_0193"
FT   CDS_pept        233423..234286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0193"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76368"
FT                   /db_xref="GOA:A5VWV8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWV8"
FT                   /protein_id="ABQ76368.1"
FT                   /translation="MTTTPVRQEYEVQLEPLLSVPVERQLPLAQRLWQQGWLRKAVILL
FT                   VIAVLWEAVARYQDNDLLLPSFLQTATALWDGMISGELPAKVGVSLVILLKGYVLGIVL
FT                   AFGLTSLAVSTQLGRDLLGTLTSMFNPLPAIALLPLALLWFGLGDNSLIFVLVHSVLWA
FT                   LALNTYAGFLGVSETLRMAGRNYGLKGLRLVLHILVPAALPSILSGLKIGWAFAWRTLI
FT                   AAELVFGASSGKGGLGWYIFQNRNELYTDKVFAGLAVVILIGLLVEGLVFNTLERLTVR
FT                   RWGMQR"
FT   gene            complement(234404..235009)
FT                   /locus_tag="Pput_0194"
FT   CDS_pept        complement(234404..235009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76369"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWV9"
FT                   /protein_id="ABQ76369.1"
FT                   /translation="MPPSYCGKPRQGRYLLPFATTRATLSRQWALLRQLPSRSPGITSA
FT                   ELVWRLRDVGFTVSKRTVERDLNELSLIFPLERNDKSIPFGWHWSASAVGELRGNFDLL
FT                   THLRGDALQPSQGEGVELVARISDALARQLRDAPLSSDMQLTALEHGHRLRGTVSDGWP
FT                   LRWWLLSHGDRVVVEQPAGLREEIGRILSNAAAQYQNL"
FT   gene            235172..235966
FT                   /locus_tag="Pput_0195"
FT   CDS_pept        235172..235966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0195"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76370"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWW0"
FT                   /protein_id="ABQ76370.1"
FT                   /translation="MSVASNIHSLLARLLPERVIAPPAPAGRRQRLFCGVGLPSQRSLL
FT                   VNRLDEANDLQAVYVDLRRQALQGSVSALNDLGWIWLNGKYWRADTVLAGHLLRMAALQ
FT                   GNAAAWFNLGQQHYFGKGIDPSYVQAAECYRQAFDRGMLHAAAALGDLYEEEVCDGDLE
FT                   WQVDLVQAYQWFMRGAEQGEARCRFEVGYRLMHGLHVEANLKAALYWLELAAAAGVVQA
FT                   AEELAVHFSSRDAVRYQEWRDRAVQMGSTLALTMKLEDQIQP"
FT   gene            236174..236626
FT                   /locus_tag="Pput_0196"
FT   CDS_pept        236174..236626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0196"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76371"
FT                   /db_xref="GOA:A5VWW1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWW1"
FT                   /protein_id="ABQ76371.1"
FT                   /translation="MSLDFLRLQVSSGLVVAARHWRRICHTALTGYGISEACAAPLLMI
FT                   VRLGDGVHQVAVAQAAGLESPSLVRLLDQLCKAGLVCRSEDPLDRRAKALSLTAEGRAL
FT                   AEAIEAELVRLRRDVLGGIDQADLEAALRVLRAFEAAGLGSAGGVA"
FT   gene            236623..238710
FT                   /locus_tag="Pput_0197"
FT   CDS_pept        236623..238710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0197"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76372"
FT                   /db_xref="GOA:A5VWW2"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWW2"
FT                   /protein_id="ABQ76372.1"
FT                   /translation="MNGFFSSVPPARDWFYGVRTFGASMIALYIALLMQLPRPYWAMAT
FT                   VYIVSSPFVGPTSSKALYRAVGTLLGAGGAIFLVPPLVQSPLLLSIAIALWTGTLLFLS
FT                   LNLRTANNYVLMLAGYTLPMIALAVVDNPLAVFDVASSRAQEICLGIVCAAVVGAIFWP
FT                   RRLAPVVVGATGNWFTEAIRYSDTYLARDASADKVGGMRGVMVTTFNSLELMIGQLAHE
FT                   GAGPHTLKNARELRGRMIHLLPVIDALDDALVALEGRAPAQFAQLQPVLEAAREWLKGT
FT                   ADSASVAHWATLHEQIGRLQPATAALDQRAELLLSNALYRLTEWADLWQDCCTLQHALR
FT                   TDDAKPWRAVYRHWRLGRLTAFFDRGLMLYSVASTVLAIVVACGLWIGLGWNDGASAVI
FT                   LAAVACSFFAAMDDPAPQIYRFFFWTLMSVIFSSLYLFLVLPNLHDFPMLVLAFAVPFI
FT                   CIGTLTVQPRFYLGTLLTIVNTSTFISIQGAYDADFFTFLNSNLAGPAGLLFAFIWTLV
FT                   MRPFGVELAAKRMTRFAWRDIVEMTEPATLAEHRQVGVQMLDRLMQHLPRLSQTGQDSG
FT                   VALRDLRVGLNLLDLLAYMPRAGQQARERLNTVVEEVGAHYAACLRAGERLHAPAALLR
FT                   NMERARLALNLDELYERGDARTHLLHALSGLRLALLPGVEVMLEPAEQPQLPPGLDGAP
FT                   L"
FT   gene            238707..238919
FT                   /locus_tag="Pput_0198"
FT   CDS_pept        238707..238919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0198"
FT                   /product="protein of unknown function DUF1656"
FT                   /note="PFAM: protein of unknown function DUF1656"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76373"
FT                   /db_xref="GOA:A5VWW3"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWW3"
FT                   /protein_id="ABQ76373.1"
FT                   /translation="MIGELDISGVFLPTLLVMMFGTYLLFLGVHAVLVRLHFYRLVWHR
FT                   ALFNVALYAVLLGAVDHFCRNLMLP"
FT   gene            238916..239791
FT                   /locus_tag="Pput_0199"
FT   CDS_pept        238916..239791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0199"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76374"
FT                   /db_xref="GOA:A5VWW4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWW4"
FT                   /protein_id="ABQ76374.1"
FT                   /translation="MKKPMLTLGRVVLTLLVVTFAAVLVWQMVVYYMFAPWTRDGHIRA
FT                   DVIQIAPDVSGLIQKVEVRDNQTVKRGDVLFTIDQDRFTLALRQAKATLGERQETLAQA
FT                   SREAQRNRKLGNLVAAEQLEESQSREARARSAVSEAQVAVDTAQLNLDRSVVRSPVDGY
FT                   LNDRAPRNHEFVTAGRPVLSVVDSASYHVDGYFEETKLGGIHIGDAVDIRVMGDNTRLR
FT                   GHVQSFAAGIEDRDRSSGANLLPNVNPAFSWVRLAQRIPVRIAFDEVPQDFRMIAGRTA
FT                   TVSIIEGQRP"
FT   sig_peptide     238916..238981
FT                   /locus_tag="Pput_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.971) with cleavage site probability 0.647 at
FT                   residue 22"
FT   gene            239788..241206
FT                   /locus_tag="Pput_0200"
FT   CDS_pept        239788..241206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0200"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76375"
FT                   /db_xref="GOA:A5VWW5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWW5"
FT                   /protein_id="ABQ76375.1"
FT                   /translation="MKQLILAGLCLSLGACMMVGPDYEVPGDAAVQRNDLNGPLRQDAD
FT                   SVVSAPVPEDWWQLYQDQRLNELVRQALSANTELRVAAANIAKARAQVEVAESQGGFNG
FT                   GVKLGAQRLQESGEAFLQPEKVPVANIGEAIISASYQFDLWGTFKRGTEAAKANADAVQ
FT                   AAADTARITLVADVVKAYTQVCSANEEYHIARESLDLQEQSVKLNQRLRDAGRGDETQV
FT                   TRSQTQFKSLRAELPRFKAERETGMYTLAALLAKPVDQLPAGTADCAELPHLNQLVPVG
FT                   DGAALLKRRPDVRQAERQLAAATAYIGVATGALYPDISIGAQVGTIGILENLGEPSTNR
FT                   WGFGPQISWTIPTNGTRARIRMAEASTQAALANFDGVVLNAIRETQTRLAQYSALLDRR
FT                   EALAEAEKSAKEAADQTHRYYQAGRESFLADLQATRTYTDMRAQLAAANSQVALGQIGV
FT                   FLALGGGWKARTQE"
FT   sig_peptide     239788..239862
FT                   /locus_tag="Pput_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.796) with cleavage site probability 0.789 at
FT                   residue 25"
FT   gene            241307..242260
FT                   /locus_tag="Pput_0201"
FT   CDS_pept        241307..242260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76376"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWW6"
FT                   /protein_id="ABQ76376.1"
FT                   /translation="MGEDSTSVVKSFYCRDRLATQVRELSSYSLLDHRQGCLAQVNVGQ
FT                   GAGSVLFAVDAMRTVIAGSAELSFAKMCYQAYGLSSPQPSIVPGFNGESRDAVTGCYLL
FT                   GAGYRLYSPVMMRFCSPDSWSPFGEGGLNAYAYVSCDPVNYSDPTGHGKHIKMKVSQPK
FT                   ERPGKLAVEPLRTPASKSPSLDRSNSSGSNLSGASSPLTPSPVSAGSSKRYSSQASSDT
FT                   SASTDLDDIWKLDKSRATYKELTPAEQYVFDEFQNAIKNEGKSPRDAAEMAGASDYKRM
FT                   KDKKVNRFQIRLSQGQRVSFEIEGKNVIIRQVGGHT"
FT   gene            242341..244284
FT                   /locus_tag="Pput_0202"
FT   CDS_pept        242341..244284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0202"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; iron permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76377"
FT                   /db_xref="GOA:A5VWW7"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWW7"
FT                   /protein_id="ABQ76377.1"
FT                   /translation="MFSFAFPPRLAMNSRFRLLAWLPAVLLGPVLALCSNLALAEAPAE
FT                   ATKALHLLDYIGADYPPTVQDGTVIDDGEYREQQEFSAVLADLLKGLPANAEQKGLEQG
FT                   VQALRQAIDQRQEGAAVAKQARQLGARLAVAYEVSQAPVITPDPARGAALYAQNCSICH
FT                   GETGAGDGPAGVGLEPAPANLRDVSRLDQLSLFDLYNTLALGIDGTEMPSFADQLDDRQ
FT                   RWDVAAYIASFTAKPEAGKGDKTWNLADLARQTPAEVAANEGTAAVEAFRAQRAQPPQV
FT                   KRGPAQLLEYTASTLDKSLAAYRAGDHDQAYDLSVAAYLEGFELVESSLDNIDTQARKD
FT                   TEKTLMAYRQSLQDGLPVAQAEQRLADAKTKLEQAAKLLGSDGLSWTLSYISGLLILLR
FT                   EGLEAILVLAAILAFLRNTGQQSAVRSVNIGWGLALVAGFATWALAAYVIDVGGAQREL
FT                   LEGCTALFAAVMVLWLGVWMHDRRHAAAWKDYIKSSLVSGGGRFGFAVLAFFSVYRELF
FT                   EVILFYETLWLQAGPAGHQAVLAGGATALLLLVGLAWVILRGSAKLPLSLFFSINAALL
FT                   CALSVVFAGHGVKALQEAGVLGTRPVAFFEFDWLGIHADAYSLSAQAVALLAIVFLYGR
FT                   SWLAEKRSTAAN"
FT   sig_peptide     242341..242463
FT                   /locus_tag="Pput_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.992 at
FT                   residue 41"
FT   gene            complement(244347..244592)
FT                   /locus_tag="Pput_0203"
FT   CDS_pept        complement(244347..244592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76378"
FT                   /db_xref="InterPro:IPR013468"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWW8"
FT                   /protein_id="ABQ76378.1"
FT                   /translation="MPFTPDLIDEMEVLALFKHDSSQEGIKITSTASPALIAAAQRLHE
FT                   KGLTDQPDGGYLTSLGHDAVESVQLLQNILKAPQPA"
FT   gene            complement(244662..244964)
FT                   /locus_tag="Pput_0204"
FT   CDS_pept        complement(244662..244964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76379"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWW9"
FT                   /protein_id="ABQ76379.1"
FT                   /translation="MSEPTNIDNDDDEAFAEATLTQAIENQIESGEPPAAKATFNKLTL
FT                   VGYEREDILNLMAHVLAFEIDNMLVEDRAFNGEWYENALRALPELPPEMDQGDDE"
FT   gene            245112..245774
FT                   /locus_tag="Pput_0205"
FT   CDS_pept        245112..245774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0205"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76380"
FT                   /db_xref="GOA:P82998"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/Swiss-Prot:P82998"
FT                   /protein_id="ABQ76380.1"
FT                   /translation="MLKLHGFSVSNYYNMVKLALLEKGLPFEEVTFYGGQAPQALEVSP
FT                   RGKVPVLETEHGFLSETSVILDYIEQTQSGKALLPADPFEQAKVRELLKEIELYIELPA
FT                   RTCYAESFFGMSVEPLIKEKARADLLAGFATLKRNGRFAPYVAGEQLTLADLMFCFSVD
FT                   LANAVGKKVLSIDFLADFPQAKALLQLMGENPHMARIMADKEASMPAFMEMIRSGKR"
FT   gene            complement(245881..247380)
FT                   /locus_tag="Pput_0206"
FT   CDS_pept        complement(245881..247380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0206"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76381"
FT                   /db_xref="GOA:A5VWX1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWX1"
FT                   /protein_id="ABQ76381.1"
FT                   /translation="MRFSGHFSRPAPCGSQPNPAIIDATFSFTPAMSESMSTDKTNQSW
FT                   GGRFSEPVDAFVARFTASVDFDKRLYRHDIMGSIAHATMLAQVGVLSDAERDTIIDGLK
FT                   TIQGEIEAGNFDWRVDLEDVHMNIEARLTDRIGITGKKLHTGRSRNDQVATDIRLWLRD
FT                   EIDLILGEITRLQQGLLEQAEREAETIMPGFTHLQTAQPVTFGHHLLAWFEMLSRDYER
FT                   LVDCRKRTNRMPLGSAALAGTTYPIDRELTCKLLGFEAVAGNSLDGVSDRDFAIEFCAA
FT                   ASVAMMHLSRFSEELVLWTSAQFQFIDLPDRFCTGSSIMPQKKNPDVPELVRGKSGRVF
FT                   GALTGLLTLMKGQPLAYNKDNQEDKEPLFDAADTLRDSLRAFADMIPAIKPKHAIMREA
FT                   ALRGFSTATDLADYLVRRGLPFRDCHEIVGHAVKYGVDTGKDLAEMSLDELRQFSDQIE
FT                   QDVFAVLTLEGSVNARDHIGGTAPAQVRAAVVRGKALLASR"
FT   gene            247573..248316
FT                   /locus_tag="Pput_0207"
FT   CDS_pept        247573..248316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0207"
FT                   /product="Two-component response regulator AlgR"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76382"
FT                   /db_xref="GOA:A5VWX2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWX2"
FT                   /protein_id="ABQ76382.1"
FT                   /translation="MNVLIVDDEPQGRERLSRLLGELEGYTVLEPSATNGDEALALIES
FT                   LKPDVVLLDIGMPGLDGLQVAARLCEREAPPAVVFCSGDDEYGAEAFKDSTLSHVTKPF
FT                   QAQALRDALRKAEKPNRAQLAALTRPANEGGGPRSHISARTRKGIELIPLSQVIYFIAD
FT                   HKYVTLRHETGEVLLDEPLKALEDEFGERFVRIHRNALVARERIERLQRTPLGHFQLYL
FT                   KGLDGDALTVSRRHVAGVRKMMQTL"
FT   gene            248435..249376
FT                   /locus_tag="Pput_0208"
FT   CDS_pept        248435..249376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0208"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76383"
FT                   /db_xref="GOA:A5VWX3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VWX3"
FT                   /protein_id="ABQ76383.1"
FT                   /translation="MSTREIRIATRKSALALWQAEYVKARLEQAHTGLQVTLVPMVSRG
FT                   DKLLDAPLAKIGGKGLFVKELETALLDNEADIAVHSMKDVPMDFPEGLGLYCICEREDP
FT                   RDAFVSNTFDSLETLPAGSIVGTSSLRRQAQLLARRPDLQIRFLRGNVNTRLAKLDAGE
FT                   YDAIILAAAGLIRLGFEDRITSTISVDDSLPAGGQGAVGIECRSADVEIHALLAPLHHV
FT                   DTADRVIAERALNKRLNGGCQVPIACYAVLEGDQLWLRGLVGQPSGGTLLVADARAPRA
FT                   AAEALGVQVAEDLLGQGAEAILKEVYGEAGHP"
FT   gene            249373..250140
FT                   /locus_tag="Pput_0209"
FT   CDS_pept        249373..250140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0209"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76384"
FT                   /db_xref="GOA:A5VWX4"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWX4"
FT                   /protein_id="ABQ76384.1"
FT                   /translation="MSQWRLLLTRPAEDCAALAQSLAAAGVGSSCLPLLEIEPITVQAP
FT                   QRLSLEGLHDFQAIIVVSKPAARLLLEHLAETSIQPPQRGWFTVGEATAGVLQGAGLEV
FT                   SFPPRGDDSEALLALPALRQALTEPAPRVLIVRGVGGRELLAERLAEQGASVEYLELYR
FT                   RCLPAYPAGTLMRRIEAERLNGLVVSSGQGFEHLQRMAGADWLRLAQLPLFVPSPRVAE
FT                   QAKAAGAQQVVDCRGASATALLAAVQRSAAPAS"
FT   gene            250186..251286
FT                   /locus_tag="Pput_0210"
FT   CDS_pept        250186..251286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0210"
FT                   /product="protein of unknown function DUF513, hemX"
FT                   /note="PFAM: protein of unknown function DUF513, hemX"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76385"
FT                   /db_xref="GOA:A5VWX5"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWX5"
FT                   /protein_id="ABQ76385.1"
FT                   /translation="MSETVLSNNDQPSAQAPAEPVTTPPAKRSGSGLAALALLLGAAGV
FT                   AVGGWGVWQVRQLQGSEFNQGQHIEALTQRAEALQQREQQISAQLASLPAASELEDRRR
FT                   LVAQLQGDQQRLSQRLETVLGESRKEWRLAEAEHLLRLATLRLSALQDITSAKALVEGA
FT                   DEILREQSDPGAFAAREQLARSLATLNSTQQPDRTGLFLKLAAQRELVQQLSAQSPEFD
FT                   SNADALGALTADGDGASRLSQWWAEISKYFQIDFNADENVRPLLAGQQLNQLRLALSLT
FT                   IEQAQWAALNGDAKVYTQALDDARSVLLANFNADNPQSKAMLDSLNALADQPVSVVTPD
FT                   LSESLAAVQAYIQRRHLPAEAEGGKP"
FT   gene            251283..252521
FT                   /locus_tag="Pput_0211"
FT   CDS_pept        251283..252521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0211"
FT                   /product="HemY domain protein"
FT                   /note="PFAM: HemY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76386"
FT                   /db_xref="GOA:A5VWX6"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWX6"
FT                   /protein_id="ABQ76386.1"
FT                   /translation="MKRVYLLAVLAIVVAAALGIAVAKHSGYVLVSYGGFRYQSGLWAA
FT                   LAGILAVVLLLWLLRYLVGLVLTSSGVVNPWSRRNRSRRIRLAIEQGQLDLAEGRWASA
FT                   QRHLHRAAEAERQPLLYYLGAARAANEQGRTEDSDNLLERALERQPQAELAIALTHAQL
FT                   QMDRGENDGALETLLAMQERHPHNGQVLRLLQRLYVERGDWSALIRLMPDLRKGKVLPA
FT                   AELAALEQRAWGQNLSLATTRGEDALSARQSLERAWQQLTAAQRQEPQLVLAYAEQLRQ
FT                   VGAQNEAEQVLRTALKRDYESHLARLYGLVRGDDPARQLQTAEGWLKAHPQDASLLLTL
FT                   GRLSLQNRLWGKARDYLESSLRMERNPEACAELARLLAGLGETERSNQLFQEGLGLLDE
FT                   RLLALPLPEGVRA"
FT   sig_peptide     251283..251354
FT                   /locus_tag="Pput_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.875 at
FT                   residue 24"
FT   gene            252744..253250
FT                   /locus_tag="Pput_0212"
FT   CDS_pept        252744..253250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0212"
FT                   /product="disulfide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76387"
FT                   /db_xref="GOA:A5VWX7"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWX7"
FT                   /protein_id="ABQ76387.1"
FT                   /translation="MLPARLRTFFLPACLVALAVLVASFRLENTVGLMPCPLCLSQRLL
FT                   LGVYALLCFAAVLQAPGTRGILRYARLVLGCSLAGALLAARHVWLQGAEGVNEVCPVPI
FT                   GRVFEQSWGEAARQLLLGGPDCRSLAWSFLDLTLPEWSLLAFLLLAVLPLSCLLAYRFR
FT                   TLART"
FT   sig_peptide     252744..252830
FT                   /locus_tag="Pput_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.560 at
FT                   residue 29"
FT   gene            253482..253952
FT                   /locus_tag="Pput_0213"
FT   CDS_pept        253482..253952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0213"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit,
FT                   Rsd/AlgQ"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76388"
FT                   /db_xref="GOA:A5VWX8"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWX8"
FT                   /protein_id="ABQ76388.1"
FT                   /translation="MLDSCQNAQERWGGVHKLIDRWLEERQELVQAFRALRDVRPAFAD
FT                   KDTNGDFCALLVDYVSAWHFEVCEQLVSEAKAFGDKKALKLAEEINPRINDSTQIALAF
FT                   NDHCTKGECKDTERFAEKLAKLGGLLHERFELEDCLIEVLHNAHKEEGAVQA"
FT   gene            complement(253961..254599)
FT                   /locus_tag="Pput_0214"
FT   CDS_pept        complement(253961..254599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0214"
FT                   /product="peptidylprolyl isomerase, FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76389"
FT                   /db_xref="GOA:A5VWX9"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWX9"
FT                   /protein_id="ABQ76389.1"
FT                   /translation="MPRYLVLGLCLMAPLALADNDDHDLAYSLGASLGERLRQEMPGLQ
FT                   LDALVEGLKQSYQGQPLKLDKARMQAVLQQHETQEGDAAVQKLQAAETRFMANERGRYG
FT                   VHELTEGVLYSELQPGTGVQPKAGGKVQVRYVGRLPDGSIFDQNQTPQWFNLDSVIEGW
FT                   QVALPKMHTGAKWRLVIPSAQAYGAEGAGDLIAPYTPLVFEIELLAVGD"
FT   sig_peptide     complement(254543..254599)
FT                   /locus_tag="Pput_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.998 at
FT                   residue 19"
FT   gene            254778..255800
FT                   /locus_tag="Pput_0215"
FT   CDS_pept        254778..255800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWY0"
FT                   /protein_id="ABQ76390.1"
FT                   /translation="MSAKKKPVSTPLHLLQQLSGSLLEHLEEACSQALADAEKLLAKLE
FT                   KQRGKAQEKLHNGRLKLQDAAKAGKAKAQSKAQKAIGELEELLESLKERQTQTRSYIQQ
FT                   LKRDAQDSLKLAQGVGKVREAAGKALDQRVAKPVAKATAAAKPAAKPAAKATAAAKPAA
FT                   KPAARATAAAKPAAKPAAKATAAAKPAAKPAAKATAAAKPAAKPAAKATAAAKPAAKPA
FT                   TKATAAAKPAAKPAAKATAAAKPAAKPAAKATAAAKPAAKATAAAKPAAKPAAKAPAAK
FT                   PAAKPAAAKAPARTAAKAAAKPAEAKPATPPAATTNSVSPPAAAPSAPVSTPAQAPSAS
FT                   "
FT   gene            complement(255779..256258)
FT                   /locus_tag="Pput_0216"
FT   CDS_pept        complement(255779..256258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0216"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76391"
FT                   /db_xref="InterPro:IPR012659"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWY1"
FT                   /protein_id="ABQ76391.1"
FT                   /translation="MHTDLWNYALTLYTRPGVEAACLELQALGGDVCLLLCATWLQARG
FT                   VAVLGERAQALQELAEPWQRDVVAPLRSLRQQWRATASGDTQLAALREQVKGLELQAEK
FT                   ALLERLQERSQQWPVGSHEPADDWLARLAPDQALHHDALVQLRVAAAALQDAEGA"
FT   gene            256309..258219
FT                   /locus_tag="Pput_0217"
FT   CDS_pept        256309..258219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0217"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76392"
FT                   /db_xref="GOA:A5VWY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWY2"
FT                   /protein_id="ABQ76392.1"
FT                   /translation="MIRLSNLTLQRGPQRLLEGAEMTLHAGHKAGLIGANGAGKSSLFA
FT                   LLRGELSPDAGDCQLPGDWRIAHMRQEVDTLDRLAVDYVLDGDVRLRKVQAELAAAEQA
FT                   HDGTALARLHSELESADGYTADARARKLLAGLGFTNEQMDRRVGDFSGGWRMRLNLAQA
FT                   LMCPSDLLLLDEPTNHLDLDAILWLEDWLKGYPGTLLLISHDRDFLDAVVDHVLHVEQR
FT                   KLNLYKGGYTAFERTRAERLAQQQQAYEKQQAQRAHMEKYIARFKAQATKARQAQSRIK
FT                   ALERMEELSAAHVDSPFDFVFRESQKISSPLLSLSEGRLGYGDKAILDKVKLQLTPGAR
FT                   IGLLGPNGAGKSTLIKNLAGELEPLSGRLVRGENLAVGYFAQHQLDSLDDKASPLLHLQ
FT                   RIAPTEREQTLRDFLGGFDFHGARCDEPVVNFSGGEKARLALALIAWERPNLLLLDEPT
FT                   NHLDLEMRLALTMALQEFAGAVVVVSHDRHLLKSTTDDFLLVADGKVDTFDGDLEDYSR
FT                   WLVEYRQRSAPASTAPANPDKTDKKAQRQAAAALRQQLAPHKKAADKLETELNQVHTQF
FT                   AEIETALGDGGLYEAARKDELRDLLARQTKLKQREGELEEAWMEALETLESMQAELEAL
FT                   S"
FT   gene            258219..258806
FT                   /locus_tag="Pput_0218"
FT   CDS_pept        258219..258806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0218"
FT                   /product="Small-conductance mechanosensitive channel-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76393"
FT                   /db_xref="GOA:A5VWY3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWY3"
FT                   /protein_id="ABQ76393.1"
FT                   /translation="MEELRSLLPGQWMDTFWLGLQILLILAAAFVLQRIIARGLSRLGQ
FT                   RYPLPPELLVPVRGGLRWLIMGSALLFVLERMGVSATVLWTALSGFVAVAAVAFFAMWS
FT                   VLSNLLCAVLIFTVGPFRIGDVVELVDTLDKPGVKGRVIAINLLFTTLLEVPEAGGALV
FT                   QVPNSQFFQKSVRRWRGAEVQALHKETAAEAD"
FT   gene            259005..259637
FT                   /locus_tag="Pput_0219"
FT   CDS_pept        259005..259637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0219"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA)"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76394"
FT                   /db_xref="GOA:A5VWY4"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWY4"
FT                   /protein_id="ABQ76394.1"
FT                   /translation="MSMEVWLGFFAACWVISLSPGAGAIASMSSGLQYGFWRGYWNALG
FT                   LQLGLIMQIAIIAAGVGAVLAASATAFQVIKWFGVAYLVYLAYKQWRALPMDMSEESGV
FT                   RPIGKPLSLVFRGFLVNISNPKALVFMLAVLPQFLNPHAPLLPQYVAITVTMVTVDLLV
FT                   MAGYTGLASHVLRMLRTPKQQKRLNRTFAGLFIGAATFLATLRRAPV"
FT   sig_peptide     259005..259079
FT                   /locus_tag="Pput_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.839) with cleavage site probability 0.450 at
FT                   residue 25"
FT   gene            complement(259683..260444)
FT                   /locus_tag="Pput_0220"
FT   CDS_pept        complement(259683..260444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0220"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="PFAM: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76395"
FT                   /db_xref="GOA:A5VWY5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWY5"
FT                   /protein_id="ABQ76395.1"
FT                   /translation="MTMFMQVGFGAVLIVLAMLVLSAFRILREYERGVVFQLGRFWQVK
FT                   GPGLILLIPVIQQMVRVDLRTVVLDVPPQDVITRDNVSVKVNAVLYFRVLDPQKAIIQV
FT                   EDFLVATSQLAQTTLRAVLGKHELDELLAEREQLNMDIRQVLDAQTDAWGIKVANVEIK
FT                   HVDLNESMVRAIARQAEAERERRAKVIHAEGELQASEKLMQAAQMLSKEPGAMQLRYMQ
FT                   TLGTIAGDKSSTIVFPLPIDLLKGLVDKEKE"
FT   sig_peptide     complement(260373..260444)
FT                   /locus_tag="Pput_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.696) with cleavage site probability 0.346 at
FT                   residue 24"
FT   gene            complement(260441..261787)
FT                   /locus_tag="Pput_0221"
FT   CDS_pept        complement(260441..261787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0221"
FT                   /product="Nodulation efficiency protein NfeD"
FT                   /note="PFAM: protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76396"
FT                   /db_xref="GOA:A5VWY6"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWY6"
FT                   /protein_id="ABQ76396.1"
FT                   /translation="MIARCWRWLLLLLLLGITPGGQAAPGAVWVLGIDDAIGPASADYL
FT                   VRSLSQAQAQGAQLVVIRMDTPGGLDSAMRQMIKAILASTVPVASYVAPSGARAASAGT
FT                   YILYASHVAAMAPGTNLGAATPVRIGGPPGTPSDDKAKGGDDETLARKQVNDAAAYIRG
FT                   LAQMRGRNADWAEKAVREAVSLSASEALRLNVIDQVADDLPDLLRKLDGKTLQVAGQPR
FT                   QLQTAGASVVEHLPDWRTRVLAVITNPSVALILIMIGVYGLLFEFMNPGSAVGGVVGGI
FT                   CLLLALYALQLLPVSFAGVALILLGITFMIAEAFLPSFGVVGFGGIVAFVVGALILIDT
FT                   DAPGFGIPLALIGTLALLSALLIGGVLGMALKARRRALVSGDAGLVGSLVTVTQVMASD
FT                   PFCGVVLAQGEQWQVQCATPLQTGQNVRVTARHGVMLEVSAAAPATQGE"
FT   sig_peptide     complement(261716..261787)
FT                   /locus_tag="Pput_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            261886..262344
FT                   /locus_tag="Pput_0222"
FT   CDS_pept        261886..262344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0222"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76397"
FT                   /db_xref="GOA:A5VWY7"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWY7"
FT                   /protein_id="ABQ76397.1"
FT                   /translation="MRMAKTLQARLDKANCDYDIIPHPHSATSLESARTAGVPAERVAK
FT                   SVMLDDRHGNYIMAVLPANRHLDMTKVRMSGAWHLTRESGLPSLFNDCERGAVPALGDA
FT                   YQIKMLLDPSLTRQGDVYLEAGDHDHLIHMSMEQYMKLVPHAEVRELC"
FT   gene            262406..262648
FT                   /locus_tag="Pput_0223"
FT   CDS_pept        262406..262648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76398"
FT                   /db_xref="InterPro:IPR021250"
FT                   /db_xref="InterPro:IPR038086"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWY8"
FT                   /protein_id="ABQ76398.1"
FT                   /translation="MEAPIHPFAELFKQLGLPDDPTSIDQFITSHSPLKNEIRLVDAPF
FT                   WTDSQRAFLQDSIIEDSDWAVPFDQLNEALRRPRK"
FT   gene            262718..263356
FT                   /locus_tag="Pput_0224"
FT   CDS_pept        262718..263356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76399"
FT                   /db_xref="GOA:A5VWY9"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWY9"
FT                   /protein_id="ABQ76399.1"
FT                   /translation="MKDPYAPGFWCSVTILGTLTASYFYGIRQTQQMNQAVHFLYAAAA
FT                   VTVAVALVALTWIAWQQLRLNKREVVQGRTLLTIWNTKVALRRVETVFDRYFWGSYWHS
FT                   GRTFEEVMGELRGTPLEQSLDALKRQCRVLDREIHDRHHHWLANARDLSSVAQAMARER
FT                   YQLDLGEPTHSGHGNTAVLNRDLEVLVYTWSARLRSFDHQLDELERAYH"
FT   gene            complement(263363..263800)
FT                   /locus_tag="Pput_0225"
FT   CDS_pept        complement(263363..263800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0225"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76400"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWZ0"
FT                   /protein_id="ABQ76400.1"
FT                   /translation="MKTVEQILKTKSQHQTVYTIGPDDSVLDALKLLAEKNIGALPVVE
FT                   GGQVVGIVSERDYARKLVLKGRSSAATPVREIMSAPVVTVDPKQKLDFCMNLMTDRHLR
FT                   HLPVVDNGRLLGLLSIGDLVKETIDEQASLIKQMEQYIRGE"
FT   gene            complement(263971..265728)
FT                   /locus_tag="Pput_0226"
FT   CDS_pept        complement(263971..265728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0226"
FT                   /product="dipeptidase, putative"
FT                   /note="TIGRFAM: dipeptidase, putative; PFAM: peptidase M20"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76401"
FT                   /db_xref="GOA:A5VWZ1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010964"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWZ1"
FT                   /protein_id="ABQ76401.1"
FT                   /translation="MIGKGMRTTMQLKKLTATTLLLAGIGLFTQPAQANLTQQQSAAIV
FT                   KAFDGSDPSDFRQFLGKLKGSALGKADNLEATVDAYLANKPLAAEQQDEINRLLGLYTR
FT                   IKYGKAATETLRELVAIPTFNVEGTPQYENPEFLKIADKIKALADRFGLAFRNIDNRVY
FT                   EISLGSGKEVIGIHAHADVVPVNPDNWKLADGTRLDPFKVTLVGDRMYGRGTEDDKNGI
FT                   VVAMYALKVAKDENLPLARQFKLLIDTTEETSGDAIPYYFERNPTPDYNLALDGGYPVV
FT                   IAEKGYGTVMASFTKRPASGKGAEIVNLTGGLATNQIPTTSVATLISDNPAQLVKHLQQ
FT                   AGARYVKQHGSDFSIDAKADGKQVLLTVTGVSAHSSEPESGINPVARMLDFINGLGQQV
FT                   SLKHNHFTDAARYAAENWGLDYLGNTLGVAFKDPFMGPLTTSLTFVGVDDKGLKLAVNL
FT                   RIPKGKPIATIKDELADKLGKWTRQSNTSVAFDYSLDEPMYRNPEGEWVKALLAVATEN
FT                   LGMKHEFGTSAGATSVHDLPNGVQFGLAMPDVKYTGHNDNEFKTVEQFMLDLQVVSEMV
FT                   ARIGQMPKL"
FT   sig_peptide     complement(265624..265728)
FT                   /locus_tag="Pput_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 35"
FT   gene            complement(265864..265940)
FT                   /locus_tag="Pput_R0005"
FT                   /note="tRNA-Arg7"
FT   tRNA            complement(265864..265940)
FT                   /locus_tag="Pput_R0005"
FT                   /product="tRNA-Arg"
FT   gene            266070..266189
FT                   /pseudo
FT                   /locus_tag="Pput_0227"
FT   gene            266409..267851
FT                   /locus_tag="Pput_0228"
FT   CDS_pept        266409..267851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0228"
FT                   /product="succinate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.16"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76402"
FT                   /db_xref="GOA:A5VWZ2"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWZ2"
FT                   /protein_id="ABQ76402.1"
FT                   /translation="MQLKDAQLFRQQAYINGEWLDADNGQTIKVTNPATGEVIGTVPKM
FT                   GTAETRRAIEAADKALPAWRALTAKERSAKLRRWFELMIENQDDLARLMTTEQGKPLAE
FT                   AKGEIAYAASFIEWFAEEAKRIYGDTIPGHQPDKRLIVIKQPIGVTAAITPWNFPAAMI
FT                   TRKAGPALAAGCTMVLKPASQTPYSALALVELAHRAGIPAGVLSVVTGSAGEVGGELTG
FT                   NSLVRKLSFTGSTEIGRQLMEECAKDIKKVSLELGGNAPFIVFDDADLDKAVEGAIISK
FT                   YRNNGQTCVCANRIYVQDGVYDAFAQKLAAAVAKLKIGNGLEEGTTTGPLIDGKAVAKV
FT                   QEHIEDAVSKGAKVLSGGKLIEGNFFEPTILVDVPKTAAVAKEETFGPLAPLFRFKDEA
FT                   EVIAMSNDTEFGLASYFYARDMSRVFRVAEALEYGMVGINTGLISNEVAPFGGIKASGL
FT                   GREGSKYGIEDYLEIKYLCISV"
FT   gene            268034..269311
FT                   /locus_tag="Pput_0229"
FT   CDS_pept        268034..269311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0229"
FT                   /product="4-aminobutyrate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.19"
FT                   /note="TIGRFAM: 4-aminobutyrate aminotransferase; PFAM:
FT                   aminotransferase, class I and II; aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76403"
FT                   /db_xref="GOA:A5VWZ3"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWZ3"
FT                   /protein_id="ABQ76403.1"
FT                   /translation="MSKTNESLMQRRVAAVPRGVGQIHPIFVDTAKNSTVIDVEGRELI
FT                   DFAGGIAVLNTGHLHPKVVAAVQEQLTKVSHTCFQVLAYEPYVELCEKINKLVPGDFDK
FT                   KTLLVTTGSEAVENAVKIARAATGRAGVIAFTGGYHGRTMMTLGLTGKVVPYSAGMGLM
FT                   PGGIFRALFPSELHGISVDDAIASVERIFKNDAEPRDIAAIILEPVQGEGGFLPAPKEL
FT                   MKRLRALCDQHGILLIADEVQTGAGRTGTFFAMEQMGVAPDLTTFAKSIAGGFPLAGVC
FT                   GKAEYMDAIAPGGLGGTYAGSPIACAAALAVIEVFEEEKLLDRSKAVGERLTAGLREIQ
FT                   KKYPIIGDVRGLGSMIAVEVFEKGTHTPNAAAVGQVVAKAREKGLILLSCGTYGNVLRI
FT                   LVPLTAEDALLDKGLAIIEECFAEIA"
FT   gene            269449..270708
FT                   /locus_tag="Pput_0230"
FT   CDS_pept        269449..270708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0230"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: response regulator receiver; Metal-dependent
FT                   hydrolase HDOD"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76404"
FT                   /db_xref="GOA:A5VWZ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWZ4"
FT                   /protein_id="ABQ76404.1"
FT                   /translation="MSAAAPTPPSVLIVEGDPWVRDMLSEMLLSVRCDARLQVCADGAQ
FT                   ALSALSSKPDLIIAARELAGVDGLDLLRKVRAKGPGVPFILMSNRNDSASVREALPLHP
FT                   TAYLSKPLNLDNLRKRLQELLLAVGEEIACPVPALQAGASLPAYLEQRRATADGGPLLA
FT                   DVQVAINRALNPQGLNLRVLEEEVRNDPQVTAVLIAAANSAALHREAPVQTLLQALNKL
FT                   GSTQSMNLILGMTLKRSARLSDPLLAEHAARYWDLSLHTAEYGRTLARMLELDEGRCYC
FT                   AGLLHCLGDLAVLRCLQEWRLAGGDLDERNVQQSLEEFGAAFGSALRTRWRLPLALREL
FT                   IAAIYQLGGGVYSREILAMNLAGQLSRLPAGQGLEKVASGKTARLLKLGLPELRRLRKE
FT                   ENPEVKPQEEPPVAGAEVSS"
FT   gene            complement(270811..271839)
FT                   /locus_tag="Pput_0231"
FT   CDS_pept        complement(270811..271839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0231"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; PAS fold-3 domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76405"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWZ5"
FT                   /protein_id="ABQ76405.1"
FT                   /translation="MLAARFHVETCSVHMAKNIPTIFPGTPPPEAAQTLLALLHAQGEV
FT                   ARLSERDQLFSSLLDSVNAVLWAFDWETRQVLYVSPAYERIFGRPVSLVLADYNEWRDS
FT                   IYPDDLEFAERSLAQVLLKGAVEDREYRILNADGQLRWLSDKCYINQQHDGDRVIIVGI
FT                   AEDITEKKQLEGELQRLATTDVLTQSSNRRHFFECAQQAFDSAREDGTPLAFLLLDIDD
FT                   FKRINDSYGHQEGDQVLQHIADSGKAVLRRGDLFGRIGGEEFAAVFPGCNAQVAEQIAE
FT                   RLQRQIQHLSFSHGQQTYGVTVSQGLTELTDEDVALDSLYARADAAMYQAKRQGKNQIV
FT                   RG"
FT   gene            complement(271939..273123)
FT                   /locus_tag="Pput_0232"
FT   CDS_pept        complement(271939..273123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0232"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76406"
FT                   /db_xref="GOA:A5VWZ6"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR015876"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWZ6"
FT                   /protein_id="ABQ76406.1"
FT                   /translation="MWYNGLLDLSAWQLVGITLLMTHVTIVSVTVYLHRYSAHRALELN
FT                   GALKHFFRFWLWLTTAQNTREWTAVHRKHHAKCETPDDPHSPVYKGLGTVLRKGAELYR
FT                   EEARNPETLRIYGKNCPDDWIERNLYSRYKLGGIALMAVIDLLLFGTLGITIWAVQMMW
FT                   IPFWAAGVVNGLGHALGYRNFECRDAATNLVPWGIIIGGEELHNNHHTYPNSAKLSVKR
FT                   WEFDMGWAWIRLFCLLRLAKVQRVAPIAHRVAGKASLDMDTAMAILNNRFQIMAQYRKL
FT                   VIGPLVKQELARVDASVRYRFRRAKRLLSRETSLLEDRHHVRIESMLAHSQALKTIYEK
FT                   RLALQQIWARTSANGHDMLAAMKDWVHEAETSGIQALRDFAAQLKTYSLRPTGA"
FT   gene            273270..275165
FT                   /locus_tag="Pput_0233"
FT   CDS_pept        273270..275165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0233"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76407"
FT                   /db_xref="GOA:A5VWZ7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWZ7"
FT                   /protein_id="ABQ76407.1"
FT                   /translation="MSVSVRDALRMAALYVVLSILWLALAEVMLHSMTDDPLALTVGRQ
FT                   INVVVWVLLSAVLIYVSRVRLLNFIGHGARLRCEDRERLRMAAAVFDSTLEGVLVTDRQ
FT                   GLIVHVNRAFMRITGYQQDEVIGQRPSKFKSGRHGLAFYQEIFATLAEKGEWSGEIWNR
FT                   RKSGEIYPQWQTICAIRDDEGELSHYVAVFSDISAIKHSEQELAYLAHHDPLTGLPNRL
FT                   LFTDRVEQALAVAQANKRGCALLLLDLDHFQSINDGLGHTIGDQLLKLVGERLGEVLGN
FT                   GMTLARLGGDEFGVLAENCQQVGQAGKLAQCIIERMREPFQFEGNRLFISASVGISLFP
FT                   SDALSAEQLLRNADSALYKAKSNGRACYALYTEELTAHAQHRVETAAELRRALEQDELR
FT                   VYFQPVHDLATGRQVGVEALVRWQHPGRGLVPPSEFIPIAERTGLIAEIDTWVLQQACR
FT                   QMVQWQAEGRQLAFVGVNISSRLFGQHELYRQIAEVLHDTGLAPALLELEVTESAVMED
FT                   PEVALEQLHRLRELGVTLAIDDFGTGYSSLLRLKRLPVQKLKIDQGFVAGLPVDEDDIA
FT                   IVRVIIALARSMGMQVHAEGIEQTEQASFLLQEECQLGQGYWFGRPVPAEDLRWD"
FT   gene            complement(275193..275837)
FT                   /locus_tag="Pput_0234"
FT   CDS_pept        complement(275193..275837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0234"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76408"
FT                   /db_xref="GOA:A5VWZ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWZ8"
FT                   /protein_id="ABQ76408.1"
FT                   /translation="MWFDRLLEGLLDTLLMVGVSSLIALLVGVPMAVLLVTSDKGGIFE
FT                   ARLLNRVLGAFVNLFRSIPFLILMVALIPFTRLVVGTTYGVWAAVVPLTIAATPFFARI
FT                   AEVSLREVDHGLVEAAQAMGCRRWHIVWHVLLPEALPGIVGGFTITLVTLINSSAMAGA
FT                   IGAGGLGDIAYRYGYQRFDSQIMLTVIAMLVALVALIQLGGDRLAKGLNKR"
FT   gene            complement(275827..276936)
FT                   /locus_tag="Pput_0235"
FT   CDS_pept        complement(275827..276936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0235"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76409"
FT                   /db_xref="GOA:A5VWZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:A5VWZ9"
FT                   /protein_id="ABQ76409.1"
FT                   /translation="MSQASALRAPTPQALPPIAKEQALRPEVNEAHVRFIGLGKTYPGQ
FT                   AQPALQGIDLNIRHGEIFGIIGRSGAGKSSLLRTINRLEQPSQGRVLIDQVDIAPFDED
FT                   QLVALRRRIGMIFQHFNLMSAKTVWQNVELPLKVAGVAKAERQRKVRELLELVGLQEKH
FT                   HVYPAQLSGGQKQRVGIARALVHTPEILLCDEATSALDPETTASILELLRDINQRLGLT
FT                   IVLITHEMAVIRDICHRVVVLERGAVVEQGEVWRVFGSPRHEVTRTLLAPLQAKLPAAL
FT                   QASLQAHPASGNSAVVLKLTVLGEPELSALFNDLGGRVRLLQGGVETIGEHALGQLILS
FT                   VQHSPHDTHQLLERARRWAEDVEVLGHVV"
FT   gene            complement(276938..277738)
FT                   /locus_tag="Pput_0236"
FT   CDS_pept        complement(276938..277738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0236"
FT                   /product="NLPA lipoprotein"
FT                   /note="PFAM: NLPA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76410"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX00"
FT                   /protein_id="ABQ76410.1"
FT                   /translation="MLEKLFRPVAAIAITLGLCAGTLAAEPLKIGTTSAFAIPLEAAVE
FT                   EAHKRGLEVKLIEFSDWIAPNVSLNSGDIDVNYFQHIPFLENAKAAAGFNLVPYAPGII
FT                   NNVGLYSKKYKSFAELPEGASVAIANDPINSGRGLLLLAKAGLITLKPGVGYKATEDDI
FT                   LANPKKLKILQVEAVQLVRAYDDADLVQGYPAYIRLANTFDATSALLFDGLENKEYVIQ
FT                   FVIRPQSKDDPRLAQFVDIYQHSPVVRAALNKAHGKLYQAGWEG"
FT   sig_peptide     complement(277664..277738)
FT                   /locus_tag="Pput_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.806 at
FT                   residue 25"
FT   gene            complement(277731..279116)
FT                   /locus_tag="Pput_0237"
FT   CDS_pept        complement(277731..279116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0237"
FT                   /product="Coenzyme F420-dependent N5 N10-methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76411"
FT                   /db_xref="GOA:A5VX01"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX01"
FT                   /protein_id="ABQ76411.1"
FT                   /translation="MAKQILLNAFNMNCIGHINHGLWTHPRDTSTQYKTLDYWTNLARL
FT                   LERGLFDGLFIADIVGTYDIYGQSLDVTLKESIQLPVNDPLLLVSAMAAVTRHLGFGLT
FT                   ANLTYEAPYLFARRLSTLDHLSNGRVGWNIVTGYLDSAARAMGLAQQPAHDRRYDQADE
FT                   YLQVLYKLLEGSWADDAVVADREHRVYATPDKVRKVQHQGEFYKVEGYHLCEPSPQRTP
FT                   VLFQAGSSARGLAFAGNHAECVFISGQDKAATRAQVDKVRAAAQAAGRDPQAVKVFMGI
FT                   TVIVAATEQLAQAKHAEYLRHASAEAGVAHFAASTGIDFAAYELDEPIAFNQGNAIQSA
FT                   TRQLQDNAWTRRRLLQQHALGGRYVTLVGAPEQVAEQLIAWIDETGLDGFNLTRTVTPE
FT                   SFEDFVELVIPQLQQRGRYKTAYTEGTLREKLFHTDHPHLPADHPGSAYRFTPTPTGAL
FT                   HHA"
FT   gene            complement(279116..280297)
FT                   /locus_tag="Pput_0238"
FT   CDS_pept        complement(279116..280297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0238"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal domain
FT                   protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76412"
FT                   /db_xref="GOA:A5VX02"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX02"
FT                   /protein_id="ABQ76412.1"
FT                   /translation="MTIAIITSDAQALAVAEDIAQQLRRDSALRDRERRLPLAELELFT
FT                   RSGLWAISVPKAFGGAGVSNVTLAKVIARIAQADGSLGQIPQNHFYGLEVLRVNGSPEQ
FT                   QQRLYAEVLAGRRFGNALAELGTKTAHERTTRLSRDGDGFRINGRKFYSTGAIYAQRIP
FT                   TSVVDEQGIQQLAFVPADSQGLQVIDDWSGFGQRTTGSGSVVFDNVYVSAADVVPFQSA
FT                   FERPTPVGPLAQILHAAIDTGIARAAYEDALHFVRTRSRPWVDSGLDKATDDPLTLKSF
FT                   GHLAVRLHAAEALLERAGEYLDRARDDSTADNVAAASIAVAEARAISTEISLTAGTTLF
FT                   ELGGSQATLAEHNLDRHWRNARVHTLHDPVRWKYHAIGNYYLNDANPPRRGTI"
FT   gene            complement(280439..281680)
FT                   /locus_tag="Pput_0239"
FT   CDS_pept        complement(280439..281680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0239"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal domain
FT                   protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76413"
FT                   /db_xref="GOA:A5VX03"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX03"
FT                   /protein_id="ABQ76413.1"
FT                   /translation="MPSQANTQFHSDLDSSPPLLPAKVLRNDAEALQAARELAEVAREQ
FT                   AARRDQQRKLPWAEIELFTRSGLGSISVPKAYGGPDVSFATVAEVFRLISAADPALGQI
FT                   PQNQFGMLQLLRLTASEAQQARIFRSVLDGWRIGNAGPERGTRDTLTLKARITRAGDSY
FT                   RISGEKFYSTGALFAHWVAVKALDDEGRQRLAFVRRGSPGLRIVDDWSGFGQRTTASGT
FT                   VLLDQVPVDAELVIDNWRQRDIPNIQGAASQLIQAAIDAGIAEAAIDDAITFVREKSRP
FT                   WIEANVDRASDDPYVIADIGRLKLELHAAEALLRKAARVLDEVNAAPIDAASAARASIA
FT                   VAEAKVLTTEIALQASEKLFELAGSRATLAEFNLDRHWRNARVHTLHDPVRWKYHAVGA
FT                   YHLNGTLPARHSWI"
FT   gene            complement(281998..282756)
FT                   /locus_tag="Pput_0240"
FT   CDS_pept        complement(281998..282756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0240"
FT                   /product="L-cystine ABC transporter ATP-binding protein /
FT                   Diaminopimelate ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76414"
FT                   /db_xref="GOA:A5VX04"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX04"
FT                   /protein_id="ABQ76414.1"
FT                   /translation="MIEVKGLTKRFKGQTVLNGIDLTVQPGEVVAIIGPSGSGKTTFLR
FT                   CLNLLETPDAGQIQIGAISIDANRPLGGQQGAIRRLRQQAGFVFQNFNLFPHRTALENV
FT                   IEGPVIVKKTPREQAIELGRRLLAKVGLAGKEDAYPRRLSGGQQQRVAIARALAMEPEV
FT                   ILFDEPTSALDPELVGEVLATIRGLAEEKRTMIIVTHEMSFARDVANRVIFFDKGVIVE
FT                   QGEAKALFAAPKEERTRQFLRKFLGTAASE"
FT   gene            complement(282759..283427)
FT                   /locus_tag="Pput_0241"
FT   CDS_pept        complement(282759..283427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0241"
FT                   /product="L-cystine ABC transporter membrane protein /
FT                   Diaminopimelate ABC transporter membrane protein"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76415"
FT                   /db_xref="GOA:A5VX05"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX05"
FT                   /protein_id="ABQ76415.1"
FT                   /translation="MIAESLQLVVDSAPFLLKGAGYTVLLSVGGMFFGLVLGFALALMR
FT                   LSKILPLNWLARVYVSFFRGTPLLVQLFVIYFGMPQIGIELDPIPASLIGLSLNMAAYI
FT                   CEILRAAISSIDRGQWEAAASIGMTRVQAMRRAILPQALRTALPPLGNSFISLVKDTAL
FT                   AATIQVPELFRQAQLITARTFEVFTMYVAVAVIYWVLCSILAHFQNRMEARVNQHDQEH
FT                   "
FT   gene            complement(283424..284218)
FT                   /locus_tag="Pput_0242"
FT   CDS_pept        complement(283424..284218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0242"
FT                   /product="L-cystine-binding protein /
FT                   Diaminopimelate-binding protein"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; SMART: ionotropic glutamate receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76416"
FT                   /db_xref="GOA:A5VX06"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX06"
FT                   /protein_id="ABQ76416.1"
FT                   /translation="MSKFAKPLLNASLALLLGAGLLSQAFAGEQLKTIQEKGVINVGLE
FT                   GTYPPFSFQDENGKLTGFEVELSELLAKELGVKAKIQPTKWDGILAALESKRLDVVVNQ
FT                   VTISEERKKKYDFSEPYTVSGIQALILKKKAEQLNIKGAQDLAGKKVGVGLGTNYEQWV
FT                   KKDVPQADVRTYEDDPSKFADLRNGRIDAILIDRLAALEYAQKAKDTQLAGDAFSRLES
FT                   GVALRKGEPELLAAINKAIDKLKADGTLAKLSEKYFGADVTK"
FT   sig_peptide     complement(284135..284218)
FT                   /locus_tag="Pput_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            284526..285458
FT                   /locus_tag="Pput_0243"
FT   CDS_pept        284526..285458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0243"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76417"
FT                   /db_xref="GOA:A5VX07"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX07"
FT                   /protein_id="ABQ76417.1"
FT                   /translation="MSEQPSSAHWQLQSIVTGLRGAREQWRTRNGRSIGEQGGRELPSR
FT                   EAMRQILEQLCGALFPMRLGPVDLREESEDFYVGHTLDAALTALLAQARLELRYAARQS
FT                   KAELAGVDARALSLIQGFAAALPELRILLDTDVLAAYHGDPAARSVDEVLLCYPGILAI
FT                   IHHRLAHHLYKAGLPLLARISSELAHSATGIDIHPGAQIGPSFFIDHGTGVVIGETAII
FT                   GERVRIYQAVTLGAKRFPSDESGTLHKGLPRHPIVEDDVVIYAGATVLGRITIGKGSTI
FT                   GGNVWLTRSVPAESNITQANLQLDCQDKN"
FT   gene            285729..287732
FT                   /locus_tag="Pput_0244"
FT   CDS_pept        285729..287732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0244"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76418"
FT                   /db_xref="GOA:A5VX08"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX08"
FT                   /protein_id="ABQ76418.1"
FT                   /translation="MSAPNPSAANGKIRMNPPVFYFAASFILIFGLVVISNPQAAGDWL
FT                   LAAQNWAANTVGWYYMLAMTLYLVFVVVTALSGYGKIKLGADHDEPEFSYLSWAGMLFA
FT                   AGISITLFFFCVSEPLTHMLQPPQGEAGTVEAGRQAMQILFLHWGLHGWGVFAFVGMAL
FT                   AYFAYRHNLPLALRSALYPLIGKRINGPIGYAVDGFGIIATVFGLGADMGFGVLHLNAG
FT                   LDYLFGISHSQWVQVILITLMMGAAVAVAVAGVEKGVRVMSDINLFLACALLLFVLFAG
FT                   PTQHLFNTLIQNLGDYLGALPRKSFDVYAYGENRGWLGGWTVFYWAWWIAWAPFVGLFI
FT                   ARISRGRTIREFVFGVLLIPLGFTLAWMSIFGNSALDQVINHGMTALGQSALDNPSMSL
FT                   YLLLETYPWSKAVIATTVFISFVFFVTSADSGTVVLSTLSAKGGDADEDGPNWLRIFWG
FT                   AMTALITSALLFAGSIDSLKSAVVLTSLPFSLILLCMMWGLHKAFYLESQRQIAQMHSL
FT                   APFAQSRRGRGGWRQRLSQAVHFPSRDEVYRFMDDVVRPAIADVREVFEQKGLVLITQD
FT                   DPSHDNVSLKIGHGEEQPFIYQVQMRGYFTPSFALGGLGTQELKNRRYYRAEVHLSEGS
FT                   QNYDLVGYSKEQIINDILDQYERHMQYLHLVR"
FT   sig_peptide     285729..285851
FT                   /locus_tag="Pput_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.716) with cleavage site probability 0.553 at
FT                   residue 41"
FT   gene            complement(287856..288731)
FT                   /locus_tag="Pput_0245"
FT   CDS_pept        complement(287856..288731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0245"
FT                   /product="Taurine dioxygenase"
FT                   /EC_number="1.14.11.17"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76419"
FT                   /db_xref="GOA:A5VX09"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX09"
FT                   /protein_id="ABQ76419.1"
FT                   /translation="MSTPAHWRPIEETDMSLTITPLSPALGAQISGVDISRDISAEERD
FT                   AIEQALLQHQVLFLRDQPINPEQQARFAARFGDLHIHPIYPNVPDTPQVLVLDTAVTDV
FT                   RDNAVWHTDVTFLPTPALGAVLSAKQLPAYGGDTLWASGIAAFEALSAPLREMLGGLTA
FT                   THDFTKSFPLERFGTTPEDLTRWEATRRNNPPLSHPVVRTHPVSGRKALFVNEGFTTRI
FT                   NELSELESDALLRLLFAHATRPEFSIRWRWQEHDVAFWDNRVTQHFAVDDYRPNRRVMH
FT                   RATILGDAPF"
FT   gene            complement(288738..289577)
FT                   /locus_tag="Pput_0246"
FT   CDS_pept        complement(288738..289577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0246"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76420"
FT                   /db_xref="GOA:A5VX10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX10"
FT                   /protein_id="ABQ76420.1"
FT                   /translation="MSSLDLPVAGKHNTQTRPAATLRHPLSTRWISTLTLASLLLAWWL
FT                   VTAAGWVEPLFLPSPGDILAKAWTLLTQGYMDASLWQHLGASLGRIGLALVAATLTAIP
FT                   VGIAIGYNRVARGILDPLIEFYRPIPPLAYLPLIVIWCGIGELSKVLLIYLAIFAPIAI
FT                   ATATGVRTVDPAKLRAAQSLGASKAQLIRHVILPSALPDILTGIRIGLGVGWSTLVAAE
FT                   LIAATSGLGFMVQSAAQFLVTDVVVLGILLIALIAFALEMSLRALQRKLVPWHGQIH"
FT   gene            complement(289574..290362)
FT                   /locus_tag="Pput_0247"
FT   CDS_pept        complement(289574..290362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0247"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76421"
FT                   /db_xref="GOA:A5VX11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX11"
FT                   /protein_id="ABQ76421.1"
FT                   /translation="MALLELERISAQYPGASTPVLADINLSLGPRQLLVALGPSGSGKT
FT                   SLLNLIAGFVAPSGGDITLDGVPVQGPGAERGVVFQDDALLPWQNVLGNVAFGLELAGV
FT                   PRAQREAKAREMLTLVDLDGFGERRIWQLSGGQKQRVGLARALAAAPRVLLMDEPFGAL
FT                   DAFTREQMQELLLQVWQRTAKPVFLITHDIEEAVFLASELVLLAPNPGRVVERLQLNFG
FT                   QRYAAGESARAIKSDPAFIETREHVLARVFSQRQSLQERA"
FT   gene            complement(290376..291347)
FT                   /locus_tag="Pput_0248"
FT   CDS_pept        complement(290376..291347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0248"
FT                   /product="taurine ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: taurine ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; NMT1/THI5 like; SMART:
FT                   extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76422"
FT                   /db_xref="GOA:A5VX12"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX12"
FT                   /protein_id="ABQ76422.1"
FT                   /translation="MIPHAPLRLFAALTLASTSWLAQAADLTVAYQTTVDPAKVAQVDG
FT                   DYEKASKASIDWRKFDNGADVITAVASGDVQIGYLGSSPLAAAATRKLPVETFLIATQI
FT                   GAGEALVARDSIKSPQDLIGKKVAVPFVSTGHYSLLAALKSWNIDPSKVQILNLAPPAI
FT                   IAAWKRGDIDATYVWDPALGVAKENGKVLITSGELAQKGAPTFDAWIVRKDFAEKHPDV
FT                   VKAFAKVTLDAYADYRKDPKAWLADKGNVDKLVKLSGAKASDIPVLLEGNVYPLAADQA
FT                   NALGAPTTQALTDTANFLKQQGKVEAVLPDYSPYVSAKFLPN"
FT   sig_peptide     complement(291273..291347)
FT                   /locus_tag="Pput_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            291866..293206
FT                   /locus_tag="Pput_0249"
FT   CDS_pept        291866..293206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0249"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76423"
FT                   /db_xref="GOA:A5VX13"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX13"
FT                   /protein_id="ABQ76423.1"
FT                   /translation="MYKSSLALAVALGVLAQQAGAAGFVEDSKLSLSSRTMYFNNDNRE
FT                   DHARPGAERPDQRESGQGFKLDYISGFTQGTVGFGVDAQALWGIHLDGGEGYHKSGFFP
FT                   DDGKGSAAQWARFGANAKARFSKTEAHFGSALAPNLPILVSNDGRLLPQTFEGGTIQSK
FT                   EIDNLTINAGQLTHAMGRASSNRTGLSVAGSNAESNKFRYGGLDYKLTPDLTLQYYYSN
FT                   LEDFYKQHFLGATHVFKIADDQSFKTDLRYFDSSSDGKNGNDSAYNFNNNGGYAKNTGE
FT                   IDNKTWSAMFTYTLGGHALMLGHQQVGDDGGFVWLNQGSLSNDSGTSEGAGGSSFYLFT
FT                   DSMINQFARAGENTTFGQYSYDFAALGVPGLKASVAYLRGDDIRNKSGSGTYNEWERDA
FT                   RIDYTLQEGALKGLGFSLRQGVYRGAGESSADQDQARFIVNYTYSFL"
FT   sig_peptide     291866..291931
FT                   /locus_tag="Pput_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.976 at
FT                   residue 22"
FT   gene            293372..294010
FT                   /locus_tag="Pput_0250"
FT   CDS_pept        293372..294010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0250"
FT                   /product="1-Cys peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76424"
FT                   /db_xref="GOA:A5VX14"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX14"
FT                   /protein_id="ABQ76424.1"
FT                   /translation="MSLKLGDIAPDFEQDSSEGKIRFHEWLGNSWGVLFSHPADFTPVC
FT                   TTELGLTAKLKDEFAKRGVKAIALSVDPVDSHHKWIDDINETQNTVVNFPIIADADRKV
FT                   SDLYDLIHPNASDTLTVRSLFIIDPNKKVRLTITYPASTGRNFNEILRVIDSLQLTDNH
FT                   KVATPGNWQDGDEVVIVPSLKDEEEIKQRFPKGYRAVKPYLRLTPQPNR"
FT   gene            294229..294822
FT                   /locus_tag="Pput_0251"
FT   CDS_pept        294229..294822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0251"
FT                   /product="FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76425"
FT                   /db_xref="GOA:A5VX15"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR020048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX15"
FT                   /protein_id="ABQ76425.1"
FT                   /translation="MLVVSIGGSPSLRSRSGVLLERSRQWLQDRGVEVVTFQVRDFPAE
FT                   DLLHARFDSPHVQHFQQLVAQADGLIVSTPVYKASFSGALKTLLDLLPERALAHKIVLP
FT                   IATGGSIAHMLAVDYALKPVLSALKAQETLQGIFADDSQVAYAEGTKPAQLVQALEERL
FT                   HDSLETFHVALARRPRPVAPGVLNERLISARWSI"
FT   gene            294908..295873
FT                   /locus_tag="Pput_0252"
FT   CDS_pept        294908..295873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0252"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SMART: extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76426"
FT                   /db_xref="GOA:A5VX16"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX16"
FT                   /protein_id="ABQ76426.1"
FT                   /translation="MRTVFLRRGLVALFAAAVSFGAITQAQAESLRIGYQKYGTLVLLK
FT                   AKGTLEKRLAEQGVQVQWTEFPGGPQLLEGLNVGSIDFGVTGETPPVFAQAAGADLLYV
FT                   AYEPPAPHSEAILVPKGSPIQSVKDLKGKKVVLNKGSNVHYLLVRALEDAGLKYSDIQP
FT                   VYLPPADARAAFERGSVDAWVIWDPYQAAAEQQLQARTLRDGKGLVDNHQFYLATRNYA
FT                   TQHPAVINTVIEEVRAVGEWSQANPQEVTDQVAPLLGLPAGITLTSVKRQGYGAAPLTP
FT                   EVVAAQQKIADTFQALKLIPKPLSIKDVIWTPPAKVASAP"
FT   sig_peptide     294908..294994
FT                   /locus_tag="Pput_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.874 at
FT                   residue 29"
FT   gene            295933..297081
FT                   /locus_tag="Pput_0253"
FT   CDS_pept        295933..297081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0253"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76427"
FT                   /db_xref="GOA:A5VX17"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019911"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VX17"
FT                   /protein_id="ABQ76427.1"
FT                   /translation="MSLNIFWFLPTHGDGKYLGTSEGARAVDHGYLQQIAQAADRLGFG
FT                   GVLIPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGIISPTVAARQAATLDRLSNGRAL
FT                   FNLVTGGDPDELAGDGLHLNHQERYEASVEFTRIWRKVLEGENVDYDGKHIQVKGAKLL
FT                   YPPIQQPRPSLYFGGSSEAAQDLAAEQVELYLTWGEPPAAVAEKIAQVREKAAAQGREV
FT                   RFGIRLHVIVRETNEEAWAAAERLISHLDDDTISRAQASLARFDSVGQQRMAALHGGNR
FT                   DNLEVSPNLWAGVGLVRGGAGTALVGDGPTVAARVKEYADLGIDTFIFSGYPHLEESYR
FT                   VAELLFPHLDVQRPEQPKTGGYVSPFGEMVANDILPKSVSQS"
FT   gene            297092..297889
FT                   /locus_tag="Pput_0254"
FT   CDS_pept        297092..297889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0254"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76428"
FT                   /db_xref="GOA:A5VX18"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX18"
FT                   /protein_id="ABQ76428.1"
FT                   /translation="MSRATSSNLTQRLAPWALPVLLLAIWQLAVSAGWLSTRILPAPSA
FT                   VVSAGVELVRSGEIWTHLAISGWRAGLGFVIGGSIGLVLGFITGLSNWGERLLDSSVQM
FT                   IRNVPHLALIPLVILWFGIDESAKIFLVALGTLFPIYLNTYHGIRNVDPALVEMARSYG
FT                   LSGFGLFRQVILPGALPSILVGVRFALGFMWLTLIVAETISANAGIGYLAMNAREFLQT
FT                   DVVVLAIVLYAVLGKLADLAARGLERVWLRWHPAYQVARKEGA"
FT   sig_peptide     297092..297190
FT                   /locus_tag="Pput_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.796 at
FT                   residue 33"
FT   gene            297886..298698
FT                   /locus_tag="Pput_0255"
FT   CDS_pept        297886..298698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0255"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76429"
FT                   /db_xref="GOA:A5VX19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX19"
FT                   /protein_id="ABQ76429.1"
FT                   /translation="MTVLKEQPPRLLRGTPLASKGLRKTFGQREVLKGIDLHIPAGQFV
FT                   AIVGRSGCGKSTLLRLLAGLDQPTAGQLLAGAAPLEEAREETRLMFQDARLLPWKKVID
FT                   NVGLGLSGDWRPRALEALDAVGLADRANEWPAALSGGQKQRVALARALIHQPRLLLLDE
FT                   PLGALDALTRIEMQQLIERLWRQHGFTVLLVTHDVSEAVAVADRVILIEDGEVGLDLTV
FT                   DLARPRARGSHRLAALESEVLNRVLSTPGTAPEPDPVAPLPTQLRWAH"
FT   gene            298726..298941
FT                   /locus_tag="Pput_0256"
FT   CDS_pept        298726..298941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0256"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76430"
FT                   /db_xref="GOA:A5VX20"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX20"
FT                   /protein_id="ABQ76430.1"
FT                   /translation="MTIKAINVRNQFKGTVKEILEGPVLSEIDVQTASGIVTSVITTRS
FT                   VRELELQVGSEVIAFVKSTEVSIAKL"
FT   gene            complement(299084..299716)
FT                   /locus_tag="Pput_0257"
FT   CDS_pept        complement(299084..299716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0257"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76431"
FT                   /db_xref="GOA:A5VX21"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX21"
FT                   /protein_id="ABQ76431.1"
FT                   /translation="MNRTTTPRKPRASSQARIEAILAAARELLAEQGVAALSIYSVAER
FT                   AQIPPSSVYHFFASVPALLEALTADVHRAFREALSAPIDSSAFSTWHELSRLIEQRMLD
FT                   IYHEDAAARQLILAQHGLSEVVQADRQHDMELGDLMHTLFDQHFHLPVMPLDVDVFALA
FT                   MELSDRVYARSVQLHEAITPRMAEEGKRVFEAYLGLYLPPFLAKRSR"
FT   gene            complement(299716..301308)
FT                   /locus_tag="Pput_0258"
FT   CDS_pept        complement(299716..301308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0258"
FT                   /product="glutamate-cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="TIGRFAM: glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76432"
FT                   /db_xref="GOA:A5VX22"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX22"
FT                   /protein_id="ABQ76432.1"
FT                   /translation="MKEYILSELLNRRLSLLGANLPLLKQCLHGIERECLRVTDEGRLA
FT                   QTPHPEALGSALTNEQITTDYSESLLEFITPALADPAKVLESLEETHRFVYSKLGDEYL
FT                   WSPSMPCTLPAEEDIPIAEYGSSNIGKLKHVYRKGLALRYGRTMQCIAGIHYNFSLPEA
FT                   LWPLLREAEGSTENDRDYQSSAYIALIRNFRRYSWLLMYLFGASPALDKGFLRGRPHQL
FT                   EELDAETLFLPYATSLRMSDLGYQSNAQAGLTPCYNNLASYTDSLRKAVGTPYPPYVEI
FT                   GTHVDGEWVQLNTNILQIENEYYSNIRPKRVTYTGERPIQALTSRGVQYVEVRCLDINP
FT                   FLPVGIDLTEARFLDAFLLFCALEDSPQLDNGECGQCTSNFLTVVKEGRRPGLELHRNG
FT                   QPISLKDWASELIERIRQLANLLDQAQGSDEHAKALDAQQAKVDDTSLTPSAQVLARMT
FT                   EHDESFVQFSLRQSRVHAETFREQPLSNEKQQAFETLARESLARQSELERDEVGDFDLF
FT                   VGAYQASILAISS"
FT   gene            complement(301447..301830)
FT                   /locus_tag="Pput_0259"
FT   CDS_pept        complement(301447..301830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0259"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76433"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX23"
FT                   /protein_id="ABQ76433.1"
FT                   /translation="MDVPREYVESAFSQLLGCRLQHLDTGVAEVALALEPQLRNRGQKL
FT                   HGGAIFSLVDIAMGLACSASHGFDQQSVTIECKINYMRAVSDGEVLCTARVLHAGRRTL
FT                   VVDADVVQGDKLVAKAQGTFAVL"
FT   gene            complement(301830..304154)
FT                   /locus_tag="Pput_0260"
FT   CDS_pept        complement(301830..304154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0260"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase, RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76434"
FT                   /db_xref="GOA:A5VX24"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX24"
FT                   /protein_id="ABQ76434.1"
FT                   /translation="MDSINSRIAEELGVRPQQVEAAVSLLDEGSTVPFIARYRKEVTGS
FT                   LDDTQLRHLEERLRYLRELDERRASILSSIEEQGKLTPELAREIKLADTKTRLEDLYLP
FT                   YKQKRRTKGQIALEAGLGELADGLFNDPTLAPESEAARFVNVEKGVADVKAALEGAKYI
FT                   LMERFAEDAALLDKLRSYLKQEAVLSARVVAGKEEEGAKFRDYFAHDELLRTAPSHRAL
FT                   AIFRGRNEGVLSVSLKVGEELPGTLHPCELMIGNHVGIENRSRPADKWLGEVVRWTWKV
FT                   KLYTHLETDLFGELRDNAEGEAINVFAHNLHDLLLAAPAGPRATLGFDPGLRTGCKIAV
FT                   VDATGKLLDHTTVYPHAPKNDWDRTISIMAALCAKHSVELIAIGNGTASRESDKLVAEL
FT                   VKKYPALKITKIMVSEAGASVYSASELAAREFPDLDVSIRGAVSIARRLQDPLAELVKI
FT                   DPKSIGVGQYQHDVSQLKLARGLDAVVEDCVNAVGVDVNTASVALLTRISGLNATLAQN
FT                   IVAHRDANGPFATRAALKKVSRLGEKTFEQAAGFLRVMNGDNPLDASAVHPEAYPLVQR
FT                   IAADTDRDIRSLIGDSSFLKRLDPKKFTDETFGLPTVTDILQELDKPGRDPRPEFKTAT
FT                   FQDGVEDLKDLEPGMILEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPREAVK
FT                   AGDVVKVKVMEVDIPRKRVGLSMRMSDTPGEKVEGNRGGNRGNGGSRQQQAPRQRETAT
FT                   AAPANNAMASLFANAKQLKKK"
FT   gene            304372..305112
FT                   /locus_tag="Pput_0261"
FT   CDS_pept        304372..305112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0261"
FT                   /product="Two-component response regulator OmpR"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76435"
FT                   /db_xref="GOA:A5VX25"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX25"
FT                   /protein_id="ABQ76435.1"
FT                   /translation="MTGTPNTAEGDKILIVDDDPGLSSLLERFFTSKGYRARAVPNTEQ
FT                   MDRLLQREVFNLVVLDLMLPGEDGLSACKRLRQQNNQIPIIMLTAKGDELSRIKGLELG
FT                   ADDYLGKPFNPDELMARVKAVLRRQAPSVPGAPGSEDESVTFGDYELSLATRELKRGNE
FT                   VHMLTTGEFAVLKALVMHAREPLTRDKLMNLARGREWDALERSIDVQISRLRRMIEPDP
FT                   SKPRYIQTVWGVGYVFVPDGNAGK"
FT   gene            305126..306439
FT                   /locus_tag="Pput_0262"
FT   CDS_pept        305126..306439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0262"
FT                   /product="Osmolarity sensor protein envZ"
FT                   /EC_number="2.7.3.-"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76436"
FT                   /db_xref="GOA:A5VX26"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX26"
FT                   /protein_id="ABQ76436.1"
FT                   /translation="MKTPLWFPQSFFARTLWLVLIVVLFSKALTLVYLLMNEDVLVDRQ
FT                   YSHGVALTLRAYWAADEENRDKIAEAAGLIRVTGSGVPEGEQHWPYSEIYQRQMQAELG
FT                   DDTEVRLRIHAPPALWVNAPSLGPGWLKVPLYPHPLRGQKIWNVLGWFLAIGLLSTASA
FT                   WIFVRQLNQPLKRLVFAARQLGQGRSVRLPISDTPSEMTEVYKAFNQMAEDVEQAGRER
FT                   ELMLAGVSHDLRTPLTRLRLSLSLLNSDNELSDDMVRDIEDMDAILDQFLAFIRDGRDE
FT                   PVEEVDLADLVREVVAPYNQPEERVRLCLEPIPPFPLRRVSLKRMLGNLIGNALHHAGK
FT                   GVEVAAYVSGDESAPYVVLSVLDRGTGIDESELETIFNPFIRGDRARGGKGTGLGLAIV
FT                   KRIAAQHGGNVELRNRSGGGIEARVRLPLGLLLPRNAV"
FT   gene            complement(306537..307442)
FT                   /locus_tag="Pput_0263"
FT   CDS_pept        complement(306537..307442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0263"
FT                   /product="SSU ribosomal protein S6P modification protein"
FT                   /note="TIGRFAM: alpha-L-glutamate ligase, RimK family;
FT                   PFAM: protein of unknown function DUF201; RimK domain
FT                   protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76437"
FT                   /db_xref="GOA:A5VX27"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VX27"
FT                   /protein_id="ABQ76437.1"
FT                   /translation="MKIAVLSRNPRLYSTRRLVEAGTQRGHEMVVIDTLRAYMNIASHK
FT                   PQIHYRGKPLEGFDAVIPRIGASVTFYGCAVLRQFEMMGVYPLNESVAIARSRDKLRSL
FT                   QLLSRRGIGLPITGFAHSPDDIPDLIQMVNGAPLVIKVLEGTQGIGVVLCETPQAAESV
FT                   IEAFMGLKQNIMVQEYIKEAGGADIRCFVVGDKVIASMKRQAKPGEFRSNLHRGGVASL
FT                   IKITPEERITAIRAAKVMGLSVAGVDILRSNHGPLVMEVNSSPGLEGIEVTTGKNVAGM
FT                   IIEHLEKNGGPNQTRTKGKG"
FT   gene            complement(307439..307978)
FT                   /locus_tag="Pput_0264"
FT   CDS_pept        complement(307439..307978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0264"
FT                   /product="protein of unknown function DUF785"
FT                   /note="PFAM: protein of unknown function DUF785"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76438"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX28"
FT                   /protein_id="ABQ76438.1"
FT                   /translation="MQKVPAVLKVLHLIRRVRFVKTFDHLTVIGLREWVALPDLGVAGL
FT                   RAKIDTGASTSSLHATEVEPFERDGQPWVRFTAHLGSVVQLRHRRCEAPLVTMKTIKSS
FT                   NGHAQTRYVIRTSLALGDGVWEVEVTLACRKNMRYRLLLGSKALIHGQLVVNPGLKYVQ
FT                   DKPAFPATLSPVTGAA"
FT   gene            308031..308432
FT                   /locus_tag="Pput_0265"
FT   CDS_pept        308031..308432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0265"
FT                   /product="heat shock protein Hsp15"
FT                   /note="PFAM: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76439"
FT                   /db_xref="GOA:A5VX29"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX29"
FT                   /protein_id="ABQ76439.1"
FT                   /translation="MAQKAEDDDKVRLDKWLWAARFYKTRALAKAAIESGKVHCRGERC
FT                   KPGKEPRVGDEFVLRTGFDERTVVVKALSVVRRGAPEAQALYEETEESVRRREQAAEMR
FT                   KAGAMGVTTDGRPTKKQRRQIHQLHGSYD"
FT   gene            complement(308460..309254)
FT                   /locus_tag="Pput_0266"
FT   CDS_pept        complement(308460..309254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0266"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76440"
FT                   /db_xref="GOA:A5VX30"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX30"
FT                   /protein_id="ABQ76440.1"
FT                   /translation="MDNRPLFQARWSWGPLAACTLLPIALLCFWLWPFGQILCLTFDEW
FT                   LFRSLNAPLADSTTWRYIWTIGSLRPFDIVVGLILLAVLIRGDWVFKAAQVRQAFFGFL
FT                   VTLLLLVVIRALFSKWVDAAGWQHKSPSMIFDDVVHLSDYYPNLEAAWELKDRSSKSFP
FT                   GDHASVLLIWALFMSVFSRRLVQYLVVWGLAALFMLPRLVAGAHWGQDDYIGGLLMAVL
FT                   ALGWSYYTPLAAKGSEALMRWTAPLFKLLSTLPLVGRMAVLR"
FT   gene            309375..310274
FT                   /locus_tag="Pput_0267"
FT   CDS_pept        309375..310274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0267"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76441"
FT                   /db_xref="GOA:A5VX31"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VX31"
FT                   /protein_id="ABQ76441.1"
FT                   /translation="MSDLPDTDFTQRFIFDERDVRGEWVSLDDSYAAVLARHEYPQPVK
FT                   VLLGELMAATALLVGAMKFDGLLILQARSAGPIPLLMVECSSEREIRGMARYEADQISA
FT                   DATLSQLMPDGHLTLTIDPVKGQRYQGTVDLDGANLSECFTNYFVQSQQLNTRFWLNAA
FT                   GGKARGLLLQQLPRDRQPDDEEREDSWQHVVALAKTLKPEEWTEGNETLLHRLYHEDAV
FT                   RLFDIQPLRFNCSCSRERSGNALVSLGEHDAKALVDECGGTVEIDCQFCNERYFFDASD
FT                   VAQLFAGGGTDVASETRH"
FT   gene            310454..311995
FT                   /locus_tag="Pput_0268"
FT   CDS_pept        310454..311995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0268"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76442"
FT                   /db_xref="GOA:A5VX32"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VX32"
FT                   /protein_id="ABQ76442.1"
FT                   /translation="MTQANNTVYTDLSVDELVKEALQRGEGVLADTGALVVETGHRTGR
FT                   SPADRFIVEEPSTQDAISWGPINRKFPADKFDALWARVEAFNNAQDHFVSYVHVGAAAE
FT                   HYLPVKMTTQTAWQNLFGRCLFINPEQFNPAGRDQWQILNVANFVCEPERDGTNSDGCV
FT                   IINFAQKKVLIAGMRYAGEMKKAMFSVQNFLLPAADVLPMHCAANIGEEGDVTLFFGLS
FT                   GTGKTTLSADESRYLIGDDEHGWGEGVVFNMEGGCYAKCIDLSEKNEPVIWKAIKHGAV
FT                   LENVVLDANKHADYTDVSLTQNSRAAYPLEHVAKRSEANLGGEPNAVIFLTCDLTGVLP
FT                   PVSILNNEQAAYHFLSGYTALVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGEYAELLIK
FT                   RINGFNSKVYLVNTGWTGGGYGVGKRFSIPTTRAVIAAIQSGALVGAETEHLDIINLDV
FT                   PKAVPGVETELLNPRTNWADKAAYDEAAKGLAKLFIENFKKFEVSDAIKAAGPQL"
FT   gene            312277..312717
FT                   /locus_tag="Pput_0269"
FT   CDS_pept        312277..312717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0269"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76443"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX33"
FT                   /protein_id="ABQ76443.1"
FT                   /translation="MTEAPQRTAFSHFHPILTRPQDNDLNGHIAGATVHGFFETAIQAF
FT                   LVEQAELDLRHGELAAFVVSSAADFYALPGFPDLLEVGLGVTRLAGSTVEYRLALYRPG
FT                   EPEACAAGTVVQVFIERDSGRPVALPEALQVILSGLMLERQA"
FT   gene            complement(312774..313256)
FT                   /locus_tag="Pput_0270"
FT   CDS_pept        complement(312774..313256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0270"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76444"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX34"
FT                   /protein_id="ABQ76444.1"
FT                   /translation="MKKYSSILLLSFSLLSGVAMAGGTTEAGIGGALGGVLGSVVGNSI
FT                   GGSTGGAIGAGLGGAAGGALGADKRQRGEAAIGGALGAAGGNVVGRSVGGTTGSYIGAA
FT                   AGGGAGGALGNYLGKEADEDDYRDGRRYRRGYDDDRRHWDRGHHYGHRKHKRHWRD"
FT   sig_peptide     complement(313191..313256)
FT                   /locus_tag="Pput_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(313453..315798)
FT                   /locus_tag="Pput_0271"
FT   CDS_pept        complement(313453..315798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0271"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76445"
FT                   /db_xref="GOA:A5VX35"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX35"
FT                   /protein_id="ABQ76445.1"
FT                   /translation="MTSYQPLPDNAPASPPRYKPYHGPAGGWGALRSVAKAWVGSDNAL
FT                   KNIRALLKTNQNGGFDCPGCAWGDSPESGMVKFCENGAKAVNWEATKRRVDAAFFARYS
FT                   VTSLLQQSDYWLEYQGRLTEPMVYDAPSDRYLPISWDAAFALIARELNKLTNPDQAEFY
FT                   TSGRASNEAAYLYQLFVRAYGTNNFPDCSNMCHEASGVALGQSVGVGKGTVTFDDFEHA
FT                   DSIFVWGQNPGTNHPRMLDPLRDAVKRGAQVVCINPLKERGLERFQHPQNPLEMLTNSD
FT                   RPTNTAFFRPALGGDMAMLRGMAKFALQWEREAQANGEPAVFDHAFIAEHGHGVDEYLA
FT                   VVDATPWSHIQAQSGLTLADIELAARMYCRGKRVIMCWAMGITQHRHSVPTIQEIVNLQ
FT                   MLRGNIGVPGAGLCPVRGHSNVQGDRTMGINERPPEALLDAIEKRFGFPVPRRNGHNTV
FT                   EAIHAMLDGRAKVFIGLGGNFAQATPDTERTAQALRNCELTVHISTKLNRSHLVHGKQA
FT                   LILPCLGRTDIDLQADGPQAVTVEDSFSMVHASNGQLKPLSTQMRSEPAVIAGIAAATL
FT                   GKQPVDWHWLVADYDRIRDLIGDTIAGFSGFNQRLRNPGGFYLGNSAASREWATSTGRA
FT                   NFKANLLPDTLLDERVRASGQLPDLIMQSMRSHDQYNTTIYGLDDRYRGVRGQREVLFA
FT                   NEADIIRLGFQPGQKVDIVSLWGDEHVRRVQGFTLLAFDIPAGQAAAYYPEVNPLVPLE
FT                   SIGVGSHTPTSKFIAIKLERAREDGRIL"
FT   gene            complement(315804..316634)
FT                   /locus_tag="Pput_0272"
FT   CDS_pept        complement(315804..316634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0272"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76446"
FT                   /db_xref="GOA:A5VX36"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX36"
FT                   /protein_id="ABQ76446.1"
FT                   /translation="MNSKPPVCAASSPLSMPAASNTYDYVQLSDAKRDSTPLAEEVALA
FT                   IVYNGLNQAVMLVSPTDLEDFAVGFSVGSGIVEGTAEIYDLKLSGSGSAMYADLEISSR
FT                   AFWNLKNQRRQLAGTSGCGLCGVEALEQALPDLAVLPGAPLPPAQWLVGLRERIDAFQP
FT                   LGQHCGAVHAALFMDRQGELLLGREDIGRHNALDKLIGALLRQHIDSQGGLAIVTSRCS
FT                   LELIQKVLRAGIQTLVSLSAPTGLALQWARKHNLNLIHLPKHSAPRVYSPAAES"
FT   sig_peptide     complement(316572..316634)
FT                   /locus_tag="Pput_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.659 at
FT                   residue 21"
FT   gene            316810..317250
FT                   /locus_tag="Pput_0273"
FT   CDS_pept        316810..317250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0273"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: Peptidoglycan-binding LysM;
FT                   transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76447"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX37"
FT                   /protein_id="ABQ76447.1"
FT                   /translation="MSLFSFVKEAGEKLIDLLTPGNANAEEQLKKHVEAVGLGNPNITA
FT                   TVEGDKIILKGEVASQEEKEKIILAAGNISGVASVEDQITVTGPVVQAARFVTVKSGDT
FT                   LSAIAMVVYGNANQYNKIFEANKPMLKHPDKIYPGQVLRIPD"
FT   gene            complement(317362..318024)
FT                   /locus_tag="Pput_0274"
FT   CDS_pept        complement(317362..318024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0274"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76448"
FT                   /db_xref="GOA:A5VX38"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX38"
FT                   /protein_id="ABQ76448.1"
FT                   /translation="MPVLPWSAIDTVLLDMDGTLLDLHYDNRFWLDHLPQRYAELHGVS
FT                   RAMAEMELQPLFERNAGTLNWYCLDFWSRELRLPIRELKREIADLIALRPDADTFLAAI
FT                   RQAGKRVVMITNAHRDSLSLKLERVELAPYFERLISSHDYGYPKESPQFWDALQADIGF
FT                   EPERSLFIDDTLAILRSARRFGVGHLLAVRQPDSKAGPRDTEEFAAVEDYRELLVGL"
FT   gene            318089..318655
FT                   /locus_tag="Pput_0275"
FT   CDS_pept        318089..318655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0275"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76449"
FT                   /db_xref="GOA:A5VX39"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX39"
FT                   /protein_id="ABQ76449.1"
FT                   /translation="MRQKPTVLSREIVASSRLFRVEAVQLRFSNGAERTYERLVGRGNG
FT                   YGAVMIVAMLDAEHAVLVEEYCGGTDEYELSLPKGLIEPGEDVLAAADRELKEEAGFGA
FT                   RQLEHLTELSLSPGYMSQKIQVVLASDLYEERLEGDEPEPMRVDKVNLRELSALAMHPQ
FT                   FTEGRALAALYLARDLLIQRGLLEL"
FT   gene            318652..319470
FT                   /locus_tag="Pput_0276"
FT   CDS_pept        318652..319470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0276"
FT                   /product="3'(2'),5'-bisphosphate nucleotidase"
FT                   /EC_number="3.1.3.7"
FT                   /note="TIGRFAM: 3'(2'),5'-bisphosphate nucleotidase; PFAM:
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76450"
FT                   /db_xref="GOA:A5VX40"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX40"
FT                   /protein_id="ABQ76450.1"
FT                   /translation="MNDLQLMHEVVKLALTAGEAILPFWRADVAVTNKADDSPVTAADL
FT                   AAHRVIADGLLALAPQIPVLSEEDCNIALAERQSWSRWWLVDPLDGTKEFIAGSEEFTV
FT                   NIALIENGEVVFGVVSMPTNGRCYFGGRGMGAWRADAGEAAQLIQVRNAPAQGERFTVV
FT                   ASRRHSSPEQEALLAGLGAAVGELELANIGSSLKFCLLAEGSADCYPRLAPTSQWDTAA
FT                   AQGVVEGAGGEVIGLDGLPFRYPPRESLLNPHFLALPANAAWRQAFLNLI"
FT   gene            complement(319617..320072)
FT                   /locus_tag="Pput_0277"
FT   CDS_pept        complement(319617..320072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0277"
FT                   /product="thioesterase domain, putative"
FT                   /note="TIGRFAM: thioesterase domain, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76451"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX41"
FT                   /protein_id="ABQ76451.1"
FT                   /translation="MSTNSQYLQSVLHSDIPLTREMGLEVIDWQQHTLRLQLPLAANVN
FT                   HKSTMFGGSLYCAAVLVGWGWLHLRLRELGIDDGHIVIQEGQISYPLPVTGTAVARCAA
FT                   PDDKTWERFLTLYQRRGRARLTLETTVSNDGSDEPAVRFSGQYVLHR"
FT   gene            complement(320072..321478)
FT                   /locus_tag="Pput_0278"
FT   CDS_pept        complement(320072..321478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0278"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76452"
FT                   /db_xref="GOA:A5VX42"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX42"
FT                   /protein_id="ABQ76452.1"
FT                   /translation="MTTETLIDSRAQVILVDDDPHLRQALSQTLDLAGLKVVALPEAQG
FT                   LADRIEADWPGVVVSDIRMPGIDGLQLLEQLHGRDSELPVLLITGHGDVPLAVQAMRAG
FT                   AYDFLEKPFATDALLDSVRRALALRRLVLDNRSLRLALSDRQQLATRLVGHSPAMLRLR
FT                   EQIGALAGTRADVLILGETGAGKEVVARALHDLSSRSEGPFVAINAGALAESVVESELF
FT                   GHEPGAFTGAQKRRIGKFEFANGGTLFLDEIESMSLDVQVKLLRMLQERVVERLGGNQL
FT                   IPLDIRIIAATKEDLRQAADQGRFRADLYYRLNVAPLRIPPLRERGDDILVLFQHFADA
FT                   ASQRHGLSPHALQPAQRALLLRHDWPGNVRELQNAAERFALGLELALDGQAPSAAAPAA
FT                   PMLSGNLSEQVEQFERSLIAAELAQPHGSMRSLAEALGIPRKTLHDKLRKHGLNFDGGS
FT                   GGHDDQEDNR"
FT   gene            complement(321475..323289)
FT                   /locus_tag="Pput_0279"
FT   CDS_pept        complement(321475..323289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0279"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76453"
FT                   /db_xref="GOA:A5VX43"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX43"
FT                   /protein_id="ABQ76453.1"
FT                   /translation="MIAKPTPPRRPRWRSLALLALILAPLLWPLHHLAERYYQEELASQ
FT                   NRQTLDLYVANLLGTLHRYETLPQILGDLPALRGVLADPFRLEAVTNANRLLKDIVQQT
FT                   GAEVMYLMDVSGNTLAASNWDKHDSFVGRNFAFRPYFNEAMAGHLGRFFGQGTTSAKRG
FT                   YFFAAAVRDRERIVGVLVVKVDLDHTETLWGRTPEQLLLTDHNGVVILTSRPDWRFRAT
FT                   RTLTDAERQAIIAIQPYPTQAPQPLVLNPQAWITQTRDIKETGWQVSILAPRTLVDRSV
FT                   QTVMAIGAGTLLVLMLLAGLVMQRRRHYIDRIDFEARGRQELEKRVAERTADLEGLNTR
FT                   LKNAVLERENAQQEAVRAQDELVQAGKLSVLGTMSASISHELNQPLAAIRSYAENAEIL
FT                   LDHQRTEDARGNLKLIGELTGRMASIIAHLRAFARRDRHAPESVALQPALDDALALLAK
FT                   RRRAMAVELIRDLPEATLWVQAGETRLRQVLGNLLANALDALTEKANPRRLWLSAEQRD
FT                   DCVYLYIRDNGPGFSRQALEHAKEPFFTTKTRTQGLGLGLAICESLMRALGGELLLANH
FT                   PEGGAMLTLQLRVAASGATLPNSEDPSA"
FT   gene            complement(323332..323877)
FT                   /locus_tag="Pput_0280"
FT   CDS_pept        complement(323332..323877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0280"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="TIGRFAM: dTDP-4-dehydrorhamnose 3,5-epimerase; PFAM:
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase related"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76454"
FT                   /db_xref="GOA:A5VX44"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX44"
FT                   /protein_id="ABQ76454.1"
FT                   /translation="MNIIPTAIPEVLIIEPKVFADSRGFFFEAFNAREFSQQTGVNMEF
FT                   VQDNHSRSIKGVLRGLHYQVANTQGKLVRVVHGEIRDIAVDVRKSSPTFGKWVAVHLSA
FT                   DNHRQLWVPPGFAHGFAVMSESAEFLYKTTDYYNPGADRCIRWDDPQLAIDWGLQQPPL
FT                   LSDKDKVGLPLAEAELLP"
FT   gene            324156..325262
FT                   /locus_tag="Pput_0281"
FT   CDS_pept        324156..325262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0281"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="PFAM: Porphyromonas-type peptidyl-arginine
FT                   deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76455"
FT                   /db_xref="GOA:A5VX45"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VX45"
FT                   /protein_id="ABQ76455.1"
FT                   /translation="MKTLNSTPRADGFHMPAEWAPQTQVWMVWPERPDNWRLGGKPAQA
FT                   AHVTLAKAIARFEPVTVAASAGQYENARRQLDQPNIRVVEISNDDAWVRDTGPTFVING
FT                   HGEVRGVDWGFNAWGGFDGGLYAPWNRDEELAAKVLEMERCQRYQTEGFVLEGGSIHVD
FT                   GEGTVITTEECLLNRNRNPHLSREQIEAVLRDHLAVDTVVWLPDGLYNDETDGHVDNFC
FT                   CYVRPGEVLLAWTDDSNDPNYARCHAAMDVLKNTRDAKGREFIVHKMPIPGPLYATAEE
FT                   CAGVDQVAGSQERDPSVRLAGSYVNFLIVNGGIIAPSFDDPADAEARAILARIFPDHEV
FT                   VMIPGRELLLGGGNIHCLTQQQPAPVKR"
FT   gene            325457..325654
FT                   /locus_tag="Pput_0282"
FT   CDS_pept        325457..325654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76456"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX46"
FT                   /protein_id="ABQ76456.1"
FT                   /translation="MNAASESALRPSAVDRQSLRLLAKRLKHHGSIRVRTTDPRRLLAG
FT                   RYPQGLISEAEMQALMAVWH"
FT   gene            complement(325721..327790)
FT                   /locus_tag="Pput_0283"
FT   CDS_pept        complement(325721..327790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0283"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76457"
FT                   /db_xref="GOA:A5VX47"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX47"
FT                   /protein_id="ABQ76457.1"
FT                   /translation="MLVPCRLSPLTLGLSLLFSASLASAATTTLPESSVTADSEREKDN
FT                   PRVKEVSTATRTSTPVRYVPQAIDTVKTANVLDYGSNTLGKALEGIPNVSSGADTRFDS
FT                   VRIRGFEASNDFYLDGIRDDSQYIRDLHNIERVEVLKGPAAVLYGRGSQGGIVNRVSKA
FT                   PEPGRRSTIEAQAGSEDLRSLYADLSADPSDTVSLRLNMGNQDNNSFRDGIDGSRQLFA
FT                   PSISWQITPDLNWLVQYEYSRYNRTPDRGIPSVNGRPADVSRSATYGDHRDYIDDRAQS
FT                   LRSRLNYQLNETWQLRHTLGLFKLDSEFDNTYVTGYNAGTNTLTRQRWQQDLNTRNLFN
FT                   NLEAESDFDTLGLEHKLLLGLEFGNQRRDPLLYSAGSQNLPGLGKPSQPHNGTLAVSSN
FT                   NHTVVDSRGVYLQDQIRLNDQWQVLAGVRFDQFEVETTNKDGLREPQDSNSTSPRLGMV
FT                   YTPWRDHSFYASWSKTFSPVGGGLIGITPGAPGNTNDTRPEQTRQKEIGVKSDWLDQRL
FT                   TTTLAIYELELYNRRTRDPNDPNIILLSGMQRSRGIELTATGNIVGNWYVRGGIGLQDA
FT                   TIVKDNNGQEGNRINDVAKRNGSLFVTWKPELGWYAETGLTLVGERYADNQNTTVLPGY
FT                   GRWDALAGYRTHDWDVRAALSNIADKTYYSSATSAAQIQVGDPRSLVVTGSYSF"
FT   sig_peptide     complement(327713..327790)
FT                   /locus_tag="Pput_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.986 at
FT                   residue 26"
FT   gene            328265..329584
FT                   /locus_tag="Pput_0284"
FT   CDS_pept        328265..329584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0284"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76458"
FT                   /db_xref="GOA:A5VX48"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX48"
FT                   /protein_id="ABQ76458.1"
FT                   /translation="MLKTRISLVALAMIAATQAQANDQADSKGFIEDSHANVLLRNAYI
FT                   NRDKKHGTDDQIEWGQAFIANFSSGFTQGTVGVGVDAFGLYAVRLDGGKGHNGGGGVDF
FT                   FKPHETTNAEGNASSPHNLARGGAAVKFRISNTVLKYGDQMPALPVLQYDDARLLPESF
FT                   TGTLITSKEIQGLELNAGRFTQEARKSAERRDGGGLKSINVLGGSYKFTDNFTASLYTA
FT                   DNEDVMKKHYLGLNYVFPIASDQSLTLDFNGYKSDINNKYVKAAGLNGDSNTIWSLAAT
FT                   YAYGAHSFTLAHQRSTGSTGYNYGFYQNAGGVGDGGSTIYLANSYWSDFNAEDERSWQL
FT                   GYGLDFGAYGIPGLTYKLAYVVGDNINTRNVANPQGFGEGKEREIFNQIRYVVQDGPAK
FT                   DLSIKLRSSFLRTNNAVQQNGYNDDGNEVRVFVEYPISIF"
FT   sig_peptide     328265..328330
FT                   /locus_tag="Pput_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(329735..331405)
FT                   /locus_tag="Pput_0285"
FT   CDS_pept        complement(329735..331405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0285"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76459"
FT                   /db_xref="GOA:A5VX49"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX49"
FT                   /protein_id="ABQ76459.1"
FT                   /translation="MKHSLPSRYACFVLCLVFTFASLPLLAQHAWLWPVTLITALLSLV
FT                   GLNDLRQSHHAVRRNYPILGNIRYLIETIRPEIRQYLIEGDDDKLPFSRSQRSLVYARA
FT                   KNESAEKAFGTLNDAYKPGFEFISHSMLPVATPDPASFRIAIGGPQCRVPYSASIFNIS
FT                   AMSFGALSANAIAALNRGARMGRFAHDTGEGSISPYHREHGGDLIWEIGSGYFGCRTED
FT                   GRFDPQRFAEQARSAQVKMIEIKLSQGAKPGHGGILPGHKVSPEIAETRGVRVGEDCIS
FT                   PAAHSAFRTPVELLQFVAGLRELSGGKPVGFKFCLGHPWEFMGIAKAMLATGITPDFIV
FT                   VDGKEGGTGAAPREFSDNMGVPMREGLMFVHNTLVGLNLRSSIRIGAAGKIVSAFDIAS
FT                   VLAIGADWVNSARGFMFAIGCIQSQSCHTNKCPTGVATQDPLRQRALVVPDKAERVASF
FT                   HRNTLHALAEMLAAAGLEHPSELKPKHLARRISPSEIGLFSDLHTFLKPGELLSGSIES
FT                   EFYARMWRMARSDSFAPETGDTATRTMASRLRHEETEPA"
FT   sig_peptide     complement(331322..331405)
FT                   /locus_tag="Pput_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            complement(331651..333018)
FT                   /locus_tag="Pput_0286"
FT   CDS_pept        complement(331651..333018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0286"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76460"
FT                   /db_xref="GOA:A5VX50"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX50"
FT                   /protein_id="ABQ76460.1"
FT                   /translation="MRWFHRLWPRTLFGQLLLIMVSGTLVIQLMSSSIWFDVRFAQALE
FT                   VPVRLVAARSAPLIAQADCHRGTQQAPAHYQLHCVESPPAQEHDERRGHRRVELLLQQA
FT                   LKYELGHAQDVRLMNVQLTDELGQPIVWRSLFGLRTAQAHIQFAVPLPDGHWLTVAGQE
FT                   LQGWSGESAWVLISDYLLRVYALRIVAVLLVCLVAVRLCLRPLRRLADAARGLGSNLEQ
FT                   PPLALDGPEEVRQAAQAFNAMQQRLIAMVNDKAYFLAAVSHDLRTPLTRMRLRLERLPD
FT                   DEHRQRLRQNITQMDDMIGQVLDYLRAGEQRNLQQVDLDRLVARQCADLATAAEPLPVH
FT                   GKAGSLRVDALLLQRCLQNLLVNALRYAKNISVTLERATTGVLIHIDDCGPGIAPGLLA
FT                   TITDPFVRGDGSRNQASGGYGLGLSIAQRIATSHGGELMLSNRESGGLRVSILLPG"
FT   sig_peptide     complement(332887..333018)
FT                   /locus_tag="Pput_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.716) with cleavage site probability 0.409 at
FT                   residue 44"
FT   gene            complement(333020..333739)
FT                   /locus_tag="Pput_0287"
FT   CDS_pept        complement(333020..333739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0287"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76461"
FT                   /db_xref="GOA:A5VX51"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX51"
FT                   /protein_id="ABQ76461.1"
FT                   /translation="MSTTLLVVDDDDEIRELLCDYLTDAGYSVLAAADGQQMRDQLARH
FT                   KVELVVLDLMLPGEDGLSLCRQLQATPGLAVIMLSAKGSTLDRIIGLEVGADDYLAKPF
FT                   EPRELIARIKAVLRRPQRLGTSAEEPMVDAQLFAGFRLEHVKRLLTRPDGETLTLPRSD
FT                   YRVLRELLEANNRVVSRDQLTRSAFGRDHLPDDRSVDMCVSRLRQQLRRAPAGTAQILT
FT                   IRNEGYLLSLAPLAAGA"
FT   gene            333880..336177
FT                   /locus_tag="Pput_0288"
FT   CDS_pept        333880..336177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0288"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76462"
FT                   /db_xref="GOA:A5VX52"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX52"
FT                   /protein_id="ABQ76462.1"
FT                   /translation="MNPQSITPVFTPFSQSGNCLKPLAFCVAVAISGGAVAADGKPLEL
FT                   DATQIEDSALLPADDAGQLGYTVESTRSSTGLALTPRQTPQSVTTITRQQMDDRDIHTI
FT                   EQALETAPGVTANKSEVGGRTDYRARGYSISNWKVDGLQTQGGSDFSGSGNALNMDLYE
FT                   RIDIVRGANGLLGGTGDPSATVNLIRKAPTKTFGGSAYATYGSWDKRRLGADLNLPLSE
FT                   DGRLRSRFVMTQQDANSFRDNQSERSRAALANFEFDLDDATTLGAGYQYEYNKVVGGGW
FT                   GANIPIWYRDGSKTDLPRSTNVVPSWSFGEYTTRTAFGSLEHRFDNDWTLDLKAAQATT
FT                   EALNHRGLAKVNSAGRGSYGGYWDQDGSGAVLNGLHSSSDTTQQSAQIDLSGPFQLFGR
FT                   THQAMVGYNDSRTVGWSPQYTCTMVGDGMTSAPALGCQFRANNGFPVTDWHNGVDDDYD
FT                   LIASRTGLHSKTTTRLQGMYAATRLSITDPLSVIVGVRTSNYSSVTRSVAGERSSQEEN
FT                   GIVTPYLGAVYDLNDNYSVYASYTDIFTPQTSETSSGSKVEPIRGQSYETGIKGEWFDG
FT                   RLNASAAYFRTKQENKAVLDGDLTTPTGGSAYKAGSGQETDGIDLEVAGALTPNWNVYA
FT                   GYTYLHFRRVDSDGRSDPSHLFKASTTYRLSGPLDRLTLGAGVTAQTNIRAISSPAGQP
FT                   TNGVSNGATDVNWSGYAIWNAMAKYQLSDNTSVSLNANNLFDKHYYSQYGFYAGAIYGD
FT                   PRNLSLTVSTAF"
FT   sig_peptide     333880..333993
FT                   /locus_tag="Pput_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.968 at
FT                   residue 38"
FT   gene            complement(336328..336534)
FT                   /locus_tag="Pput_0289"
FT   CDS_pept        complement(336328..336534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76463"
FT                   /db_xref="InterPro:IPR021430"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX53"
FT                   /protein_id="ABQ76463.1"
FT                   /translation="MAKRFPTNPRHPERICWGCDLYCPAKALACGNGADRTMHPVELFG
FT                   KDWDSFEGQLEKPVDPGQAVEPR"
FT   gene            336593..337069
FT                   /locus_tag="Pput_0290"
FT   CDS_pept        336593..337069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76464"
FT                   /db_xref="GOA:A5VX54"
FT                   /db_xref="InterPro:IPR018669"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX54"
FT                   /protein_id="ABQ76464.1"
FT                   /translation="MTGINPLAIARSPYISHPDIWLTDIWIRDIFHPMLVRRDNTMRVI
FT                   TKAAVTKAIEAHGQWKAPLSLWLTTFDRATLRFESFEQLRQTWVTVSGWNVDRIPHSKL
FT                   RPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR"
FT   gene            337111..337584
FT                   /locus_tag="Pput_0291"
FT   CDS_pept        337111..337584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0291"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76465"
FT                   /db_xref="GOA:A5VX55"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039060"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX55"
FT                   /protein_id="ABQ76465.1"
FT                   /translation="MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKD
FT                   DAELEARMALIDELYSHADSEGHAAARFAEMVADRVYEYESESVLVPFASQAEALAFLL
FT                   SDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV"
FT   gene            338005..338220
FT                   /locus_tag="Pput_0292"
FT   CDS_pept        338005..338220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0292"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76466"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX56"
FT                   /protein_id="ABQ76466.1"
FT                   /translation="MTESVGAGAIELIINGSPAFRCVYVAKFADMVVVLHSFVKTTNRP
FT                   DRHAMQVAEERMKELKQELRKMGYRV"
FT   gene            complement(338217..338540)
FT                   /locus_tag="Pput_0293"
FT   CDS_pept        complement(338217..338540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76467"
FT                   /db_xref="GOA:A5VX57"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX57"
FT                   /protein_id="ABQ76467.1"
FT                   /translation="MALQFHESPFHATHDADTASKMALKMDLSIFITDCIKKMGLKQHD
FT                   AAAKLNVTQSRISELANGKIEKFTLDAMMDMLDKLGFRTTLTLPSNDAGSPPQIVITQT
FT                   PGS"
FT   gene            complement(338834..338909)
FT                   /locus_tag="Pput_R0006"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(338834..338909)
FT                   /locus_tag="Pput_R0006"
FT                   /product="tRNA-Thr"
FT   gene            complement(339008..339256)
FT                   /locus_tag="Pput_0294"
FT   CDS_pept        complement(339008..339256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76468"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX58"
FT                   /protein_id="ABQ76468.1"
FT                   /translation="MTRANPLALLTFALALTGCAGGTSPHPNSNLGWNHPGMQLGGDNG
FT                   LPLRTEAPCRKRGCDNDKLFFNPGKSEPSVTTMHRGW"
FT   sig_peptide     complement(339188..339256)
FT                   /locus_tag="Pput_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.474 at
FT                   residue 23"
FT   gene            339782..340072
FT                   /locus_tag="Pput_0295"
FT   CDS_pept        339782..340072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76469"
FT                   /db_xref="InterPro:IPR021427"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX59"
FT                   /protein_id="ABQ76469.1"
FT                   /translation="MKTIDSDPNSPKPITTAGVETFLAAGNPSLNLLRVEPGVPVDAAY
FT                   EHVSILMGYIKHLVREGDMEDDHKFLGAADYLCDMAKALMNDIEIAKGKAH"
FT   gene            340079..340255
FT                   /pseudo
FT                   /locus_tag="Pput_0296"
FT   gene            complement(340427..341632)
FT                   /locus_tag="Pput_0297"
FT   CDS_pept        complement(340427..341632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76470"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX60"
FT                   /protein_id="ABQ76470.1"
FT                   /translation="MPSPLHSHHLSTRFQALDQFLIEHQQLWKPRPFTTLQLPWETTHP
FT                   ELATHLRQCSLADAEADSAADRLPAPFPQLAEQAQKLAALGSLPQTDLPPAAHRLDVAV
FT                   PGRKWQQIEAFASHLAFREPPRHWLDWCSGKGHLGRRLLQPGQQLTCLEYDAELVAAGQ
FT                   ALSAHHHLPAQHVHQDVMASNSARHLASDKSVVALHACGDLHVRLLQLASQQGCRQLAI
FT                   APCCYNRIAAQQYQALSTAAQASSLQLSLDDLGLPLSETVTAGARVRRQRDTSMARRLG
FT                   FDLLQRQQRQSDEYLPTPSLPVAWLEKPFEQYCRDLAELKQLPVSGDPDWAMLEAAGWQ
FT                   RLAEVRNLERVRNLFRRPLELWLVLDRALFLEEQGYDVRLGLFCDYPLTPRNLLILAER
FT                   DG"
FT   gene            complement(341744..342433)
FT                   /locus_tag="Pput_0298"
FT   CDS_pept        complement(341744..342433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0298"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76471"
FT                   /db_xref="GOA:A5VX61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX61"
FT                   /protein_id="ABQ76471.1"
FT                   /translation="MNWEVIFKWLPRLAEGAVLTLELVAIAVVAGLILAIPLGIARSSR
FT                   HWYVRAVPFSYIFFFRGTPLLVQLFLVYYGLAQFDAVRSSSLWPYLRDPFWCTVLTMTL
FT                   HTAAYIAEILRGALQAIPKGEIEAARALGMSRGKTLFYIMLPRAARIGLPAYSNEVILM
FT                   LKASALASTVTLLELTGMARTIIARTYLPVEIFFAAGVFYLVISFMLVQGFKLLERWLR
FT                   VDACQGR"
FT   gene            complement(342433..343125)
FT                   /locus_tag="Pput_0299"
FT   CDS_pept        complement(342433..343125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0299"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76472"
FT                   /db_xref="GOA:A5VX62"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX62"
FT                   /protein_id="ABQ76472.1"
FT                   /translation="MNIDLHGFGPAMMAGTLMTVKLALCALLLGLVLGLLGALAKTSPL
FT                   KPLQWLGGFYSTLVRGVPELLWVLLIYFGTVGLMNSLGEALNMPGLELSAFAAGVIALG
FT                   LCFGAYATEVFRGAILAIPKGHREAGLALGLSKGRILSRIILPQMWRIALPGLGNLFMI
FT                   LMKDTALVSVIGLEEIMRHSQIGVTVTKEPFTFYMVAACIYLGLTVLAMTGMHFMEKRA
FT                   ARGFARAE"
FT   sig_peptide     complement(343003..343125)
FT                   /locus_tag="Pput_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.978 at
FT                   residue 41"
FT   gene            complement(343180..343932)
FT                   /locus_tag="Pput_0300"
FT   CDS_pept        complement(343180..343932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0300"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76473"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX63"
FT                   /protein_id="ABQ76473.1"
FT                   /translation="MHTYKKFLLAAAATLVMSANAMAAEKLRMGIEAAYPPFNNKDASG
FT                   NVVGFDKDIGDALCAKMKVECSVVTSDWDGIIPALNAKKFDFLVSSLSITDERKQAVDF
FT                   TEPYYSNKLQFIAPKNVDFKTDKESLKGKVIGTQRATLAGTYLEDNFKGVDIKLYDTQE
FT                   NAYLDLVSGRIDGILADKYVQYEWLKSKDGSNFEFKGEPVMDSDKIGIAVRKGDTKLRD
FT                   DLNKALAEIKADGTYKKINDKYFPFSIE"
FT   sig_peptide     complement(343861..343932)
FT                   /locus_tag="Pput_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(343944..344717)
FT                   /locus_tag="Pput_0301"
FT   CDS_pept        complement(343944..344717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0301"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76474"
FT                   /db_xref="GOA:A5VX64"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX64"
FT                   /protein_id="ABQ76474.1"
FT                   /translation="MAQATPALEIRNLHKRYGEQEILKGISLTARDGDVISILGSSGSG
FT                   KSTLLRCINLLENPHQGEILVAGEALKLKAAKNGDLIAADNRQINRLRSEIGFVFQNFN
FT                   LWPHMSILDNIIEAPRRVLGQSKAEAIEAAEALLNKVGIYDKRHSYPAQLSGGQQQRAA
FT                   IARTLAMKPKVILFDEPTSALDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARHVSSE
FT                   VVFLHQGLVEEQGSPQQVFENPTSARCKQFMSSHR"
FT   gene            345349..346734
FT                   /locus_tag="Pput_0302"
FT   CDS_pept        345349..346734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0302"
FT                   /product="gamma-aminobutyrate:proton symporter, AAT family"
FT                   /note="TIGRFAM: GABA permease; PFAM: amino acid
FT                   permease-associated region; TC 2.A.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76475"
FT                   /db_xref="GOA:A5VX65"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR011265"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX65"
FT                   /protein_id="ABQ76475.1"
FT                   /translation="MSGNNSNDLAQGLKQRHVTMLSIAGVIGAGLFVGSGHAIAAAGPA
FT                   VLLAYAAAGTLVVLVMRMLGEMAVASPDTGSFSTYADRAIGRWAGFTIGWLYWWFWVLV
FT                   IPLEANAAAAILHAWFPAVDLWAFSLIITLALTLTNLCSVKNYGEFEFWFALLKVLAII
FT                   GFIAVGCAALFGFVPSSQVSGASHLFDTQGFMPNGLGAVLAAMLTTMFSFMGTEIVTIA
FT                   AAESKDPGKQISRATNSVIWRICLFYLVSIFLVVALVPWNDPALAETGSYQTVLSRIGV
FT                   PNAKLIVDIVVLIAVTSCLNSALYTSSRMLFSLSKRGDAPAIAQRTTKAATPHVAVLLS
FT                   TAAAFLCVFANFVAPAQVFEFLLASSGAIALLVYLVIAVSQLRMRAQREARGEKITFKM
FT                   WLFPGLTWATIAFIVAILVVMALREDHRAEIIATALLSIGVVAAGLLVHRKREAAGRAA
FT                   LDS"
FT   sig_peptide     345349..345471
FT                   /locus_tag="Pput_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.792 at
FT                   residue 41"
FT   gene            complement(346938..347381)
FT                   /locus_tag="Pput_0303"
FT   CDS_pept        complement(346938..347381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76476"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX66"
FT                   /protein_id="ABQ76476.1"
FT                   /translation="MATPTKQQKRAKRAASKAKQNRMVRSGQAVKASAGDSASVEQVYK
FT                   KAMESGSYDAMFNKMKEAQEGGLVPMISVFLVDPLLALVLKGHKEEHATDYIVLVFNAY
FT                   RKWLDGADEETTMAWLESDEFQDAYIAASELVAKQQQQQKQFG"
FT   gene            complement(347569..348549)
FT                   /locus_tag="Pput_0304"
FT   CDS_pept        complement(347569..348549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0304"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76477"
FT                   /db_xref="GOA:A5VX67"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX67"
FT                   /protein_id="ABQ76477.1"
FT                   /translation="MSEESPLLLPAPSEPTTTPIRTRRTRQRKPEPTITRISQQPAALE
FT                   VATAPKGSNEDSTSARLPASYPYRTRLRRQDYDKAKHALQIELLKVQSWVKETGQRVVI
FT                   LFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSEQEKGQWYFQRYIQHLPTEGEMVF
FT                   FDRSWYNRAGVEKVMDFCTPLQYLEFMRQAPDLERMLCNSGILLFKYWFSVNREEQLRR
FT                   FISRRDDPLKHWKLSPIDIKSLDKWEDYTSAKEAMFFHTDTADAPWTVIKSDDKKRARI
FT                   NCIRHFLHSLDYPGKDPRVAHAPDPLLVGRASHGFEEDETPQPAT"
FT   gene            complement(348720..348795)
FT                   /locus_tag="Pput_R0007"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(348720..348795)
FT                   /locus_tag="Pput_R0007"
FT                   /product="tRNA-Phe"
FT   gene            complement(348886..349158)
FT                   /locus_tag="Pput_0305"
FT   CDS_pept        complement(348886..349158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0305"
FT                   /product="Fe(II) trafficking protein YggX"
FT                   /note="PFAM: Fe(II) trafficking protein YggX"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76478"
FT                   /db_xref="GOA:A5VX68"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VX68"
FT                   /protein_id="ABQ76478.1"
FT                   /translation="MTRTVMCRKYQEELPGLERPPYPGAKGQDIFEHISQKAWADWQKH
FT                   QTMLINEKRLNMMNAEDRKFLQAEMDKFFAGEEYAQAEGYVPPAE"
FT   gene            complement(349155..350222)
FT                   /locus_tag="Pput_0306"
FT   CDS_pept        complement(349155..350222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0306"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   helix-hairpin-helix motif; HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76479"
FT                   /db_xref="GOA:A5VX69"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX69"
FT                   /protein_id="ABQ76479.1"
FT                   /translation="MSPEQFSSAVLDWYDEHGRHDLPWQQGITPYRVWVSEIMLQQTQV
FT                   STVLNYFDRFMQALPTVQALAEAPEDEVLHLWTGLGYYTRARNLQKAAKVVVEQHGGEF
FT                   PRSVEQLTELPGIGRSTAGAIASISMGIRAPILDGNVKRVLARYTAQAGYPGEPKVANQ
FT                   LWATAERLTPQQRANHYTQAMMDMGATLCTRSKPSCLICPLQRGCEAHLHGEETRYPEP
FT                   KPRKALPQRRTLMPLLANHEGAILLYRRPSSGLWGGLWSLPELDDIAQLDDLAYQHGLR
FT                   LAGRHAMDGLTHTFSHFQLAIEPWLVRVDPVGEHVVEADWLWYNLATPPRLGLAAPVKK
FT                   LLERATDELIAGDAR"
FT   gene            complement(350219..352465)
FT                   /locus_tag="Pput_0307"
FT   CDS_pept        complement(350219..352465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0307"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76480"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX70"
FT                   /protein_id="ABQ76480.1"
FT                   /translation="MKAFGKILGLGLLGLLLIIVALGFALTHLFDPNDYKDEIRQLARD
FT                   KAHVELTLNGDIGWSLFPWLGLELHEASIATLNKPKEPFADLQMLGLSVRVLPLLRREV
FT                   QMSDVRVEGLNLTLARDEQGHGNWEDIGKPLPAQNGAGTDAQAQAPAEQTPATTDSNDR
FT                   AIKLDIDSLTVNNARVQYTDAKTGQNYSAESIQLSTGPVHEGANIPLKASAFISASQPS
FT                   IKARTELAGELRFDRKLKRYNFEDMRLSGETSGEPTGGKTVTFAAQGQLLVDLAANVAS
FT                   WNGLKVSANQLRALGELNLRDLDKAPQLSGGLSIAQFNLRAFLESIGHPLPATNDPAAF
FT                   AKLELVTRLQGTPSSLALEDLAVKLDDSTFSGRVAVEDFAKHALRLQLKGDTFDADRYL
FT                   PAKSEEAKGATAARQAEVKQQEASAVAGAGTTPLPNAPTQVAWSDDKLLPVDRLRALDL
FT                   QADLAFGSLTLDKLPIEGAQLKAVGQGGLLTLQTLRGALYNGTFEAKGTVDVRPAVPQL
FT                   GVNTNIQRVPVEHFIKAEGKEQTPPVKGLLTLTSDLTATGNSQKALVDTLNGSANFAIN
FT                   DGVLVNANLEQQLCQAIATLNRKTLSSEPRGKDTPFQELRGSLVVRNGVASNPDLKARI
FT                   PGLTVNGHGDLDLRVLGMDYNVGVVVEGDQRAMPDPACQVNERYVGVEVPLRCRGPLEL
FT                   GAKACRLDQNGLGKVAAKLAGNRLKDKIDEKLDEKLGDKVSPELKDALKGLFKR"
FT   sig_peptide     complement(352382..352465)
FT                   /locus_tag="Pput_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.532 at
FT                   residue 28"
FT   gene            352733..354394
FT                   /locus_tag="Pput_0308"
FT   CDS_pept        352733..354394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0308"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76481"
FT                   /db_xref="GOA:A5VX71"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX71"
FT                   /protein_id="ABQ76481.1"
FT                   /translation="MTSTVATGTLASEPGFLSKERIIARPGFNRWLVPPAALAIHLCIG
FT                   MAYGFSVFWLPLSQALGITAPVACAADMGFMARMFSAECDWPISMLSWIYTLFFVFLGC
FT                   SAAVLGGWLEHAGPRKAGLVSALCWCGGMLLSAIGVKTHQLWLMWLGSGVIGGIGLGLG
FT                   YISPVSTLIKWFPDKRGMATGMAIMGFGGGAMVGAPLATALMGHFGNEHEVGVWQSFVA
FT                   MAAIYFVFMSAGALAYRVPPTGWKPEGWAAPLKNAGNAMVTDRHVHVSVAWKTPQFALI
FT                   WLVLCLNVSAGIGILGMASPLLQEVFAGKLLGNELTFSQLSTAQLAQIAAIAAGFTGLL
FT                   SLFNIGGRFFWASFSDYIGRKNTYFAFFALGVGLYSLVPNMGHLGNVALFVAAFCIILS
FT                   MYGGGFATVPAYLADLFGTQMVGAIHGRLLTAWAAAGVLGPVLITYLREYQLAAGVERA
FT                   AAYDMTLYILAGLLVLGFICNMLVRPVADKHFMSDAELAAERALSHDKGVDGARSLEWK
FT                   AAPGSLPLVLLAWAVVVVPLAWGVWVTLQKTAVLFH"
FT   gene            354625..355257
FT                   /locus_tag="Pput_0309"
FT   CDS_pept        354625..355257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0309"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76482"
FT                   /db_xref="GOA:A5VX72"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VX72"
FT                   /protein_id="ABQ76482.1"
FT                   /translation="MKPFSPNDFAELVMVERKASVERNTLETQVKCSINLDGSGKARFD
FT                   IGVPFLEHMLDQIARHGLIDLDIECKGDTHIDDHHTVEDVGITLGMAFAQAIGDKKGIF
FT                   RYGHAYVPLDEALSRVVIDFSGRPGLQMHVPYTRASVGGFDVDLFQEFFQGFVNHALVT
FT                   LHIDNLRGHNTHHQIETVFKAFGRALRMAITLDERMAGQMPSTKGCL"
FT   gene            355258..355896
FT                   /locus_tag="Pput_0310"
FT   CDS_pept        355258..355896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0310"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76483"
FT                   /db_xref="GOA:A5VX73"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX73"
FT                   /protein_id="ABQ76483.1"
FT                   /translation="MQTVAVIDYGMGNLHSVAKALEHVGAGKVLVTSDASVIREADRVV
FT                   FPGVGAIRDCMAEIRRLGFDSLVREVSQDRPFLGICVGMQALLEHSEENNGVDCIGLFP
FT                   GQVRFFGKDLQEEGEHLKVPHMGWNEVSQTIDHPLWHDIPDRARFYFVHSYYINAGKPG
FT                   QVVGRGHYGVDFAAALADGSRFAVQFHPEKSHTHGLQLLQNFIAWDGRW"
FT   gene            355897..356157
FT                   /locus_tag="Pput_0311"
FT   CDS_pept        355897..356157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76484"
FT                   /db_xref="InterPro:IPR018680"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX74"
FT                   /protein_id="ABQ76484.1"
FT                   /translation="MSRSKTKAPTITLAPEQEREALDTLKRFLEDRFELQLGSFEVAEV
FT                   LELFSKEIAPHYYNRAIADVQLHLKERFESIESDLWALEKP"
FT   gene            356185..356922
FT                   /locus_tag="Pput_0312"
FT   CDS_pept        356185..356922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0312"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76485"
FT                   /db_xref="GOA:A5VX75"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VX75"
FT                   /protein_id="ABQ76485.1"
FT                   /translation="MLIIPAIDLKDGACVRLRQGRMEDSTVFSDDPVSMAAKWVEGGCR
FT                   RLHLVDLNGAFEGQPVNGEVVTAIAKRYPNLPIQIGGGIRSLETIEHYVKAGVSYVIIG
FT                   TKAVKQPEFVAEACKAFPGKVIVGLDAKDGFVATDGWAEVSSVQVIDLARRFEADGVSA
FT                   IVYTDIAKDGMMQGCNVPFTKALAEATRIPVIASGGIHNLGDIKALLDAKAPGIIGAIT
FT                   GRAIYEGTLDVAEAQAFCDNYQG"
FT   gene            356933..357703
FT                   /locus_tag="Pput_0313"
FT   CDS_pept        356933..357703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0313"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76486"
FT                   /db_xref="GOA:A5VX76"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VX76"
FT                   /protein_id="ABQ76486.1"
FT                   /translation="MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGA
FT                   DEITFLDITASVDGRDTTLHTVERMASQVFIPLTVGGGVRTVQDIRNLLNAGADKVSIN
FT                   TAAVFNPEFVGEAADRFGSQCIVVAIDAKKVSGPGEAPRWEIFTHGGRKPTGLDAVEWA
FT                   KKMEGLGAGEILLTSMDQDGMKNGFDLGVTRAISDALGIPVIASGGVGNLQHLADGILE
FT                   GHASAVLAASIFHFGEYTVPEAKAYMASRGIVVR"
FT   gene            complement(357842..359020)
FT                   /locus_tag="Pput_0314"
FT   CDS_pept        complement(357842..359020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0314"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: glycine betaine/L-proline ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76487"
FT                   /db_xref="GOA:A5VX77"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022473"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX77"
FT                   /protein_id="ABQ76487.1"
FT                   /translation="MSIIRFEDVDVIFSNKPREALALLDQGQTREQILKQTGLVVGVEK
FT                   ANLDINKGEICVLMGLSGSGKSSLLRCINGLNTVSRGKLFVEHEGKHIDIANCSAAELK
FT                   MMRTKRIAMVFQKFALMPWLTVRENISFGLEMQGRPEKERRKLVDEKLELVGLTQWRNK
FT                   KPDELSGGMQQRVGLARALAMDADILLMDEPFSALDPLIRQGLQDELLGLQAKLSKTIV
FT                   FVSHDLDEALKLGTRIAIMKDGRIIQYSKPEEIVLNPADEYVRTFVAHTNPLNVLCGRS
FT                   LMRSLDNCKRVNGSVCLDPGIDSWLDLGEGGALKRARQGQNGLDMQRWAPGQDVELLER
FT                   RPTVVHADIGMREALQIRYQTGNKLVLQDNDRVVGILGDTELYHALLGKNHG"
FT   gene            complement(359017..359862)
FT                   /locus_tag="Pput_0315"
FT   CDS_pept        complement(359017..359862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0315"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76488"
FT                   /db_xref="GOA:A5VX78"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX78"
FT                   /protein_id="ABQ76488.1"
FT                   /translation="MLIDQKIPLGQYIASFVEWLTQNGANYFDAIAQGLEFMIHGVTSA
FT                   LTFFNPFVLIALFAALAHFIQRKWALTAFVALSFLLILNLGYWQETMETLAQVTFATVV
FT                   CVVIGVPLGILAAHKPMFYTAMRPVLDLMQTVPTFVYLIPTLTLFGLGVVPGLISTVVF
FT                   AIAAPIRLTYLGICDVPQELMDAGKAFGCSRRQLLTRIELPHAMPSIAAGVTQCIMLSL
FT                   SMVVIAALVGADGLGKPVVNALNTADISLGFEAGLAIVLLAIMLDRICKQPELPVRGEA
FT                   "
FT   gene            complement(359947..360894)
FT                   /locus_tag="Pput_0316"
FT   CDS_pept        complement(359947..360894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0316"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76489"
FT                   /db_xref="GOA:A5VX79"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX79"
FT                   /protein_id="ABQ76489.1"
FT                   /translation="MKGSPSLLLVALLSAPLLAQAAEPEQCQTVRFSDVGWTDITVTTA
FT                   TTSVVLEALGYKTHTTMISVPVTYKSLATGKDLDVFLGNWMPTMENDIKQYRDAGTVET
FT                   VRANLENAKYTLAVPQALYDKGLKDFSDIPKFKKELDGKIYGIEPGNDGNRTIQSMIDK
FT                   NAFGLKDAGFKIVQSSEAGMLSQVDRAQKRGEALVFLGWEPHPMNTRFKMQYLTGGDDF
FT                   FGPDFGKATVLTNTRKGYTQECSNVGQLLKNLSFELKDESTMMGYVLDDKMKPEAAAKK
FT                   WIKDNPGKLDAWLAGVTTVDGKPGLEAVKAKLTQ"
FT   sig_peptide     complement(360829..360894)
FT                   /locus_tag="Pput_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            361347..362723
FT                   /locus_tag="Pput_0317"
FT   CDS_pept        361347..362723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0317"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="TIGRFAM: L-serine dehydratase 1; PFAM: serine
FT                   dehydratase alpha chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76490"
FT                   /db_xref="GOA:A5VX80"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX80"
FT                   /protein_id="ABQ76490.1"
FT                   /translation="MAISVFDLFKIGVGPSSSHTVGPMRAGALFVQGLRERGELERVKR
FT                   IEVRLYGSLSATGIGHGTDNATIMGLMGEWPDAIDPTQIVPRIADLRETNTLQLDSRLP
FT                   VEFVWARDMLLLDENLPYHPNAMTLIAEGEQGELHRDTYYSVGGGFVVDAAQAASGVLD
FT                   ADQTVLPYDFNSAAELLRLCKQNDLSVSQLMMANEKVWRSEEDIRAGLHKLWEAMQECV
FT                   NNGLKYEGTLPGGLNVRRRAAKLHRSLQEIGKPNVIGSTMSAMEWVNLFALAVNEENAA
FT                   GGRMVTAPTNGAAGIIPAVLHYYMRFSDAVDESSVVDYFLAAAAVGILCKKNASISGAE
FT                   VGCQGEVGSACAMAAAGLAEVLGATPPQVENAAEIALEHNLGLTCDPVGGLVQVPCIER
FT                   NAIAAVKAINAVQMALRGDGEHFISLDQVIRTMRDTGADMHDKYKETSRGGLAVSAIEC
FT                   "
FT   gene            363225..364331
FT                   /locus_tag="Pput_0318"
FT   CDS_pept        363225..364331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0318"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76491"
FT                   /db_xref="GOA:A5VX81"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX81"
FT                   /protein_id="ABQ76491.1"
FT                   /translation="MTSYTSGNPTQNRTTPQSIGFLLLDNFTLISLASAVEPLRMANQL
FT                   SGRELYRWHTLTIDGGQVWASDGLQITPDAAISNAPPIDTVIVCGGVGIQRSVTREHVT
FT                   WLQAQARQSRRLGAVCTGSWALACAGLLDGFDCSVHWECLAAMQEAFPRVNMSTRLFTL
FT                   DRNRFTSSGGTAPLDMMLHLISRDHGRELSAAISEMFVYERIRNEQDHQRVPLKHMLGT
FT                   NQPKLQEIVALMEANLEEPIDLDELAVYVAVSRRQLERLFQKYLHCSPSRYYLKLRLIR
FT                   ARQLLKQTPMSIIEVASVCGFVSTPHFSKCYREYFGIPPRDERVGSNTAQQVAMMPIPQ
FT                   AMTLSPHSGPMAALSQARNESTFASVRL"
FT   gene            complement(364453..364710)
FT                   /locus_tag="Pput_0319"
FT   CDS_pept        complement(364453..364710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76492"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX82"
FT                   /protein_id="ABQ76492.1"
FT                   /translation="MMHADLIDQDDLAGHLRARGFDIPAGASAEQACEAVVRGLTEPNA
FT                   RALKGMVEQMYTGSATILPAVRQAIDKQLLPALAQFNKRA"
FT   gene            365049..366746
FT                   /locus_tag="Pput_0320"
FT   CDS_pept        365049..366746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0320"
FT                   /product="Ricin B lectin"
FT                   /note="PFAM: Ricin B lectin"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76493"
FT                   /db_xref="GOA:A5VX83"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX83"
FT                   /protein_id="ABQ76493.1"
FT                   /translation="MWKMDSTGAENVKKNICMIIVLGATLIMASCSSSTPPMSTVGSVV
FT                   PQLFTLQPTQNRQMLQKTAKGYLKTLLADPANEEFTLVNVDASLIEGGTENIVVTLPDR
FT                   KTEKFHRRNFNFLADGYEGWVGYQSSKWKAGSSGSESEIDFDPKFYMSVIRLGNQLAAS
FT                   FLVEGQRYRLVYIGSDTHVLIKVDESKLPSEDALGAEVEIPVSPALEKPQQVSSAYSII
FT                   RLLFVSTVQSRAKNPNYRADLMLGLQDVNQIAKNSKVNITYEFAGFIDSAIDEVGKDFG
FT                   TLLNEVQYNNPAVNAKRVELRADLVSMYVANNELCGAGKPSTNKTQGFSAISCITSLGH
FT                   EIGHNFGMIHNWDGQTDTYIHGYRYGPDGGTLRFRTQMSYDCSPTCPRVPFYSNPRLSY
FT                   QGQPLGTVAHHDVARAINERRASIESFYPPMPGVLKNKGRLEQGSPHPCLQDFAGSNIQ
FT                   FVACSPGPQQKWTLEPWGEAGTFRIVAPGGNCMVARADNSVLAEPCPATVKDSLLWMVS
FT                   AQPDHTLKIQSYNRNLCLGSQPSLKPGPELLACDNGRYQSWINLDIPQ"
FT   sig_peptide     365049..365150
FT                   /locus_tag="Pput_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.916) with cleavage site probability 0.529 at
FT                   residue 34"
FT   gene            complement(366791..367261)
FT                   /locus_tag="Pput_0321"
FT   CDS_pept        complement(366791..367261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0321"
FT                   /product="thioesterase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76494"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX84"
FT                   /protein_id="ABQ76494.1"
FT                   /translation="MPALITYRTTVQEDWVDYNGHLRDAFYLLIFSYATDALMERIGLD
FT                   ADSRGQSGNSLFTLEAHINYLHEVKLGTEVWVQTQIIGFDKKRLHLYHSLHRSGFDEAL
FT                   AASEQLLLHVDLAGPKAKPFGESSTHRLQSVVDDQRDLPTPAFTGRVIKIPG"
FT   gene            complement(367272..368237)
FT                   /locus_tag="Pput_0322"
FT   CDS_pept        complement(367272..368237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0322"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76495"
FT                   /db_xref="GOA:A5VX85"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX85"
FT                   /protein_id="ABQ76495.1"
FT                   /translation="MPFITEIKTFAALGSGVIGSGWVARALAHGLDVVAWDPAPGAEQA
FT                   LRKRVANAWPALEKQGLALGASQDRLKFVATIEECVRNADFIQESAPERLDLKLDLHAK
FT                   ISAAAKPDAIIGSSTSGLLPSEFYESSTHPERCVVGHPFNPVYLLPLVEIVGGSRTSPE
FT                   AIEAAKTIYTALGMRPLHVRKEVPGFIADRLLEALWREALHLVNDGVATTGEIDDAIRF
FT                   GAGLRWSFMGTFLTYTLAGGDAGMRHFMSQFGPALKLPWTYLPAPELTDKLIDDVVSGT
FT                   SEQQGERSIAALERYRDDTLLAVLEAVKTSKASHGLSFSD"
FT   sig_peptide     complement(368151..368237)
FT                   /locus_tag="Pput_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.964 at
FT                   residue 29"
FT   gene            complement(368408..369292)
FT                   /locus_tag="Pput_0323"
FT   CDS_pept        complement(368408..369292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0323"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76496"
FT                   /db_xref="GOA:A5VX86"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX86"
FT                   /protein_id="ABQ76496.1"
FT                   /translation="MNHDVIITCALTGAGDTASKSHLVPVTPKQIAESAVEAAKAGATV
FT                   VHCHVRDPQTGRFSRDVNLYREVMERIREADVDIIVNLTAGMGGDLEIGPGETPLAFGP
FT                   GTDLIGPLERLAHVEALLPEICTLDCGTLNFGDGNSIYVSTPAQLRAGAKRITELGVKA
FT                   ELEIFDTGHLWFAKQMMKEGLLEDPLFQLCLGIPWGAPADTTTMKAMVDNLPANVTWAG
FT                   FGIGRMQMPMAAQAVLLGGNVRVGLEDNLYLDRGVLASNGQLVERASEIITRMGGRVLS
FT                   PAEGREKMNLKRR"
FT   gene            complement(369416..370360)
FT                   /locus_tag="Pput_0324"
FT   CDS_pept        complement(369416..370360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0324"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76497"
FT                   /db_xref="GOA:A5VX87"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX87"
FT                   /protein_id="ABQ76497.1"
FT                   /translation="MHSLIRRSLLPLALSSIVATPLFAAEPAACKNVRLGVVNWTDVIA
FT                   TSAMAQVLLDGLGYQTKQTSASQQIIFAGIRDKRLDMFLGYWNPIMTQTITPFVDANQV
FT                   KVLDKPSLEDARATLAVPKYLYDKGLKTFADIHKFEKALGGKIYGIEPGSGANTQIKAM
FT                   ITKNQFDLGKFQLVESSEAGMLAAVDRAVRRKEAVVFFGWAPHPMNVNIDMAYLGDSQD
FT                   ALGPDEGRATVWTVTAPDYAERCPNAHRLLANLKFSAEDESRMMQPLLDHKDALESARQ
FT                   WLKDHPEDKARWLEGVTTFDGKPAADNLKLTAN"
FT   sig_peptide     complement(370286..370360)
FT                   /locus_tag="Pput_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            370505..371452
FT                   /locus_tag="Pput_0325"
FT   CDS_pept        370505..371452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0325"
FT                   /product="transcriptional regulator, AraC family with
FT                   amidase-like domain"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76498"
FT                   /db_xref="GOA:A5VX88"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX88"
FT                   /protein_id="ABQ76498.1"
FT                   /translation="MMETIAFLLVPGFSAMGFISAVEPLRVANRFGGQLYRWQVLSLDG
FT                   EAVLASNGMSINADAALGEGEPANILLVVAGFEPLANVAPKLLHALRRLNHEAVMLGGI
FT                   DTGAMVLAEAGLLEGYRATLHWEALEAFKERYPGLQATQELFEIDRSRITCAGGTASID
FT                   LMLHLIAQSHGSELAVKVSEQFVLGRIRQRQDHQRMQIGARYGISNKKLVHAIGEMEKH
FT                   IEPPLSTLELAAAIKVTRRQLERLFRMHLDATPSGFYLGLRLDKARQLLAQTDMSVTEV
FT                   SLACGFELPSYFTRRYKLRFGRCPREERRPSGTK"
FT   sig_peptide     370505..370570
FT                   /locus_tag="Pput_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.907) with cleavage site probability 0.868 at
FT                   residue 22"
FT   gene            complement(371456..372073)
FT                   /locus_tag="Pput_0326"
FT   CDS_pept        complement(371456..372073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76499"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX89"
FT                   /protein_id="ABQ76499.1"
FT                   /translation="MGDTNLDTRVFEERLSIKPAPWLTLETWEDLQLCLRYSQAVANEK
FT                   FSMETQPQQWFTVALATLQSLKFTLFEHTHKTIVYEPHLLALSDVYSGYLPPPREKGPW
FT                   FKSLEENVQAALQSAGTRTFTVMNASSHLSIEMDHEGDQVPVAILFYAYCVTDPVEPTR
FT                   KLNLIFDHLGARFNAADFAPLRKDLQARNREKLRAILERELD"
FT   gene            complement(372145..372837)
FT                   /locus_tag="Pput_0327"
FT   CDS_pept        complement(372145..372837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76500"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX90"
FT                   /protein_id="ABQ76500.1"
FT                   /translation="MADIKVEMEKIRKEGQERVAATGQTICVFADNVPANIAEDILAGM
FT                   RLMTELANKKFDKETQQREWYNFYNDGLIKFGWTMTGAAHAEDAIDEDNLTLAELITKS
FT                   VTISVSADPRRAACARRVLQIVVQKPEVKAHLEKHSHSESGKSSNFVVAQCEMTPQGLP
FT                   AMHMTSFQASYDSKVEREGALTRKVDKTSTRVYRASQQGTFSVRHFDAARDLVNEKIKG
FT                   DIAAFLAI"
FT   gene            complement(372976..373392)
FT                   /locus_tag="Pput_0328"
FT   CDS_pept        complement(372976..373392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0328"
FT                   /product="protein of unknown function DUF1311"
FT                   /note="PFAM: protein of unknown function DUF1311"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76501"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX91"
FT                   /protein_id="ABQ76501.1"
FT                   /translation="MKSMAWLVLLAIVSGAQASEDESTPCDNVETDQQTFACAAFNKQV
FT                   AERELQSAYDDLVARMRDQFGDEAGLMSRIEAAEKVWSQLRDADCKVETHAEQPGSRAY
FT                   QIAWNSCIAQRSDERAEYLRSLGSQNSDEPAPED"
FT   sig_peptide     complement(373336..373392)
FT                   /locus_tag="Pput_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.929 at
FT                   residue 19"
FT   gene            373678..374655
FT                   /locus_tag="Pput_0329"
FT   CDS_pept        373678..374655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0329"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="PFAM: peptidase M19, renal dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76502"
FT                   /db_xref="GOA:A5VX92"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX92"
FT                   /protein_id="ABQ76502.1"
FT                   /translation="MSPAELHADSIVIDGLIIAKWNRELFEDMRKGGLTAANCTVSVWE
FT                   GFKATVDNIASSQKLIRDNSDLVMPVRTTADIRKAKELGKTGILFGFQNAHAFEDQIAY
FT                   VDVFKQLGVGIVQMCYNTQNLVGTGCYERDGGLSGFGREIVAEMNRVGIMCDLSHVGSK
FT                   TSEEVILESKKPVCYSHCLPSGLKEHPRNKSDEELKFIADHGGFVGVTMFAPFLAKGID
FT                   STIDDYAEAIEYTMNIVGEDAIGIGTDFTQGHGQDFFEYLTHDKGYARRLTNFGKIINP
FT                   LGIRTVGEFPNLTETLLKRGHSERVVRKIMGENWVNVLKDVWGE"
FT   gene            374732..375262
FT                   /locus_tag="Pput_0330"
FT   CDS_pept        374732..375262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76503"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX93"
FT                   /protein_id="ABQ76503.1"
FT                   /translation="MAKIAPQLPIEVDSETGVWTSDALPMLYVPRHFFVNNHIGIEEVL
FT                   GADAYAEILYKAGYKSAWHWCEKEAECHGLEGVAVFEHYMKRLSQRGWGLFEIQDIDLD
FT                   KGTCSVKLKHSAFVYVYGKCGRKVDYMFTGWFAGAMDQILAARGSNIRTVAEQVYGGSE
FT                   EGHEDGLFVTKPL"
FT   gene            375278..377338
FT                   /locus_tag="Pput_0331"
FT   CDS_pept        375278..377338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0331"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76504"
FT                   /db_xref="GOA:A5VX94"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX94"
FT                   /protein_id="ABQ76504.1"
FT                   /translation="MAFEAMFQPIQIGKLTIRNRVLSTAHAEVYATDGGMTTDRYVKYY
FT                   EEKAKGGIGLAICGGSSVVAIDSPQEWWASVNLSTDRIIPHFQNLADAMHKHGAKIMIQ
FT                   ITHMGRRSRWDGFNWPTLMSPSGIREPVHRATCKTIEVEEIWRVIGNYAQAARRAKEGG
FT                   LDGVELSAVHQHMIDQFWSPRVNKRTDEWGGTFEGRMKFGLEVLKAVRAEVGDDFCVGM
FT                   RICGDEFHPDGLSHEDMKQIAAYYDATGMLDFIGVVGSGCDTHNTLANVIPNMSYPPEP
FT                   FLHLAAGIKEVVKVPVLHAQNIKDPNQATRILEGGYVDMVGMTRAHMADPHLIAKIKMG
FT                   QIDQIKQCVGANYCIDRQYQGLDVLCIQNAATSREYMGVPHIIEKTTGVKRKVVVVGAG
FT                   PAGMEAARVAAERGHDVTLFEKRDQIGGQITIAAKAPQRDQIAGITRWYQLELARLKVD
FT                   LRLGTAADVAAIQDLRPDVIVLAVGGHSFLEQNEHWGAAEGLVVSSWDVLDGKVAPGKN
FT                   VLVYDTICEFTGMSVADFIADKGSQVEIVTDDIKPGVAMGGTTFPTYYRSMYPKEVIMT
FT                   GDMMLEKVYREGDKLVAVLENEYTGAKEERVVDQVVVENGVRPDEELYYALKEGSRNKG
FT                   QIDVEALFAIKPQPILSQPGEGYLLYRIGDCVAQRNVHAAIYDALRLCKDF"
FT   gene            377517..379469
FT                   /locus_tag="Pput_0332"
FT   CDS_pept        377517..379469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0332"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76505"
FT                   /db_xref="GOA:A5VX95"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021872"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX95"
FT                   /protein_id="ABQ76505.1"
FT                   /translation="MLNTLLPILLFAALGLAVLGALRRVRMWRRGRPSKVNLIGGLLAM
FT                   PRRYLVDLHHVVERDKYMSKTHVATAGGFVLSAVLAILVHGFGLQSKILGYALLVATVI
FT                   MFTGAIFVFKRRLNPPSRLSKGPWMRLPKSLLAFAVSFFIATLPVAGILPANTGGWVMV
FT                   AILGLGVLWGVSELFFGMTWGGPMKHAFAGALHLAWHRRADRFGGGRSTGLKPLDLEDP
FT                   NAPLGVEKPVDFTWNQLLGFDACVQCGKCEAMCPAFAAGQPLNPKKLIQDMVIGLAGGT
FT                   DAQFAGSPYPGKPIGEHGGNPHQPIVNGLVDAETLWSCTTCRACVEECPMMIEHVDAIV
FT                   DMRRHLTLEKGATPNKGAEVLDNLIATDNPGGFAPGGRMNWAADLNLRLLSEVKATEVL
FT                   FWVGDGAFDMRNQRTLRSFVKVLKASGVDFAVLGLEERDSGDVARRLGDEATFQQLAKR
FT                   NIQTLAKYKFQRIVTCDPHSFHVLKNEYGALGGDYQVQHHSTYIAELIAAKKLNLGQHK
FT                   GGSVTYHDPCYLGRYNGEYEAPREVLKALGIEVREMQRSGFRSRCCGGGGGAPITDIPG
FT                   KQRIPDMRMDDIRETEAELVAVGCPQCTAMLEGVVEPRPQIKDLAELVADVLIEEDAST
FT                   VPKPQTAKREPAEVH"
FT   sig_peptide     377517..377579
FT                   /locus_tag="Pput_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.976) with cleavage site probability 0.930 at
FT                   residue 21"
FT   gene            379469..380701
FT                   /locus_tag="Pput_0333"
FT   CDS_pept        379469..380701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0333"
FT                   /product="Electron transfer flavoprotein, alpha
FT                   subunit-like protein"
FT                   /note="PFAM: Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like; Electron transfer flavoprotein,
FT                   alpha subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76506"
FT                   /db_xref="GOA:A5VX96"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX96"
FT                   /protein_id="ABQ76506.1"
FT                   /translation="MSDIIRRDPRAEWIARNRLHPLHAAMQTQQTSWMGPNGIIRKNPH
FT                   AIAAGFFGPAGIKRIDRSGAQQGTGAGGRRTATVEVKLPLHQVAAPAFYIAVVPDMVGG
FT                   RLSSHDRDLLGLAHSLAGSDGAVLAVVFNEHKESNFSTAGVDRLLVIEGEAFEGYAPEQ
FT                   LVQGLRAVDNQFAPRHWLLPDSRTGGGELGRRLGAALGERPATRVWQIKDGQCIGRAGA
FT                   GQQDLQRTVPRLILAAAECAEPVSETRHEALPVELSTSVARSLPRIEDLGSVAVDPATI
FT                   AMAEAEFIVSGGNGVKDWDLYHKATAALGATEGASRVAVDDGFMPRNRQVGATGTWVTA
FT                   RVYVAVGISGAIQHLQGIGACDKVVAINMDPGCDMIKRADLSVIGDSSAILKALIEAVD
FT                   NFRSSGQRDAA"
FT   gene            380712..381482
FT                   /locus_tag="Pput_0334"
FT   CDS_pept        380712..381482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0334"
FT                   /product="Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like protein"
FT                   /note="PFAM: Electron transfer flavoprotein,
FT                   alpha/beta-subunit-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76507"
FT                   /db_xref="GOA:A5VX97"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX97"
FT                   /protein_id="ABQ76507.1"
FT                   /translation="MSTKVISLVSIGAHPSSGRARRAEQDARAVELGLQLAGDNLQVVH
FT                   AGDPQEEALRAYLGMGLDHLDVLEQPAGADVLGVLGDYLRDAGAQLVLTGSQAETGEGS
FT                   GMLPFLLAEKLGWPLIVGLAEVESIDNGTAQVLQALPRGQRRRLKVRLPLLATVDNAAP
FT                   KPRQSAFGPARRGVLAARNVAIVEDELLAEAELQPARPRPKRLKVIKAKSGADRMKAAT
FT                   AKASGGGGKVLKDVSPQEGAEAILKLLVEEGVLR"
FT   gene            382083..382910
FT                   /locus_tag="Pput_0335"
FT   CDS_pept        382083..382910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76508"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX98"
FT                   /protein_id="ABQ76508.1"
FT                   /translation="MATFLLSADRQLSVLHGLAFSPRVYSPYGIMNAAPVPGLAFCGQY
FT                   QDPLTGSYPLGNGHRFYSPNLMRFITHDRLSPFSRGGINSYVYCGADPVNRHDPSGAAW
FT                   SILLRSVSVVSSAATLVGSVVRTVKNVVGRRIAFKARITNSGRETPVVHNELPHLSRVS
FT                   NQQFFITGSAGLAGQVIAATSGVTPALQTATDVLGLVNSVTNLSGGLTGNLAAAREVSR
FT                   YFWRYPREIPGVALETLMDVTMMDEMAANVGRGLTAVANRISFWRTPTYEVQV"
FT   gene            complement(382991..384283)
FT                   /locus_tag="Pput_0336"
FT   CDS_pept        complement(382991..384283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0336"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76509"
FT                   /db_xref="GOA:A5VX99"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A5VX99"
FT                   /protein_id="ABQ76509.1"
FT                   /translation="MDVTATLSLGDPLEPARKATAEMLQTRERTYSLPQPFYTDERLFQ
FT                   IDMQEIFHKEWLIAGMTCEIPAKGNYITLQIGKNPIIVIRGAEGKVHAFHNVCRHRGSR
FT                   LCVSDKGKVAKLVCHYHQWTYELDGRLLFAGTEMGADFDMKEYGLKPVNVKVAGGYIFI
FT                   SLAENPPAIDEFLATLEHYMEPYDMENTKVAVQTTLMEKANWKLVLENNRECYHCSGSH
FT                   PELLQTLLEWDDTNDPRASQEFKDHVAASAAAWEAEKIPYLHKSHGLRNRIVRMPLLKG
FT                   TVSMTMDGKQACQKLMGRIKNPDLGSMRILHLPHSWNHCMGDHMIVFTVWPISAQETMV
FT                   TTKWLVHKDAVEGVDYNPENMRKVWDATNDQDRRLAEENQRGINSTAYQPGPYSKTYEF
FT                   GVVNFIDWYSGRMLNNLGAEPAPYLKEVQAQ"
FT   gene            384579..385679
FT                   /locus_tag="Pput_0337"
FT   CDS_pept        384579..385679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0337"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76510"
FT                   /db_xref="GOA:A5VXA0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXA0"
FT                   /protein_id="ABQ76510.1"
FT                   /translation="MSDTFLNPVTTQTWANGRHIVRCVKVIQETWDVRTFCFMADQPIM
FT                   FFFKPGQFVTLELEIEGKPVMRSYTISSSPSVPYSFSITVKRVPGGLVSNFLHDTMHEG
FT                   AELPVHGPVGLFNAIDFPAGKVLYLSGGVGITPVMSMARWFYDTNANVDMVFVHSARSP
FT                   KDIIYHRELEQMASRIPNFSLHIICEKHGLGEPWAGYRGYLNQRLMELIAPDYMERVVF
FT                   CCGPTPYMTAVKRMLEAVGFEMKNYHEESFGATPAEAKADAVEHAEQAADAPELDVSDL
FT                   NLVEFIGSEKSIRVAPGETVHAAAAKVGLMIPKACGMGICGTCKVLKLGGEVEMEHNGG
FT                   ITEEDEAEGYILSCCSVPKGDVRIDY"
FT   gene            385773..386495
FT                   /locus_tag="Pput_0338"
FT   CDS_pept        385773..386495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76511"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXA1"
FT                   /protein_id="ABQ76511.1"
FT                   /translation="MLYKKGGGMVDEGILHLHLSSSFLPNAGRRVCAYSPYGVVHDNGA
FT                   AMIAFNAELRDSATSNYLLGKGRRMYSPALMRFLSADRLSPFSRGGINAYAYCHGNPVN
FT                   RVDPTGQYSVTKVIANTVWLGKRAKASMSNLKGLKRLDDRNKWVKKVGVVMVAAGVPGA
FT                   NWVNVASFAVKMGSATVDVGFFFGRKAVDYFVMHKVRPMIAGILPPNGLSRVNSAPPVS
FT                   QVTQVREGHLSRRHSSAF"
FT   gene            complement(386498..388123)
FT                   /locus_tag="Pput_0339"
FT   CDS_pept        complement(386498..388123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0339"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76512"
FT                   /db_xref="GOA:A5VXA2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXA2"
FT                   /protein_id="ABQ76512.1"
FT                   /translation="MSLRNMNIAPRALLGFALIGLLMLGLGIFSLVQMGNIRQAGVAIE
FT                   QVSVPSIKILDELTALNLRMRTLSYRLLLNREPATQRDTLDLLDQRNSQIDRARQAYLP
FT                   MIVAADEQAAFDQYGQLLNQYRQLESRMRTLSQADRLDELRDLLNRDLLANSEQINKVM
FT                   DTLVRINTDQTRATNEKAANQYAGAFALVIGLLVAATVLTFACAFLLTRSIVKPIEEAL
FT                   KCAEQVADGDLTHFIRAEGTDEAARLLRAMARMQDKLRDTLQQIAGSATQLASAAEELN
FT                   AVTDESARGLQQQNNEIEQAATAVTEMTSAVEEVARNAVSTSEASSEASRSTGDGRDLV
FT                   METVGAIERMSGDVQATAKLITHLAEQSRDIGKVLDVIRGLADQTNLLALNAAIEAARA
FT                   GEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQGGTEEAVESMRTSTERAESTLNI
FT                   ARGAGMALDTIAGAVAQINERNLVIASAAEEQAQVAREVDRNLVNINDLSVQSATGAHQ
FT                   TSAASAELSRLAVDLNSLVARFRT"
FT   sig_peptide     complement(388016..388123)
FT                   /locus_tag="Pput_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.624 at
FT                   residue 36"
FT   gene            388390..388620
FT                   /locus_tag="Pput_0340"
FT   CDS_pept        388390..388620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76513"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXA3"
FT                   /protein_id="ABQ76513.1"
FT                   /translation="MLEASLNQIEQLVSDLMQKNAQLIEQNTALGQELAQAKEENETLQ
FT                   LSLMEQEEKNGATAARIQALVERASAGVVGA"
FT   gene            388617..388919
FT                   /locus_tag="Pput_0341"
FT   CDS_pept        388617..388919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0341"
FT                   /product="cell division protein ZapA"
FT                   /note="PFAM: protein of unknown function DUF710"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76514"
FT                   /db_xref="GOA:A5VXA4"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXA4"
FT                   /protein_id="ABQ76514.1"
FT                   /translation="MRLQEQPINVVSILGIDYSIKAPEGQEETLAQAVRMLNKALNETK
FT                   RQYPTLIGDKLLVLAALNLCSKQVELQKEHQQTLARTQAQIDATVDAIVRTIAEQ"
FT   gene            389241..391178
FT                   /locus_tag="Pput_0342"
FT   CDS_pept        389241..391178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0342"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76515"
FT                   /db_xref="GOA:A5VXA5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXA5"
FT                   /protein_id="ABQ76515.1"
FT                   /translation="MRIWRKSIQLQLITSMGAALLASILVVVIIFTVALNRLTDRYLVD
FT                   TALPASIEAIRNDIERMLGQPLVAAADIAGNTLLRDWLAAGEDPAQAPQFIEYLTAAKQ
FT                   RNHAFTTLFASTETGHYYNENGLDRTLSRSNPKDKWFYGYIDSGAERFINIDIDGATGE
FT                   LALFIDYRVEKEGKLVGVAGMGLRMTELSKLIHDFSFGEHGKVFLVRNDGLIQVHPDAA
FT                   FSGKRQLAEQLGADSAKGVMTGGESLRSSRFSRDGERYLALGLPLRDLNWTLVAEVPES
FT                   EIYAQMHQAVWLTSLIGGAVALVSLLLVVLLARGLVRPIRRVTAALVQIGGGAGDLSHR
FT                   LDDSRQDELGDLARGFNRFLDSQRSLIGEVLSTSERLRRAVEQVTQVVDNTAERSGRQQ
FT                   EMTEMVATAVHEMGLTVQDIARNAGDAAQASQSARDEALQAREVVQRSIRGIEGMSGDI
FT                   GKAADAVSQLADEVASVDEVLAVIRSISEQTNLLALNAAIEAARAGEMGRGFAVVADEV
FT                   RTLARRTQLSTDEVQQMIQRLKLGAGSAVSSMQAGQQATGSGVESSQRTGASLSAITDQ
FT                   VEHISDMNHQVATATEEQSAVTEEINRTVQGISDLARETAAEVQGCREECQALRGLADD
FT                   LARQMGGFRL"
FT   sig_peptide     389241..389351
FT                   /locus_tag="Pput_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.422 at
FT                   residue 37"
FT   gene            complement(391317..392357)
FT                   /locus_tag="Pput_0343"
FT   CDS_pept        complement(391317..392357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0343"
FT                   /product="L-threonine aldolase"
FT                   /EC_number="4.1.2.5"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76516"
FT                   /db_xref="GOA:A5VXA6"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026273"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXA6"
FT                   /protein_id="ABQ76516.1"
FT                   /translation="MTDKSQQFASDNYSGICPEAWAAMEKANRGHDRAYGDDQWTERAS
FT                   EYFRKLFETDCEVFFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNG
FT                   SKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAISAT
FT                   CKELGLNLHMDGARFTNACAFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILFFNRQ
FT                   LAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHCAQLLASLVSDLPGV
FT                   ELMFPVEANGVFLQMPEHAIEALRGKGWRFYTFIGSGGARFMCSWDTEEARVRELAADI
FT                   RAIIAG"
FT   gene            392682..393935
FT                   /locus_tag="Pput_0344"
FT   CDS_pept        392682..393935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0344"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase;
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76517"
FT                   /db_xref="GOA:A5VXA7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXA7"
FT                   /protein_id="ABQ76517.1"
FT                   /translation="MFSKQDQIQGYDDALLAAMNAEEQRQEDHIELIASENYTSKRVMQ
FT                   AQGSGLTNKYAEGYPGKRYYGGCEHVDKVEALAIERAKQLFGADYANVQPHSGSSANGA
FT                   VYLALLQAGDTILGMSLAHGGHLTHGAKVSSSGKLYNAVQYGIDTNTGLIDYDEVERLA
FT                   VEHKPKMIVAGFSAYSKTLDFPRFRAIADKVGALLFVDMAHVAGLVAAGLYPNPIPFAD
FT                   VVTTTTHKTLRGPRGGLILAKSNEEIEKKLNAAVFPGAQGGPLMHVIAAKAVCFKEALE
FT                   PGFKAYQQQVIENAQAMAQVFIDRGYDVVSGGTDNHLFLVSLIRQGLTGKDADAALGRA
FT                   HITVNKNAVPNDPQSPFVTSGLRIGTPAVTTRGFKVAQCVALAGWICDILDNLGDADVE
FT                   ADVAKNVAALCADFPVYR"
FT   gene            393951..395201
FT                   /locus_tag="Pput_0345"
FT   CDS_pept        393951..395201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0345"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76518"
FT                   /db_xref="GOA:A5VXA8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXA8"
FT                   /protein_id="ABQ76518.1"
FT                   /translation="MQRYSGFGLFKHSLSHHENWQRMWRTPTPKKVYDVVIVGGGGHGL
FT                   ATAYYLAKEHGITNVAVIEKGYLGGGNTARNTTIVRSNYLWDESAHLYEHAMKLWEGLS
FT                   QDLNYNVMFSQRGVYNLCHTLQDMRDSERRVSANRLNGVDGELLNTAQVAAEIPYLDCS
FT                   KNTRYPILGATVQRRGGVARHDAVAWGFARAADALGVDLIQQTEVIGFRKENGAVIGVE
FT                   TNKGFIGAKRVGVVTAGNSGHMAKLAGFRLPLESHPLQALVSEPIKPIIDSVIMSNAVH
FT                   GYISQSDKGDLVIGAGIDGWVGYGQRGSYPVIEHTLQAIVEMFPNLSRVRMNRQWGGIV
FT                   DTSPDACPIITKTPVKNMFFNCGWGTGGFKATPGSGNVFAASLAKGEMHPLAAPFSMDR
FT                   FYNGALIDEHGAAAVAH"
FT   gene            395216..395551
FT                   /locus_tag="Pput_0346"
FT   CDS_pept        395216..395551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0346"
FT                   /product="sarcosine oxidase, delta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, delta subunit family;
FT                   PFAM: Sarcosine oxidase, delta subunit, heterotetrameric"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76519"
FT                   /db_xref="GOA:A5VXA9"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXA9"
FT                   /protein_id="ABQ76519.1"
FT                   /translation="MLHIFCPHCGELRSEEEFHASGQAHIARPLDPNACSDEEWGTYMF
FT                   YRDNPRGIHHELWDHVAGCRQYFNVTRDTVTYEILETYKIGEKPQVTANGKAASATSTV
FT                   KGQGEKV"
FT   gene            395548..398562
FT                   /locus_tag="Pput_0347"
FT   CDS_pept        395548..398562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0347"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, alpha subunit family;
FT                   PFAM: glycine cleavage T protein (aminomethyl transferase);
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76520"
FT                   /db_xref="GOA:A5VXB0"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXB0"
FT                   /protein_id="ABQ76520.1"
FT                   /translation="MSQTYRLASGGRIDRSKVLNFTFNGKTYQGYAGDSLAAALLANGV
FT                   DIVGRSFKYSRPRGIIAAGTEEPNAILQIGSSEATQIPNVRATQQALYAGLVATSTNGW
FT                   PNVNNDVMGILGKVGGSMMPPGFYYKTFMYPKSFWMTYEKYIRKAAGLGRAPLQNDPDS
FT                   YDYMNRHCDVLIVGAGPAGLAAALAAARSGARVILADEQEEFGGSLLDTRETLDGKPAA
FT                   EWVNAVVKELEGLPEVTLLPRATVNGYHDHNFLTIHERLTDHLGDRAPIGQVRHRVHRV
FT                   RAKRVVLAAGAHERPLVYGNNDVPGNMLAGAVSTYVRRYGVAPGRKLVLSTNNDHAYRA
FT                   ALDWHDAGLQVVAIADARHNPRGSLVEEARAKGIRILTSSAVVEAKGSKHVTGARVAAI
FT                   DVQAHKVTSPGEVLECDLIASSGGYSPIVHLASHLGGRPVWRDDILGFVPGDAPQKREC
FT                   VGGINGVYALGDVIADGFEGGVRAATEAGFKATVGTLPKTVARKEEATVALFLVPHDKG
FT                   TKGPKQFVDQQNDVTAAGIELATREGFESVEHVKRYTALGFGTDQGKLGNINGLAIAAR
FT                   SIGITIPEMGTTMFRPNYTPVTFGAVAGRHCGHLFEPVRFTALHAWHVKNGAEFEDVGQ
FT                   WKRPWYFPKAGEDIHAAVTRECKAVRDSVGLLDASTLGKIDIQGPDAREFLNRIYTNAW
FT                   TKLDVGKARYGLMCKEDGMVFDDGVTACVGDNHFIMTTTTGGAARVLQWMELYHQTEWP
FT                   ELKVYFTSVTDHWATMTLSGPNSRKLLSELTDIDMDKEAFPFMTWKEGNVGGVPARVFR
FT                   ISFTGELSYEVNVQANYAMGVLEQIIEAGKKYNLTPYGTETMHVLRAEKGFIIVGQDTD
FT                   GSMNPDDLNMSWCVGRNKPFSWIGLRGMNREDCVRENRKQLVGLKPVDPTKWLPEGAQL
FT                   VFDPKQPIPMDMVGHVTSSYASNSLGYSFAMGVVKGGLKRMGERVYSPQADGSVIEAEI
FT                   VSSVFFDPKGERQNV"
FT   gene            398733..399365
FT                   /locus_tag="Pput_0348"
FT   CDS_pept        398733..399365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0348"
FT                   /product="sarcosine oxidase, gamma subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, gamma subunit family;
FT                   PFAM: Sarcosine oxidase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76521"
FT                   /db_xref="GOA:A5VXB1"
FT                   /db_xref="InterPro:IPR006280"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXB1"
FT                   /protein_id="ABQ76521.1"
FT                   /translation="MSAINVFQQNPGAEAKAQSPLHHADLASLVGKGRKNAGVTLRERK
FT                   FLGHLTLRGDGHNPEFAAGVHKALGLELPVALTVVANKDMSLQWVGPDEWLLIVPGGQE
FT                   LAAEQKLRAALEGQHIQVVNVSGGQSLLELRGPNVRDVLMKSTSYDVHPNNFPVGKAVG
FT                   TVFAKSQLVIRRTAEDTWELVIRRSFADYWWLWLQDASAEYGLSIEA"
FT   gene            399377..400234
FT                   /locus_tag="Pput_0349"
FT   CDS_pept        399377..400234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0349"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76522"
FT                   /db_xref="GOA:A5VXB2"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXB2"
FT                   /protein_id="ABQ76522.1"
FT                   /translation="MSRAPDTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQ
FT                   SGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLN
FT                   DLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEE
FT                   TGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATA
FT                   HYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANR
FT                   TVVL"
FT   gene            400536..401735
FT                   /locus_tag="Pput_0350"
FT   CDS_pept        400536..401735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0350"
FT                   /product="glutathione-independent formaldehyde
FT                   dehydrogenase"
FT                   /note="TIGRFAM: Formaldehyde dehydrogenase,
FT                   glutathione-independent; PFAM: Alcohol dehydrogenase,
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76523"
FT                   /db_xref="GOA:A5VXB3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014184"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXB3"
FT                   /protein_id="ABQ76523.1"
FT                   /translation="MSGNRGVVYLGAGKVEVQHIDYPKMQDPRGKKIEHGVILKVVSTN
FT                   ICGSDQHMVRGRTTAQVGLVLGHEITGEIVEKGRDVERMQIGDLVSVPFNVACGRCRSC
FT                   KEMHTGVCLTVNPARAGGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPERDKAMEKIR
FT                   DLTCLSDILPTGYHGAVTAGVGPGSTVYVAGAGPVGLAAAASARLLGAACVIVGDLNPA
FT                   RLAHAKSQGFEVVDLSKDTPLHEQIVDILGEPEVDCAVDAVGFEARGHGHEGAKHEAPA
FT                   TVLNSLMQVTRVAGNIGIPGLYVTEDPGAVDAAAKIGALSIRFGLGWAKSHSFHTGQTP
FT                   TMKYNRQLMQAIMWDRINIAEVVGVQVINLDQAPEGYGEFDAGVPKKFVIDPHKMWGAA
FT                   "
FT   gene            complement(401894..402682)
FT                   /locus_tag="Pput_0351"
FT   CDS_pept        complement(401894..402682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76524"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXB4"
FT                   /protein_id="ABQ76524.1"
FT                   /translation="MSNHQTHTYTAYGYATTLPSEKARQGFNGEFPDALTGLYFLGSGY
FT                   RAYETKLMRFISPDSLSPFAEGGINSYCYCGNDPVNNSDPTGHVGVRAAIVKRRLPLPR
FT                   TRSQTLLQLDSPAQVNTPYHRDAPPYFTSHPAVFSTSGTPPTYNLGALPSYSEQLPTGH
FT                   QRIVTPTLLPTDKGPKFLPPPRPPRYPIPKPQPEIQAALPPDQARAYRVRLQAMHDRYR
FT                   RLKQVLRRLERGDMHVPEELRRNIEQLRQEGTRIRELLAD"
FT   gene            402883..403458
FT                   /locus_tag="Pput_0352"
FT   CDS_pept        402883..403458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76525"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXB5"
FT                   /protein_id="ABQ76525.1"
FT                   /translation="MKAITLATLMTLAASPVFAFNLSDAANAVSAMQNQQQQGQVQAPE
FT                   AQANLLNTLGSQLNITPEQAVGGAGAMLGLARNNLSSDDYGQLTKAVPGLDLLAGANAL
FT                   GGLSGLGDLLGKSSESQSALSNALGNNVENRSDLDNAFKALGMDTGMIGQFAPLLLQYL
FT                   GQQGVAGALLQNLGSLWTAPTPLTQPSV"
FT   sig_peptide     402883..402942
FT                   /locus_tag="Pput_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 20"
FT   gene            complement(403746..404732)
FT                   /locus_tag="Pput_0353"
FT   CDS_pept        complement(403746..404732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76526"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXB6"
FT                   /protein_id="ABQ76526.1"
FT                   /translation="MWTKAIMEQLFYQARNLVTLKENGQYRSIFRSPMHLLAEFRGENI
FT                   YPIELLATDTKKTIMHAHDGVKKEHHTYTVFGHSGTLLPKRTLQGFNGEPIDHLLSAYH
FT                   LGQGYRTYSPGLMRFQSPDSHSPFGKGGVNYYAYCGGDPVNYTDPTGHVFVQLTKGQTM
FT                   KVRRHSAVALPHKFNPSSLKRTTSHASALKAGTPKYARPPEDHFKRIGEPDIFESIINN
FT                   LTLDDALAFSNTSQHNRSHAVPVIYRYLSLATVSDASVGAARAGVLPGLPRIFGQNFEL
FT                   HPYLQDINMLRDVDILRAGGVRNVVRLRTFDRLYTEETLQAATASVD"
FT   gene            405491..406081
FT                   /locus_tag="Pput_0354"
FT   CDS_pept        405491..406081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76527"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXB7"
FT                   /protein_id="ABQ76527.1"
FT                   /translation="MRPLPMKALTLATLMTLTASPVFAFNLSDAANAVSAMQNQQQQGQ
FT                   VQAPEAQANLLNTLGSQLNITPEQAVGGAGAMLGLARNNLSSDDYGQLTKAVPGLDLLA
FT                   GANALGGLSGLGDLLGKSSESQSALSNALGNNVENRSDLDNAFKALGMDTGMIGQFAPL
FT                   LLQYLGQQGIAGALLQNLGSLWTTPAPLAQPSV"
FT   sig_peptide     405491..405565
FT                   /locus_tag="Pput_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(406167..407054)
FT                   /locus_tag="Pput_0355"
FT   CDS_pept        complement(406167..407054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0355"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76528"
FT                   /db_xref="GOA:A5VXB8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXB8"
FT                   /protein_id="ABQ76528.1"
FT                   /translation="MRRLLTGILTTTLLLLNTVVLICPLLVFALLKLVLPGRGRDYASW
FT                   AVMWVAETWSEIDKAIFALCIPTQWDIRGVENLRKDTSYLAVSNHQTWVDIPALIESLN
FT                   RRTPFFKFFLKKELIWVPLLGLAWWGLDYPFMKRYSKAFLEKHPELKGKDLEITKAACE
FT                   LFKRQPVTVVNYLEGTRFTEAKRQEQQSPYRYLLKPKAGGVAFVLAALGEQLDALLDVT
FT                   IVYPGNKAPGFWDLLNGSISRVIIDIQVRELDPALWAGDYENDPEFRQTVQAWVNQLWV
FT                   AKDQRIEQLRQEMS"
FT   sig_peptide     complement(406965..407054)
FT                   /locus_tag="Pput_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.933 at
FT                   residue 30"
FT   gene            407236..407736
FT                   /locus_tag="Pput_0356"
FT   CDS_pept        407236..407736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0356"
FT                   /product="protein of unknown function DUF785"
FT                   /note="PFAM: protein of unknown function DUF785"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76529"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXB9"
FT                   /protein_id="ABQ76529.1"
FT                   /translation="MKSLLAMLSLLALPVMAAEPTIYGRYENIALPELGETLKAKMDTG
FT                   AFTASLSAKDIELFTRDGDEWVRFRLATKESDGKVYEHKVSRISKIKGRADEEDEGDAP
FT                   EVSKRPVVDLELCLGDVKRTVEVNLVDRSNFNYPLLVGSKALREFKAAVNPAKKFTAGK
FT                   PGC"
FT   sig_peptide     407236..407289
FT                   /locus_tag="Pput_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 18"
FT   gene            407884..408564
FT                   /locus_tag="Pput_0357"
FT   CDS_pept        407884..408564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0357"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76530"
FT                   /db_xref="GOA:A5VXC0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXC0"
FT                   /protein_id="ABQ76530.1"
FT                   /translation="MPHILIVEDEAAIADTLVYALQADGHSTEWVTLGSAALDQQRQRP
FT                   ADLVILDIGLPDISGFETCRQLRRFTEVPVMFLSARDGEIDRVVGLEIGADDYVVKPFS
FT                   PREVAARVRAILKRMAPRAEVVGETTLFHLDTLRMQITYRSQPLTLTRHEFRLLQCLLE
FT                   QPQRVFSREQLLDALGVASDVGYERTIDSHIKSLRAKLRQVAGDAEPIQTHRGLGYSYS
FT                   PEHA"
FT   gene            408564..410000
FT                   /locus_tag="Pput_0358"
FT   CDS_pept        408564..410000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0358"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76531"
FT                   /db_xref="GOA:A5VXC1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXC1"
FT                   /protein_id="ABQ76531.1"
FT                   /translation="MRLGIRIFLVYFLFVGLAGYFLLNTVREQIRPVVRQSSEETLVDT
FT                   ANLLAEILRDDVKAGTLNQGRLPEVLEAYGSRSPGAQIWGLAKNQVSHRIYVTDAKGIV
FT                   LLDSSGEALGKDYSQWNDVLLTLRGQYGARSTRSDPNDESTSVMHVGAPIIDNGKIIGV
FT                   VTVAKPNSSLQPYIDRSERRLLTLGLGLIGLGLLIGAALSWWLARSLRKLAGYAQAVSE
FT                   GERAELPHYKGGELANLAQAVERMRTQLEGKAYVERYVHTLTHELKSPLAAIRGASELL
FT                   QGEDMPADQRARFAGNIERESERLQQMIERLLNLARVEQMQALEDEQQVALAALVDELL
FT                   LAHAARIEGARLQVRQRVPATLRLLCDPFLMRQALANLLDNALDFTPEGGTLLFDLERD
FT                   GERVALSLFNQGQAIPAYAIGRVSERFYSLPRPGSGRKSTGLGLNFVAEVMQLHGGALA
FT                   VDNVDGGVRVRLWLPVRRIS"
FT   gene            410108..411436
FT                   /locus_tag="Pput_0359"
FT   CDS_pept        410108..411436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0359"
FT                   /product="Inner membrane CreD family protein"
FT                   /note="PFAM: Inner membrane CreD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76532"
FT                   /db_xref="GOA:A5VXC2"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXC2"
FT                   /protein_id="ABQ76532.1"
FT                   /translation="MNKTLGFKLGMIAMLMLLLLIPLLLINGLIDERQAMRDGVLRDIA
FT                   QSTSFDQQLSGPLLVVPYRKYQRRWIEKDGERTQETSTIAGHLYFLPETFDADLGVDTE
FT                   LRARGIYQARLFHTKGRISGRFKLPAHWGIDKDFDDYRFDTPFLVVGISDIRGIESALE
FT                   LSMDDQKVPFEPGTQLDWMRGGVHASLPGLDGLQARAFSYGFDLALQGTGQLHVVPVGR
FT                   TSSVDMRANWPHPSFVGNYLPNRREIDAQGFSAHWQTSFFATNLEDAIRQCANAGQCTD
FT                   FSERSFGVSFIDPVDQYLKSERAIKYALLFIALTFAGFFLFEVMKNLSVHPVQYILVGV
FT                   ALAFFYLLLLSLSEHIGFGLAYGLSASACVMLIGFYLSHVLRSLVRGVGFAAGLAALYA
FT                   LLFGLLSAEDYALLMGSLLCFGLLGVFMVLTRRLDWARVGRAA"
FT   sig_peptide     410108..410191
FT                   /locus_tag="Pput_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.790) with cleavage site probability 0.602 at
FT                   residue 28"
FT   gene            complement(411601..412224)
FT                   /locus_tag="Pput_0360"
FT   CDS_pept        complement(411601..412224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0360"
FT                   /product="Glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76533"
FT                   /db_xref="GOA:A5VXC3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXC3"
FT                   /protein_id="ABQ76533.1"
FT                   /translation="MSTMTLFHSPLSPFVRKVMVVLHETGQLERVQLQPVNISPVSGDP
FT                   QLNLDNPIGKIPALRLEDGTVLHDSRVICEYLDLQHVGLPLLPREGSARWRRMTLVSQA
FT                   DAIMDAAVSSRYESFLRPEDKRWDGWLQAQGDKIRRSLANLEQEHLPELISGFDLAAIG
FT                   VACALGYLDLRQPGFGWRERQPGLAAWYAEVVKRPSMVATAPVA"
FT   gene            complement(412228..412950)
FT                   /locus_tag="Pput_0361"
FT   CDS_pept        complement(412228..412950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0361"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76534"
FT                   /db_xref="GOA:A5VXC4"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXC4"
FT                   /protein_id="ABQ76534.1"
FT                   /translation="MPAKAQTPTPLNKHRGTAMVLRSEILVNKNVMPTAEQALPGRDTP
FT                   MSLPEFHYVFKDTPLLGPFFEGAIDFAIFGLGCFWGAERRFWQREGVVSTVVGYAGGFT
FT                   PHPTYEEVCSGLTGHTEVVLVVFDKDKVSYRELLAMFWELHNPTQGMRQGNDIGTQYRS
FT                   AIYCTSPEQLEQAKASRDAFQAELSKAGFGEITTEIDQAPTVYFAEAYHQQYLAKNPDG
FT                   YCGIGGTGVCLPPSLQGN"
FT   gene            complement(413065..415845)
FT                   /locus_tag="Pput_0362"
FT   CDS_pept        complement(413065..415845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0362"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   GAF domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76535"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXC5"
FT                   /protein_id="ABQ76535.1"
FT                   /translation="MAACQPSGHDATLPNPPQPQGSVPSSSESSMKSQPDAASRVAAEV
FT                   VTQLPVPSRLGMLRFERLNEATWAMLYLDPACERQFGLKTGELCALIDAPYASLMEPEA
FT                   RYRLHDEIQLQLAQRGYYRVRYTLHTPSTSLRLLEAGEAYKQHNRQLLRGYLSVLDDQQ
FT                   EETGEPGASDLESRNNRLQLALQLNQRTQQEQLEHLERVRGQQDLILRLARHRYSAGNS
FT                   LLEAAQLITQSACEIYKVDSASIWHLEDQRLEPIIAWYRDAQEHRQPEAIDASRFPDYL
FT                   DALHASRAIDAHNAGHDPRTRALAQSMRPENKAMLDASIRVDGQVIGVLCLEQTGQPRA
FT                   WQSDEIAFAGELADQFAQVITNHKRRAAASALHLFQRAVEQSASAFLLVNRDGRVEYVN
FT                   PSFTAITQYSTDEVQGRQLGELPALENLSELLFDSPSSLAMGNSWQGEFKSRRKNLEPY
FT                   WGQLSISKVYGDNRELTHYIGIYEDVTQTKLAQQRIERLAYTDNLTNLGNRPAFIRSLD
FT                   ERFARDGESSMCLLLVDIDNFKRINDSLGHQTGDKLLISLARRLRNSLHSGGILARFAS
FT                   NEFAVLLDHTSLEDGQGVAQQLLCTLDKPMFVDNQLINVTASVGLACAPLHGVDPASLM
FT                   KNAGLALHKAKANGKHQVQVFTEVLNAEASYKLFVENNLRRALTQNELDVFYQPKLCLR
FT                   SGRLLGLEALLRWNHPERGMIRPDQFISVAEETGLIIPIGKWVVRQACCMSQQLRKAGL
FT                   GNLHVAINLSPKQFSDPDLVASISTILKEEALPPHLLELELTEGLLLEASEDTHRQLDE
FT                   LKALGLTLAMDDFGTGYSSLSYLKKFPIDILKIDRSFINEIPDNQDDMEITSAVVAMAH
FT                   NLKLKVVAEGIETPEQLAFLRRHRCDVGQGYLFDRPIPGRELAERLKRYPRGPVA"
FT   gene            complement(416167..417798)
FT                   /locus_tag="Pput_0363"
FT   CDS_pept        complement(416167..417798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0363"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="TIGRFAM: pyruvate dehydrogenase complex
FT                   dihydrolipoamide acetyltransferase; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein; catalytic domain of
FT                   components of various dehydrogenase complexes; E3 binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76536"
FT                   /db_xref="GOA:A5VXC6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXC6"
FT                   /protein_id="ABQ76536.1"
FT                   /translation="MSELIRVPDIGSGEGEIIELFVKVGDRIEADQSLLTLESDKASME
FT                   IPAPKAGVIKELKVKLGDRLKEGDELLVLEAEGAAAAAPEAPAAAPAAAPAAEAAPAAP
FT                   AAAPAAASVQDIHVPDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASMEIPSPAA
FT                   GVVEEVLCKLEDEVGTGDLIFKLKVAGAAPAAAPTPAAAAPAPAKAEAAPAAAPAAAAP
FT                   AAAPAPAATAPAAGSNAKVHAGPAVRQLAREFGVELGAVAATGPHGRILKEDVQVYVKA
FT                   MMQKAKEAPAAAGATGGAGIPPIPAVDFSKFGEVEEVALTRLMQVGAANLHRSWLNVPH
FT                   VTQFDSADITELEAFRVAQKAVAEKAGVKLTVLPLLLKACAFLLKELPDFNSSLAPSGK
FT                   AIIRKKYVHIGFAVDTPDGLLVPVIKNVDQKSLLQLAAEAAALAEKARTKKLSADEMQG
FT                   ACFTISSLGHIGGTGFTPIVNAPEVAILGVSKATMQPVWDGKAFQPKLMLPLSLSYDHR
FT                   VINGAAAARFTKRLGDVLGDIRTMLL"
FT   gene            complement(417812..420457)
FT                   /locus_tag="Pput_0364"
FT   CDS_pept        complement(417812..420457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0364"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /EC_number="1.2.4.1"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76537"
FT                   /db_xref="GOA:A5VXC7"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXC7"
FT                   /protein_id="ABQ76537.1"
FT                   /translation="MQDLDPIETQEWLDALESVLDKEGEDRAHYLMTRMGELATRSGSQ
FT                   LPYAITTPYRNTIPVTHEARMPGDLFMERRIRSMVRWNALAMVMRTNLKDSDLGGHISS
FT                   FASSATLYDIGFNYFFQAPTEEHGGDLVFFQGHASPGVYARAFMEGRISEDQMNNFRQE
FT                   VDGNGLSSYPHPWLMPDFWQFPTVSMGLGPIQAIYQARFMKYLEARGFIPAGKQKVWCF
FT                   MGDGECDEPESLGAIALAGREKLDNLIFVINCNLQRLDGPVRGNGKIIQELEGVFRGGG
FT                   WNVNKVVWGRFWDPLLAKDTNGALQRRMDEVIDGEYQNYKAKDGAYVREHFFNTPELKA
FT                   MVEDLSDEEIWKLNRGGHDPYKVYAAYHQAVNHKEQPTVILAKTIKGYGTGAGEAKNTA
FT                   HNTKKVDVDSLRHFRDRFDIPVKDADLENLPFFKPEEGSAEAKYLAERRAALGGFVPQR
FT                   RAKSFSVPTPPLETLKAILDGSGDREISTTMAFVRILAQLVKDKDIGQRIVPIIPDEAR
FT                   TFGMEGMFRQLGIYSSVGQLYEPVDKDQVMFYREDKKGQILEEGINEAGAMSSFIAAGT
FT                   SYSCHNQPMLPFYIFYSMFGFQRIGDLAWAAGDSRTRGFLIGGTAGRTTLNGEGLQHED
FT                   GHSHMMAGTIPNCRTYDPTYGYELAVIIQDGMKKMTEEQQDIFYYITVMNESYQQPAMP
FT                   AGVEEGIIKGMYLLEEDTREAAHHVQLMGSGTILREVREAAKILREEFNVGADVWSVTS
FT                   FNELRRDGLAVERANRLKPGQKPQQTYVEQCLNGRKGPVIASTDYMKLFAEQIRQWVPS
FT                   KEFKVLGTDGYGRSDSRKKLRHFFEVDRHFVVLAALEALADRGEIEPKVVADAIVKFGI
FT                   DPDKRNPLDC"
FT   gene            420841..423774
FT                   /locus_tag="Pput_0365"
FT   CDS_pept        420841..423774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0365"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76538"
FT                   /db_xref="GOA:A5VXC8"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXC8"
FT                   /protein_id="ABQ76538.1"
FT                   /translation="MRLPLPSDLPATLQPLVTRNQQFISDAVAGHPELDLQAWSPLHRQ
FT                   QFDQVAAASEFVLSLAQREPAMLFALLASGELERRYAPGELRGQIAATAQAAQSEDELA
FT                   RNLRRARNRQQLRIIWRDITRQAELGETCRDLSDLADAAIDEAYQWLYPRHCQQFGTPI
FT                   GNRSGQPQHMVVLGMGKLGAVELNLSSDIDLIFGFPEGGETEGVKRSLDNQEFFTRLGQ
FT                   RLIKALDPVTVDGFVFRVDMRLRPYGSAGALVLSFNALEQYYQDQGRDWERYAMIKARV
FT                   VAGDQAAGAQLQEMLRPFVYRRYLDFSAIEALRTMKQLIQQEVRRKGMAENIKLGAGGI
FT                   REVEFIAQAFQLIHGGRDLSLQQRPLLKVLATLEGQGYLPPAVVAELREGYEFLRYTEH
FT                   AIQAIADRQTQMLPEGETDQARVAYVLGFADWQSFHDQLMYWRGRIDWHFRQVIADPDD
FT                   EDGEGELVVGGEWSPLWEQAQDEEAAGRQLQEAGFKQPAEALRRLAGLRSSPQLRSMQR
FT                   IGRERLDAFIPRLLAQAVEHDNPDLVLERVLPLVEAVARRSAYLVLLTENPGALRRLLT
FT                   LCAASPWIAEQIALYPLLLDELLNEGRLFSPPLAPELASELRERLTRIPEDDLEQQMEA
FT                   LRHFKLAHSLRVAASEISGNLPLMKVSDYLTWLAEAILDQVLALAWRQTVARHGQPKRS
FT                   DGSLCDPGFIIIGYGKMGGLELGHGSDLDLVFIHDGDPQAETDGAKPIDSAQFFTRLGQ
FT                   RIIHLLTTQTNSGQLYDVDMRLRPSGASGLLVSSLGAFERYQQNEAWTWEHQALVRARV
FT                   LVGCKQVGAAFEGVRAKVLGQARDLEKLRGEVSEMRAKMRDNLGTKATAAGTAANAFDA
FT                   GVPFDIKQDAGGIVDIEFMVQYAALAWSHDHPAILRWTDNIRILEELEQANLMPASDAV
FT                   LLREVYKAFRSASHRQALQKQAGVIDAAQFADERREVRRIWGELGLT"
FT   gene            424009..425058
FT                   /locus_tag="Pput_0366"
FT   CDS_pept        424009..425058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0366"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76539"
FT                   /db_xref="GOA:A5VXC9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXC9"
FT                   /protein_id="ABQ76539.1"
FT                   /translation="MRILIIGPSWVGDMVMAQTLFQCLKQQHPDCVIDVLAPEWSRPIL
FT                   ERMPEVRQALSFPLGHGALELATRRRIGKSLAGQYDQAILLPNSLKSALVPFFAGIPKR
FT                   TGWRGEMRFGLLNDVRKLDKARYPLMIERFMALAYAPGAELPQPYPRPSLQIEAQSRDA
FT                   ALAKFGLELDRPVLALCPGAEFGEAKRWPAEHYAAVADAMIRQGWQVWLFGSKNDHSVG
FT                   EQVRDRLIPGFREESSNLAGETSLAEAIDLMSCAHAVVSNDSGLMHVAAALNRPLVAVY
FT                   GSTSPGFTPPLAEQVEVVRTGIECSPCFDRTCRFGHYNCLRLLEPGKVIAALHSLSGPD
FT                   LIDTVAEVD"
FT   gene            425059..426117
FT                   /locus_tag="Pput_0367"
FT   CDS_pept        425059..426117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0367"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase I;
FT                   PFAM: glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76540"
FT                   /db_xref="GOA:A5VXD0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXD0"
FT                   /protein_id="ABQ76540.1"
FT                   /translation="MRVLIIKTSSLGDVIHTLPALTDAAHAIPGIRFDWVVEEGFAEIP
FT                   SWHPAVDQVIPVAIRRWRKNLWQTIKSGEWKAFKQRVRERKYDLVIDAQGLVKSAWLTR
FT                   YVKAPVAGLDRYSAREGWASRFYDRPLSVATGQHAVERVRQLFAMALAYDLPEGIGNYG
FT                   LDLDRLQLPPAAPYVVFLHGTTWATKHWPEAYWRELAERMGRRKLEVRLPWGNPAEKAR
FT                   AERIAQGLNNCQVLPKLNLAGVARVLAAAKACVAVDTGLGHLAAALDVPTLSLFGPTNP
FT                   GLTGAYGRTQIHQASDWPCAPCLQKKCTYKPSADDLARFDLKREWPLCFTRLNPEHVAS
FT                   RLSALLLAEDVR"
FT   gene            426117..427241
FT                   /locus_tag="Pput_0368"
FT   CDS_pept        426117..427241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0368"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76541"
FT                   /db_xref="GOA:A5VXD1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXD1"
FT                   /protein_id="ABQ76541.1"
FT                   /translation="MQLAFVLYKYFPFGGLQRDFMRIALECQKRGHQIRVYTLIWEGDI
FT                   PPGFEVLVAPVKAIFNHRRNEKLSAWMAADLAKRPVDRLIGFNKMPGLDVYYAADGCFE
FT                   DKAQTLRGGLYRRWGRYRHFAEYERAVFAKDAHTEVLMISEVQQPLFIKHYGTPVERFH
FT                   LLPPGISQDRRAPANAAEIRAEFRKEFNLGEDDLLLVQIGSGFKTKGVDRSLKALAALP
FT                   SALRKRTRLMVIGQDDPKVFQLQSATLGLGDQVQFLKGRSDIPRFLLGADLLIHPAYNE
FT                   NTGTVLLEALVAGLPVLVSKVCGYAHYIAEADSGLVLDEPFEQDQLNGYLQRMLEDPQA
FT                   RASWSRNGLAFADSADLYSMPQHAADVILGQKTA"
FT   gene            427238..428044
FT                   /locus_tag="Pput_0369"
FT   CDS_pept        427238..428044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0369"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76542"
FT                   /db_xref="GOA:A5VXD2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXD2"
FT                   /protein_id="ABQ76542.1"
FT                   /translation="MKLILAEPFKRLWAGRDAFDAVEALQGEVYRELEGRRTLRTEVAG
FT                   EGFFVKIHRGIGWGEIFKNLFTAKLPVLGAGQEWKAIQRLHEVGVPTMTAVAYGERGSN
FT                   PAAQHSFIITEELAPTISLEDFSIDWVKQPPEPRLKRALIAEVAKMTGGMHRAGVNHRD
FT                   CYICHFLLHTDRPVTADDFKLSVIDLHRAQTRARISRRWRDKDLAALYFSALDIGLTQR
FT                   DKLRFLRGYFQRPLRQVLKDEAALLAWLERKAQKLYDRKQRYGDAL"
FT   gene            428044..428778
FT                   /locus_tag="Pput_0370"
FT   CDS_pept        428044..428778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0370"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76543"
FT                   /db_xref="GOA:A5VXD3"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXD3"
FT                   /protein_id="ABQ76543.1"
FT                   /translation="MASWTLAPGYEHLAADFGSLDAVFALQGERLTLDPLSEVVRIERD
FT                   GINYYVKRYTGAGKHMRRYLGRPRIKAEWQNLKQFAKWGIPTAEVVAWGLERNGLAFGR
FT                   GAMITRELPHTEDLSALADNNDARLADRSWVDHVSRQLARHTRVMHQHRFAHNDLKWRN
FT                   LLVDDQGTLFFIDCPTGDFWRGFMWRHRMIKDLACLDKVAKYHLSATQRLRFYLQYRGR
FT                   DRLNVRDKKRIHRVLGFFEGRE"
FT   gene            428775..429527
FT                   /locus_tag="Pput_0371"
FT   CDS_pept        428775..429527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0371"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76544"
FT                   /db_xref="GOA:A5VXD4"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027023"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXD4"
FT                   /protein_id="ABQ76544.1"
FT                   /translation="MTDYLASADLALLKRHGLDNFEALWALQLDAVDEPNTGRGGWSSV
FT                   FRLELEGKGYYLKRQSDYLTRTLHRPFGEPTFAREFRNISRYQKLRIPALQAVFYGERK
FT                   QGGKHRAILMTRALDEWADLDSLLAQWPRLGEAERTGILQACGQLARTLHSAGQVHGCF
FT                   YPKHIFLRQRREGWDAQLIDLEKTRPLLFGMRDRLKDLEPLLRRAQAWRVQDVRTLLAT
FT                   YLGQPADGALVDTWLQRLTQRRREKEAR"
FT   gene            429527..430969
FT                   /locus_tag="Pput_0372"
FT   CDS_pept        429527..430969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76545"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXD5"
FT                   /protein_id="ABQ76545.1"
FT                   /translation="MRLSELKDAGRSPTLPLSITLVDAAGSADLQLLTLLRVLPGQRYV
FT                   GAGVWRGTPVLAKLLVGGNAARHFQRELQGVKLLAEQGLTTPTLLADGLKEGEGGWLLF
FT                   EFLDGAQSLADAWAAVANLPVLADEQHLVLGEALTAVAHMHAQGLWQEDLHLDNLLRHA
FT                   GKLYLIDGAGIRAETPGQQLSRPRVLENLGVFFAQLPKRLEPFIEELLVHYLLANAEHA
FT                   LPLEALQKQVDKVRTWRQKDYLDKAGRECSLFSVQRTLSGLQAIRRSEVEAMQPVLEQA
FT                   DALIDKGHLYKTGGAASVARIEVNGRPLVIKRYNIKNTAHWFKRFWRPSRAWHSWIEGH
FT                   RLEFLDIATPRPLAVLEQRVLGLRSRAYLVTEYVDGPDLTACFAPYVESGDAPEEQVDA
FT                   LVHVMQQLIRERISHGDFKGHNLFWHNGQWSLIDLDAMCQHATQLSFAPAYARDRARLL
FT                   RNWPNGSALHQRLDRLLPKLVD"
FT   gene            complement(430987..433773)
FT                   /locus_tag="Pput_0373"
FT   CDS_pept        complement(430987..433773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76546"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXD6"
FT                   /protein_id="ABQ76546.1"
FT                   /translation="MRPLEQLEQIDRQIGDLLDGLPTLDRQHPINPDTRTWLHGELASF
FT                   WTTADEQGETPRQKLLALRKALMLAEVELRLGDETLGYRSADQLWACLQQPLPSQRRHM
FT                   PLAKRPQVYRVLLEGLRPNWRSYLPGTLIIVAGTAEGPMLTPQDAAGAALLCSLSQGIE
FT                   AFDSLGALHQELCERLEDPLQSRPLLHLYTDTQADRARRSQRLRYDWYADSLLEAQIDS
FT                   VIEAQRQRLSDTGLWSNGSPDQHTRIHKALALWPEVGAKPILQTRYSQLLEKNLPNWLR
FT                   NTSAQGLSHMMQAMQTLVAIAEQAAAPGVLSLNDFKQRNSLLAWANARLRERLSHDLGY
FT                   DTDPREIKIIVVRARRTGAIMHPFALSSYVTYVGMRRVGHEMVEMVEEINTLEEIALKN
FT                   LPWFDSDYWLTARVIHAHGKAMPAGLTPQYVKHMVRELNVGDSYAKYLHTQLISSRAGK
FT                   WRLTAHSKVNRARMHAEAVKARYAGHFGEDPFEHGYNWVRAVLDQPHNALRAPVAGYPV
FT                   TVRQLNIMGHTLQGVLLLNSLPYKSPACVLYTPDAPDRRAWRRFRTTRELLRTLRQQPT
FT                   LRAYVAQRLPLLPAATVQRLLEKGRMSTHLTTPEIQDDLFFVYYMAEARALIAQADADS
FT                   MTTREVNTESVMALSWRLLDFISLLLPNRALLVLSISRMAIDIWDGAEAFKQEDVEGVM
FT                   RHAYQALSHLNDAGTSFMGSRVLRRSLRGIPKPPPLPLPARLQVQPDSSSLRYRIDGIY
FT                   GEGVYEQSSAFGGQSLYFVKDNDNRYYRVSFDGYRWRAIDPDQPDAYLQQPLKRKADGQ
FT                   WVIDSPVLWYDGLPDLKQLLQDCYLQTPVAGLPVNIEQGLFQADNQLYLALENGQLPVR
FT                   RHLLPDHYHLEIAVASNAGVVPWAVLRHENGQWLIRVRQAGRSSDWLTLPDQPPPTH"
FT   gene            complement(433841..434026)
FT                   /locus_tag="Pput_0374"
FT   CDS_pept        complement(433841..434026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76547"
FT                   /db_xref="GOA:A5VXD7"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXD7"
FT                   /protein_id="ABQ76547.1"
FT                   /translation="MSHRSQATARLFAWPALIALLGFLGLFAALLGDGGWDVLAWAGLG
FT                   LPALLSLRGLLWRRGR"
FT   sig_peptide     complement(433940..434026)
FT                   /locus_tag="Pput_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.803 at
FT                   residue 29"
FT   gene            complement(434023..435135)
FT                   /locus_tag="Pput_0375"
FT   CDS_pept        complement(434023..435135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0375"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76548"
FT                   /db_xref="GOA:A5VXD8"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXD8"
FT                   /protein_id="ABQ76548.1"
FT                   /translation="MKSPTIRRWSLIHTWSSLVCTLFLLLLAVTGLPLIFHHELEHLLG
FT                   DAPELREMPAGTPHLDLQQLVLKAEQHRPGEVMQYFGYDEDEPNGVVAITAATAGTDPN
FT                   LSHTFMLDARTGEAVAMPAANGGFMMVMLRLHVDMFAGLPGKLLLAFMGVLFIVAIVSG
FT                   TVLYAPFMRRLEFGTVRHKKSRRLRWLDLHNLIGVVTLAWALTVSVTGVISALSDLVIA
FT                   AWRNDSLAAMVAPYRDAPPLVERAPATRLLDIAEQAAPGMRPDFIAFPGTRFSSEHHYA
FT                   VFMNGATHLSSHLFTPVLIDARTLEVTAVGNRPWYMDAMGLSQPLHFGDYGGRPMQILW
FT                   ALLDVLTIIVLGSGLYLWWGKQRKPREARA"
FT   sig_peptide     complement(435049..435135)
FT                   /locus_tag="Pput_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.967) with cleavage site probability 0.492 at
FT                   residue 29"
FT   gene            complement(435192..437624)
FT                   /locus_tag="Pput_0376"
FT   CDS_pept        complement(435192..437624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0376"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; Secretin/TonB, short N-terminal
FT                   domain; TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76549"
FT                   /db_xref="GOA:A5VXD9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXD9"
FT                   /protein_id="ABQ76549.1"
FT                   /translation="MSRAVDHILRPSLMALAIGLAAPLTSPALFAAEQSMSRAYNLPSA
FT                   PLATTLNQIASQAGIALAIDPALVSGRTSAPVSGQYDGLGALQAALSGTGLQLQQSRAG
FT                   SYSLVAVPDGTLALPETTVNATSASESAWGPVEGYVAKRTAAGTKTDTALVEVPRSISV
FT                   ATREQMKDRGVHSLDDAVRYMPGIVSASFGSDTRYDWMRVRGFEPTQFLDGLPLPRGVY
FT                   ANPKAETWNLDRLALLRGPASSIYGQTPPGGLLDMVSRRPQAESAHEIELQYGSDNHRQ
FT                   INFASTGKIDDEGRFLYGVSGVIRDSGTQIDHIDNKRYNIAPSLTWNIDEDTTLTFLTQ
FT                   FTRDDTGATSQFRPIQGTKIDMPFGKISHHKNLGDPDYEFYDRTYYALGYAFEHRINDV
FT                   WQFRQNLRYTKSDLSFQTITPGSYYEPGGPVKDDGTVSRMSTNTDEDISQFAVDNNFQA
FT                   DFATGDINHTLLIGLDHQRINTNYLSIFDFTVPDSNVNNPVYGLPITRPDRSTAFYDYN
FT                   QKTRQTGLYVQDQMVLGNWRLTLGGREDWVHTGTKFFNQGDATNTQRDKKFSGNAAISY
FT                   VFDSGFVPYLSYAESFQPSSNASVSASDSFKPTEGKQWELGVKYQPPGSNTLLSAAVYD
FT                   LTQKNVSVTNTVGGVTITSQTGEVKVRGLELEAVSDVTDNLKVIAAYTLAKSEVQDGDF
FT                   KGNRLQLMPNQQASIWGDYTWHSGVLDGFGIGLGARYTGNTYGDQGNTYLGKAKAYTVF
FT                   DGSVHYDLGRLNGSLKGASVAVTATNLLNKDYLSTCDAYYCYYGDERSVVASATYKF"
FT   sig_peptide     complement(437529..437624)
FT                   /locus_tag="Pput_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            complement(437878..438834)
FT                   /locus_tag="Pput_0377"
FT   CDS_pept        complement(437878..438834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0377"
FT                   /product="anti-FecI sigma factor, FecR"
FT                   /note="PFAM: FecR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76550"
FT                   /db_xref="GOA:A5VXE0"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032623"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXE0"
FT                   /protein_id="ABQ76550.1"
FT                   /translation="MSNVPVSSRVLEAAIAWKLSLGDSSSTPDERNEFMRWHAASEEHA
FT                   RAWRQLGAMDQRVSAAAGPARQALLQSRASLRRRIGKVGGGLAGTFLLGALLAWGGAPS
FT                   LAPSYWLADQRTATGELRTLRLEDGTLLSLNTHTAVDIDYAGAQRVIVLHQGEISVETG
FT                   HQDSRPLLVRTEDGRLRPLGTRFLVRREADGTRLEVLQASVAAMPHNSGDEQVLREGQQ
FT                   VLMNANGIGEVGTVPAGADAWTRGMLVVDNVRLGDLLATLGQYRSGYLGVDAKVADLRV
FT                   TGSFPLTNTDLALASLVPALPVKIERHTQWWVNVTSK"
FT   gene            complement(438831..439349)
FT                   /locus_tag="Pput_0378"
FT   CDS_pept        complement(438831..439349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0378"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76551"
FT                   /db_xref="GOA:A5VXE1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXE1"
FT                   /protein_id="ABQ76551.1"
FT                   /translation="MSSAQSPHADLVGALYRDHRGWLLAWLQRSMACRQRAEDLSQDTF
FT                   VRLLGREQLETPREPRAFLAAVAKGLMFDHFRRTALEQAYLAELALIPEAEQPSPEMQH
FT                   LILEDLKAIDRLLGKLSSKARAAFLHSRLDGMGHAEIAERLGVSVSRVRQYIAQGMRQC
FT                   YVALYGEPT"
FT   gene            complement(439553..440263)
FT                   /locus_tag="Pput_0379"
FT   CDS_pept        complement(439553..440263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0379"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /note="TIGRFAM: DNA polymerase III, epsilon subunit; PFAM:
FT                   Exonuclease, RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76552"
FT                   /db_xref="GOA:A5VXE2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXE2"
FT                   /protein_id="ABQ76552.1"
FT                   /translation="MSLFAWLRPSAPELDHAKRQRLARLPKPVPLGVCTLREQRWVVLD
FT                   LETSGLNPNRDQVLSIGAVAIEDGAIDFAQQFERTLHRPLQKTNASVLIHGLGPSALAA
FT                   GCDPAEALLDLLDFIGNSPVLAFHAPFDQRMLARALKETLGHRLQSMFLDVAELAPMLN
FT                   PDTVLREAGLDDWVARFGLQVEERHHASADAQVTAELALILFSQARRQQLDSPLQLEQR
FT                   LRGWRRRKMQSHGL"
FT   gene            complement(440260..442197)
FT                   /locus_tag="Pput_0380"
FT   CDS_pept        complement(440260..442197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0380"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294,
FT                   nucleotidyltransferase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76553"
FT                   /db_xref="GOA:A5VXE3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXE3"
FT                   /protein_id="ABQ76553.1"
FT                   /translation="MSKKDAYSQAGKTAVLQNIQGTLQFLQRFPPFNQMEHSHLAFLVE
FT                   QCQLRFYACGESIVKPADGPVEHFYIVKQGRVVGERQHLAKPGVETTFEITSGECFPLA
FT                   ALLGERATRTEHLAGEDTFCLQLNKAAFIRVFSMSEVFRDFALRGVSSLLDQVNQQVRQ
FT                   RAVETLGTQYSLNTPLGELAMRHPVVCSAHTPLREAVRLMHEQQVGSIVVVDPQRYPIG
FT                   IFTLRDLRQVVATVDADLGAAIDRHMTAKPFYLPPQASAFDAAMAMTERHIAHVCLVEN
FT                   GRLCGVVSERDLFSLQRVDLVHLARTIRHAPRLDTLVSLRGEISQLVERMLAHGASSTQ
FT                   ITQIITLLNDHTVCRVIELALAERGDPGVPFSWLCFGSEGRREQTLHTDQDNGILFEAV
FT                   DSAEADAIRARLLPLAQYINQCLAQCGFTLCTGNVMAGNPELCLSRSEWARRFAGFVRE
FT                   ASPESLLGSSIYFDLRVVWGDEQGCEQLRQGLLAQVADNRIFQRMMADNALRQRPPVGR
FT                   LREFVLTRQGNDKAATLDLKVQGLTPFVDGARLLALANGIAACNTLERLRQLVAKGVIE
FT                   PLDGAAYEEAYHFIQQTRMQQHQRQIRDNLPYSNRLDPDSLNHLDRRILRESLRQAQRL
FT                   QSSLALRYQL"
FT   gene            442314..442859
FT                   /locus_tag="Pput_0381"
FT   CDS_pept        442314..442859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0381"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76554"
FT                   /db_xref="GOA:A5VXE4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXE4"
FT                   /protein_id="ABQ76554.1"
FT                   /translation="MSALVKDPTKGETGYASNAVLMLKRNYFDETSMPEHTDILSDAER
FT                   EALAVINQSAPVEARPLVLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQK
FT                   RIGLMITDLRMQPESGLDLIRTIRASERAALSIIVVSGDTDVEEAVDVMHLGVVDFLLK
FT                   PVDLGKLLELVRKELKMG"
FT   gene            complement(442903..445080)
FT                   /locus_tag="Pput_0382"
FT   CDS_pept        complement(442903..445080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0382"
FT                   /product="malate synthase"
FT                   /EC_number="2.3.3.9"
FT                   /note="TIGRFAM: malate synthase G; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76555"
FT                   /db_xref="GOA:A5VXE5"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXE5"
FT                   /protein_id="ABQ76555.1"
FT                   /translation="MTGYVQVGGLQVAKVLYDFVNNEAIPGTGIVAEQFWAGAEKIIND
FT                   LAPKNKALLAKRDELQAKIDAWHQARKGQAHDAAAYKAFLQEIGYLLPQADDFQATTQN
FT                   VDEEIAHMAGPQLVVPVMNARFALNAANARWGSLYDALYGTDAISDEGGAEKGQGYNKV
FT                   RGDKVIAFARAFLDEAAPLAAGSHVDSTGYRIEGGKLVVALKGGSNSGLRDDAQLIGFH
FT                   GDAAAPTAVLLKHNGLHFEIQVDASTPVGSTDAAGVKDILMESALTTIMDCEDSVAAVD
FT                   ADDKVIVYRNWLGLMKGDLAESVSKGGKTFTRTMNPDREYAAPNGGSVTLHGRSLLFVR
FT                   NVGHLMTNPAILDAQGNEIPEGIQDGLFTNLIALHNLNGNTSRKNTRSGSVYIVKPKMH
FT                   GPEEVAFAAEIFSQVEDLLGMPRNTVKVGIMDEERRTTVNLKSCIKAAAERVAFINTGF
FT                   LDRTGDEIHTSMEAGAVVRKGAMKNEKWIGAYENNNVDVGLATGLQGRAQIGKGMWAMP
FT                   DLMAAMLEQKIAHPLAGANTAWVPSPTAATLHALHYHKVDVQARQRELASRTPASVDDI
FT                   LAIPLAADTNWSAEEIRNELDNNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATL
FT                   RISAQLLANWLRHGVVSQEQVLESLKRMAVVVDQQNAGDALYRPMAPNFDDNVAFQAAV
FT                   ELVVEGGKQPNGYTEPVLHRRRREFKARNGL"
FT   gene            445530..446048
FT                   /locus_tag="Pput_0383"
FT   CDS_pept        445530..446048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0383"
FT                   /product="ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76556"
FT                   /db_xref="GOA:A5VXE6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXE6"
FT                   /protein_id="ABQ76556.1"
FT                   /translation="MDHLVLTVIAPDKAGQVERIAQCIADHSGNWLESRMSRMAGQFAG
FT                   ILRVAVPAENYAELVASLQGLARYDIRVLIAESGIEPSCTWKPIAMELVGNDRPGIVRD
FT                   ITRLLAELQVNVERFSTDVQPAPMSSEPLFHADALLALPLTLPLEELQQRLESLADDLM
FT                   VELKLRAED"
FT   gene            complement(446377..447264)
FT                   /locus_tag="Pput_0384"
FT   CDS_pept        complement(446377..447264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0384"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76557"
FT                   /db_xref="GOA:A5VXE7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXE7"
FT                   /protein_id="ABQ76557.1"
FT                   /translation="MHAANPRRGYILGLSAYIIWGLFPLYFKAIQSVPAVEIIVHRVLW
FT                   SALFGSLLLLVWKHPGWWRELRNNPRRLGILALSGALIAGNWLTYVWSVNNGRMLEASL
FT                   GYYINPLINVLLGMLILGERLRRLQWLAVGMAAVGVAQQVWQVGSLPWVSLVLALSFGF
FT                   YGLIRKQAPVAALPGLVVETWMLVPLALGWLLLHPAAMSAQGAFYTSSEALWQMAAGPV
FT                   TLVPLVCFNAAARHLPYTTLGFLQYLAPTLVLLQAVVLFDEHLSSSTLAAFMFIWAGLA
FT                   IYSVDAWLNLRKRS"
FT   gene            complement(447329..448303)
FT                   /locus_tag="Pput_0385"
FT   CDS_pept        complement(447329..448303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0385"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; protein of
FT                   unknown function DUF227"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76558"
FT                   /db_xref="GOA:A5VXE8"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXE8"
FT                   /protein_id="ABQ76558.1"
FT                   /translation="MSHPFDTLTPDLVLDAVESLGFLSDARVLALNSYENRVYQVGIED
FT                   AQPLIAKFYRPGRWSDAAILEEHAFTAELADCEVPVVAPLQHDDRTLFEHKGFRFTLFP
FT                   RRGGHAPEPGNLDQLYRLGQLLGRLHAVGASKPFKHREALAVDNFGHASLNTLLEGNFV
FT                   PRELLPAFESVARDLLKRVEDIYARTPHQLIRLHGDLHPGNLMHRDEVYHVVDLDDCRM
FT                   GPAVQDLWMMLAGNREERLGQLAELIDGYNEFHDFDPRELALIEPLRALRQLHYSAWLA
FT                   RRWDDPAFPPSFPWFGQPRYWGDQILALREQMAALDEAPLKLF"
FT   gene            complement(448462..449226)
FT                   /locus_tag="Pput_0386"
FT   CDS_pept        complement(448462..449226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0386"
FT                   /product="transcriptional regulator, ModE family"
FT                   /note="TIGRFAM: molybdate transport repressor, ModE; PFAM:
FT                   regulatory protein, LysR; TOBE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76559"
FT                   /db_xref="GOA:A5VXE9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXE9"
FT                   /protein_id="ABQ76559.1"
FT                   /translation="MSLPALLTQHIARRPQRIALLQHIAEQGSITRAAKAAGISYKAAW
FT                   DAIDELNNLASQPLVKRSTGGRGGGGAHLSPEGERVLRLYQRLQALQAQILEAAEESSD
FT                   LDLLGRLMLRTSARNQLQGQVSGLRPEGRYDRVSLALSGGLEIDALITHDSTARLELTV
FT                   GTTVVALLKAGWVRLLAEGEEAEAGSNCLCTKVEEVLAEVDGPSEVRLALGNGQTLCAM
FT                   ADAHWLAAQHVVDGSVVRVQFHPSYVLIGVPA"
FT   gene            complement(449276..450007)
FT                   /locus_tag="Pput_0387"
FT   CDS_pept        complement(449276..450007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0387"
FT                   /product="amidophosphoribosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76560"
FT                   /db_xref="GOA:A5VXF0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXF0"
FT                   /protein_id="ABQ76560.1"
FT                   /translation="MNCQLHWKRLVYKWSLINQKCLLCDEPAEQHYPLCITCEQALPWL
FT                   GDQCRHCALPLPMAGLTCAPCGRGLPAFDQVIALWHFGFPVDTLISRFKHNRQWPLGRL
FT                   MAELLGHGLLYRYAEGLPRPDLLLPVPLARRRLRERGFNQAGMLGRWLSSHIGVTCNER
FT                   LLVRTRETPAQQHLGAKARQRNLRQAFAVMGKLQGKHVAIVDDVLTTGATAQAIAQALR
FT                   KAGARQVDVYCLARTPKPGYV"
FT   gene            450097..451155
FT                   /locus_tag="Pput_0388"
FT   CDS_pept        450097..451155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0388"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="TIGRFAM: biotin synthase; PFAM: Radical SAM domain
FT                   protein; biotin and thiamin synthesis associated; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76561"
FT                   /db_xref="GOA:A5VXF1"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXF1"
FT                   /protein_id="ABQ76561.1"
FT                   /translation="MSASTTATTRHDWSLAEVKALFQQPFNDLLFQAQTVHRAHFNPNR
FT                   VQVSTLLSIKTGACPEDCKYCPQSGHYNTGLEKQKLMEVQKVLEEAARAKAIGSTRFCM
FT                   GAAWKHPSAKDMPYVLEMVKGVKAMGLETCMTLGKLDQEQTKALAHAGLDYYNHNLDTS
FT                   PEFYGSIITTRTYSERLQTLAYVRDAGMKICSGGILGMGESLDDRAGLLIQLANLPEHP
FT                   ESVPINMLVKVAGTPLAEEEDVDPFDFIRMLAVARILMPKSHVRLSAGREQMNEQMQAL
FT                   AFMAGANSIFYGEKLLTTANPQADKDMQLFARLGIKPEAREEHADEVHQAAIEQALVEQ
FT                   RSSEMFYDAATA"
FT   gene            451157..452329
FT                   /locus_tag="Pput_0389"
FT   CDS_pept        451157..452329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0389"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="TIGRFAM: 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase, class I and II; aminotransferase
FT                   class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76562"
FT                   /db_xref="GOA:A5VXF2"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXF2"
FT                   /protein_id="ABQ76562.1"
FT                   /translation="MAFDLAARLAERRAADLYRQRPLLESPQGPEVVVDGQRLLAFCSN
FT                   DYLGLANHPEVITAWQAGAERWGVGGGASHLVVGHSTPHHQVEEALAELTGRPRALLFS
FT                   TGYMANLGAITALVGQGDTVLQDRLNHASLLDGGLLSGARFNRYLHNDPASLASRLDKA
FT                   VGNTLVVTDGVFSMDGDLADLPALADVARARGAWLMVDDAHGLGTLGTQGGGIVEHFGL
FT                   GVDDVPVLIGTLGKACGTAGAFVAGSEALIEALVQFARPYIYTTSQPPALACATLKSLE
FT                   LLRRETWRREHLAALIRQFREGAQQMGLQLMDSPTPIQPIVIGDSAQALRLSRLLRERG
FT                   LLVTAIRPPTVPAGSARLRVTLSAAHSEAQVQLLLNALAECYPQLENADA"
FT   gene            452322..453053
FT                   /locus_tag="Pput_0390"
FT   CDS_pept        452322..453053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0390"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76563"
FT                   /db_xref="GOA:A5VXF3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXF3"
FT                   /protein_id="ABQ76563.1"
FT                   /translation="MRNRLVLLPGWGLGTAALEPLAASLRAQDARLQIELMPLPEQAHS
FT                   DVQAWIDHLDRKLPSNVWLGGWSLGGMLASALAHKRGDHCCGLLTLASNPSFLARPDWP
FT                   HGMAEDTFGTFLDGCRNHTQVTLKRFRTLCSDGALQPRTLLRQLGVGVPDTDPLYLATG
FT                   LEVLAKLDTREALQAYGGPQLHLFAGSDALVPAEAAKALSELLPDVEVGLVEDSSHAFL
FT                   LEYPQELAAGIKSFLHESGDD"
FT   sig_peptide     452322..452390
FT                   /locus_tag="Pput_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.873) with cleavage site probability 0.492 at
FT                   residue 23"
FT   gene            453034..453864
FT                   /locus_tag="Pput_0391"
FT   CDS_pept        453034..453864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0391"
FT                   /product="pimeloyl-CoA biosynthesis protein BioC"
FT                   /note="TIGRFAM: biotin biosynthesis protein BioC; PFAM:
FT                   UbiE/COQ5 methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76564"
FT                   /db_xref="GOA:A5VXF4"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXF4"
FT                   /protein_id="ABQ76564.1"
FT                   /translation="MRVAMTDLSRPTLPGALPDKRQVAASFSRAAASYDSVAALQRAVG
FT                   LSLLEQLPAGLQPSHWLDLGSGTGHFSRMLAERFAQASGVAVDIAEGMLLHARHVKGGA
FT                   QYHVVGDAERLPLRDGSVDLVFSSLAVQWCDQFACVLAEAQRVLRPGGVLAFSSLCVGT
FT                   LDELRASWQAVDGLVHVNRFRRFEDYQRLCAASGFEQLELERCPHVLHYPDVRSLTHEL
FT                   KALGAHNLNPGRPSGLTGRARMQGLLQAYEAFRQPAGLPATYQVVYGVLRKPLA"
FT   gene            453875..454555
FT                   /locus_tag="Pput_0392"
FT   CDS_pept        453875..454555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0392"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; PFAM: Cobyrinic acid
FT                   a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76565"
FT                   /db_xref="GOA:A5VXF5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXF5"
FT                   /protein_id="ABQ76565.1"
FT                   /translation="MSQAFFIAGTDTDVGKTTIAAGLLHAARLQGMSTLGAKPVASGCT
FT                   MTPKGLRNSDALALIDESTVKLPYEQVNPFAFEPAIAPHVAAREAGVTLAVPELLAAMR
FT                   NVLQQNADFTLIEGAGGWRVPLSGLENLSDLAVALRLPVILVVGVRLGCISHALLSAEA
FT                   IERDGLQLAGWVANIIEPRTSRLEENLASLAERLPAPCLGRVPKLKQASADMVAEHLQL
FT                   DLLD"
FT   gene            454767..455063
FT                   /locus_tag="Pput_0393"
FT   CDS_pept        454767..455063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76566"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXF6"
FT                   /protein_id="ABQ76566.1"
FT                   /translation="MEITGSSAYYAGLSAIQTGQNRVDQAASQIANTTAERTATSQSSD
FT                   FQAERLRAVDRSQQMDLATSVVQQAVGKTEVELGAKVAKASDEMLGRIIDTYA"
FT   gene            455352..457157
FT                   /locus_tag="Pput_0394"
FT   CDS_pept        455352..457157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0394"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76567"
FT                   /db_xref="GOA:A5VXF7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXF7"
FT                   /protein_id="ABQ76567.1"
FT                   /translation="MPDYKAPLRDIRFVRDELLGYEAHYQSLPGCQDATPDMVDAILEE
FT                   GAKFCEQVLSPLNRVGDQEGCTWSESGVKTPTGFKEAYQQFVEGGWPSLAHDVEHGGQG
FT                   LPESLGLALSEMVGGSNWSWGMYPGLSHGAMNTISAHGTAEQQHTYLTKLVSGEWTGTM
FT                   CLTEPHCGTDLGMLRTKAEPQADGSYKVSGTKIFISAGEHDMADNIVHIVLARLPDAPA
FT                   GTKGISLFIVPKFLPNAEGGVGERNGVSCGSIEHKMGIHGNATCVMNFDAATGYLIGPA
FT                   NKGLNCMFTFMNTARLGTALQGLAHAEVAFQGGLKYARERLQMRSLTGPKAPDKAADPI
FT                   IVHPDVRRMLLTMKAFAEGNRAMVYFTAKQVDIVKYSQDEEERKKADALLAFLTPIAKA
FT                   FMTEVGFEAANHGVQIYGGHGFIAEWGMEQNVRDSRISMLYEGTTGIQALDLLGRKVLM
FT                   TQGEALKGFTKIVHKFCQAQEGNEAVKEFVEPLAAINKEWGELTMKVGMAAMKDREEVG
FT                   AASVDYLMYSGYACLAYFWADIARLAAEKLAAGTSEEAFYTAKLQTARFYFQRILPRTR
FT                   THVATMLSGANNLMAMDEEHFGLSY"
FT   gene            457459..458736
FT                   /locus_tag="Pput_0395"
FT   CDS_pept        457459..458736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0395"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76568"
FT                   /db_xref="GOA:A5VXF8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXF8"
FT                   /protein_id="ABQ76568.1"
FT                   /translation="MFRFNAVRASHFLPSLFLLLAGLAAAYVRDLSVFFTSLFNVLPTL
FT                   VLLLGGAYCAVYRRQRELFLMLTVYIAYFLLDTQTDFYRDHGRVREDAAVIFHLVCLLL
FT                   PALFGLYGAWQERTHLLQDLVARGAVLFAVGSVAVALQQSYPEALLTWLAEIRWPALHG
FT                   HWMSLIQMVYPLFLGVFILLVVQYLRAPRPLHAAQLIGLLGIFWMLPQTFILPFTLNIM
FT                   CSQVMLMIAAAVAHEAYQMAFRDELTGLPGRRALNERMQRLGRNYVIAMTDVDHFKKFN
FT                   DTHGHDVGDQVLRLVASRLVTGGGRAYRYGGEEFALVFAGKTAAECVPHVEAVREVIAN
FT                   YVMHLRDQHNRPQDDTAGRQRRAGSAGGTVSVTISIGVAERQADHRNPEAVLKSADQAL
FT                   YSAKGAGRNCVMVHGRQSLRGAVRTA"
FT   sig_peptide     457459..457539
FT                   /locus_tag="Pput_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.924 at
FT                   residue 27"
FT   gene            458861..460639
FT                   /locus_tag="Pput_0396"
FT   CDS_pept        458861..460639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0396"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76569"
FT                   /db_xref="GOA:A5VXF9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXF9"
FT                   /protein_id="ABQ76569.1"
FT                   /translation="MADYKAPLRDMRFVLNEVFNVAEQWTQLPGLAEVVDADTAMAVLE
FT                   EAGKVTAKTIAPLSRAADEEGCHWDNGAVRTPAGFIEAYNTYAEGGWVGVGGDPLFGGM
FT                   GMPKAISAQVEEMVNASSLAFGLYPMLTAGACLSINAHASEALKEKYLPNMYAGVWAGS
FT                   MCLTEPHAGTDLGIIRTKAEPQADGSYKVSGTKIFITGGEHDLTENIIHLVLAKLPDAP
FT                   AGPKGISLFLVPKFLVNEDGSLGARNPATCGSIEHKMGIQASATCVMNFDEAVGYIVGE
FT                   PNKGLAAMFTMMNYERLGVGIQGLASAERSYQNAVEYARDRLQSRAPAGPQAKDKAADP
FT                   IIVHPDVRRMLLTMKALIEGGRAFSTYVAMQLDSAKYSEDASVRKRSEELVALLTPVAK
FT                   AFLTDLGLECAVHGQQVFGGHGYIREWGQEQLVRDVRITQIYEGTNGIQALDLMGRKVV
FT                   ASGGAYYKLFSDEIRQFITGAGSELDEFAKPLGASLDQLDGLTEWVLQQAKGNPNEIGA
FT                   ASVEYLHAFGYVAYGYMWALMARAAQAGEGDAPFYSGKLGTARFYFARLLPRVDSLVAS
FT                   VKAGSESLYLLDAEQF"
FT   gene            complement(461003..461926)
FT                   /locus_tag="Pput_0397"
FT   CDS_pept        complement(461003..461926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0397"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76570"
FT                   /db_xref="GOA:A5VXG0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXG0"
FT                   /protein_id="ABQ76570.1"
FT                   /translation="MDFRQLRYFVAVYEEGHVGRAAERLSLSQPALSQQIRQLEHSLDL
FT                   SLFERSNKRLLPTLAAHTLYNHALPLLDGLQRAHEAMRNFKGQSLRTLAIGVLQTVRPS
FT                   LIPQLLERLRKAQPHLVVQIYELSGLEIERRLLNGNLDIGISYLPPRQPGLHGLLLYED
FT                   ELQLVIPDTHPLKDFKKVSIRQAAELPMLMLGEEFQIRQIWQAQLASQGRRPQVQAEMN
FT                   NMAGILDSLAHTALATILPGRAKEAAEDDQGLLWKPLSEPRVPLKVGLVFRDAQRQQAS
FT                   VELLRTLLEEETDARLMGASPLDVLA"
FT   gene            462138..463418
FT                   /locus_tag="Pput_0398"
FT   CDS_pept        462138..463418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0398"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76571"
FT                   /db_xref="GOA:A5VXG1"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXG1"
FT                   /protein_id="ABQ76571.1"
FT                   /translation="MNLFNLRRSAPAAAAEPKRAPVIVPHASELSPERLMPGAERAAQV
FT                   FVRGQGSWLWDNEGHAYLDFTQGGAVNSLGHSPSVLVKALGNQAQALINPGSGFHNRGL
FT                   LGLVNRLCQSTGSDQAYLLNSGAEACEGAIKLARKWGQLHRNGAYHIITASQACHGRSL
FT                   GALSASDPLPCNRCEPGLPGFSKVPFNDLAALHAEVDSRTVAIMLEPIQGEAGVIPATQ
FT                   EYLKGVETLCRELGILLILDEVQTGIGRCGALLAEELYGVRADIITLGKGLGGGVPLAA
FT                   LLARGKACCAEPGELEGSHHGNALMCAAGLAVLDSVLEPGFLAQVQDNGRHLREGLSRL
FT                   TGRYGQGEVRGHGLLWALQLKENLARELVAAALHEGLLLNAPQADVVRFSPALTVSKGN
FT                   IDEMLLRLARAFARLHAQQQARREVPA"
FT   gene            463566..463724
FT                   /locus_tag="Pput_0399"
FT   CDS_pept        463566..463724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0399"
FT                   /product="protein of unknown function UPF0057"
FT                   /note="PFAM: protein of unknown function UPF0057"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76572"
FT                   /db_xref="GOA:A5VXG2"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXG2"
FT                   /protein_id="ABQ76572.1"
FT                   /translation="MDFIRIIIAIILPPLGVFLQVGFGGAFWLNILLTLLGYIPGIVHA
FT                   VYIIAKR"
FT   gene            complement(463788..465611)
FT                   /locus_tag="Pput_0400"
FT   CDS_pept        complement(463788..465611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0400"
FT                   /product="peptidase S9, prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9, prolyl oligopeptidase active
FT                   site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76573"
FT                   /db_xref="GOA:A5VXG3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXG3"
FT                   /protein_id="ABQ76573.1"
FT                   /translation="MIETPVSSPAAEFSAAQAVAAGTDFAELKVSADGLFWNEFRPADG
FT                   ACRIWHWLHYQARCLTPDGFSVRSRVYEYGGGSFCLGGDGLVFVNEKDQQVYTQPLDDS
FT                   LPRALTHDVSCRYGDVQWHDGQVLAVEERHAEQVEHRLIALGDSSREVLAEGADFYASP
FT                   AVSADGQRLAWIEWDRPAQPWTVTRLMYRARDASGHWGSAQCVAAAEESLQQPRFDAEG
FT                   RLYCLSDRNGFWQPWGEVDGQWQALPAAPADHAAAPWQLGTCTWLALGPQSYLASWFED
FT                   GFGQLGLRGEDGRMERFASAYTRFRSLAMDSEHLYAIAASPISPPAVIAIDRSNHEVRV
FT                   LAGGAEMLPAGQISLPQPIHYDSGGEQAHGFFYPPAQPQGAAPLVVFIHGGPTSACYPV
FT                   LDPRIQYWTQRGFAVADLNYRGSTGYGREYRQALHQRWGESDVADACAVVEYLAAQGVV
FT                   DKRKAFIRGGSAGGYTTLCALAFQDVFRAGASLYGVSDPIALGHATHKFEGDYLDWLIG
FT                   DPQRDADRYRQRTPLLHAERIKVPVIFFQGELDAVVVPEQTRSMLAALQANGIDAEGHF
FT                   YAGERHGFRKAENLAHALEEEWKFYCRVLAQ"
FT   gene            complement(465577..466707)
FT                   /locus_tag="Pput_0401"
FT   CDS_pept        complement(465577..466707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0401"
FT                   /product="coenzyme PQQ biosynthesis protein E"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein E; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76574"
FT                   /db_xref="GOA:A5VXG4"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR011843"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXG4"
FT                   /protein_id="ABQ76574.1"
FT                   /translation="MPPTPEVGLPLWLLAELTYRCPLQCPYCSNPLDFAAQGQELSTEQ
FT                   WFKVMAEAREMGAAQIGFSGGEPLVRQDLAQLIAEARRLGYYTNLITSGIGLNEARIAD
FT                   FKKAGLDHIQISFQASDEQVNNLLAGSKKAFAQKLEMARAVKAHGYPMVLNFVTHRHNI
FT                   DKIDRIIELCIALEADFVELATCQFYGWAHLNRLGLLPTRAQLERAERITNEYRDKLKA
FT                   EGNPCKLIFVTPDYYEERPKACMNGWGNLFLTITPDGTALPCHGARQLPVQFPNVRDHD
FT                   LHHIWYESFGFNRFRGYEWMREPCRSCDEKEKDFGGCRCQAFMLTGDASNADPVCAKST
FT                   EHGIILKAREEAETAQLAIEQMTFRNDRNSRVIARG"
FT   gene            complement(466709..466984)
FT                   /locus_tag="Pput_0402"
FT   CDS_pept        complement(466709..466984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0402"
FT                   /product="coenzyme PQQ synthesis D"
FT                   /note="PFAM: coenzyme PQQ synthesis D"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76575"
FT                   /db_xref="GOA:A5VXG5"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR022479"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXG5"
FT                   /protein_id="ABQ76575.1"
FT                   /translation="MSFDRNQVPNWRPGYRFQYEPAQKGHVLLYPEGMIKLNDSASLIG
FT                   GLIDGQRDVAAIISELEQQFPDVPEVADDIEQFMEVARAEHWIVLA"
FT   gene            complement(466981..467736)
FT                   /locus_tag="Pput_0403"
FT   CDS_pept        complement(466981..467736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0403"
FT                   /product="coenzyme PQQ biosynthesis protein C"
FT                   /EC_number="1.3.3.11"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein C; PFAM:
FT                   TENA/THI-4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76576"
FT                   /db_xref="GOA:A5VXG6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR011845"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXG6"
FT                   /protein_id="ABQ76576.1"
FT                   /translation="MSDALPMSPAEFEQALRAKGAYYHIHHPYHVAMYQGRATREQIQG
FT                   WVANRFYYQVNIPMKDAAILANCPDREVRREWIQRLLDHDGAPGEDGGIEAWLRLGQAV
FT                   GLDPDQLRSQELVLPGVRFAVDAYVNFARRASWQEAASSSLTELFAPQIHQSRLDSWPQ
FT                   HYPWIDPAGYEYFRTRLGQARRDVEHGLAITLQHYTTRAGQERMLEILQFKLDILWSML
FT                   DAMSMAYELNRPPYHSVTQERMWHKGITL"
FT   gene            complement(467899..468810)
FT                   /locus_tag="Pput_0404"
FT   CDS_pept        complement(467899..468810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0404"
FT                   /product="coenzyme PQQ biosynthesis protein B"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76577"
FT                   /db_xref="GOA:A5VXG7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011842"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXG7"
FT                   /protein_id="ABQ76577.1"
FT                   /translation="MYIQVLGSAAGGGFPQWNCNCVNCKGYRDGTLKATARTQSSIALS
FT                   DDGVHWILCNASPDIRAQLQAFAPMQPARALRDTGINAIVLLDSQIDHTTGLLSLREGC
FT                   PHQVWCTDMVHQDLTTGFPLFNMLSHWNGGLQWNRIELEGSFVIDACPNLKFTPFPLRS
FT                   AAPPYSPHRFDPHPGDNLGLMVEDTRTGGKLFYAPGLGQVDEKLLAMMHGADCLLVDGT
FT                   LWEDDEMQRRGVGTRTGREMGHLAQNGPGGMLEVLDGFPRQRKVLIHINNTNPILDEDS
FT                   PERAEVLRRGVEVAFDGMSIAL"
FT   gene            complement(469120..471549)
FT                   /locus_tag="Pput_0405"
FT   CDS_pept        complement(469120..471549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0405"
FT                   /product="pyrroloquinoline quinone synthesis related
FT                   protease (pqqF), Metallo peptidase, MEROPS family M16A"
FT                   /note="TIGRFAM: coenzyme PQQ biosynthesis protein PqqF;
FT                   PFAM: peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76578"
FT                   /db_xref="GOA:A5VXG8"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR011844"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXG8"
FT                   /protein_id="ABQ76578.1"
FT                   /translation="MRPIRGHARSHGICAAFHTGALPAKRPGLRTNRLAWSAATGAPMP
FT                   DAIRQLTLANGLQLTLRHAPRLKRSAAALRVHAGSHDAPAKWPGLAHFLEHLFFLGTPR
FT                   FPLEDGLMRYVQALGGQVNASTRERATDFFFEVPPNTLGGGLERLCQMLAEPDLGIERQ
FT                   RREREVIHAEFIAWSRNPSAQQQFALLQSVSAKHPLGAFHAGNRYTLALHDAAFQQALA
FT                   GFHQRFYQGGQICLSLCGPQPLDELERLARQHAELFAAGERVPQVLPPPLPAMASALTF
FT                   THQSLPSGAEHALELLIAYLEDSRPGTWLGALRERGWLQRFTAERLYAFAGQLLWHLDL
FT                   KLSADACPDEANALLQGWFRFIRQADREQLNHQFGLLQHSRAHSASALELARRDSTGQP
FT                   FAKLDAQGLQVLGALLESLPGGDHGDWQLLPVDPLLKADLPHAKAQPLPAALKISDQLP
FT                   PARQYAALYLRWHVPSPLRQQLQRVLELALAPLQERCDRASVQLQYSSAGEYWQLRCAG
FT                   LPAAVLRAVEQALALMLKPPASCWLPDTAQPPALIPIRALLKQLPDAVRGSLPAAVPAC
FT                   TLTQQQLDSLWLHTEWHGMAAGFEDTALNALGAALLQCPGQGSRPGPLPSWANHRWQHA
FT                   QVPGSEHALLLFCPLPAAKEAAGRLLAQLLQGPVYQRLRVDLQLGYAVFSAFRQVEGVG
FT                   GLLFGVQSPHTGQAQVLDHLLSLLRHGVTLDPAARQALAGQFDEPAMANSDVAEWAWQT
FT                   HLGTQADRLDVLRRSILTTRQTDLDHLLSDLLDPGSAWLCLANAAAPDTSWQGEDR"
FT   gene            complement(471561..472355)
FT                   /locus_tag="Pput_0406"
FT   CDS_pept        complement(471561..472355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0406"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76579"
FT                   /db_xref="GOA:A5VXG9"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXG9"
FT                   /protein_id="ABQ76579.1"
FT                   /translation="MRIALYQGAPKPLDVPGNLQRLRHQAQLAAERGAQLLVCPEMFLT
FT                   GYNIGLAQVERLAEAADGPAAMTVVEIAQAHRIAIVYGYPERGDDGAIYNSVQLIDAHG
FT                   RSLSNYRKTHLFGELDRSMFSPGADHFPVVELEGWKVGLLICYDIEFPENARRLALDGA
FT                   ELILVPTANMTPYDFTCQVTVRARAQENQCYLVYANYCGAEDEIQYCGQSSIIGPDGSL
FT                   LAMAGRDECQLLAELEHERVVQGRTAFPYLTDLRQELHLRKG"
FT   gene            complement(472370..474052)
FT                   /locus_tag="Pput_0407"
FT   CDS_pept        complement(472370..474052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0407"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76580"
FT                   /db_xref="GOA:A5VXH0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXH0"
FT                   /protein_id="ABQ76580.1"
FT                   /translation="MNKKNRHPADGKKPITIFGPDFPFAFDDWLEHPAGLGSIPAERHG
FT                   EEVAIVGAGIAGLVAAYELMKLGLKPVVYEASKLGGRLRSQAFNGTDGIVAELGGMRFP
FT                   VSSTAFYHYVDKLGLETKPFPNPLTPASGSTVIDLEGQTYYAEKPTDLPQLFHEVADAW
FT                   ADALESGAQFADIQQAIRDRDVPRLKELWNKLVPLWDDRTFYDFVATSRSFAKLSFQHR
FT                   EVFGQVGFGTGGWDSDFPNSMLEIFRVVMTNCDDHQHLVVGGVEQVPQGIWRHVPERCV
FT                   HWPEGTSLSTLHGGAPRTGVKRIARAADGRLAVTDNWGDTRHYSAVLATCQTWLLTTQI
FT                   DCEESLFSQKMWMALDRTRYMQSSKTFVMVDRPFWKDKDPETGRDLLSMTLTDRLTRGT
FT                   YLFDNGNDKPGVICLSYSWMSDALKMLPHPVEKRVQLALDALKKIYPKTDIAGHIIGDP
FT                   ITVSWEADPYFLGAFKGALPGHYRYNQRMYAHFMQQDMPAEQRGIFIAGDDVSWTPAWV
FT                   EGAVQTSLNAVWGIMNHFGGHTHPDNPGPGDVFNEIGPIALAD"
FT   gene            complement(474365..474826)
FT                   /locus_tag="Pput_0408"
FT   CDS_pept        complement(474365..474826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0408"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76581"
FT                   /db_xref="GOA:A5VXH1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXH1"
FT                   /protein_id="ABQ76581.1"
FT                   /translation="MSDARSITLDEIDRQLIALLQINARESVATLARQLGIARTTVNSR
FT                   LERLEKNKVISGYGVRLGQSVIGGGLQAYVGIKVQPRSGKDVVRRLSAMGQVQQLCAVS
FT                   GEFDYVAWLRTDSPEQLDQLLDQIGSVDGVEKTTTSIILSSKVDRGQPL"
FT   gene            475014..475568
FT                   /locus_tag="Pput_0409"
FT   CDS_pept        475014..475568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0409"
FT                   /product="Serine acetyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76582"
FT                   /db_xref="GOA:A5VXH2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXH2"
FT                   /protein_id="ABQ76582.1"
FT                   /translation="MNLDHLLECWRLEVSNKKRPGRPISLLFNVLRRARKDNKLRFLFA
FT                   YRLAQYLDARGGLARRHARRMQQRLNLKYGVDIDIGAQIAPGLRIAHLPGVVITRYVSI
FT                   GRNFFIRQNCSIGIKTLGLQEYALRIGDNVSMGANSCIVADRIDIGDDVVIGAMSLVTR
FT                   DIPPGMTFYNPRQVEMRPGGD"
FT   gene            complement(475912..476193)
FT                   /locus_tag="Pput_0410"
FT   CDS_pept        complement(475912..476193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76583"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXH3"
FT                   /protein_id="ABQ76583.1"
FT                   /translation="MQARESTHNPLVHGSSPCGPTSLEAAHCAAFSCPQEINVRGVYIQ
FT                   RSGAERMTLEVALKHHLSEISPTKKPITQHADNRGKVPYRYFKPNTLA"
FT   gene            476510..477103
FT                   /locus_tag="Pput_0411"
FT   CDS_pept        476510..477103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76584"
FT                   /db_xref="GOA:A5VXH4"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXH4"
FT                   /protein_id="ABQ76584.1"
FT                   /translation="MKDLFASSVLSTCIALIVVLAVLHFAPVSDILITHSQYVPARDIK
FT                   ELDSYEQLVVERMIREKTLISVDTLWSLQVSFYQTMVSILIALNAAIVGGAFVIIRSSS
FT                   KAEVVKESKAHFDEFSSTGGLARIVERKAKKELNKLNAIYGDVFDGLSEQGAIVSDHET
FT                   RIKVSEDAIIQVSSRLAALDRSESCDGRDGKIRE"
FT   sig_peptide     476510..476572
FT                   /locus_tag="Pput_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.671) with cleavage site probability 0.265 at
FT                   residue 21"
FT   gene            477112..477678
FT                   /locus_tag="Pput_0412"
FT   CDS_pept        477112..477678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0412"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76585"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXH5"
FT                   /protein_id="ABQ76585.1"
FT                   /translation="MAFIRKSGKSKSVDTSHVSEVASVDERFTVDQLLALAVQHEVDTS
FT                   PLDVKSLLSVLGIKLLSVPMSDDVSGMLSLADNSKDWVVKVNALHHPNRQRFTIAHEIA
FT                   HFSRHRFQQAEFKDLNFFRNGESNPMEVEANRFASELLMPESAFRDKVKVFSGSIEEIA
FT                   QYFKVSTLAVRVRAKNLGMKGHGLE"
FT   gene            477665..478732
FT                   /locus_tag="Pput_0413"
FT   CDS_pept        477665..478732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76586"
FT                   /db_xref="InterPro:IPR025683"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXH6"
FT                   /protein_id="ABQ76586.1"
FT                   /translation="MDWNSFIYFPVLKTKDAELRAISAIDVSYRKNMLPTYEITKSRIT
FT                   KKNSVGDIVKRLDQIKNIQGKLPYILDVTTDPKQKNSQIESILSPVNGYESWRSWLELN
FT                   CGEQIVPMIHVNFELDEDLSEAKAFVASVTAKYKKMALRLPADLEHDEYEDIVTDIVSE
FT                   LKGTRLYILLDEGCIRDRAKSSLVPITDSYQRAFSKISSLPGSVEWLEKIVCIAGSFPY
FT                   QVSAEGKDEEGDFEIYEQSLFLSLRHNRPMLQFGDYASINVKQIEMRGGTFVPRIDFCT
FT                   ATRFYYYRKRRDVGSYIWCAKQVVKNSNYISNGSWGDNEISSAAAGSPSGISPSFWISV
FT                   RACNYMIRRVEELRV"
FT   gene            complement(478721..479329)
FT                   /locus_tag="Pput_0414"
FT   CDS_pept        complement(478721..479329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76587"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXH7"
FT                   /protein_id="ABQ76587.1"
FT                   /translation="MKEAEIKRLAGYHLLKQEGTDVVFFEYTFHFGRRRADIISAEDGM
FT                   IIGYEIKSAHDRIDRLSEQLRSYEQLFDYVYVVCDTKHLSAIRKIAPEKIGIYLCSSGG
FT                   VKRLRKAKQIRNSNTIVTLDAMPIETLRREFKIVRKSKLETCESISRTHKKEEIKTIFR
FT                   RHIIQKYGSQTSHMKSETSELLTLDDVFSLGLAPNRLDS"
FT   gene            complement(479578..480273)
FT                   /locus_tag="Pput_0415"
FT   CDS_pept        complement(479578..480273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0415"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76588"
FT                   /db_xref="GOA:A5VXH8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXH8"
FT                   /protein_id="ABQ76588.1"
FT                   /translation="MYGYRKIHNDLRELGETCGRNRVGRLMQAEGLRSQTGYRRRPGFY
FT                   GGKPTAASPNHLARQFKVSEPNKVWVTDITYIRTYEGWLYLAVVLDLFSRQVIGWSMKP
FT                   RMCSDLAIDAMLMAVWRRKPQQQVMIHSDQGSQFSSSDWQSFLKANNVISSMSRRGNCH
FT                   DTAVAESFFQLLKRERIRRKIYATRDEARSDIFDYIEMFYNPKRRHSSAMQLCPVEYEK
FT                   RYFLSLESV"
FT   gene            480433..480741
FT                   /pseudo
FT                   /locus_tag="Pput_0416"
FT   gene            480786..481594
FT                   /pseudo
FT                   /locus_tag="Pput_0417"
FT                   /note="Integrase, catalytic region"
FT   gene            complement(481598..481834)
FT                   /locus_tag="Pput_0419"
FT   CDS_pept        complement(481598..481834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0419"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76589"
FT                   /db_xref="GOA:A5VXH9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXH9"
FT                   /protein_id="ABQ76589.1"
FT                   /translation="MSSQRYPEEFKIEAVKHVTEKAKSVADVAQRLGMSVHSLYAWIKL
FT                   YSKPQEQRQQDDDQQAELRKLRAELKRVTEERV"
FT   gene            complement(482039..482115)
FT                   /locus_tag="Pput_R0008"
FT                   /note="tRNA-Met6"
FT   tRNA            complement(482039..482115)
FT                   /locus_tag="Pput_R0008"
FT                   /product="tRNA-Met"
FT   gene            complement(482132..485875)
FT                   /locus_tag="Pput_0420"
FT   CDS_pept        complement(482132..485875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0420"
FT                   /product="periplasmic sensor diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: PAS sensor protein; diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; EAL domain protein;
FT                   extracellular solute-binding protein, family 3; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76590"
FT                   /db_xref="GOA:A5VXI0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXI0"
FT                   /protein_id="ABQ76590.1"
FT                   /translation="MSLKPAILLLILILWNTTAGALTLTDEENAWLAAHPQLKLGVDAS
FT                   WPPFEFRDQEGRYQGLAADYIAMIQQRLGVTFKPVEPSSWTEVLAQARESRIDLLPGIM
FT                   STPERQGFLAFTRPYLDFPIVILAHKGGAQPRKLADLYGLKVAVVENYAPHELLRTHHP
FT                   DLNLVALPNVSSTLQALATDQVDAVVGDLASSIWSLRQLKLDGLYVSGETPYRYQLAMA
FT                   VPRDKSVLVGILDKVMADMSSSEISQIQQHWVGNVVDQRMFWSDLLVYGLPTVLLLMAV
FT                   LAVVIRINRRLSSEISRRIALEQELRSSEYHYRGLVESLSAIAWEADANDFTYSYVSPH
FT                   AEDLLGYPLSDWLRPGFWRSILHPEDALWAQAYCDSETAAGRDHSLDYRVIRADGQPLW
FT                   IRNIVSMIEHGHQPVMRGLMIDISETKRTEDALRLSEQKFASVFQQCPDILLIARHSDG
FT                   CLLEVNEAFEEQIGLPPDQVIGRTATDLDLWGVEGSGPLLLQRLHQGGIRNLEMSFRRS
FT                   NGQLFTGLTSAETFELDGTPALVVAVRDISQLKETQQQLQTSEEKFAKAFHASPDGLLL
FT                   SRQSDGLLLEVNEGFCRLTGYDLNPTIDQTSLDLGIWVDLNERKRLVDQLNRDGFVRDF
FT                   TCHIRRSDGQIRLCELSARPLPITGVDCMLTIARDITERHLMQEKLQLAATVFENTAEG
FT                   VLITDIDQRISAVNRAFSEITGYSEIEALGQTPRLLASGQHDSAFYLAMWHQLTAEGHW
FT                   QGEIYNKRKNGELYPSWLTISAVRNSDREITHFVAVFADISSIKHAQAKLDYQAHHDPL
FT                   TGLPNRTLFENRLQGVLTCAQVSNRQGAVLFLDLDRFKHINDSLGHPVGDLLLKGIAQR
FT                   LKEQVRDVDTVARLGGDEFIILLPGLHKPSDASTIANKLLACFNAPFQAGEHEFFTSAS
FT                   IGISLYPQDGTDVSTLIRNADAAMYRSKAKGRNRVEAYTRDLTAQASERIALEHELRRA
FT                   VERNEMSLCFQPKLSLKTQSLVGAEALIRWSHPTFGEVPPEHFIHLAEENGTILQLGDW
FT                   VLEQACRQMQAWKQHYEPFGPLSINLAGAQLRHPHLARRIEQLLKHYQLRAGDLQLEIT
FT                   ENFIMSQAEEALAVLYQLKKLGVQLAIDDFGTGYSSLSYLKRLPLDILKIDKSFIRGLP
FT                   DDPHDAAIARAIIALGRSMQLTIIAEGVENQAQQRFLAAEGCEQIQGYIVSLPLPPEEF
FT                   AAAFLRIALSDLSDGTGAKPSL"
FT   sig_peptide     complement(485810..485875)
FT                   /locus_tag="Pput_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.961 at
FT                   residue 22"
FT   gene            complement(486003..487853)
FT                   /locus_tag="Pput_0421"
FT   CDS_pept        complement(486003..487853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0421"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma-70; PFAM: sigma-70 1.1 domain protein;
FT                   sigma-70 region 3 domain protein; sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein; sigma-70,
FT                   non-essential domain protein; sigma-70 region 1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76591"
FT                   /db_xref="GOA:A5VXI1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXI1"
FT                   /protein_id="ABQ76591.1"
FT                   /translation="MSGKAQQQSRIKELITRGREQGYLTYAEVNDHLPEDISDPEQVED
FT                   IIRMINDMGINVFESAPDADALLLAEADTDEAAAEEAAAALAAVETDIGRTTDPVRMYM
FT                   REMGTVELLTREGEIEIAKRIEEGIREVMGAIAHFPGTVDYILGEYDRVTTEGGRLSDV
FT                   LSGYIDPDDNIAAPTEEVPIPGAKAAAAKEESDDDEEESESGDDEEEAESGPDPVVAAQ
FT                   RFGAVSDQLQATSKVLKKNGRNHKESIEALQALADLFMPIKLVPKQFEVLVERVRDALN
FT                   RLRQQERAIMQLCVRDARMPRADFLRMFPSNETDQTWSGDLAKRNTKWAAALGEKNAAI
FT                   VACQQKLIDLETETGLTVAEIKEINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTN
FT                   RGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVH
FT                   MIETINKLNRISRQMLQEMGREPTPEELGERMEMPEDKIRKVLKIAKEPISMETPIGDD
FT                   EDSHLGDFIEDSTMQSPIDVATVESLKEATRDVLSGLTAREAKVLRMRFGIDMNTDHTL
FT                   EEVGKQFDVTRERIRQIEAKALRKLRHPTRSEHLRSFLDE"
FT   gene            complement(487921..489903)
FT                   /locus_tag="Pput_0422"
FT   CDS_pept        complement(487921..489903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0422"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="TIGRFAM: DNA primase; PFAM: zinc finger, CHC2-family
FT                   protein; TOPRIM domain protein; DNA primase DnaG,
FT                   DnaB-binding; DNA primase catalytic core, N-terminal
FT                   domain; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76592"
FT                   /db_xref="GOA:A5VXI2"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXI2"
FT                   /protein_id="ABQ76592.1"
FT                   /translation="MAGLIPQSFIDDLINRLDIVDVVSSRVQLKKTGKNYSACCPFHKE
FT                   KTPSFTVSPDKQFYYCFGCGAGGNALGFVMDHDNLDFPQAVEELARAAGMEVPREQGRR
FT                   DQKPRQPTDSPLYPLLDAASEFYRQALRSHPSRKAAVDYLKGRGLSGEIARDFGLGFAP
FT                   PGWDNLLKHLGADTLQQNVMIDAGLLIENAESGKRYDRFRDRVMFPIRDSRGRIIAFGG
FT                   RVLGDDKPKYLNSPETPVFHKGQELYGLYEARKHNRNLDEIIVVEGYMDVIALAQQGLR
FT                   NAVATLGTATSEEHLKRLFRVVPSVLFCFDGDQAGRKAAWRALESTLSNLQDGRRARFL
FT                   FLPEGEDPDSLVRAEGTDAFMARINQHAQPLADYFFEQLGVEADPRSLEGKAHMATLAA
FT                   PLIEKIPGANLRQLMRNRLKEITGLDPQQVEQLAQQAPATSSMPDYDPGYDYDAMASYT
FT                   PDYGDMPQHDYAPVHQEQAWKPNKGGSKKPWSDKPWDKNRKSGKPWQQRDEAPPRVPAP
FT                   VEPPTLAALRTLLHHPLLAGKVEDASHFADEEHLYSQLLVALIEAAQKNPGLSSMQLIA
FT                   RWHGTEQGRLLRALAEKEWLIVADNLEQQFFDTITSLSARQRERSLEQLLRKSRQSELT
FT                   SEEKTQLLALLSRNVPAQTPTSSGA"
FT   gene            complement(490208..490423)
FT                   /locus_tag="Pput_0423"
FT   CDS_pept        complement(490208..490423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0423"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76593"
FT                   /db_xref="GOA:A5VXI3"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXI3"
FT                   /protein_id="ABQ76593.1"
FT                   /translation="MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAER
FT                   KRKAAAAVKRHAKKVQREQRRAVRLY"
FT   gene            490628..491653
FT                   /locus_tag="Pput_0424"
FT   CDS_pept        490628..491653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0424"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: putative metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76594"
FT                   /db_xref="GOA:A5VXI4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXI4"
FT                   /protein_id="ABQ76594.1"
FT                   /translation="MLVLGLETSCDETGVALYDSERGLLADALFSQIDLHRVFGGVVPE
FT                   LASRDHVKRMLPLIRQVLDEAGCVATEIDAIAYTAGPGLVGALLVGASCAQALAFAWDI
FT                   PAIGVHHMEGHLLAPMLEENPPAFPFVALLVSGGHTQLVRVDGIGQYELLGESLDDAAG
FT                   EAFDKTAKLIGLNYPGGPEIARLAEQGVAGRFVFPRPMTDRPGLEFSFSGLKTFALNTW
FT                   QQCKNAGDDSEQTRCDLSLAFQQAVVETLTIKCKRALKQTGLKRLVIAGGVSANKALRA
FT                   SLEDMLGSIKGNVYYARPQFCTDNGAMIAYAGCQRLLAGQQQDLAISVQARWPMEQLPP
FT                   L"
FT   gene            complement(491671..492240)
FT                   /locus_tag="Pput_0425"
FT   CDS_pept        complement(491671..492240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0425"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="PFAM: protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76595"
FT                   /db_xref="GOA:A5VXI5"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXI5"
FT                   /protein_id="ABQ76595.1"
FT                   /translation="MFWLLALLAYLLGSLSFAIVLSRLSGSPDPRSSGSGNAGATNMLR
FT                   LAGRKLAILTLLGDLCKGLLPVLLARVAGLDLHAQAWVGICAVLGHLFPLYFRFKGGKG
FT                   VATAAGMLMGLYFPAALLAIGAWLLTFYLTRTSSLAALIATPLTLPLLAWREPEALLPI
FT                   SVLTVMIVWRHRNNLRDLFAGRERHF"
FT   sig_peptide     complement(492184..492240)
FT                   /locus_tag="Pput_0425"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.567 at
FT                   residue 19"
FT   gene            492315..492671
FT                   /locus_tag="Pput_0426"
FT   CDS_pept        492315..492671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0426"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76596"
FT                   /db_xref="GOA:A5VXI6"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXI6"
FT                   /protein_id="ABQ76596.1"
FT                   /translation="MDRVFIEGLEVDTVIGAYDWERDIRQCLRLDLSFAWDNRPAAAGD
FT                   DLNLALDYASVSARIQAFAEQARFELVETFAERLVATLMDEFHIPWVRLKLTKPGAVPA
FT                   ARGGVGVEIERGCL"
FT   gene            492662..493171
FT                   /locus_tag="Pput_0427"
FT   CDS_pept        492662..493171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0427"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76597"
FT                   /db_xref="GOA:A5VXI7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXI7"
FT                   /protein_id="ABQ76597.1"
FT                   /translation="MSLSTVYLGLGSNIDREAHLCAGLDALAGILTDMRCSPAFESQAV
FT                   GIKSGPFINFVVTGQTALPLIELDRRLKFIEADNGRYAPDRKGLPLDIDVLMYDDLHGT
FT                   FDGLVLPRAEILKNAFVLWPLSLLAPDLVHPGVGKRMAQLWQEAQIDQVLAPVAFEWRG
FT                   LQLTPA"
FT   gene            complement(493393..494499)
FT                   /locus_tag="Pput_0428"
FT   CDS_pept        complement(493393..494499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0428"
FT                   /product="Polynucleotide adenylyltransferase region"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76598"
FT                   /db_xref="GOA:A5VXI8"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXI8"
FT                   /protein_id="ABQ76598.1"
FT                   /translation="MHIYKVGGAVRDRLLGRPVSDIDWLVVGATVEEMLAKGYRPVGAD
FT                   FPVFLHPKTGEEYALARTERKSGRGYGGFTFHASPDVTLEEDLIRRDLTINAMAEDEAG
FT                   TVYDPYQGKQDLDKRLLRHVSPAFAEDPLRVLRVARFAARYAPLGFRVADETLALMRQI
FT                   SASGELQALTAERSWKEIERALMEVQPQVFFKVLSACGALQELLPELDDSSRTLAALEQ
FT                   AAVHEQPLHVRWACLLRGLSPTSIKAVNQRLKAPRECQELAMLTGECLAQGNQALELPA
FT                   TALLELLQKFDVYRRPQRFEDFLVVCEMAARGDGEQGYPQADYLRRAAAAARAVDVKPL
FT                   VQAGLTGQALGEALKGERLKALEAYQRG"
FT   gene            complement(494555..496123)
FT                   /locus_tag="Pput_0429"
FT   CDS_pept        complement(494555..496123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0429"
FT                   /product="SpoVR family protein"
FT                   /note="PFAM: SpoVR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76599"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXI9"
FT                   /protein_id="ABQ76599.1"
FT                   /translation="MTARAQRRQPISTGSEWTFELIQTYDREISRLAERYALDTYPNQI
FT                   EVITAEQMMDAYASVGMPLGYHHWSYGKQFLSTEKSYSRGQMGLAYEIVINSDPCIAYL
FT                   MEENTMCMQALVIAHACYGHNSFFKGNYLFRTWTDASSIIDYLVFAKQYIAQCEERHGI
FT                   DAVEDLIDSCHALMNYGVDRYKRPYPISAEEERRRQQEREEHLQRQINDLWRTIPKNAE
FT                   KGNDRDEGRFPAEPQENILYFIEKNAPLLEPWQREVVRIVRKIAQYFYPQRQTQVMNEG
FT                   WATFWHYTLMNDLYDEGLITEGFMMEFLQSHTSVVFQPGFDSPYYSGINPYALGFAMYT
FT                   DIRRMCENPTEEDRHWFPDIAGSDWLSTIKFAMSSFKDESFILQYLSPKVMRDLKLFSI
FT                   LDDDQRDDLLVPAIHDEAGYRVIREQLAAQYNLGNREPNVQIWSVDRRGDRSLTLRHQQ
FT                   HNRKPLGDSTDEVLKHLHRLWGFDIHLETVQGEQVMSTHHMPPRGEHSESADYGRMDLA
FT                   VIHHL"
FT   gene            complement(496120..497391)
FT                   /locus_tag="Pput_0430"
FT   CDS_pept        complement(496120..497391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0430"
FT                   /product="protein of unknown function DUF444"
FT                   /note="PFAM: protein of unknown function DUF444"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76600"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXJ0"
FT                   /protein_id="ABQ76600.1"
FT                   /translation="MSYVIDRRLNGKNKSTVNRQRFLRRYREHIKKAVEEAVSRRSIMD
FT                   MEHGEQISIPGRDIDEPVLHHGRGGKQTIVHPGNKEFTAGEHIPRPQGGGGGGGRGKAG
FT                   NSGEGMDEFVFQITQEEFLEFMFEDLELPNLVKRHLTGADTFKTVRAGIANEGNPSRIN
FT                   IVRTLRSAHARRIALTGSSRALLREAQKELDRLRVEEPDNFTDIQEVEQEIERLKARIN
FT                   RLPFLDTFDLKYNLLVKQPNPSSKAVMFCLMDVSGSMTQATKDIAKRFFILLYLFLKRN
FT                   YERIEVVFIRHHTSAREVDEEEFFYSRETGGTIVSSALKLMQEIMAERYPASDWNIYAA
FT                   QASDGDNWNDDSPICRDILSKQIMPHVQYYTYVEITPREHQALWYEYERIGDAFPDTFA
FT                   QQQLVSAGDIYPVFRELFQRRLAT"
FT   gene            complement(497547..499469)
FT                   /locus_tag="Pput_0431"
FT   CDS_pept        complement(497547..499469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0431"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /note="PFAM: PrkA serine kinase; PrkA AAA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76601"
FT                   /db_xref="GOA:A5VXJ1"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXJ1"
FT                   /protein_id="ABQ76601.1"
FT                   /translation="MSIFSHFQQRFESTRQEELSLQEYLELCKEDRSAYASAAERLLLA
FT                   IGEPELIDTSTNSRLSRIFSNKVIRRYPAFADFHGMEECIDQIVSYFRHAAQGLEEKKQ
FT                   ILYLLGPVGGGKSSLAEKLKQLMEKVPFYAIKGSPVFESPLGLFNATEDGAILEEEFGI
FT                   PRRYLNTIMSPWATKRLQEFGGDISKFKVVKLYPSILNQIAIAKTEPGDENNQDISALV
FT                   GKVDIRKLEEYPQNDADAYSYSGALCRANQGLMEFVEMFKAPIKVLHPLLTATQEGNYN
FT                   STEGLGAIPYTGILLAHSNESEWHTFRNNKNNEAFIDRIYIVKVPYCLRVSDEIKIYDK
FT                   LLVNSSLSKAHCAPDTLKMLAQFTVLSRLKEPENSNIYSKMRVYDGENLKDTDPKAKSI
FT                   QEYRDSAGVDEGMNGLSTRFAFKILSKVFNFDPHEIAANPVHLLYVLEQQIEQEQFPAE
FT                   VRERYLRYLKEYLAPRYIEFIGKEIQTAYLESYSEYGQNIFDRYVLYADFWIQDQEYRD
FT                   PETGEILNRIALNEELEKIEKPAGISNPKDFRNEIVNFVLRARANNNGKNPSWLSYEKL
FT                   RVVIEKKMFSNTEDLLPVISFNAKASKEDQKKHNDFVTRMVERGYTDKQVRLLSEWYLR
FT                   VRKSQ"
FT   gene            complement(499752..500084)
FT                   /locus_tag="Pput_0432"
FT   CDS_pept        complement(499752..500084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0432"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="PFAM: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76602"
FT                   /db_xref="GOA:A5VXJ2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXJ2"
FT                   /protein_id="ABQ76602.1"
FT                   /translation="MSEFKRIPPEQALELRKKEGAVVVDIRDPQAFAAGHITGARHLDN
FT                   HSVADFIRNADLDAPTLVVCYHGNSSQSAAAYLVGQGFSDVYSVDGGFELWRATYPAET
FT                   AQGNAE"
FT   gene            complement(500099..500965)
FT                   /locus_tag="Pput_0433"
FT   CDS_pept        complement(500099..500965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0433"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase (symmetrical)"
FT                   /EC_number="3.6.1.41"
FT                   /note="TIGRFAM: bis(5'-nucleosyl)-tetraphosphatase
FT                   (symmetrical); PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76603"
FT                   /db_xref="GOA:A5VXJ3"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXJ3"
FT                   /protein_id="ABQ76603.1"
FT                   /translation="MATYAVGDLQGCLQPLKCLLDRVSFNPAVDRLWLVGDLVNRGPES
FT                   LETLRFLYSIRHSLVCVLGNHDLHLLAAWHNVERLKKSDTLREIIEAPDADQLFDWLRQ
FT                   QKLLHYDEPRGIALVHAGIPPQWTLGKALELAAEVEEVLRDDTRLQLYLDGMYGNEPNK
FT                   WSKNLAGVERLRVITNYFTRMRFCTADGKLDLKSKEGLGSAPKGYKAWYAHKDRRSRHV
FT                   KIIFGHWAALQGEVTEPDVIALDTGCVWGGAMTLYNVDSGEYHRCDCADDGTLRQPAQP
FT                   TTLNDHT"
FT   gene            complement(500965..501345)
FT                   /locus_tag="Pput_0434"
FT   CDS_pept        complement(500965..501345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0434"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76604"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXJ4"
FT                   /protein_id="ABQ76604.1"
FT                   /translation="MSDPRYQIDVSVVTRYLKEQSDPENSRFAFAYTITVQNNGSLSAK
FT                   LLSRHWLITNGDGEVEEVRGAGVVGQQPNIDPGQSHTYSSGAVISTRVGTMQGSYQMFA
FT                   EDGKRFDAEIAPFRLAVPGALH"
FT   gene            complement(501543..502346)
FT                   /locus_tag="Pput_0435"
FT   CDS_pept        complement(501543..502346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0435"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76605"
FT                   /db_xref="GOA:A5VXJ5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXJ5"
FT                   /protein_id="ABQ76605.1"
FT                   /translation="MNEQYQHRARKRFGQNFLHDAGIIDRILRAINAKAGEHLLEIGPG
FT                   QGALTEGLLGSGAQLDVVELDKDLVPILHHKFADRSNFRLHQGDALKFDFNQLGVPPRS
FT                   LKVVGNLPYNISTPLIFHLLSHAGLIRDMHFMLQKEVVERMAAGPGGGDWGRLSIMVQY
FT                   HCRVEHLFNVGPGAFNPPPKVDSAIVRLVPHEVLPFPAKDHLLLERVVREAFNQRRKTL
FT                   RNTMKGLLDSAAIEAAGVDGSLRPEQLDLAAFVRLADQLADQQQA"
FT   gene            complement(502343..503332)
FT                   /locus_tag="Pput_0436"
FT   CDS_pept        complement(502343..503332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0436"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76606"
FT                   /db_xref="GOA:A5VXJ6"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXJ6"
FT                   /protein_id="ABQ76606.1"
FT                   /translation="MKPLRFAVTPGEPAGIGPDLCLLLAADAQPHPLIAITSPDLLAER
FT                   ATQLGLAVSLLPVAPGQWPDLPAPAGSLYVWDTPLAAPVVPGQLDKANAAFVLETLTRA
FT                   GQGCLDGHFAGMITAPVHKGVINESGIAFSGHTEFLAELTRTAQVVMMLATRGLRVALV
FT                   TTHLPLRDVADAITAERVERVTRILHADMRDKFGIANPRILVCGLNPHAGEGGHLGREE
FT                   IDIIEPTLARLRTEGMDLRGPLPADTLFTPKYLEHCDAVLAMYHDQGLPVLKYKGFGAA
FT                   VNVTLGLPIIRTSVDHGTALDLAGTGKVDTGSLRVALETAYQMAENRP"
FT   gene            complement(503329..504648)
FT                   /locus_tag="Pput_0437"
FT   CDS_pept        complement(503329..504648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0437"
FT                   /product="SurA N-terminal domain protein"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76607"
FT                   /db_xref="GOA:A5VXJ7"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXJ7"
FT                   /protein_id="ABQ76607.1"
FT                   /translation="MKTKLIDRLRPVLLGVALLSGAVHAAVQPLDRVVAIVDNDVVMQS
FT                   QLDQRVHEVQQTIAKRGGGVPPTSALEQQVLERLIVENLQLQIGERSGIRITDEELNQA
FT                   IGTIAQRNGMSLDQFRAALARDGLSFDDAREQVKREMIISRVRQRRVAERIQVSEQEVK
FT                   NFLASDLGKMQMSEEYRLANILIPTPEAANSDDIQKAARKVGDVYQQLRQGADFGQMAI
FT                   ANSASENALEGGEMGWRKAGQLPPDFAKMLSSMPVGEITQPIRIPNGFIILKLEEKRGG
FT                   SENVLRDEVHVRHILIKPSEIRSEAATQQLAERLYDRIKNGEDFGELAKSFSEDPGSAL
FT                   NGGDLNWVDPNSLVPEFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDSTEQAREQ
FT                   QALSVLRNRKYDEELQTWLRQIRDEAYVEIKLPGADQAAQ"
FT   sig_peptide     complement(504571..504648)
FT                   /locus_tag="Pput_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(504629..507436)
FT                   /locus_tag="Pput_0438"
FT   CDS_pept        complement(504629..507436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0438"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: OstA family protein; Organic solvent tolerance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76608"
FT                   /db_xref="GOA:A5VXJ8"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXJ8"
FT                   /protein_id="ABQ76608.1"
FT                   /translation="MALKSPAFRRKFPLLVTGGLLALQPLATSYVVAAEQFDCQVSAAG
FT                   GWDCKPKTPVNNLPPRPVHEGAAVSSGTEAAGEAETADRPVLVTEAKGRGLKSRSEDYS
FT                   HLDWVPREKLTAAQLAETGPYCGGAYIEPTRPGMADTTPKDESPTYINAKVSKYQQEQQ
FT                   VATLAGDVVMRQGSMQAEADEANLYQAENRGELKGNVKIRDNGSLVVGDEAQIQLDTGE
FT                   AQVDNAEYVMHKSHIRGSALYAKRGENAIIRLKDGTYTTCEPGSNAWQLKGNNITLNPA
FT                   TGFGTATNVTLRVKDFPVFYTPYIYFPIDDRRQSGFLPPSFSTSSDTGFMLVTPYYFNL
FT                   APNYDATLYPRYMAKRGLLMEGEFRYLTPSSEGQFGGAYLNDKNDDRKDQTDYKDQRWM
FT                   VNWQHKGGLDERLMTEVDYTDISDPFYFQDLESDQIGVESRDFLNQQGALTYRGDSYTA
FT                   RLNVHAYEAATISQITPYDRLPQITLNGVLPYQPGGLNFAYETEAARFERDLKNDTVFD
FT                   KDGNLDLTAGPDGRRLDENIQGIERANGTRLNVAPSISYPMTASYGFLTPKLKYAYTQY
FT                   DLDLDSKGKADAIALQTANPDAYGSYDSSVSRDVPIFSVDSGLYFDRNTSLFGNNYRQT
FT                   LEPRMFYLYVPYKDQKDIPLFDTGETLFSYDSLFRDNRFSGTDRIGDENKLSLGVTTRW
FT                   IEDNGFERQNFSIGQAYYFKDRKVQLPGIDYRTRKDAQSDVSPYALVYNYYFNRDWRFN
FT                   SDFNWDPDSRSTRSGSAMFHYQPEDNPNKIVNLGYRYRNDTIAYDSTTGTWKVGGGDYG
FT                   TPGDPNYIKDYYKIQQHDFSVIWPIVPQWNVIARWQHDYNRNRTLEAMGGFEYDNCCWK
FT                   LRLINRYWIDYDDFSQALPQNEKGDHGVFLQIVLKGLGGVVGNKVESFLDQGIQGYRER
FT                   EDQAY"
FT   sig_peptide     complement(507335..507436)
FT                   /locus_tag="Pput_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.968 at
FT                   residue 34"
FT   gene            507567..508586
FT                   /locus_tag="Pput_0439"
FT   CDS_pept        507567..508586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0439"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76609"
FT                   /db_xref="GOA:A5VXJ9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXJ9"
FT                   /protein_id="ABQ76609.1"
FT                   /translation="MPEHDVRLQQLTVWLDEQLNDLFRDNAWGEVPAGSLTAASSDASF
FT                   RRYFRWQGAGHSFVIMDAPPPQENCRPFVAIDHLLASADVHVPLIHAQDLERGFLLLGD
FT                   LGTQTYLDIINADNADGLFADAIDALLKFQRLPMDAPLPSYDDALLRREVELFPEWYVG
FT                   RELGLTFTDAQKATWQRVSQLLIDSALAQPKVLVHRDYMPRNLMQSTPNPGVLDFQDAV
FT                   YGPVTYDITCLFKDAFVSWPQARVEGWLSDYWQRAQAAGIPVHAEFEAFHRASDLMGVQ
FT                   RHLKVIGIFARICHRDGKPRYLGDVPRFFAYINEVIGRRPELAELGELIAELQAGARA"
FT   gene            508583..509254
FT                   /locus_tag="Pput_0440"
FT   CDS_pept        508583..509254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0440"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76610"
FT                   /db_xref="GOA:A5VXK0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXK0"
FT                   /protein_id="ABQ76610.1"
FT                   /translation="MKAMILAAGKGERMRPLTLHTPKPLVPVAGQPLIEYHLRALAAAG
FT                   VTEVVINHAWLGQQIEDHLGEGSRFGLSIRYSPEGEPLETGGGIFKALPLLGDAPFLLV
FT                   NGDVWTDYDFARLQAPLQGLAHLVLVDNPGHHGRGDFRLMGEQVVDGDDAPGTLTFSGI
FT                   SVLHPALFEGCQAGAFKLAPLLRQAMAAGKVSGEHYRGHWVDVGTLERLAEAESLIGER
FT                   A"
FT   gene            509256..510023
FT                   /locus_tag="Pput_0441"
FT   CDS_pept        509256..510023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0441"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76611"
FT                   /db_xref="GOA:A5VXK1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXK1"
FT                   /protein_id="ABQ76611.1"
FT                   /translation="MWWPGTVIGVSAGFAVASIPGALLGALLGQAIDRRLRLQGWEDMR
FT                   ERLGGRPALRDDELLFVMLGRLAKCDGRVAEQHIQQARQEMVRLDLAEAARLRAINAFN
FT                   RGKAGKDRLGGHLRRISQQPHAAEGTLRACWRMVWADGKMGNKERELLLDWGQKLGMSR
FT                   RQVQAMSLEYEPRKATGAESVPMTYAAALRLLAVDADTDTDKVKQAYRRLVSRHHPDKL
FT                   AGTGASEAQVREATARTRELHQAYAMIRKRRGL"
FT   sig_peptide     509256..509333
FT                   /locus_tag="Pput_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.855) with cleavage site probability 0.632 at
FT                   residue 26"
FT   gene            complement(510051..511049)
FT                   /locus_tag="Pput_0442"
FT   CDS_pept        complement(510051..511049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76612"
FT                   /db_xref="InterPro:IPR022529"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXK2"
FT                   /protein_id="ABQ76612.1"
FT                   /translation="MSTLYRTTLAMCCLASVLPLGALAADAEKPPANTMAPAAEAPRPP
FT                   LLERSQEDALALERLLPKAEQQTLQAGTDSFLALWKPANDNDPQGAVIIVPGAGETADW
FT                   PNAVGPLRQKFPDIGWHSLSISLPDLLADSPQARVEATPPAAPAPEKGESAPVKDVPAD
FT                   ANANVAQATAADADTAESTDAEQASEQADPADAERIFARLDAAVAFAQQHNARSIVLIG
FT                   HGSGAYWAARYLSEKQPPQVQKLVMVAAQTPARVEQDLESLAPTLKVPTADIYYATRSA
FT                   DRNAAQQRLQASKRQKDSQYRQLSLIAMPANKAAEQEQLFRRVRGWMSPQG"
FT   sig_peptide     complement(510975..511049)
FT                   /locus_tag="Pput_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 25"
FT   gene            511145..513532
FT                   /locus_tag="Pput_0443"
FT   CDS_pept        511145..513532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0443"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, dimerisation and phosphoacceptor region; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein; extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76613"
FT                   /db_xref="GOA:A5VXK3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXK3"
FT                   /protein_id="ABQ76613.1"
FT                   /translation="MKRVRRLLVIGCLWLPLIAWAKPEALPSVVLEPDQQQWLDTHRSL
FT                   RVGLVLQAPYAQFDRRLQQLYGANVELVNSLAQALRLDLTWRNFSDQASLEHALQSGEI
FT                   DFAPGLTQTPASLRLWLFSDPYMRVPQLVVGPRTGAMAVELEKLEAEQRVAVRMPSPLA
FT                   DYLRGNYGNLNLQGVPDDREALQLVVGGQASFAVLDEAQLSRLSRESEFGELAVVGDIG
FT                   LPQLLRIGSRRDWPLLADVLERGLQAVPAKELEQLHQRWLQPKYPRLSESPGFWQNMAL
FT                   LFGLLLLCALATLVWQRRQQRQLERSLLAARESLVERQVREEALRLSQFAIDQSTVGIL
FT                   WVNWDSHVRYANHAAERMLGYSEGALLERPLSDFEPSLNMDRWLELWKGARTGAGGVGQ
FT                   FETQCRRADQSLLPVELSLSFLRFRDSEYLVVYLADVTERHRALAALRESEARLKGIAG
FT                   NVPGLVFRLERDPAEGDLEFPYISEGSEALVGYAPSEIQHPQMGLRNLVHPEDRADYHR
FT                   VQDLALASDQDWSWQGRILTRQGEQRWADIKASARHLGNGQVVWDGVVWDITQGKRAEL
FT                   ALAKSQEQLRELSAHLESVREEEKARIAREVHDELGQMLTVLKLEVSMCELAYAELDPG
FT                   LNDRLASMKRLIAQLFQLVRDVATALRPPILDAGIASAIEWQARRFEARTQIPCLVQVP
FT                   DNLPALSDAKATGLFRILQEALTNVMRHAQAHSVEIELVREGGQLRMTVSDDGQGFCRE
FT                   QTRPTSFGLVGVRERVLMLGGSMTLESEPGEGTSLSVAIPLE"
FT   sig_peptide     511145..511210
FT                   /locus_tag="Pput_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            513543..514172
FT                   /locus_tag="Pput_0444"
FT   CDS_pept        513543..514172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0444"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76614"
FT                   /db_xref="GOA:A5VXK4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXK4"
FT                   /protein_id="ABQ76614.1"
FT                   /translation="MIRVLVAEDHTIVREGIKQLIGLAKDMQVAGEAGNGEQLLETLRH
FT                   TPCEVVLLDISMPGVNGLEAIPRIRALHDAPAILMLSMHDEAQMAARALKAGAAGYATK
FT                   DSDPALLLTAIRRVAGGGRYIDPSLADRMVFEVGLTESRPLHTLLSEREFSVFERLAQG
FT                   ANVNDIAQQLALSSKTISTHKARLMQKLKVNSLAELVKYAMEHKLV"
FT   gene            514468..515592
FT                   /locus_tag="Pput_0445"
FT   CDS_pept        514468..515592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0445"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76615"
FT                   /db_xref="GOA:A5VXK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXK5"
FT                   /protein_id="ABQ76615.1"
FT                   /translation="MSEAKSNAATGETLVSFRGVQKSYDGESLIVKDLNLDIRKGEFLT
FT                   LLGPSGSGKTTSLMMLAGFETPTAGEIQLGGRSINNVPPHKRDIGMVFQNYALFPHMTV
FT                   AENLAFPLTVRNLSKTDISERVKRVLNMVQLDAFAKRYPGQLSGGQQQRVALARALVFE
FT                   PQLVLMDEPLGALDKQLREHMQMEIKHIHQRLGVTVVYVTHDQGEALTMSDRVAVFHQG
FT                   EIQQIADPRTLYEEPCNTFVANFIGENNRISGTLLASDGKRCQVQLPRGERVEALAVNV
FT                   GQAGEPVTLSIRPERVRLNGHSESCVNRFSGRVAEFIYLGDHVRVRLEVCGKGDFFVKQ
FT                   PIAELDPALAVGDVVPLGWEVEHARALDPIAEAH"
FT   gene            515633..516667
FT                   /locus_tag="Pput_0446"
FT   CDS_pept        515633..516667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0446"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76616"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXK6"
FT                   /protein_id="ABQ76616.1"
FT                   /translation="MRKQLKLTALALGLFTAGQAMAADLTVISFGGANKAAQVKAFYEP
FT                   WEKAGNGKIVAGEYNGEMAKVKAMVDTKSVSWNLVEVESPELARGCDEGMFEELDPALF
FT                   GNEADYVPGAIQPCGVGFFVWSTVMAYNADKLKTAPTSWADFWDTKQFPGKRGLRKGAK
FT                   YTMEFALMADGVAPKDVYKVLATKEGQDRAFKKLDELKPSIQWWEAGAQPPQFLASGDV
FT                   VMSSAYNGRIAAVQKESNLKVVWNGGIYDFDAWAIPKGAKNVEEAKKFIAYSVKPEQQK
FT                   IYSENIAYGPANSKAVSLLSDDVKKDMPTTPENIANQVQIDVAFWADNSEQLEQRFNAW
FT                   AAKK"
FT   sig_peptide     515633..515701
FT                   /locus_tag="Pput_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            516728..517975
FT                   /locus_tag="Pput_0447"
FT   CDS_pept        516728..517975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0447"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76617"
FT                   /db_xref="GOA:A5VXK7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXK7"
FT                   /protein_id="ABQ76617.1"
FT                   /translation="MAIAVPLNEGAGSSLKQRLKHAERVNRWKAQALIAPLALFLLLVF
FT                   LVPIAALLYKSVGNPEVVGGLPRTVEVISQWDGKSLPGEDVYKALSQDLAESRKNQTLG
FT                   DLSKRLNMELAGYRSLLTKTARALPFKAEPASYKDALQAVDERWGDPAYWQAIRRNTSS
FT                   VTSFYLLASVDHRIDDLGELAKATPDQAIYLDIFVRTLWMGVVITTICLVLAYPLAYLL
FT                   ANLPTRQSNLLMILVLLPFWTSILVRVAAWIVLLQSGGLINSALMAMGIIDQPLELVFN
FT                   RTGVYISMVHILLPFMILPLYSVMKGISPSYMRAAISLGCHPFASFWRVYFPQTYAGVG
FT                   AGCLLVFILAIGYYITPALLGSPNDQMVSYFVAFYTNTSINWGMATALGGLLLLATVLL
FT                   YLIYSWLVGASRLRLS"
FT   gene            517986..518813
FT                   /locus_tag="Pput_0448"
FT   CDS_pept        517986..518813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0448"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76618"
FT                   /db_xref="GOA:A5VXK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXK8"
FT                   /protein_id="ABQ76618.1"
FT                   /translation="MLSPYMSPVERVWFYSLRILCGLILLFLILPVLVIVPLSFNSGSF
FT                   LVYPLQGFSLQWYHDFFGSAEWMRALKNSIIVAPAATVLAMVFGTLAAIGLTRGDFPGK
FT                   SLVMALVISPMVVPVVIIGVASYLFFAPLGMGNSFTSLILVHAVLGVPFVIITVSATLQ
FT                   GFNYNLVRAAASLGASPLLAFRRVTLPLIAPGVISGALFAFATSFDEVVVTLFLAGPEQ
FT                   ATLPRQMFSGIRENLSPTIAAAATLLIAFSVLLLLTLEWLRGRSEKLRTQQPA"
FT   gene            518963..519637
FT                   /locus_tag="Pput_0449"
FT   CDS_pept        518963..519637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0449"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76619"
FT                   /db_xref="GOA:A5VXK9"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXK9"
FT                   /protein_id="ABQ76619.1"
FT                   /translation="MQPYAIAPSILSADFARLGEDVDKVLAAGADIVHFDVMDNHYVPN
FT                   LTIGPMVCTALRKYGVTAPIDVHLMVSPVDRIIGDFIEAGATYITFHPEATQHIDRSLQ
FT                   LIKDGGCKAGLVFNPATSLDALKYVMDKIDMVLLMSVNPGFGGQKFIPGTLDKLREARA
FT                   LIDASGRDIRLEIDGGVNVNNIREIAAAGADTFVAGSAIFNAPDYQEVIAKMRAELALA
FT                   RP"
FT   gene            519634..520452
FT                   /locus_tag="Pput_0450"
FT   CDS_pept        519634..520452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0450"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76620"
FT                   /db_xref="GOA:A5VXL0"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXL0"
FT                   /protein_id="ABQ76620.1"
FT                   /translation="MSGFEQLFPGELPRLVMFDLDGTLIDSVPDLAAAVDRMLLELGRP
FT                   PAGLEAVRHWVGNGAQVLVRRALAGGIDHADVDDALAEQALALFMDAYAESHELTVVYP
FT                   GVRDTLRWLRKQGVEMALITNKPERFVGPLLDQMKIGNFFRWIIGGDTLPQKKPDPAAL
FT                   LFVMQMAGVTPQQSLFVGDSRSDVQAAKAAGVQCVGLTYGYNHGRPIDDESPSLVIDDL
FT                   RALLPGCADPATGITLADLQASQDRESTVAVTGKFWMKVIKALARWRWRA"
FT   gene            520522..522003
FT                   /locus_tag="Pput_0451"
FT   CDS_pept        520522..522003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0451"
FT                   /product="anthranilate synthase, component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I and chorismate binding
FT                   protein; Anthranilate synthase component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76621"
FT                   /db_xref="GOA:A5VXL1"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXL1"
FT                   /protein_id="ABQ76621.1"
FT                   /translation="MNREEFLRLAAAGYNRIPLACETLADFDTPLSIYLKLADQPNSYL
FT                   LESVQGGEKWGRYSMIGLPSRTVMRVHGYHVSILHDGVEVESCEVEDPLAFVETFKDRY
FT                   KVADIPGLPRFNGGLVGYFGYDCVRYVEKRLGASPNPDPLGVPDILLMVSDAVVVFDNL
FT                   AGKMHAIVLVDPAEDQAFEQGQARLQGLLETLRQPITPRRGLDLSGPPAAEPAFRSSYT
FT                   REDYENAVGRIKEYILAGDCMQVVPSQRMSIDFKAAPIDLYRALRCFNPTPYMYFFNFG
FT                   DFHVVGSSPEVLVRVEDNLVTVRPIAGTRPRGATEEADRALEDDLLSDDKEIAEHLMLI
FT                   DLGRNDVGRVSSTGSVRLTEKMVIERYSNVMHIVSNVTGQLREGLTAMDALRAILPAGT
FT                   LSGAPKIRAMEIIDELEPVKRGVYGGAVGYFAWNGNMDTAIAIRTAVIKDGELHVQAGG
FT                   GIVADSVPALEWEETINKRRAMFRAVALAEQTSAR"
FT   gene            complement(522250..524139)
FT                   /locus_tag="Pput_0452"
FT   CDS_pept        complement(522250..524139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0452"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain; PFAM: lipolytic enzyme, G-D-S-L family;
FT                   Autotransporter beta- domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76622"
FT                   /db_xref="GOA:A5VXL2"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR017186"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXL2"
FT                   /protein_id="ABQ76622.1"
FT                   /translation="MRKAPLLRFTLASLALACSQALAGPSPYSTLIVFGDSLADAGQFP
FT                   DLSGGTPGARFTNRDADGNFAPVSPMILGGRLGVAPGDLNPSTSIGIQPDGNNWAVGGY
FT                   TTQQILDSITTTSETVIPPGNPNAGLVLRERPGYLANGLRADPNALYYLTGGGNDFLQG
FT                   LVNSPADAVAAGARLAASAQALQQGGARYIMVWLLPDLGQTPNFSGTPQQNPLSLLSAA
FT                   FNQSLISQLGQIDAQIIPLNIPVLLSEALSSPSQFGLASDQNLVGTCYSGDSCVENPVY
FT                   GINGTTPNPTKLLFNDSVHPTIAGQQLIADYAYSILAAPWELTLLPEMAHASLRAHQDE
FT                   LRNQWQTPWQAVGQWQAFVASGAQDLDFDGQRSAASGDGRGYNLTVGGSYRLNDAWRLG
FT                   LAGGAYRQKLEAGEQDSDYKLNSYMASAFAQYRQDRWWADAALTAGHLDYSDLKRTFAL
FT                   GVNDRSEKGDTDGEAWAMSGRLGYNLAADTSNWQLAPFISADYARVKVDGYEEKSGRST
FT                   ALGFDDQERTSRRLGVGLLGSVQVQPNTRLFAEVAQEHEFEDDQQDVTMHLTSLPANDF
FT                   TLTGYTPHSDLTRASLGVSHELVAGVHLRGNYNWRKSDELTQQGVSVGVSVDF"
FT   sig_peptide     complement(524068..524139)
FT                   /locus_tag="Pput_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            524507..525100
FT                   /locus_tag="Pput_0453"
FT   CDS_pept        524507..525100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0453"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76623"
FT                   /db_xref="GOA:A5VXL3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXL3"
FT                   /protein_id="ABQ76623.1"
FT                   /translation="MLLMIDNYDSFTYNVVQYLGELGAEVKVIRNDELTIAQIEALNPE
FT                   RIVVSPGPCTPSEAGVSIEAILHFAGKLPILGVCLGHQSIGQAFGGDVVRARQVMHGKT
FT                   SPVYHRDLGVFASLNNPLTVTRYHSLVVKRETLPDCLEVTAWTSHADGSVDEIMGLRHK
FT                   TLNIEGVQFHPESILTEQGHELFANFLKQTGGRR"
FT   gene            525110..526159
FT                   /locus_tag="Pput_0454"
FT   CDS_pept        525110..526159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0454"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76624"
FT                   /db_xref="GOA:A5VXL4"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXL4"
FT                   /protein_id="ABQ76624.1"
FT                   /translation="MDIKNALSRIVGQLDLTTEEMREVMRQIMTGQCSEAQIGAFLMGM
FT                   RMKSESIDEIVGAVSVMRELAEKVELQSLDGVVDIVGTGGDGANIFNVSTASSFVLAAA
FT                   GCPVAKHGNRAVSGKSGSADLLEAAGIYLNLTPTQVARCIDSLGIGFMFAQSHHSAMKH
FT                   AAGPRRELGLRTLFNMLGPLTNPAGVKHQVVGVFAQTLCRPLAEVLQRLGSKHVLVVHS
FT                   KDGLDEFSLAAPTFVAELKNGEITEYWVEPEDLGMKSQSLHGLAVESPQASLELIRDAL
FT                   GRRKTENGQKAAEMIVLNAGAALYAADHAMSLKAGVELAHDVLHTGLAWEKLQELGAFT
FT                   AVFKVENEA"
FT   gene            526156..526989
FT                   /locus_tag="Pput_0455"
FT   CDS_pept        526156..526989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0455"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76625"
FT                   /db_xref="GOA:A5VXL5"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXL5"
FT                   /protein_id="ABQ76625.1"
FT                   /translation="MSVPTVLERIIARKFQEVAERSARVSLAELEGLAKAADAPRGFAN
FT                   ALIEQAKRKQPAVIAEIKKASPSKGVIREHFVPAEIAVSYEKGGATCLSVLTDVDYFQG
FT                   ADEYLQQARAAVSLPVIRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAATAK
FT                   DVGLDVLVEVHDGDELERALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRDRLAI
FT                   TESGILNRADVELMAINEVYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQQLD"
FT   gene            527136..527840
FT                   /locus_tag="Pput_0456"
FT   CDS_pept        527136..527840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0456"
FT                   /product="Lipoate-protein ligase A-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76626"
FT                   /db_xref="GOA:A5VXL6"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXL6"
FT                   /protein_id="ABQ76626.1"
FT                   /translation="MTDQPLALSVEQGLHAEQELLAAVCRGERENGVLFWRPTDHALVM
FT                   PRRMSRLGNFEVACAELAIAGWPVLLRETGGEPVPQSHSTVNVALVYAAPRSEGDHGRI
FT                   ENAYERLCLPLCDVLREWGGVASVGEIDGAFCDGRYNVNLNGRKLVGTAQRWRQGLGGK
FT                   RPVVLVHGALLLDNERESMVAAVNRFNECCELEQRCRADAHIALHEVAPAAPWFERLSQ
FT                   AYAKVLAELPKD"
FT   gene            complement(527837..528508)
FT                   /locus_tag="Pput_0457"
FT   CDS_pept        complement(527837..528508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0457"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein,
FT                   Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76627"
FT                   /db_xref="GOA:A5VXL7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXL7"
FT                   /protein_id="ABQ76627.1"
FT                   /translation="MPRIEQDFVMVASALPAKIKNIDKLLVHCQRRRYTAKSNIICAGD
FT                   RAETLSFIIKGSVTIIIEDDDGHEMIIAYLNHGDFFGELGLFEPVDGEQQRSAWVRAKT
FT                   ECEVAEISYEKFRELARQDPEILYALGSQMAQRLRNTTRKVGDLAFFDVTGRVARCLLE
FT                   LCKQPDAMTHPDGMQIKITRQEIGRIVGCSREMVGRVLKDLEERSLVQVKGKTMVVYGT
FT                   R"
FT   gene            528673..529095
FT                   /locus_tag="Pput_0458"
FT   CDS_pept        528673..529095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0458"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76628"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXL8"
FT                   /protein_id="ABQ76628.1"
FT                   /translation="MKARIQWAGEAMFLGESGSGHVVVMDGPPEAGGRNLGVRPMEMLL
FT                   LGLGGCSSFDVVSILKKSRQAVESCEAFLEAERASEDPKVFTKIHMNFVVKGRGLKEAQ
FT                   VKRAVELSAEKYCSASIMLERAGVEITHGYEIVELG"
FT   gene            complement(529172..530212)
FT                   /locus_tag="Pput_0459"
FT   CDS_pept        complement(529172..530212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76629"
FT                   /db_xref="GOA:A5VXL9"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXL9"
FT                   /protein_id="ABQ76629.1"
FT                   /translation="MTDRFDAKDLARAVQAGILQPGQDQSLVAFLRQQPAPRGSFQLAH
FT                   VAFYFGAMLIMAALGWLLTEAWMSLGDGALLIIASLYILLTTLFALNLQRRAQPVAAGV
FT                   LAAVAVSIVPLAVFAIERMLGWWPLDDAQADYHQYYTYVQGGWLAMEAATVLAGLLMLR
FT                   LIPYPFVVMPMAVALWFMSMDLSEWFFGSPFSWEQRRHVSLWFGLGLLVVILVIDGRTR
FT                   EDYARWGYLAGLAAFWGGLTLLDSGSELGKAIYCLINIALMGMAVLLRRPVFMVFGALG
FT                   VAAYLGYLSYEVFAQSLLFPVVLTMIGVGVIWLGLVYQKRRERLSQALRSSLPQWLRMA
FT                   LPALRD"
FT   gene            complement(530223..530870)
FT                   /locus_tag="Pput_0460"
FT   CDS_pept        complement(530223..530870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0460"
FT                   /product="Ubiquinone biosynthesis protein COQ7-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76630"
FT                   /db_xref="GOA:A5VXM0"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXM0"
FT                   /protein_id="ABQ76630.1"
FT                   /translation="MATERHYSPLDRLLLQADTAMRTLLPFSGQPARPSPAIVQPDVDL
FT                   DEQQARHIAGLMRINHTGEVCAQALYQGQALTAKLPEVRKAMEHAAEEEVDHLAWCEQR
FT                   IRQLNSHPSVLNPLFYGMSFGIGALAGLVSDKVSLGFVAATEHQVCKHLDEHLEQLPHE
FT                   DEKSRAILEQMRIDEEQHAESALEAGGYRFPAPVRFGMSLLAKVMTKSTYRI"
FT   gene            complement(530936..531274)
FT                   /locus_tag="Pput_0461"
FT   CDS_pept        complement(530936..531274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0461"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76631"
FT                   /db_xref="GOA:A5VXM1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXM1"
FT                   /protein_id="ABQ76631.1"
FT                   /translation="MDDLFLKIINREIPADIIYEDDQILAFKDIAPAAPVHFLVIPKKH
FT                   IRTLNDLTEEDKALAGHILFTAQRLAVEQGCEEGFRVVMNCNPKGGQTVYHIHMHVLGQ
FT                   RQMNWPPG"
FT   gene            complement(531338..532120)
FT                   /locus_tag="Pput_0462"
FT   CDS_pept        complement(531338..532120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0462"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76632"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXM2"
FT                   /protein_id="ABQ76632.1"
FT                   /translation="MTRYAMITGASSGLGLALAEALARRGRNLILVARQRETLEPVAIE
FT                   LTQRFGVEVLFRACDLSQPLRLSGFVLELEEGERRIDLLVNCAGLRTYGPFLAHEWADE
FT                   QDLLEVNVLALSRLCHAIGNLMAVQGGGQILNVAGLAGVAPGPWMAAYAASKAYVLSFS
FT                   QALREELKRTGIKVSVLCPGPVRSARRRIARLDGKPRCLSPEEVALYTVRALDKNRALI
FT                   MPGRRNRWLAFAPRLLPRWLVRKLAGAIHRRYCPLGME"
FT   sig_peptide     complement(532061..532120)
FT                   /locus_tag="Pput_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.976 at
FT                   residue 20"
FT   gene            complement(532188..533144)
FT                   /locus_tag="Pput_0463"
FT   CDS_pept        complement(532188..533144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0463"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76633"
FT                   /db_xref="GOA:A5VXM3"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXM3"
FT                   /protein_id="ABQ76633.1"
FT                   /translation="MSLPASLEQRLRLPVVAAPMFLISNPQLVLACCASGVVGSFPALN
FT                   QRDSAGFKAWLEEIEAGLAQLQAPAPYAVNLIVHPTNPRLQADLALCVAHRVPIVITSL
FT                   GAVKEVVDAVHGYGGLVLHDVTTRRHAEKAAEAGVDGLIAVAAGAGGHAGTWSPFALAA
FT                   EIRQFFDKTLLLAGCINHGHEILAAQLLGADLAYMGTRFIATTESQAQGAYKQMLLDAH
FT                   AADIIHTPVVSGIPASFLRQSLEQAGYDMNALKGGQVQGKLKPIDDEAKAWKTVWSAGQ
FT                   GVGAIHDLPSASALIERLHGEYRQALERCQVLRARAL"
FT   gene            complement(533173..533598)
FT                   /locus_tag="Pput_0464"
FT   CDS_pept        complement(533173..533598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0464"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76634"
FT                   /db_xref="GOA:A5VXM4"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXM4"
FT                   /protein_id="ABQ76634.1"
FT                   /translation="MLYLWIKALHIVSVVCWFAGLFYLPRLFVYHAQSQDSISQERFAT
FT                   MERKLYRGIMNPAMIATYVFGAWMLYLTPGWLSQGWLHAKLTLVILLTGYHHVCGAQRK
FT                   RFANGTNTRSHVYYRWFNEVPVLILLGIVILVVVKPF"
FT   gene            533741..534775
FT                   /locus_tag="Pput_0465"
FT   CDS_pept        533741..534775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0465"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase, NAD - binding;
FT                   oxidoreductase domain protein; Semialdehyde dehydrogenase,
FT                   dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76635"
FT                   /db_xref="GOA:A5VXM5"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXM5"
FT                   /protein_id="ABQ76635.1"
FT                   /translation="MIKVGIVGGTGYTGVELLRLLAQHPQAEVAVITSRSEAGVAVADM
FT                   YPNLRGHYDGLAFSVPDSKALGACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRL
FT                   QDAVEWGKWYGQPHGAPELLKDAVYGLPEVNREKIRQARLIAVPGCYPTATQLGFLPLL
FT                   EAGLADASRLIADCKSGVSGAGRGAAVGSLFCEAGESMKAYAVKGHRHLPEISQGLRLA
FT                   AGKDIGLTFVPHLTPMIRGIHATLYANVVDTSVDLQALFEKRYADEPFVDVMPAGSHPE
FT                   TRSVRGANVCRIAVHRPQGGDLVVVLSVIDNLVKGASGQAVQNLNILFGLDERMGLSHA
FT                   GLLP"
FT   gene            534875..535273
FT                   /locus_tag="Pput_0466"
FT   CDS_pept        534875..535273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0466"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76636"
FT                   /db_xref="GOA:A5VXM6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXM6"
FT                   /protein_id="ABQ76636.1"
FT                   /translation="MRVIEFYGGYRAGRINMSVETFTPTGLEFTHGAAQKVKNLVNEEG
FT                   NERLKLRVFVTGGGCSGFQYGFTFDEDVAEDDTIVEREGVSLVVDPMSFQYLAGAEVDY
FT                   QEGLEGSRFVIKNPNAATTCGCGSSFSI"
FT   gene            complement(535333..536424)
FT                   /locus_tag="Pput_0467"
FT   CDS_pept        complement(535333..536424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0467"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76637"
FT                   /db_xref="GOA:A5VXM7"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXM7"
FT                   /protein_id="ABQ76637.1"
FT                   /translation="MALYLGVMSGTSLDGLDIALIEQGEQLELLATHYLPMPPDLRKDL
FT                   LALCSSGTDEIARAALAENRWASLAGEGIRQLLARQGLKPEAIRAIGSHGQTIRHEPSR
FT                   GFTVQIGNPALLAELTGISVVADFRRRDVAAGGQGAPLVPAFHETLFSQLGRRLAILNV
FT                   GGFSNLSLIEQDKPVHGFDCGPGNVLLDAWIEREHGHAYDADGAWAASGVVQPGLLSAL
FT                   MADPFFAGSGPKSTGREVFNLPWLDRHLANLPAYRAQDVQATLLELTARSIIDSLGKAQ
FT                   QGTEALLVCGGGARNGALMARLGQLLPAARVASTGAYGVDPDWVEAMAFAWLAHCCLEG
FT                   IAANRPSVTAAKGLRVLGAIYPA"
FT   gene            complement(536428..537849)
FT                   /locus_tag="Pput_0468"
FT   CDS_pept        complement(536428..537849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0468"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; Opacity-associated protein A;
FT                   Opacity-associated protein A, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76638"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXM8"
FT                   /protein_id="ABQ76638.1"
FT                   /translation="MTNEPPKAPPLYPKSHLLAASGIAALLSLALLVFPSSEVEAKKTT
FT                   LNLELESPAEQLKDESRAAPLVQSEGEQGSPFAQIEEATPETQKADQQAPAAEPVAEAA
FT                   KEPGHREVTVARGDTLSTLFAKVGLPANAVHDLLASNKQAKQFSQLKHGQVLQFELDKD
FT                   GQLASLHSKVSNLETIRLTKTAKGYTFNREISKPVIRTAYAHGVIKSSLSASAQRAGLS
FT                   HSMTMDMARVLGYDIDFAQDIRPGDEFDVVYEQKVMDGKVVGTGNILSARFTNRGKTYT
FT                   AVRYTNKQGNTTYYTADGNSLRKAFIRTPVDFARISSRFSAGRKHPILNKIRAHKGVDY
FT                   AAPRGTPIKAAGDGRIELAGRRGGYGNTVIIQHGNRYKTLYGHMQGFAKGIKTGSTVKQ
FT                   GQIIGYIGTTGLSTGPHLHYEFQVNGVHVDPLSQKVPMADPIAKNERQRFLQQSQPLIA
FT                   RMDQEKATLLAANKR"
FT   sig_peptide     complement(537724..537849)
FT                   /locus_tag="Pput_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.468 at
FT                   residue 42"
FT   gene            538063..539262
FT                   /locus_tag="Pput_0469"
FT   CDS_pept        538063..539262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0469"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib; RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76639"
FT                   /db_xref="GOA:A5VXM9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXM9"
FT                   /protein_id="ABQ76639.1"
FT                   /translation="MKSVEEQLALIKRGAEEVLVESELVEKLKRGQPLRIKAGFDPTAP
FT                   DLHLGHTVLINKLRQFQDLGHQVIFLIGDFTGMIGDPSGKSATRPPLTREQVLENAETY
FT                   KQQVFKILDPAKTEVAFNSTWMDKLTPADFIRLASQYTVARMLERDDFDKRYTTNQPIA
FT                   IHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRELQRSYGQEAQNIVTMPLLEGLD
FT                   GVKKMSKSLGNYVGIQEAPGVMYSKLVSIPDTLMWRYFELLSFRSMEEIEQFRADVANG
FT                   ANPRDIKIKLAEEIVARFHGEEAAANAHRAAGNRMKEGELPEDLPEIEVAAAEDLPIAA
FT                   VLNRAGLVKNSAQARDLLSGGAVKVDGAVVDKDFMFVLGATHVCQAGKKSFGRVTLKAE
FT                   "
FT   gene            539844..541372
FT                   /locus_tag="Pput_R0009"
FT   rRNA            539844..541372
FT                   /locus_tag="Pput_R0009"
FT                   /product="16S ribosomal RNA"
FT   gene            541451..541527
FT                   /locus_tag="Pput_R0010"
FT                   /note="tRNA-Ile1"
FT   tRNA            541451..541527
FT                   /locus_tag="Pput_R0010"
FT                   /product="tRNA-Ile"
FT   gene            541534..541609
FT                   /locus_tag="Pput_R0011"
FT                   /note="tRNA-Ala1"
FT   tRNA            541534..541609
FT                   /locus_tag="Pput_R0011"
FT                   /product="tRNA-Ala"
FT   gene            541844..544737
FT                   /locus_tag="Pput_R0012"
FT   rRNA            541844..544737
FT                   /locus_tag="Pput_R0012"
FT                   /product="23S ribosomal RNA"
FT   gene            544881..544996
FT                   /locus_tag="Pput_R0013"
FT   rRNA            544881..544996
FT                   /locus_tag="Pput_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            545178..546137
FT                   /locus_tag="Pput_0470"
FT   CDS_pept        545178..546137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0470"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin/lipoate A/B protein ligase; Helix-turn-helix,
FT                   type 11 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76640"
FT                   /db_xref="GOA:A5VXN0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXN0"
FT                   /protein_id="ABQ76640.1"
FT                   /translation="MLKLLNLLKDGRFHSGEALGAALGVSRSAVWKQLQHLESELNLTI
FT                   HKVRGRGYQLAAPLALLEAQAIAEFAVGEQWPVFIHETIDSTNAEGLRLASEGQAAPFL
FT                   VLAERQSAGRGRRGRQWVSPFAENLYYSLVLRVDGGMRQLEGLSLVVGLAVMRTLQAFG
FT                   VKDVGLKWPNDVLVRGQKITGILLELVGDPADVCHVVLGIGINVNMQVNEQVDQQWTSM
FT                   RREVGAAIDRNHLVALLSQQLQHELARHRRYGFAAFQEEWEQAHLWQGRNVSLVAGSTR
FT                   IDGVVLGVDGQGGLRLEVDGMEKSFSGGELSLRLRDDS"
FT   gene            546127..546876
FT                   /locus_tag="Pput_0471"
FT   CDS_pept        546127..546876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0471"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76641"
FT                   /db_xref="GOA:A5VXN1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXN1"
FT                   /protein_id="ABQ76641.1"
FT                   /translation="MILELDCGNSFIKWRVIHVADAVIEGGGIVDSDQALVAEVAALAS
FT                   VRLTGCRIVSVRSEEETDALCALIAQAFAVQARVAHPVREMAGVRNGYDDYQRLGMDRW
FT                   LAALGAFHLAKGACLVIDLGTAAKADFVSADGEHLGGYICPGMPLMRSQLRTHTRRIRY
FT                   DDASAERALNSLSPGRSTVEAVERGCVLMLQGFAYTQLEQARVLWGEEFTVFLTGGDAP
FT                   LVREALPQARVVPDLVFVGLAMACPLD"
FT   gene            546884..547309
FT                   /locus_tag="Pput_0472"
FT   CDS_pept        546884..547309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76642"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXN2"
FT                   /protein_id="ABQ76642.1"
FT                   /translation="MRWLFLLLLVLNVFYYVWHQQEAPLKVKEVAPLSLYKGNQQEIRL
FT                   LRETGVSAPPKRRDECLVVGGVKGQEQLDALRQRLLSLDIATSPVAGQLPGADGRWLKV
FT                   SPESERLLDQTVLLALSNDFKDLKHKIIFCQGIATGE"
FT   gene            547462..547545
FT                   /locus_tag="Pput_R0014"
FT                   /note="tRNA-Tyr1"
FT   tRNA            547462..547545
FT                   /locus_tag="Pput_R0014"
FT                   /product="tRNA-Tyr"
FT   gene            547570..547643
FT                   /locus_tag="Pput_R0015"
FT                   /note="tRNA-Gly1"
FT   tRNA            547570..547643
FT                   /locus_tag="Pput_R0015"
FT                   /product="tRNA-Gly"
FT   gene            547673..547748
FT                   /locus_tag="Pput_R0016"
FT                   /note="tRNA-Thr1"
FT   tRNA            547673..547748
FT                   /locus_tag="Pput_R0016"
FT                   /product="tRNA-Thr"
FT   gene            547827..549020
FT                   /locus_tag="Pput_0473"
FT   CDS_pept        547827..549020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0473"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76643"
FT                   /db_xref="GOA:A5VXN3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXN3"
FT                   /protein_id="ABQ76643.1"
FT                   /translation="MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAIV
FT                   EFDKIDSAPEEKARGITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDF
FT                   PGDDTPIIIGSARMALEGKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPIEDVF
FT                   SISGRGTVVTGRIERGIVRVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVL
FT                   LRGTKRDDVERGQVLVKPGSVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTD
FT                   VTGNCELPEGVEMVMPGDNIQMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            549075..549150
FT                   /locus_tag="Pput_R0017"
FT                   /note="tRNA-Trp1"
FT   tRNA            549075..549150
FT                   /locus_tag="Pput_R0017"
FT                   /product="tRNA-Trp"
FT   gene            549195..549563
FT                   /locus_tag="Pput_0474"
FT   CDS_pept        549195..549563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0474"
FT                   /product="protein translocase subunit secE/sec61 gamma"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76644"
FT                   /db_xref="GOA:A5VXN4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXN4"
FT                   /protein_id="ABQ76644.1"
FT                   /translation="MTPKTEAQESRFDLFKWLAVVALVVVGVVGNQYYSASPILYRVLV
FT                   LLVLAAVAGFVALQTAKGKSFFALAKEARTEIRKVVWPTRQETTQTTLIVVAVVLVMAL
FT                   LLWGLDSLLGWAVSLIVG"
FT   gene            549573..550106
FT                   /locus_tag="Pput_0475"
FT   CDS_pept        549573..550106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0475"
FT                   /product="transcription antitermination protein nusG"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: transcription antitermination protein
FT                   NusG; KOW domain protein; SMART: NGN domain protein; KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76645"
FT                   /db_xref="GOA:A5VXN5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXN5"
FT                   /protein_id="ABQ76645.1"
FT                   /translation="MAKRWYVVHAYSGYEKHVMRSLIERVKLAGMEDGFGEILVPTEEV
FT                   VEMRNGQKRKSERKFFPGYVLVQMEMNEGTWHLVKDTPRVMGFIGGTADKPAPITDKEA
FT                   EAILRRVADGSDKPKPKTLFEPGEVVRVIDGPFADFNGSVEEVNYEKSRLQVAVLIFGR
FT                   STPVELEFSQVEKV"
FT   gene            550226..550657
FT                   /locus_tag="Pput_0476"
FT   CDS_pept        550226..550657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0476"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76646"
FT                   /db_xref="GOA:A5VXN6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXN6"
FT                   /protein_id="ABQ76646.1"
FT                   /translation="MAKKIQAYIKLQVKAGQANPSPPVGPALGQHGVNIMEFCKAFNAR
FT                   TQGQEAGLPTPVIITVYSDRSFTFETKSTPASVLLKKAAGLTSGSARPNTVKVGTVTRA
FT                   QLEDIAKAKQADLTAADLDAAVRTIAGSARSMGLNVEGV"
FT   gene            550657..551352
FT                   /locus_tag="Pput_0477"
FT   CDS_pept        550657..551352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0477"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76647"
FT                   /db_xref="GOA:A5VXN7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXN7"
FT                   /protein_id="ABQ76647.1"
FT                   /translation="MAKLTKRQKAIAEKIEAGKAYNFEEAATLLASLPAAKFVESYDIA
FT                   VNLGVDPRKSDQVVRSATVLPHGTGKTVRVAVFTQGPAAEAALAAGADRVGMDDLAAEM
FT                   KGGDLNYDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPDVATAVKNAKAGQVRY
FT                   RTDKNGIIHTSVGKIGFEADKLKENVEALIADLKRIKPASSKGIYVKRVTLSTTMGPGL
FT                   VIDQSSLNV"
FT   gene            551463..552050
FT                   /locus_tag="Pput_0478"
FT   CDS_pept        551463..552050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0478"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76648"
FT                   /db_xref="GOA:A5VXN8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXN8"
FT                   /protein_id="ABQ76648.1"
FT                   /translation="MVLPIRYRIRHQNDIRPRPDETVKTRSKPVAIKLEDKKAIVAEVN
FT                   EAAKVALSAVVADARGVTVSAMTGLRKEAREAGVYVRVVRNTLLKRAVEGTEFSILNDA
FT                   FKGPTLIAFSNEHPGAAARLFKEFAKGQDKFEIKAAAFDGNFIAANQIDVLATLPTRDE
FT                   AIARLMSVIQGATSKLARTLAAIRDQKEATAA"
FT   gene            552127..552492
FT                   /locus_tag="Pput_0479"
FT   CDS_pept        552127..552492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0479"
FT                   /product="LSU ribosomal protein L12P"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76649"
FT                   /db_xref="GOA:A5VXN9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXN9"
FT                   /protein_id="ABQ76649.1"
FT                   /translation="MSLTNEQIIEAIGQKTVLEVVELIKAMEETFGVTAAVAAAGPAAA
FT                   AAVVEEQTEFNVVLVEAGDKKVNVIKAVRELTGLGLKEAKEKVDGAPQVVAEGVSKEAA
FT                   EDAKKKLEEAGAKVELK"
FT   gene            552713..556786
FT                   /locus_tag="Pput_0480"
FT   CDS_pept        552713..556786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0480"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2, domain 6; RNA polymerase Rpb2,
FT                   domain 7; RNA polymerase Rpb2, domain 2; RNA polymerase
FT                   beta subunit; RNA polymerase Rpb2, domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76650"
FT                   /db_xref="GOA:A5VXP0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXP0"
FT                   /protein_id="ABQ76650.1"
FT                   /translation="MAYSYTEKKRIRKDFSKLPDVMDVPYLLAIQLDSYREFLQAGASK
FT                   DHFRDVGLHAAFKSVFPIISYSGNAALEYVGYRLGEPAFDVKECVLRGVTFAVPLRVKV
FT                   RLIIFDKESSNKAIKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDH
FT                   DRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDCVFVRIDRRRKLPASVLLRALGYSTE
FT                   EVLNTFYTTNVFHISGEKLSLELVPQRLRGEVAVMDIHDETGKVIVEQGRRITARHINQ
FT                   LEKAGVKQLDVPMEYVLGRTTAKAIVHPATGEILAECNTEMTTELLIKVAKAQVVRIET
FT                   LYTNDIDCGPFISDTLKIDTTSNQLEALVEIYRMMRPGEPPTKDAAETLFNNLFFSAER
FT                   YDLSAVGRMKFNRRIGRTEIEGSGVLSKEDIVEVLKTLVDIRNGKGIVDDIDHLGNRRV
FT                   RCVGEMAENQFRVGLVRVERAVKERLSMAESEGLMPQDLINAKPVAAAVKEFFGSSQLS
FT                   QFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGL
FT                   INSLAAYARTNQYGFLESPYRVVKEGVVSDDIVFLSAIEEADHVIAQASAAMNDKKQLI
FT                   DELVAVRHLNEFTVKAPEDVTLMDVSPKQVVSVAASLIPFLEHDDANRALMGSNMQRQA
FT                   VPTLRADKPLVGTGMERNVARDSGVCVVARRGGVIDSVDASRIVVRVADDEVETGEAGV
FT                   DIYNLTKYTRSNQNTCINQRPLVSKGDKVQRGDIMADGPSTDMGELALGQNMRIAFMAW
FT                   NGFNFEDSICLSERVVQEDRFTTIHIQELTCVARDTKLGPEEITADIPNVGEAALNKLD
FT                   EAGIVYVGAEVGAGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPTGTK
FT                   GTVIDVQVFTRDGVERDSRALAIEKMQLDEIRKDLNEEFRIVEGATFERLRSALNGQVV
FT                   DGGAGLKKGTVITDEVLDGLEHGQWFKLRMAEDALNEQLEKAQQYIVDRRRLLDDKFED
FT                   KKRKLQQGDDLAPGVLKIVKVYLAIRRRIQPGDKMAGRHGNKGVVSVIMPVEDMPHDAN
FT                   GTPVDVVLNPLGVPSRMNVGQILETHLGLAAKGLGEKIDRMLEEQRKAAELRVFLTEVY
FT                   NEIGGRQENLDEFTDEEILALANNLKKGVPMATPVFDGAKEREIKAMLKLADLPESGQM
FT                   VLFDGRTGNKFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQR
FT                   FGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGDHRMEPGMPESFNVLIK
FT                   EIRSLGIDIDLETE"
FT   gene            556851..561050
FT                   /locus_tag="Pput_0481"
FT   CDS_pept        556851..561050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0481"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase, alpha subunit; RNA polymerase Rpb1,
FT                   domain 3; RNA polymerase Rpb1, domain 1; RNA polymerase
FT                   Rpb1, domain 5; RNA polymerase Rpb1, domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76651"
FT                   /db_xref="GOA:A5VXP1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXP1"
FT                   /protein_id="ABQ76651.1"
FT                   /translation="MKDLLNLLKNQGQVEEFDAIRIGLASPEMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVALAKVRRERMAH
FT                   IELASPVAHIWFLKSLPSRIGLLMDMTLRDIERVLYFESYVVIDPGMTTLEKGQLLNDE
FT                   QYFEALEEFGDDFDARMGAEAVRELLHAIDLEHEIGRLREEIPQTNSETKIKKLSKRLK
FT                   LMEAFQGSGNLPEWMVLTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLSAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFGKLEMRGLATTIKAAKK
FT                   MVERELPEVWDVLAEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTREA
FT                   INAKGEGRVFADLQEVDRVFRAGEAALHAKIKVRINETVKERDGSVVKNTRIVDTTVGR
FT                   ALLFQVVPAGLPYDVVNQPMKKKAISKLINQCYRVVGLKETVIFADQLMYTGFAYSTIS
FT                   GVSIGVNDFVIPDEKARIIGNATDEVKEIESQYASGLVTQGEKYNKVIDLWSKANDEVS
FT                   KAMMANLSKEKVIDREGKEVEQESFNSMYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLSVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTEI
FT                   DCGTDQGLVMTPHIEGGDVVEPLGERVLGRVIARDVFKPGTEDVIVPAGTLVDEQWVEF
FT                   IELNSIDEVIVRSPINCETRYGICAKCYGRDLARGHQVNIGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRTSAADSVQVKNGGMVRLHNLKQVERADGNLVAVSRSGELAIADEFG
FT                   RERERYKLPYGAVISVKEGEKVEAGAIVAKWDPHTHPIVTELKGTVTFVGMEENITIKR
FT                   QTDELTGLTNIEVLDVKDRPAAGKEIRPAIKMVDASGKDLYLPGTDVPAQYFLPANALV
FT                   GVADGAQIGVGDVIARIPQETSKTRDITGGLPRVADLFEARRPKEASILAEVSGTIAFG
FT                   KETKGKRRLVITPTDGSDPYEELIPKWRHLNVFEGEQVNRGEVISDGPSDPHDILRLLG
FT                   VSALAKYIVNEIQDVYRLQGVKINDKHIETILRQMLRKVEISESGDSSFIKGDQMELTQ
FT                   VLVENERLAGEDKFISKFTRVLLGITKASLSTESFISAASFQETTRVLTEAAVTGKRDY
FT                   LRGLKENVVVGRLIPAGTGLAYHSERKRRRDADKPLRVSASEVEAALTEALNSSGN"
FT   gene            561262..561633
FT                   /locus_tag="Pput_0482"
FT   CDS_pept        561262..561633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0482"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76652"
FT                   /db_xref="GOA:A5VXP2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXP2"
FT                   /protein_id="ABQ76652.1"
FT                   /translation="MATINQLVRQPRKRSVEKSDVPALQNCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVSSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDT
FT                   SGVKGRNQGRSKYGTKRPK"
FT   gene            561740..562210
FT                   /locus_tag="Pput_0483"
FT   CDS_pept        561740..562210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0483"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76653"
FT                   /db_xref="GOA:A5VXP3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXP3"
FT                   /protein_id="ABQ76653.1"
FT                   /translation="MPRRRVAAKREILDDPKYGSQILAKFMNHVMESGKKAVAERIVYG
FT                   ALDTVKARKNSDPLEIFEKALDAIAPLVEVKSRRVGGATYQVPVEVRPSRRNALAMRWL
FT                   VDYARKRGEKSMALRLAGELLDAAEGKGAAVKKREDVHRMAEANKAFSHYRF"
FT   gene            562241..564388
FT                   /locus_tag="Pput_0484"
FT   CDS_pept        562241..564388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0484"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76654"
FT                   /db_xref="GOA:A5VXP4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXP4"
FT                   /protein_id="ABQ76654.1"
FT                   /translation="MARTTAINRYRNIGICAHVDAGKTTTTERILFYTGLSHKMGEVHD
FT                   GAATTDWMVQEQERGITITSAAVTTFWKGSRGQYDNYRVNVIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVFCGTSGVEPQSETVWRQANKYGVPRVVYVNKMDRAGANFLRVVGQIKNRLG
FT                   HTPVPVQLAIGSEDNFQGQVDLIKMKAIYWNDDDKGTTYREEEIPADMVELANEWRNNM
FT                   VEAAAEATEELMNKYLEEGELSVEEIKAGLRARTLASEIVPAVCGSSFKNKGVPLVLDA
FT                   VIDFLPAPTEIPAIKGIHPDLIDVPKDEVKPEQFDERHADDDEPFSALAFKIATDPFVG
FT                   TLTFVRVYSGFLTSGDSVINSVKGKKERVGRMVQMHANQREEIKEVRAGDIAALIGMKD
FT                   VTTGDTLCNADKPIILERMDFPEPVISLSVEPKTKQDQEKMGIALGKLAQEDPSFRVKT
FT                   DEETGQTIISGMGELHLDILVDRMKREFNVEANIGKPQVSYREKITKSNVEIEGKFVRQ
FT                   SGGRGQFGHCWVRFSEPDVDDKGNITEGLVFSNEVVGGVIPKEYIPAIQKGIEEQMKNG
FT                   VVAGYPLIGLKAAVFDGSYHDVDSNEMAFKIAASMATKQLAQKGGGVVLEPIMKVEVVT
FT                   PEDYLGDVMGDLNRRRGLVQGMDESVSGRVVRAEVPLGEMFGYATDVRSMSQGRASYSM
FT                   EFSKYAEAPSNIVEALVKKQG"
FT   gene            564416..565609
FT                   /locus_tag="Pput_0485"
FT   CDS_pept        564416..565609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0485"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76655"
FT                   /db_xref="GOA:A5VXN3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXN3"
FT                   /protein_id="ABQ76655.1"
FT                   /translation="MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAIV
FT                   EFDKIDSAPEEKARGITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDF
FT                   PGDDTPIIIGSARMALEGKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPIEDVF
FT                   SISGRGTVVTGRIERGIVRVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVL
FT                   LRGTKRDDVERGQVLVKPGSVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTD
FT                   VTGNCELPEGVEMVMPGDNIQMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            565751..566062
FT                   /locus_tag="Pput_0486"
FT   CDS_pept        565751..566062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0486"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76656"
FT                   /db_xref="GOA:A5VXP6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXP6"
FT                   /protein_id="ABQ76656.1"
FT                   /translation="MQNQQIRIRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLVSPHVNKDARDQYEIRTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQISLG"
FT   gene            566143..566778
FT                   /locus_tag="Pput_0487"
FT   CDS_pept        566143..566778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0487"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76657"
FT                   /db_xref="GOA:A5VXP7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXP7"
FT                   /protein_id="ABQ76657.1"
FT                   /translation="MTIGVIGRKCGMTRIFTEEGVSIPVTVIEIEPNRVTQFKTEETDG
FT                   YRAVQVTVGERRASRVTAAQAGHFAKANVAAGRGVWEFRLEEGDFQAGDLIKAELFTAG
FT                   QLVDVTGQSKGKGFAGTIKRWNFRGQDNTHGNSVSHRVPGSIGQCQTPGRVFKGKKMSG
FT                   HMGAERVTVQSLEVVRVDAERNLLLIKGAVPGATGGDVVVRPAVKARG"
FT   gene            566791..567393
FT                   /locus_tag="Pput_0488"
FT   CDS_pept        566791..567393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0488"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76658"
FT                   /db_xref="GOA:A5VXP8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXP8"
FT                   /protein_id="ABQ76658.1"
FT                   /translation="MQLNVNDAQAIEVSELTFGGEFNETLVHQAVVAYMAGGRQGTKQQ
FT                   KTRSDVAGGGKRPWRQKGTGRARAGTTRGPIWRGGGVTFAARPQDHSQKLNKKMYRAAL
FT                   RSILAELVRSDRLVVVQDFAVEAPKTKDLLNKLNGMGLSDVLIVSDAVDQNLYLAARNL
FT                   PHVDVRDVQGSDPVSLIAYEKVLITVSAVKKFEELLG"
FT   gene            567390..567689
FT                   /locus_tag="Pput_0489"
FT   CDS_pept        567390..567689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0489"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76659"
FT                   /db_xref="GOA:A5VXP9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXP9"
FT                   /protein_id="ABQ76659.1"
FT                   /translation="MNQERVFKVLLGPHVSEKATVLAEKKGQFVFKVATDATKLEIKKA
FT                   VEGLFNVKVENVSTVNVLGKTKRTARGLGKRNDWKKAIVSLQPGQDLDFSSSAE"
FT   gene            567704..568528
FT                   /locus_tag="Pput_0490"
FT   CDS_pept        567704..568528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0490"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76660"
FT                   /db_xref="GOA:A5VXQ0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXQ0"
FT                   /protein_id="ABQ76660.1"
FT                   /translation="MAIVKCKPTSPGRRFVVKVVNKELHKGAPHAPLIEKKSKSGGRNN
FT                   NGRITTRHVGGGHKQHYRLVDFRRNDKDGIPATVERIEYDPNRTAHIALLCYADGERRY
FT                   IIAPKGVSAGDQLIAGALAPIKAGNSLQLRNIPVGSTIHGIELKPGKGAQIARSAGASA
FT                   QLIAREGVYVTLRLRSGEMRKVLAECRATLGEVSNSEHSLRSLGKAGAKRWRGVRPTVR
FT                   GVAMNPVDHPHGGGEGRTSGGRHPVSPWGFPTKGAKTRGNKRTDNMIVRRRK"
FT   gene            568545..568820
FT                   /locus_tag="Pput_0491"
FT   CDS_pept        568545..568820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0491"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76661"
FT                   /db_xref="GOA:A5VXQ1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXQ1"
FT                   /protein_id="ABQ76661.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEVAVEKNDRKPVKTWSRRSMILPQMV
FT                   GLTIAVHNGRQHVPVLVNEDMVGHKLGEFAGTRTYRGHVADKKAKR"
FT   gene            568832..569164
FT                   /locus_tag="Pput_0492"
FT   CDS_pept        568832..569164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0492"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76662"
FT                   /db_xref="GOA:A5VXQ2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXQ2"
FT                   /protein_id="ABQ76662.1"
FT                   /translation="MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAE
FT                   IMKKVLESAVANAEHNEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHIT
FT                   VKVADK"
FT   gene            569178..569864
FT                   /locus_tag="Pput_0493"
FT   CDS_pept        569178..569864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0493"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3-C-terminal domain protein; KH, type 2 domain
FT                   protein; Ribosomal protein S3, N-terminal domain; SMART: KH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76663"
FT                   /db_xref="GOA:A5VXQ3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXQ3"
FT                   /protein_id="ABQ76663.1"
FT                   /translation="MGQKVHPTGIRLGIVKEHTSVWYADGATYADYLLKDLKTREYLQD
FT                   KLKSASVSRIDIHRPAQTARITIHTARPGIVIGKKGEDVEKLRQDLTKQMGVPVHINIE
FT                   EIRKPELDAMLVAQSVAQQLERRVMFRRAMKRAVQNAMRIGAKGIKIQVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTYEAHTTYGVIGVKVWIFKGEVIGGRQEELKPQAPAP
FT                   RKKAAK"
FT   gene            569877..570290
FT                   /locus_tag="Pput_0494"
FT   CDS_pept        569877..570290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0494"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76664"
FT                   /db_xref="GOA:A5VXQ4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXQ4"
FT                   /protein_id="ABQ76664.1"
FT                   /translation="MLQPKRTKFRKQMTGHNRGLALRGSKVSFGEFALKAVARGRLTAR
FT                   QIESARRALTRHVKRGGKIWIRVFPDKPISKKPLEVRMGKGKGSVEYWVAQIQPGKVLY
FT                   EIEGVSEELAREAFALAAAKLPLATSFVKRTVM"
FT   gene            570290..570481
FT                   /locus_tag="Pput_0495"
FT   CDS_pept        570290..570481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0495"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76665"
FT                   /db_xref="GOA:A5VXQ5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXQ5"
FT                   /protein_id="ABQ76665.1"
FT                   /translation="MKANELREKSAQQLNEQLLGLLRDQFNLRMQKATGQLGQSHLLSQ
FT                   VKRDIARVKTVLNQQAGK"
FT   gene            570484..570750
FT                   /locus_tag="Pput_0496"
FT   CDS_pept        570484..570750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0496"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76666"
FT                   /db_xref="GOA:A5VXQ6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXQ6"
FT                   /protein_id="ABQ76666.1"
FT                   /translation="MAEAEKTVRTLTGRVVSDKMDKTITVLIERRVKHPIYGKYVKRST
FT                   KLHAHDEANQCKIGDKVSIRETRPLAKTKSWALVEVLERAVEV"
FT   gene            570774..571142
FT                   /locus_tag="Pput_0497"
FT   CDS_pept        570774..571142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0497"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76667"
FT                   /db_xref="GOA:A5VXQ7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXQ7"
FT                   /protein_id="ABQ76667.1"
FT                   /translation="MIQTQSMLDVADNSGARRVMCIKVLGGSHRRYAGIGDIIKVTVKE
FT                   AIPRGKVKKGQVMTAVVVRTRHGVRRADGSIIRFDGNAAVLLNNKQEPIGTRIFGPVTR
FT                   ELRTEKFMKIVSLAPEVL"
FT   gene            571154..571468
FT                   /locus_tag="Pput_0498"
FT   CDS_pept        571154..571468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0498"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="TIGRFAM: ribosomal protein L24; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76668"
FT                   /db_xref="GOA:A5VXQ8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXQ8"
FT                   /protein_id="ABQ76668.1"
FT                   /translation="MQKIRRDDEIIVIAGKDKGKRGKVLKVLADDRLVIGGVNLVKRHT
FT                   KPNPMAGVQGGIVEKEAPLHASNVAIFNGETNKADRVGFKVEDGKKIRVFKSTQKAVDA
FT                   "
FT   gene            571489..572028
FT                   /locus_tag="Pput_0499"
FT   CDS_pept        571489..572028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0499"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76669"
FT                   /db_xref="GOA:A5VXQ9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXQ9"
FT                   /protein_id="ABQ76669.1"
FT                   /translation="MARLKEIYRNEIAPKLKEELKLSNVMEVPRVTKITLNMGLGEAIG
FT                   DKKVIEHAVADLEKITGQKPVVTFARKSIAGFKVREGWPIGVKVTLRSDKMYEFLDRLL
FT                   AISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGLDITLTTTARSD
FT                   DEGRALLRAFKFPFRN"
FT   gene            572042..572347
FT                   /locus_tag="Pput_0500"
FT   CDS_pept        572042..572347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0500"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76670"
FT                   /db_xref="GOA:A5VXR0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXR0"
FT                   /protein_id="ABQ76670.1"
FT                   /translation="MAKKSMKNRELKRQLTVAKFAKKRAELKATIVNLNASPEERFAAV
FT                   VALQKQPRDASASRLRNRCRLTGRPHGVYRKFGLGRNMLRQAAMRGDVPGLVKASW"
FT   gene            572556..572948
FT                   /locus_tag="Pput_0501"
FT   CDS_pept        572556..572948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0501"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76671"
FT                   /db_xref="GOA:A5VXR1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXR1"
FT                   /protein_id="ABQ76671.1"
FT                   /translation="MSMQDPLADMLTRIRNAQMAEKSVVSMPSSTLKVAVAKVLKDEGY
FT                   IAGYQVTGEAKPSLSIELKYFEGRPVIEELKRSSRPGLRQYKAVTDLPKVRGGLGVSIV
FT                   STNKGVMTDRAARAAGVGGEVLCTVF"
FT   gene            572961..573494
FT                   /locus_tag="Pput_0502"
FT   CDS_pept        572961..573494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0502"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76672"
FT                   /db_xref="GOA:A5VXR2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXR2"
FT                   /protein_id="ABQ76672.1"
FT                   /translation="MSRVAKNPVKLPSGVEVKFAGQQLSVKGAKGTLELNVHSSVEVTE
FT                   ESGELRFVARNGDQQARAMAGTTRALVNNMVQGVSQGFERKLQLVGVGYKAQAKGTVLN
FT                   LALGFSHPVDYELPAGITAETPSQTDILIKGIDKQLVGQVAAEIRDFRPPEPYKGKGVR
FT                   YADEVVRRKEAKKK"
FT   gene            573505..573855
FT                   /locus_tag="Pput_0503"
FT   CDS_pept        573505..573855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0503"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76673"
FT                   /db_xref="GOA:A5VXR3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXR3"
FT                   /protein_id="ABQ76673.1"
FT                   /translation="MTDKKVIRLRRARKARLKMHELEVVRLCVFRSSQHIYAQVISADG
FT                   SKVLASASTLDKDLRDGATGNIDAATKVGKLVAERAKAAGVSQVAFDRSGFKYHGRVKA
FT                   LADAAREGGLEF"
FT   gene            573859..574359
FT                   /locus_tag="Pput_0504"
FT   CDS_pept        573859..574359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0504"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76674"
FT                   /db_xref="GOA:A5VXR4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXR4"
FT                   /protein_id="ABQ76674.1"
FT                   /translation="MANNDQKRDEGYIEKLVQVNRVAKTVKGGRIFTFTALTVVGDGKG
FT                   RVGFGRGKSREVPAAIQKAMEAARRNMIQVDLKGTTLQYATKAAHGASKVYMQPASEGT
FT                   GIIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVYATFKGLKAMQSPESIAAKRGKSVE
FT                   EIF"
FT   gene            574362..574538
FT                   /locus_tag="Pput_0505"
FT   CDS_pept        574362..574538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0505"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76675"
FT                   /db_xref="GOA:A5VXR5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXR5"
FT                   /protein_id="ABQ76675.1"
FT                   /translation="MATVKVTLIKSVSGRLPNHKLCVKGLGLRRIGHTVEVQDTPENRG
FT                   MINKAYYMLKVEG"
FT   gene            574542..574976
FT                   /locus_tag="Pput_0506"
FT   CDS_pept        574542..574976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0506"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76676"
FT                   /db_xref="GOA:A5VXR6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXR6"
FT                   /protein_id="ABQ76676.1"
FT                   /translation="MKLNDLSPAPGSRREKHRPGRGIGSGLGKTGGRGHKGQTSRSGGS
FT                   IAPGFEGGQQPLHRRLPKFGFVSLKAMDRAEVRLSELAKVEGDVISVQSLKDANVINQH
FT                   IQRVKIMLSGEVTRAVTIKGIAATKGARAAIEAAGGKFEE"
FT   gene            574977..576308
FT                   /locus_tag="Pput_0507"
FT   CDS_pept        574977..576308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0507"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76677"
FT                   /db_xref="GOA:A5VXR7"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXR7"
FT                   /protein_id="ABQ76677.1"
FT                   /translation="MAKQGALSSLGKGGMSELWARLRFLFMAIIVYRIGAHIPVPGINP
FT                   DRLADLFRQNEGTILSLFNMFSGGALERMSIFALGIMPYISASIIMQLMTAVSPQLEQL
FT                   KKEGEAGRRKISQYTRYGTVILALVQAIGMSIGLANQGVAFSAGLGFHVVAVSTFVAGA
FT                   MFMMWLGEQITERGVGNGISMLIFAGIVAGLPRAIGQSFESARTGDINIFALVAIGLLA
FT                   VAIIGFVVFIERGQRRIAVHYAKRQQGRKVFAAQTSHLPLKVNMAGVIPAIFASSILLF
FT                   PASLGAWFGQSEGMGWLQDISQSIAPGQPLNILLFSAGIIFFCFFYTALMFNPKDVAEN
FT                   LKKSGAFIPGIRPGEQSARYIDGVLTRLTMFGALYMMAVCLLPQFLVVAANVPFYLGGT
FT                   SLLIVVVVVMDFMSQVQSHLVSHQYESLMKKANLKGYGGSGLLR"
FT   gene            576286..576453
FT                   /locus_tag="Pput_0508"
FT   CDS_pept        576286..576453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0508"
FT                   /product="ribosomal protein L36"
FT                   /note="PFAM: ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76678"
FT                   /db_xref="GOA:A5VXR8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXR8"
FT                   /protein_id="ABQ76678.1"
FT                   /translation="MAAVCCADTPLRFEESVMKVRASVKKLCRNCKIIRREGVVRVICS
FT                   AEPRHKQRQG"
FT   gene            576585..576941
FT                   /locus_tag="Pput_0509"
FT   CDS_pept        576585..576941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0509"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76679"
FT                   /db_xref="GOA:A5VXR9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXR9"
FT                   /protein_id="ABQ76679.1"
FT                   /translation="MARIAGVNIPDNKHTVISLTYIYGVGRTTAQKICADAGVNPAAKI
FT                   KDLSDEQIETLRGEVAKFTTEGDLRRDINMKIKRLMDLGCYRGLRHRKGLPVRGQRTKT
FT                   NARTRKGPRKPIRK"
FT   gene            576960..577349
FT                   /locus_tag="Pput_0510"
FT   CDS_pept        576960..577349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0510"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76680"
FT                   /db_xref="GOA:A5VXS0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXS0"
FT                   /protein_id="ABQ76680.1"
FT                   /translation="MAKPAARPRKKVKKTVVDGIAHIHASFNNTIVTITDRQGNALSWA
FT                   TSGGSGFRGSRKSTPFAAQIAAERAGQAALEYGLKNLDVNVKGPGPGRESAVRALNSCG
FT                   YKIASITDVTPIPHNGCRPPKKRRV"
FT   gene            577365..577985
FT                   /locus_tag="Pput_0511"
FT   CDS_pept        577365..577985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0511"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76681"
FT                   /db_xref="GOA:A5VXS1"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXS1"
FT                   /protein_id="ABQ76681.1"
FT                   /translation="MARYIGPKCKLSRREGTDLFLKSGVRALESKCNIEAAPGIHGQRR
FT                   GRQSDYGTQLREKQKVRRIYGVLERQFRGYYQAAASKKGATGENLLQLLECRLDNVVYR
FT                   MGFGSTRSESRQLVSHKAISVNGKTVNIPSYQVRPGDVVAVREKSLGQLRIVQALELCA
FT                   QRGRVEWVDVDAAKKSGVFKNVPARSDLSADINENLIVELYSK"
FT   gene            578008..579009
FT                   /locus_tag="Pput_0512"
FT   CDS_pept        578008..579009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0512"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase, alpha subunit domain protein; RNA
FT                   polymerase, dimerisation; RNA polymerase, insert; SMART:
FT                   RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76682"
FT                   /db_xref="GOA:A5VXS2"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXS2"
FT                   /protein_id="ABQ76682.1"
FT                   /translation="MQISVNEFLTPRHIDVQVVSPTRAKITLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVVEAEIDGVLHEYSAIEGVQEDVIEILLNLKGLAIKLHGRDEVTLTLSK
FT                   KGSGVVTAADIQLDHDVEIVNPDHVIANLASNGALNMKLTVARGRGYEPADSRQTDEDE
FT                   SRSIGRLQLDASFSPVRRIAYVVENARVEQRTNLDKLVIDLETNGTLDPEEAIRRAATI
FT                   LQQQLAAFVDLKGDSEPVVVEQEDEIDPILLRPVDDLELTVRSANCLKAENIYYIGDLI
FT                   QRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLDNWPPASLKKDDKATA"
FT   gene            579052..579438
FT                   /locus_tag="Pput_0513"
FT   CDS_pept        579052..579438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0513"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76683"
FT                   /db_xref="GOA:A5VXS3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXS3"
FT                   /protein_id="ABQ76683.1"
FT                   /translation="MRHRKSGRHLSRTSSHRKAMFQNMAVSLIEHELIKTTLPKAKELR
FT                   RVAEPLITLAKEDSVANRRLAFDRTRSKSAVGKLFNDLGKRYATRQGGYLRILKCGFRA
FT                   GDNAPMAYVELVDRPVGGAVEAAE"
FT   gene            579611..581050
FT                   /locus_tag="Pput_0514"
FT   CDS_pept        579611..581050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0514"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76684"
FT                   /db_xref="GOA:A5VXS4"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXS4"
FT                   /protein_id="ABQ76684.1"
FT                   /translation="MSKILTTASGAPVADNQNSRSAGPRGPLLLDDFHLIEKLAHFNRE
FT                   NIPERRVHAKGSGAYGTFTVTHDITGYTSAKLFEEVGKQTETFLRFSTVGGERGSADTE
FT                   RDPRGFAVKFYTEEGNWDIVGNNTPVFFIRDPLKFPDFIHTQKRHPQSNLKNAQMMWDF
FT                   WSHSPEALHQVTILFSDRGIPDGYRHMHGFGSHTYSLINAKGERTWVKWHFKTQQGIKN
FT                   LTPTDAARLAGTDPDYAQRDLFEAIERGDYPRWTVCIQVMSEAEAASRDENPFDVTKTW
FT                   SQKDYPLIEVGVLELNRNPLNYFAEVEQAAFGPSNMVPGVGLSPDRMLQGRVFAYADAH
FT                   RYRVGTNHQQLPVNAPRCPVNSYQRDGSMATGSYGSAPNYEPNSYSDAPKQSPRHAEPA
FT                   LAMNGAADRYDHREDTDYFSHAGALFRLMSDEQKALLISNIAGAMAGVSEDVIQRQLQY
FT                   FFKADPAYGEGIAKALGINLA"
FT   gene            581214..581678
FT                   /locus_tag="Pput_0515"
FT   CDS_pept        581214..581678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0515"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin, Dps
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76685"
FT                   /db_xref="GOA:A5VXS5"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXS5"
FT                   /protein_id="ABQ76685.1"
FT                   /translation="MQGHPDVINYLVTLLKGELAARDQYFIHSRMYEDWGLSKLYERIN
FT                   HEMEEETQHADALMRRILMLEGTPDMRADDLEVGSTVPEMIEADLKLEYKVRGALCKGI
FT                   ELCELHKDYVSRDILRAQLADTEEDHTYWLEKQQGLIKAIGLENYLQSQM"
FT   gene            complement(581751..584585)
FT                   /locus_tag="Pput_0516"
FT   CDS_pept        complement(581751..584585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0516"
FT                   /product="Excinuclease ABC subunit A"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76686"
FT                   /db_xref="GOA:A5VXS6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXS6"
FT                   /protein_id="ABQ76686.1"
FT                   /translation="MDKILIRGARTHNLKNIDLTLPRDKLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSMMEKPDVDTIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLYARVGTPRCPDHDIPLEAQTISQMVDLVLERPEGSKLMLLAPVVRERKGEHL
FT                   AVFDELRAQGFVRARVNGKLYELDELPKLDKQKKHSIDVVVDRFKVRADLQQRLAESFE
FT                   TALKLADGIALVAPMDDEQGEETIFSARFACPVCGHAISELEPKLFSFNNPAGACPTCD
FT                   GLGVKQFFDTKRLVNTELTLAEGAIRGWDRRNVYYFQMLGSLAAHYGFSLEEPFGELLA
FT                   EHQKVILQGSGKQSVDFKYLNDRGDIVKRSHPFEGIVPNLERRYRETESATVREELAKF
FT                   LGTQPCPDCRGTRLRREARHVWVGEKTLPAVTNLPIGEASNYFGQLTLTGRRGEIAAKI
FT                   LKEICERLQFLVNVGLDYLTLDRSADTLSGGEAQRIRLASQIGAGLVGVMYILDEPSIG
FT                   LHQRDNDRLLATLNHLRDLGNTVIVVEHDEDAIRLADYVVDIGPGAGVHGGQIVAEGSP
FT                   QEVMNHPDSLTGKYLSGRKKIVVPAKRTPRNKKLQLKLKGARGNNLQNVDLEVPIGLLT
FT                   CVTGVSGSGKSTLINNTLFPLAATALNGASSLEAAPHSSMDGLQHLDKVVDIDQSPIGR
FT                   TPRSNPATYTGIFTPIRELFSGVPESRSRGYGPGRFSFNVKGGRCEACQGDGLIKVEMH
FT                   FLPDIYVPCDVCKSKRYNRETLEIKYKGKNIHEVLEMTIEDAREFFDAVPALARKLQTL
FT                   MDVGLSYIKLGQSATTLSGGEAQRVKLSRELSKRDTGKTLYILDEPTTGLHFADIQQLL
FT                   DVLHRLRDHGNTVVVIEHNLDVIKTADWLVDLGPEGGSKGGQIIACGTPEELSEMKQSY
FT                   TGHYLKPLLERDRA"
FT   gene            584715..586109
FT                   /locus_tag="Pput_0517"
FT   CDS_pept        584715..586109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0517"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76687"
FT                   /db_xref="GOA:A5VXS7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXS7"
FT                   /protein_id="ABQ76687.1"
FT                   /translation="MHDTHNERMSGGETRAAGGLALVFAFRMLGMFMVLPVLATYGMDL
FT                   AGATPALIGLAIGAYGLTQAVLQIPFGMVSDRIGRRPVIYLGLVIFALGSVLAAQADSI
FT                   WGVIAGRILQGAGAISAAVMALLSDLTREQHRTKAMAMIGMSIGLSFAVAMVVGPLLTS
FT                   AFGLSGLFLVTAGLALVGILLIAFVVPNTHSILQHRESGVARQAIGPTLRHPDLLRLDI
FT                   SIFILHAVLMASFVALPLAFVERGGLPKEQHWWVYLTALFISFFAMVPFIIYGEKKRKM
FT                   KRVLAGAVSVLLLTEIYFWEWADGLRGLVIGTVVFFTAFNLLEASLPSLVSKVSPAGGK
FT                   GTAMGVYSTSQFLGAALGGILGGWLFQHGGLNTVFLGSAVLCAIWLIVALRMNEPPYVT
FT                   SLRMPLTPEAVREAGLTERLMAVPGVTDAVVVAEEAAIYIKLDTKILDRATLERLVNPA
FT                   SSACEA"
FT   gene            586119..586664
FT                   /locus_tag="Pput_0518"
FT   CDS_pept        586119..586664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0518"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76688"
FT                   /db_xref="GOA:A5VXS8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXS8"
FT                   /protein_id="ABQ76688.1"
FT                   /translation="MARGVNKVILVGTCGQDPEVRYLPNGNAVTNLSLATSEQWTDKQS
FT                   GQKVERTEWHRVSLFGKVAEIAGEYLRKGSQCYIEGKLQTREWEKDGIKRYTTEIIVDI
FT                   NGTMQLLGGRPQGQQQGGDPYNQGGGNYGGGQQQQYNQAPPRQQAQRPQQAPQRPAPQQ
FT                   PAPQPAADFDSFDDDIPF"
FT   gene            complement(586755..588137)
FT                   /locus_tag="Pput_0519"
FT   CDS_pept        complement(586755..588137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0519"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76689"
FT                   /db_xref="GOA:A5VXS9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXS9"
FT                   /protein_id="ABQ76689.1"
FT                   /translation="MWVPQYSHQTQPVYLMIADALEQDIERGRLAEGDRLPTLKDLAEA
FT                   LNVTPGTVGRAYDEAAKRGLVAGEVGRGTFVRQLRQPLPAPSVPTPVAGESSQIDLSII
FT                   KPNDAHMSEWLGTAIRELAASSDLGQVLDYVTEGGHTSHKQAGATWIQRWLPDARWQQV
FT                   VLTAGAQHGLLVAISSLSKSDDVVLCESLCYPGIISLAHSLGRRLRGVAMDEHGLIPEA
FT                   LRAACLEHRPSLLVCVTTHQNPTNSIMPPARRQAIAEIAREFDLFIVDDDIYGFLEPDP
FT                   GYKPLAAYAPERSVYLTSLSKSVLPALRIGYLYAPPQTLSRLSSMVRSSVWMPSPLMAQ
FT                   LASNLINSGKADQLVRMQQQEAAARQHMAREILGQYKIRTQPHSFHIWLELPEPWTSDE
FT                   FANLARDNGVTVVSGSQFLPERSHPTSGVRIALMAPSRQALGFALTKLASLLDSAEPRL
FT                   FY"
FT   gene            588327..589124
FT                   /locus_tag="Pput_0520"
FT   CDS_pept        588327..589124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0520"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76690"
FT                   /db_xref="GOA:A5VXT0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXT0"
FT                   /protein_id="ABQ76690.1"
FT                   /translation="MDIAMEMLGSYWAEHWLLAVLILGAIAFVAGFVDSIAGGGGLFLV
FT                   PGFLLVGLPPQVALGQEKLVSTLGTLAAIRNFLANSKMVWQVALVGGPFSLLGAYLGAH
FT                   LIVSISQETVGKIILALIPLGILIFLTPKDRPVEERELSSRMLYTVVPLTCLVIGFYDG
FT                   FFGPGTGSMFIIAFHYLLRMDLVSSSANSKTFNFASNIGALVAFVSAGKVVYLLALPLV
FT                   ACNILGNHLGSSLALRKGNDVVRKALVFSMLCLFTSLGVKYLT"
FT   gene            589146..589907
FT                   /locus_tag="Pput_0521"
FT   CDS_pept        589146..589907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0521"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76691"
FT                   /db_xref="GOA:A5VXT1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXT1"
FT                   /protein_id="ABQ76691.1"
FT                   /translation="MKTAFVTGASSGFGRAICCTLIGKGYRVVGGARRMDKLKALEDEL
FT                   GVNFIPLALDVTDPESLEKAVEQLREASLQIDLLVNNAGLALGVDRAQTSSAANWQQMI
FT                   DTNITGLAMVTHKILPQMVEADSGMIINIGSIAGTYPYPGGNVYGASKAFVRQFSLNLR
FT                   ADLAGTRVRVSNIEPGLCSGTDFSVVRLNGDLDAVQALYRDVEALLPEDIAATVAWVAE
FT                   QPAHVNINTIEIMPVAQSSAALNVVRNLPRA"
FT   gene            590055..590645
FT                   /locus_tag="Pput_0522"
FT   CDS_pept        590055..590645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0522"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   catalytic subunit"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76692"
FT                   /db_xref="GOA:A5VXT2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXT2"
FT                   /protein_id="ABQ76692.1"
FT                   /translation="MDLNRRQFFKVAAVGLGGSSLAALGMAPTPAFAEQVRHFKLAHTK
FT                   ETRNTCPYCSVGCGLILYSQGDAGKNVKQNIIHIEGDADHPVNRGTLCPKGAGLLDFIH
FT                   SPSRLQYPEVRKPGSKEWVRVSWDEALDRVADLMKQDRDANFIEKNAQGQTVNRWLTTG
FT                   FLAASAASSEAGYLTHKVIRATGMLGFDNQARV"
FT   sig_peptide     590055..590156
FT                   /locus_tag="Pput_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 34"
FT   gene            590658..593123
FT                   /locus_tag="Pput_0523"
FT   CDS_pept        590658..593123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0523"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   catalytic subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76693"
FT                   /db_xref="GOA:A5VXT3"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXT3"
FT                   /protein_id="ABQ76693.1"
FT                   /translation="MASLAPTYGRGAMTNHWSDIANANLVLVMGGNAAEAHPCGFKWVT
FT                   EAKAHNKARLIVVDPRFTRTASVADYYAPIRTGTDIAFMGGLINYLLSNDKIQHEYVRN
FT                   YTDVSFIVKENYGFEDGLFSGYDEAKRVYADKSGWGYELGEDGYAKVDPTLQHPRCVFQ
FT                   LMKQHYSRYTPELASMTCGMPQDAMMKVWEEIASCSVPGKTMTILYALGWTQHSIGAQI
FT                   IRSAAMVQLLLGNVGMPGGGVNALRGHSNIQGLTDLGLLSNSLPGYLTLAGDAEQDYAA
FT                   YIDKRASKPLRPGQLSYWQNYGKFHVSLMKAWYGANATAENNWGYDWLPKLDVPAYDVL
FT                   RMFEMMGQGKVNGYMCQGFNPIAALPDKNRVTAALGKLKWLVIMDPLATETSEFWRNVG
FT                   PFNDVDTASIQTEVIRLPTTCFAEEDGSLVNSSRWLQWHWKGADGPGETRTDVQIMSEL
FT                   FLRLRQRYQAEGGAYPDAIMNISWPYKIPEEPSPEELAKEMNGWAVADVTDPTGAVIKA
FT                   GQQLAGFGQLKDDGSTASGCWIFAGSWTEQGNQMARRDNSDPYGMHQVQNWAWAWPANR
FT                   RILYNRASSDPQGKPWDPEKKRLVWWNGKAWTGTDVPDFKVDSPPEAGMNPFIMNPEGV
FT                   ARFFAIDKMAEGPFPEHYEPFETPIGINPLHPQNKKATSNPAGRIFDSVWDTLGTHDEF
FT                   PYAATTYRLTEHFHFWSKHCRLNAIAQPEQFVEIGEVLANEKGIKAGDRVRVSSKRGHI
FT                   DAVAVVTKRIRPLQVNNQTVHQIGIPLHWGFTGATRHGYLTNTLVPFLGDGNTQTPESK
FT                   SFLVKVEKL"
FT   gene            593123..594073
FT                   /locus_tag="Pput_0524"
FT   CDS_pept        593123..594073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0524"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   iron-sulfur subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain protein;
FT                   Formate dehydrogenase, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76694"
FT                   /db_xref="GOA:A5VXT4"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR038384"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXT4"
FT                   /protein_id="ABQ76694.1"
FT                   /translation="MASQDIIARSATTTVPPSVRQQEQVAKLIDTTKCIGCKACQVACS
FT                   EWNELRDEVGHNHGTYDNPQDLTAETWTLMRFTEHERDDGNLEWLIRKDGCMHCADPGC
FT                   LKACPSPGAIIKHANGIVDFNQDHCIGCGYCITGCPFNIPRISQKDHKAYKCTLCSDRV
FT                   SVGLEPACVKTCPTGAIVFGSKDEMKVHAAERIVDLKSRGYDKAGLYDPDGVGGTHVMY
FT                   VLHHADTPKLYAGLPDQPVISPLVGLWKGFTKPLALLAMGAAVLAGFFHYVRIGPQRVE
FT                   EDEHPTPPDESVHQVDPSVHVYDPKQPGGQGEQRP"
FT   gene            594070..594726
FT                   /locus_tag="Pput_0525"
FT   CDS_pept        594070..594726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0525"
FT                   /product="formate dehydrogenase (quinone-dependent)
FT                   cytochrome b subunit"
FT                   /EC_number="1.2.1.2"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76695"
FT                   /db_xref="GOA:A5VXT5"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXT5"
FT                   /protein_id="ABQ76695.1"
FT                   /translation="MNDNKPILRYNANERSNHWVVAILFILAGLSGLALFHPALFWLSN
FT                   LFGGGPWTRILHPFIGVAMFVFFLGLVLRFWRANFITANDRLWLRRVDRVMRNEEEGVP
FT                   PIGKYNAGQKLLFWTLLVCMLVLLVSGVVIWRAYFSHWFGIDAIRLSALLHALAAFVLI
FT                   LSIIVHIYAGIWIKGSIGAMLHGWVSRAWARKHHELWYREVTGDKTPGDHGRKEG"
FT   gene            594731..595657
FT                   /locus_tag="Pput_0526"
FT   CDS_pept        594731..595657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0526"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="TIGRFAM: formate dehydrogenase accessory protein
FT                   FdhE; PFAM: formate dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76696"
FT                   /db_xref="GOA:A5VXT6"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXT6"
FT                   /protein_id="ABQ76696.1"
FT                   /translation="MSTLLEPGQIEASAVTPPFLHLPAANLFELRAARLEQLAEGNALG
FT                   DYLRLIARLCRIQQQLVDNPPGGMPVAEARQRLCMDHGLPPLAADSLVREGPWLVWLQA
FT                   LLEHLSGETRGPMGEALQVLRGSDDNQRKGWGIALLAGQYDGVPAALVPFLGAALQAAW
FT                   SSWLLALPAHQLKPAGSLAQCPACGSPAMAGVVRNRGKHNGLRYLACSLCACEWHVVRV
FT                   KCVYCESSKDLRYTSLEDDRHAPGKAPLRAECCPGCDSYLKQNYLENDAAAEPLADDLA
FT                   SLALDIRLDGEGFHRLAPNLMLAPGSG"
FT   gene            595797..597224
FT                   /locus_tag="Pput_0527"
FT   CDS_pept        595797..597224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0527"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; L-seryl-tRNA
FT                   selenium transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76697"
FT                   /db_xref="GOA:A5VXT7"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXT7"
FT                   /protein_id="ABQ76697.1"
FT                   /translation="MSNSLASDTPRLPSIDTLLRHPACLPLIDRHGRDAVLNTLRQLLD
FT                   DLREPARNGELGSAELAPEILLGRSGERLALQQRSQVRRVFNLTGTVLHTNLGRALLPE
FT                   EAIEAMQTAARYPLNLEFDLATGKRGDRDDLIEGLIRELTGAEAVTVVNNNAAAVLLAL
FT                   NSLGARKEGIISRGELIEIGGAFRIPDIMARAGVKLHEVGTTNRTHARDYEAAIGPRTG
FT                   LLMRVHCSNYSIQGFTTQVPTAELARIAHQHQLPLLEDLGSGSLLDLTRWGLPAEPTVR
FT                   QALADGADIVTFSGDKLLGGPQAGIIVGHKDLITRIKKNPLKRALRVDKITLAALEAVL
FT                   ALYRNPDRLAERLPSLRLLTRSQAEIQAQAERLAPELQARLGEQWAIRVEPALGMIGSG
FT                   SQPVARLPSAALCLRPQVSKKLRGRSLHVLERALRDLPVPVLGRIDDDALWLDLRQLDD
FT                   EAQWLAQLPALQLGPVQ"
FT   gene            597221..599143
FT                   /locus_tag="Pput_0528"
FT   CDS_pept        597221..599143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0528"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor SelB"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; small GTP-binding protein; PFAM: protein
FT                   synthesis factor, GTP-binding; elongation factor Tu, domain
FT                   2 protein; Elongation factor SelB, winged helix 2;
FT                   Elongation factor SelB, winged helix 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76698"
FT                   /db_xref="GOA:A5VXT8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXT8"
FT                   /protein_id="ABQ76698.1"
FT                   /translation="MIVGTAGHIDHGKTALLLALTGQAGDQRQEERARGMTIDLGYRYA
FT                   ALSEGAPLTGFIDVPGHERFIHNMLAGAHGIDLVLLVVAADDGVMPQTREHLAIIELLG
FT                   IPQALVAISKCDRVEPSRLAEVQMQVSELLAPGPYAGARQFPLSSISGEGVDALRQALL
FT                   EAEAGTRQRSVVGGFRLAVDRAFAVTGAGVVVTGTALAGRVSAGDTLLLGKAGKVVRVR
FT                   GLHAQNQAALVAEAGQRVALNIAAERLAVEQVHRGDWLVPEWLHAPSVRVDIELNLLPG
FT                   EKRAFEHFSAVHVHLGTQDVTARVALLEGESLAAGQRMFAQLLLNAPLQAVHGDRLVLR
FT                   DQRAQRTLGGGKVLDPFAPSRQRRSDARLQQLQVLRDAADLEQALPALLASAPGGISPQ
FT                   RLERQFNRLRETWQLPDDVRVVATRQGQLLFANAQWQALKQQVLEQLARFHEQEPDQLG
FT                   PDRDRLRRFVALPLERPAFVSLLDELLDDSAIASSGPWLHLPDHKVQLSEADSALWARL
FT                   QPKLIAGQYDPPWVRTLAGEENRAEADVRLLLRKLARLGLVHQVVRDLFYPEATLQRMA
FT                   ALMLGQASETQIVQVAAFRDMLGIGRKRSVQILEYFDRIGLTRRVADQRHIRADSALAQ
FT                   QQARH"
FT   gene            complement(599352..600350)
FT                   /locus_tag="Pput_0529"
FT   CDS_pept        complement(599352..600350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0529"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: Asparaginase/glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76699"
FT                   /db_xref="GOA:A5VXT9"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="InterPro:IPR041725"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXT9"
FT                   /protein_id="ABQ76699.1"
FT                   /translation="MLSMRAVKNLLVLYTGGTIGMLETPEGLAPAGGFDARMREHFAQM
FT                   ANAPQVQWTLHELNPLLDSANMQQHNWLAMRDAIVAAVDVAGHDGVLVLHGTDSMAYSA
FT                   AALSFLLLGLPAPVVLTGSMLPAGAPDSDAWDNLCGALRQFEHGLEDGVQLYFHGQLLH
FT                   GCRASKLRSEAFDAFAALPRHRDAERADTIPAELGYKQPRKPVNLAVVPVFPGLQAGHL
FT                   QALIDSGVQGLLLECYGSGTGPSDDQALLNVLSAARQRGVMLAAISQCPEGSVVFDTYA
FT                   AGNRLRGAGLVSGGGMTREAALGKMVALLGAGLDADAADRWFVLDLCGERA"
FT   gene            complement(600414..601856)
FT                   /locus_tag="Pput_0530"
FT   CDS_pept        complement(600414..601856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0530"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76700"
FT                   /db_xref="GOA:A5VXU0"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXU0"
FT                   /protein_id="ABQ76700.1"
FT                   /translation="MLEVINDFLSGKLLIVLIVGLGSYFTIRSRFVQFRHFTHMFSVFK
FT                   ESLRGQAGQLSSFQALMLSLAGRVGAGNIAGVGIAVTLGGPGAVFWMWVTALVGMSSSF
FT                   FECTLAQVYKRADGDGLYRGGPAYYIQHGLKRKSMAIVFSILLLVTYGFAFIGLQSYTV
FT                   THSLQNAFAFDPSHTGIVLAVLLAITFIGGIKRIAAVSDLLVPVKTLAYIGVTLYVIGT
FT                   QIEHVPAMLETIFKSAFGLDPAFAGLLGSAIVMGVKRGVFANEAGLGSAPNVAAVAAVK
FT                   HPGAQGVVQAFSVFLDTFVICTCTALLILLSGFYTPGFEGDGIVLTQNSLAAVVGDWGR
FT                   VFVSVALSLFVFTCILYNYYLGENSLQFLSRNRAVLMVFRGLVLALVVWGSMQDLSTVF
FT                   AFADITMTCLAFVNLVALALLFKVGLRVMRDYDDQRKAGVKQPVFDSSKFADLDLDRNA
FT                   WPANPQVETATDNAVGQVQTQR"
FT   gene            602035..602844
FT                   /locus_tag="Pput_0531"
FT   CDS_pept        602035..602844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76701"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXU1"
FT                   /protein_id="ABQ76701.1"
FT                   /translation="MSDHFATNLKLACSHYRSISEVCRQLSINRAQFNKYLSGQSRPTA
FT                   FNLKRIGDFFGVEDYELNLPAEQFARLIGARVSPQAQQPSDPISELFRPLHEHGGNLSR
FT                   YCGYYFEYSNCMSVPGTTLVSLVHLWEERGRFLFERQERQERSSTTDQHAEVRCRYLGA
FT                   AFQLQDRMFLIDYESLTFNEMSQTILIPSFKSRITRLNGLKAGVSSGDRRNPACTRVVW
FT                   EYLGEEINRINAYRQVKLYRPDDPRIDDDVRERLSVAPLRNGLFEIE"
FT   gene            complement(602856..603296)
FT                   /locus_tag="Pput_0532"
FT   CDS_pept        complement(602856..603296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76702"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXU2"
FT                   /protein_id="ABQ76702.1"
FT                   /translation="MPQVDSIVLICPAVYPDDAHQAPFGPAFTAAINKPFGFLESDSYT
FT                   FLNQFRGRVLMVIGEYDGLNSQRFGKGPGTSAGNLWLAGTERYSPIPEEVNLALMRAVS
FT                   ASRLQCLFLTDCDHGIAAHLRSTPAIADQVADTVATFILDNA"
FT   gene            complement(603297..604501)
FT                   /pseudo
FT                   /locus_tag="Pput_0533"
FT                   /note="protein of unknown function DUF81"
FT   gene            604911..605795
FT                   /locus_tag="Pput_0535"
FT   CDS_pept        604911..605795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0535"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76703"
FT                   /db_xref="GOA:A5VXU3"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXU3"
FT                   /protein_id="ABQ76703.1"
FT                   /translation="MRMRLMLLGGGNALGQALIRLGAEEDIAFLAPRPPENGWAPSSLT
FT                   QLLDDHRPDALVNLAYYFDWFQAESVSEQRLVQQERAVERLAELCQHHQITLVQPSSYR
FT                   VFDGSRATAYSEKDEPVPLGLRGQALWRIEQSVRAACPQHVLLRFGWLLDESIDGALGR
FT                   FLTRAEQPQELLLADDRRGNPTPVDDAARVILSVLKQLDCNAPLWGTYHYAGNEATTPL
FT                   ALGQAILAEAGQYRQLAVQAPTPQAHAARPDASEEPQHAVLACKKILHTFGIKPRAWRA
FT                   GLPPLLDRFYRHG"
FT   gene            605788..606720
FT                   /locus_tag="Pput_0536"
FT   CDS_pept        605788..606720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0536"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility C-terminal
FT                   domain; KR"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76704"
FT                   /db_xref="GOA:A5VXU4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXU4"
FT                   /protein_id="ABQ76704.1"
FT                   /translation="MADAPILITGGAGFIGSHLCDALLDKGYAVRILDDFSTGRRSNLQ
FT                   VDHPRLELIEGDVADAGLVTQAAAGCRAVVHLAAVASVQASVEDPVRTHQSNFIGTLNV
FT                   CEAMRVHGVRRVLFASSAAVYGNNGEGESISEDTPKAPLTPYAVDKLASEQYLDFYRRQ
FT                   HGLEPVVFRFFNIFGPRQDPSSPYSGVISIFCERVVQGLPITVFGDGEQTRDFLYVGDL
FT                   VQVMVQALEQPQVEEGAVNIGLNQATSLNQLLAALEKVVGSLPAISYAAARSGDIRHSR
FT                   ADNQRLLARFKFAQVTPMVEGLTKLLGKG"
FT   gene            complement(606751..607194)
FT                   /locus_tag="Pput_0537"
FT   CDS_pept        complement(606751..607194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0537"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix, HxlR type"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76705"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXU5"
FT                   /protein_id="ABQ76705.1"
FT                   /translation="MLDENNAQCPVARALEVLGDRWALMILRDAFDGLRRFSEFQKNLG
FT                   LAKNILTSRLKLLVESGLLMTQPASDGSAYKEYVLTDKGRSVFPVVVGLRQWGERFLFE
FT                   AGETRSELVDGVTGQALEILQVRGQDGRVLHPEDCQRRRVRHG"
FT   gene            607298..608503
FT                   /locus_tag="Pput_0538"
FT   CDS_pept        607298..608503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0538"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76706"
FT                   /db_xref="GOA:A5VXU6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXU6"
FT                   /protein_id="ABQ76706.1"
FT                   /translation="MTPSLTRWITLLLATTSAMAVATVYFAQPLLESMAAELGVAQQQI
FT                   GWVVGATQGGYALGLLLIVPLGDLVDRKRLLLGQLLFSALALVGVGMAPNWAILLLALA
FT                   IAGLMAVMVQVMVAHAASLASPGQQGQAVGTVTSGVVLGILLARLASGGLADLAGWRSV
FT                   YLVAAGLLMVLALVLWRSLPGGQPMRSRPGYRALIMAQFSLYRHDRLLRQRGVFGVLIF
FT                   AAFSVLWSAMVMPLSAAPLALSHTEIGLFGLAGVAGTLAASHAGRLADLGRGERTTGVS
FT                   LALLTLSWLPTAFVEHSLLAFVLGVLMLDFAVQAVHVTNQSLLLAGRGAMASRLIGAYM
FT                   CCYSLGSGLGAVLASWVYAHWGWVAVCGLGMGISAVALCYWLWLQRARAAEAALQCSGQ
FT                   NL"
FT   sig_peptide     607298..607381
FT                   /locus_tag="Pput_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.758 at
FT                   residue 28"
FT   gene            complement(608491..609174)
FT                   /locus_tag="Pput_0539"
FT   CDS_pept        complement(608491..609174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0539"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76707"
FT                   /db_xref="GOA:A5VXU7"
FT                   /db_xref="InterPro:IPR000758"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXU7"
FT                   /protein_id="ABQ76707.1"
FT                   /translation="MNKSLLGASLVALALAAPAAHAYQAGDMILRAGAITTAPNESSGD
FT                   LKFDGNKVSGTKATLDSDTQLGLTFAYMLTDHIGLELLAATPFKHTVAVKGLGGGLDGK
FT                   LADIKQLPPTLSLQYYPMEPNSRFQPYAGVGINYTLFFDEDLSSARKQQGFSNLKLQDS
FT                   VGIAGQLGMDYLLTDNLLVNASVWYVDIDTKASVNGPTALGYSKTKVNVDVDPWVYMVG
FT                   LGYKF"
FT   sig_peptide     complement(609106..609174)
FT                   /locus_tag="Pput_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            complement(609284..609817)
FT                   /locus_tag="Pput_0540"
FT   CDS_pept        complement(609284..609817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76708"
FT                   /db_xref="InterPro:IPR021727"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXU8"
FT                   /protein_id="ABQ76708.1"
FT                   /translation="MPAKRPAMHMLLALLLLVAMPLWAAEPKELDWPALIPEGAPVIPP
FT                   QLTPLHDMSQLSNALSVESAPPARQQAPDAPVVKSLDGQQVKLPGYIVPLEVSEEGRTT
FT                   EFLLVPYYGACIHVPPPPPNQIVHIFSEMGVRVEDLYQPYWIEGKMQVRASSSELADAG
FT                   YQMEAEKIYAYELR"
FT   sig_peptide     complement(609743..609817)
FT                   /locus_tag="Pput_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(609923..611188)
FT                   /locus_tag="Pput_0541"
FT   CDS_pept        complement(609923..611188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0541"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76709"
FT                   /db_xref="GOA:A5VXU9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXU9"
FT                   /protein_id="ABQ76709.1"
FT                   /translation="MYLLRLALASLANRRFTAFLTAFAIALSVCLLLAVERVRTEARAS
FT                   FASTISGTDLIVGARSGSVNLLLYSVFRIGNATNNIRWDSFQHYAQDPRVKWAIPISLG
FT                   DSHRGYRVMGTTTDYFSHYQYGRRQHLELSQGRTFANDPFEVVLGAEVAEALHYKLGDK
FT                   LVLAHGVAAISLVKHDDKPFTVVGVLKRTGTPVDRTLHISLGGMEAIHIDWHNGVPARG
FT                   AGRISAEQARTMDLQPAAITAFMLGLNSKIATFSLQREINEYRSEPLLAILPGVALQEL
FT                   WSLMGTAEQALFVVSLFVVLTGLIGMLTAILTSLNERRREMAILRSVGARPWHIAGLLV
FT                   LEALSLASVGIVAGLGLLYAGIALAQGYVQANYGLYLPLAMPSTHEWTLLAIILGAALL
FT                   MGSVPAWRAYRQSLADGLSIHL"
FT   sig_peptide     complement(611084..611188)
FT                   /locus_tag="Pput_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.915 at
FT                   residue 35"
FT   gene            complement(611188..611898)
FT                   /locus_tag="Pput_0542"
FT   CDS_pept        complement(611188..611898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0542"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76710"
FT                   /db_xref="GOA:A5VXV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXV0"
FT                   /protein_id="ABQ76710.1"
FT                   /translation="MNQPLIDLHDLMFAWPGHPPLLDIPSLRLDAGEALFLKGPSGSGK
FT                   TTLLGLLGGVNVPVQGRIQLLGQDLGSLSQGARDRFRVDHTGYIFQQFNLLPFLSVREN
FT                   VELPCRFSRSRKARAEQRHGSVDQAASTLLTHLGLGDPAMLARRADSLSIGQQQRVAAA
FT                   RALIGQPELVIADEPTSALDADTREAFIRLLFDECRAAGASLLFVSHDQSLAPLFDRHL
FT                   SLAELNRAAKPQEA"
FT   gene            complement(611899..612480)
FT                   /locus_tag="Pput_0543"
FT   CDS_pept        complement(611899..612480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76711"
FT                   /db_xref="InterPro:IPR021253"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXV1"
FT                   /protein_id="ABQ76711.1"
FT                   /translation="MRRLLLALPFALLPLAVAHAHDDHDHDHDHAHGSLGAHEHGVAKL
FT                   NAVLDGNTLELELDSPAMNLVGFEHAASSDADMAKVAAVRQQLEQPLKLFGLSAAAGCK
FT                   EDQQALESPLFGDASKADDEGDEHEHGHQHSDIGAHYQLTCANPDKLTELDLAPLFKAF
FT                   PATQKINVQLIGPNGQKGVETTPAKATVAF"
FT   sig_peptide     complement(612418..612480)
FT                   /locus_tag="Pput_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            612611..612955
FT                   /locus_tag="Pput_0544"
FT   CDS_pept        612611..612955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76712"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXV2"
FT                   /protein_id="ABQ76712.1"
FT                   /translation="MRIRGQIGDWPVDLTIELTPEEWAQLGRQTEVPMVAQAAATAAVV
FT                   APRQDDGQWAAARNVLRLAGQMSGPELLDRLEGLAGSTAAGKRLLVRLRHSSEVKVESG
FT                   VDAPMYHWVG"
FT   gene            complement(613104..613976)
FT                   /locus_tag="Pput_0545"
FT   CDS_pept        complement(613104..613976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0545"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76713"
FT                   /db_xref="GOA:A5VXV3"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXV3"
FT                   /protein_id="ABQ76713.1"
FT                   /translation="MTQDTPYIFDATDTNFQQLVIENSFHKPVLVDFWAEWCAPCKALM
FT                   PLLAKIAEGYQGELLLAKINCDVEQQVVAQFGIRSLPTVVLFKDGQPVDGFAGAQPESA
FT                   IRAMLEPHVQLPAAPTASPLEQAKALFAESRFAETEALLQALLGEDNSNVEALILYARC
FT                   LAERGELGEAQVVLDAVKTDEHKAALAGAKAQLTFLRQAASLPEVADLKSRLAQNPQDD
FT                   EAAYQLSIQQLARQQYEAALEGLLKLFQRNRGYENGLPQKALLQVFELLGGDHPLVGVY
FT                   RRKLSAAMF"
FT   gene            complement(614008..614664)
FT                   /locus_tag="Pput_0546"
FT   CDS_pept        complement(614008..614664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0546"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76714"
FT                   /db_xref="GOA:A5VXV4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXV4"
FT                   /protein_id="ABQ76714.1"
FT                   /translation="MPLALQRALSGLIGEARLIVSELPDCDLKLWLIDDQNMDRAFSSE
FT                   ETRRILEEPPYWSFCWASGLAMARYLAERPEWVAGKRVLDFGAGSGIAGIAAARAGARE
FT                   VVACDLDPLALDACRANAALNGVTLRYSSDFFAEEDRFDLILVADVLYDRANLPLLDAF
FT                   LSRGRQALVADSRVRDFHHPLYQQLGVLEALTLPDLAEPHEFRRVSLYHASRDTL"
FT   gene            complement(614668..615144)
FT                   /locus_tag="Pput_0547"
FT   CDS_pept        complement(614668..615144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76715"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXV5"
FT                   /protein_id="ABQ76715.1"
FT                   /translation="MGNMPVKDSPMHYRALVVLCCAALLAACGSDRPKTDNPVPAPAPS
FT                   AKAEVLGPLPAYQRELSGTLLEIPAGAEVELALLVIDERDRPQRLLASSNLTGTGQALP
FT                   YHLRFNPEAFPPGARVELRGRASNSGQLIMHLPPVRITQAQTQATGPLRFEKAP"
FT   sig_peptide     complement(615055..615144)
FT                   /locus_tag="Pput_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.621) with cleavage site probability 0.576 at
FT                   residue 30"
FT   gene            615221..615685
FT                   /locus_tag="Pput_0548"
FT   CDS_pept        615221..615685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0548"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76716"
FT                   /db_xref="GOA:A5VXV6"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXV6"
FT                   /protein_id="ABQ76716.1"
FT                   /translation="MHCPFCGANDTKVIDSRLVAEGEQVRRRRECVACGERFTTFETAE
FT                   LVLPRLIKQDGTRQPFDEEKLRAGMQRALEKRPVSVERLEAALAHIKSRLRATGEREVK
FT                   SLVVGEMVMAELRKLDEVAYIRFASVYRRFQDLDEFREEIDRLAREPAKE"
FT   gene            615688..616818
FT                   /locus_tag="Pput_0549"
FT   CDS_pept        615688..616818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0549"
FT                   /product="diaminohydroxyphosphoribosylaminopyrimidine
FT                   deaminase / 5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibD; PFAM:
FT                   CMP/dCMP deaminase, zinc-binding; bifunctional
FT                   deaminase-reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76717"
FT                   /db_xref="GOA:A5VXV7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXV7"
FT                   /protein_id="ABQ76717.1"
FT                   /translation="MPSQAAILDAHYMARALELARKGLYTTHPNPRVGCVIVRDGEVVG
FT                   EGWHVRAGEPHAEVHALRQAGELARGACAYVTLEPCSHHGRTPPCAEALVKAGVARVVA
FT                   AMQDPNPQVAGQGLRRLAEAGIEVASGVLEAEARALNPGFLKRMEHGLPFVRAKLAMSL
FT                   DGRTAMASGESQWITGPAARSAVQRLRARSSVVLTSAASVLADNARMTVRGAELGLDAE
FT                   TAALALSRTPLRVLVDGRLRLPLAAPFFQAGPTLVVTAVADDPRYAAAGHELLSLPGDN
FT                   GQVDLGALLHALAARGVNEVLLEAGAGLVGAFARQGLVDEYQLFVAGTFLGSQARPLLD
FT                   WPMDKMSEAPRLKITEMRAVGDDWRVTAIPLPAPGV"
FT   gene            616861..617526
FT                   /locus_tag="Pput_0550"
FT   CDS_pept        616861..617526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0550"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76718"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXV8"
FT                   /protein_id="ABQ76718.1"
FT                   /translation="MFTGIIESIGTIRSLTPKGGDVRVYVETGKLDLGDVKLGDSIAVN
FT                   GVCLTAVELPGDGFWADVSVETLKRTAFIDLKSGSKVNLEKALTPTTRLGGHLVSGHVD
FT                   GVGEIISRSDNARAIQFRVRAPKELAKYIAHKGSITVDGTSLTVNEVNGAEFELTIVPH
FT                   TLSETIMADYRAGRRVNLEVDLLARYLERLLLGDKAAEPSKGSGITESFLAANGFLKS"
FT   gene            617545..618636
FT                   /locus_tag="Pput_0551"
FT   CDS_pept        617545..618636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0551"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76719"
FT                   /db_xref="GOA:A5VXV9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXV9"
FT                   /protein_id="ABQ76719.1"
FT                   /translation="MALNSIEELVEDIRQGKMVILMDDEDRENEGDIIMAAECCQPEHI
FT                   NFMAKHARGLICMPMTRERCETLKLPLMAPRNGSGFGTKFTVSIEAAEGVTTGISAADR
FT                   ARTVQAAAAKDAKAEDIVSPGHIFPLMAQPGGTLARAGHTEAACDLARMAGFEPSGVIC
FT                   EVMNDDGTMSRRAELEVFAAEHGLKIGTIADLIHYRMIHERTVQRVSEQSVESELGEFN
FT                   LVTYRDAVEGDVHMALTLGKICAEEPTLVRVHNMDPLRDLLLVKQPGRWSLRAAMAAVA
FT                   EAGSGVVLLLGHPLDGDVLLAHIRESAGDAPAKAPTTYSTVGAGSQILRDLGVRKMRLM
FT                   SSPMKFNAISGFDLEVVEYVPSE"
FT   gene            618728..619204
FT                   /locus_tag="Pput_0552"
FT   CDS_pept        618728..619204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0552"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.78"
FT                   /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76720"
FT                   /db_xref="GOA:A5VXW0"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXW0"
FT                   /protein_id="ABQ76720.1"
FT                   /translation="MTLKTIEGTFIAPKGRYALVVGRFNSFVVESLVSGAVDALVRHGV
FT                   SESDITIIRAPGAFEIPLVAQKVAQQGAYDAIIALGAVIRGGTPHFEYVAGECTKGLAQ
FT                   VSMEFGVPVAFGVLTVDSIEQAIERSGTKAGNKGAEAALSALEMVSLLAQLEAK"
FT   gene            619201..619701
FT                   /locus_tag="Pput_0553"
FT   CDS_pept        619201..619701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0553"
FT                   /product="NusB antitermination factor"
FT                   /note="TIGRFAM: transcription antitermination factor NusB;
FT                   PFAM: NusB/RsmB/TIM44"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76721"
FT                   /db_xref="GOA:A5VXW1"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXW1"
FT                   /protein_id="ABQ76721.1"
FT                   /translation="MISDESDRFNPRDPKPADAGKPSKSAKRREARKLATQALYQWHMA
FT                   QHSLNEIEAQFRVDNDFTDVDGAYFREILHGVPAIKGEIDKALVPCMTIALEELDPVEL
FT                   AVLRLSTWELIKRVDVPYRVVINEGVELAKVFGATDGHKFVNGVLDKLAPALREAEVKA
FT                   NKR"
FT   gene            619720..620688
FT                   /locus_tag="Pput_0554"
FT   CDS_pept        619720..620688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0554"
FT                   /product="thiamine-phosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR
FT                   synthase related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76722"
FT                   /db_xref="GOA:A5VXW2"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXW2"
FT                   /protein_id="ABQ76722.1"
FT                   /translation="MGEFELINHYFAAAPCAQGGEGVALGIGDDCALLDLPPGEQLAVS
FT                   TDTLVAGVHFPAVCDPLLLGQRSLAVAASDLAAMGATAIGFTLALTLPDVGPDWLAAYA
FT                   DGLGRMAHRCRMSLIGGDTTRGPLSITVTVFGRVPAGQALRRSGARPGDLLCVGGSLGK
FT                   AAGALPLVLGEREAPAAQAEPLLAHYWSPMPQLTLGALLRGRATAALDISDGLLADCGH
FT                   IAKASGVALEVNLAQVPVSPALEAFLGREAAVQAALTGGDDYVLAFTLPPEALAPLAAF
FT                   DFIEVHTVGRVLEGQGVTLRDAQGQDITPVQRGYQHFRERP"
FT   gene            620685..621188
FT                   /locus_tag="Pput_0555"
FT   CDS_pept        620685..621188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0555"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /note="PFAM: phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76723"
FT                   /db_xref="GOA:A5VXW3"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXW3"
FT                   /protein_id="ABQ76723.1"
FT                   /translation="MTDHPNQVPAEFVPPSVWRNPWHFIAFGFGSGTLPKAPGTWGSLV
FT                   AIPFIPLWQMLPDWGYWLLLGVSMLFGFWLCGKVANDLRVHDHEGIVWDEIVGMWITLW
FT                   LVPEGWQWLLAGFLMFRFFDILKPWPIRWIDRHVHGGVGIMLDDILAGVFAWLGMQVLV
FT                   WAVA"
FT   gene            621205..621948
FT                   /locus_tag="Pput_0556"
FT   CDS_pept        621205..621948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0556"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76724"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXW4"
FT                   /protein_id="ABQ76724.1"
FT                   /translation="MAVRTVLLAMLLSIAPWVTAAEGIPKQIHLVSEEWLDYTNADGTG
FT                   VAWDVLRKVFEPAGVEVVTQSAPYSRAVGLVKRGEADAWVGSYKEENDDNLYPRWHFDM
FT                   DHIYALGLASKPAPTLDTIGKYRLAWVRGYDYGSYLPNVREFREIQRREGILPMLEHDR
FT                   VDYYIDALTEVDYVLGQASQPERFRRTHVAELPLYLAFARNDQAKALCDLFDKRMKELV
FT                   RSGELKPIFEHWKQPYPFNAGSHPH"
FT   sig_peptide     621205..621267
FT                   /locus_tag="Pput_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.644 at
FT                   residue 21"
FT   gene            622130..622747
FT                   /locus_tag="Pput_0557"
FT   CDS_pept        622130..622747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0557"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76725"
FT                   /db_xref="GOA:A5VXW5"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXW5"
FT                   /protein_id="ABQ76725.1"
FT                   /translation="MPVVFVAASKLPTPFATFTMHGFLDEATGREHVVLSLGDIADGQP
FT                   VLGRLHSECLTGDALFSQRCDCGSQLEAALQAIAREGRGVLLYLRQEGRGIGLLNKIRA
FT                   YELQDGGADTVEANERLGFAADQRDYAICLPMLEHLGVKSLRLMTNNPRKVKALTDMNI
FT                   VVAERVPLHTGHNPHNRYYLATKAGKLGHMLGNEHQGEVPQA"
FT   gene            622744..623163
FT                   /locus_tag="Pput_0558"
FT   CDS_pept        622744..623163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76726"
FT                   /db_xref="GOA:A5VXW6"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXW6"
FT                   /protein_id="ABQ76726.1"
FT                   /translation="MTRAEVKRRLALAWWQYLAVGLVPLPVMAWAFGGGDALIPVLAMP
FT                   LFIAGAATMFLSLPRFGAYKRALIATSKVLGTGEEAAAWIELARVRRMAMLYACFPAWV
FT                   AALSVLVGLEAVPQILLALSTVVVLYLYRIPRQLG"
FT   sig_peptide     622744..622833
FT                   /locus_tag="Pput_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.722) with cleavage site probability 0.427 at
FT                   residue 30"
FT   gene            623163..623975
FT                   /locus_tag="Pput_0559"
FT   CDS_pept        623163..623975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0559"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76727"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXW7"
FT                   /protein_id="ABQ76727.1"
FT                   /translation="MRLLPGLLALFACTVLAAEPLRVVSLAPSMSEIMLELQAGDLLVG
FT                   VLDGGERPAALRHLPSVGRQGQLDMERLLSLRPDLLLLWPGSVPPAQRDQLKRLGIATF
FT                   SAEPHDISQLIEQIEAIAGRIGRAEQGHSYARALRERLQQLQQQYRRDEPLQVFYQVWD
FT                   RPLYTLGGRQVVTDALAVCGARNVFADLGQPAPQVNVESVLLRNPQVILATDEAQLASW
FT                   KAWPQIRAVADGRLLVVPDKGLERPSGQMIEATARLCALLDAKAPVSR"
FT   sig_peptide     623163..623216
FT                   /locus_tag="Pput_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.965 at
FT                   residue 18"
FT   gene            complement(623953..625824)
FT                   /locus_tag="Pput_0560"
FT   CDS_pept        complement(623953..625824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0560"
FT                   /product="TonB-dependent receptor, plug"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76728"
FT                   /db_xref="GOA:A5VXW8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXW8"
FT                   /protein_id="ABQ76728.1"
FT                   /translation="MKKFACATILCTPTFLLAAERDDALKLPDVLISASRQVESRTATS
FT                   AANTVFTRTDIDRLQPTSVTDLLSRVPGVQVAPTGGRGSLPGIFIRGTKAAQSLVLVDG
FT                   VRIANATSGDSGLQFLDIDQIERIEVLRGSRSAVYGSDAIGGVIQIFTRRSSGPGLQPR
FT                   LRMAAGSNQTFQRSLGLSGGNDTTRFNLGASLDETAGIDSTGPSFASDGDHDAYRNKAL
FT                   NLSLSHTFGERFEAGLNVLDSRGRSEYDNPFGGFDPVTFESFGQQPYTDFSVSSLGSYV
FT                   DVQVTETWHSRLELAHGENRDDKRDKLSAERFVFNTYRDQATWQNDLALGEQNTILIGG
FT                   DWYEDRVHGSTDFTEDSRWNRAVFAQHRYQGEQISTELGVRHDRNQQFGGQTTWSGSLT
FT                   VPLNAHNDVLLSYSEGFRAPTFNDLYYPQFSNPNLDPEHSRSYELQWRSQLTAESRLEV
FT                   SLYRTDLRDAIIFGQDSIPRNVASARINGVEMALAQQWGAWHSQLGLALIDPRDRDTGH
FT                   TLARRARRTLSLDLDREFGRFSVGASWQAVSSSYDDEANRNRIGGYGLLGLRGSWAASD
FT                   ELKLEAKLDNLLDRSYSRALYSYEGAYHPYREEGRTVLFSVTWTPAL"
FT   sig_peptide     complement(625768..625824)
FT                   /locus_tag="Pput_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 19"
FT   gene            complement(626172..628067)
FT                   /locus_tag="Pput_0561"
FT   CDS_pept        complement(626172..628067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0561"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase, central region; Transketolase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76729"
FT                   /db_xref="GOA:A5VXW9"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXW9"
FT                   /protein_id="ABQ76729.1"
FT                   /translation="MPTTFQEIPRERPVTPLLDRADTPAGLRRLAEADLETLADELRQE
FT                   LLYTVGQTGGHFGAGLGVIELTIALHYVFDTPDDRLVWDVGHQAYPHKILTGRRNRMLS
FT                   LRQKDGIAAFPRRSESEYDTFGVGHSSTSISAALGMAIAARLQNSARKSIAVIGDGALT
FT                   AGMAFEALNHAQEVNADMLVILNDNDMSISRNVGGLSNYLAKILSSRTYASMREGSKKV
FT                   LSRLPGAWEIARRTEEYAKGMLVPGTLFEELGWNYIGPIDGHDLPTMIATLRNMRDLKG
FT                   PQFLHVVTKKGKGFAPAEIDPIGYHAITKLEPADKPAAPKKASGPKYSAVFGQWLCDMA
FT                   AADNRLVGITPAMKEGSDLVDFSERYPERYFDVAIAEQHAVTLAAGMACEGSKPVVAIY
FT                   STFLQRAYDQLIHDVAVQNLDVLFAIDRAGLVGEDGPTHAGSYDLSYLRCIPGMLVMTP
FT                   SDENELRKMLSTGHLYNGPAAVRYPRGTGPNAPISGDLQPLEIGKGVVRRQGEKVALLV
FT                   FGVQLAEAMQVAEQINATVVDMRFVKPLDEALVLELAGSHELLVTIEENAIMGGAGAAV
FT                   GEFLASQAVLKPLLHLGLPDIYVEHAKPAQMLAECGLDAAGIEASVKARMVKLGL"
FT   gene            complement(628245..629132)
FT                   /locus_tag="Pput_0562"
FT   CDS_pept        complement(628245..629132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0562"
FT                   /product="farnesyl-diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /note="PFAM: Polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76730"
FT                   /db_xref="GOA:A5VXX0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXX0"
FT                   /protein_id="ABQ76730.1"
FT                   /translation="MIGTYQASCQARVDAALEPLFIAPSKELQRLYAAMRYSVMNGGKR
FT                   VRPLLAYAACEALGAPAEQANGAACAVELIHAYSLVHDDLPAMDDDDLRRGQPTTHKAF
FT                   DEACAILAGDGLQSLAFSALLDPCLSPQIDSIRLAMVQVLAKAAGPAGMVGGQAIDLGS
FT                   VGQKLDQQALEFMHRHKTGALIEASVRLGALASARAEQAQLDALQTYAQAIGLAFQVQD
FT                   DILDVESDTATLGKRQGADIARDKPTYPALLGLEAAKVYAIELRDQALAALQGFGETAE
FT                   PLRALARYIVERRN"
FT   gene            complement(629129..629371)
FT                   /locus_tag="Pput_0563"
FT   CDS_pept        complement(629129..629371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0563"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76731"
FT                   /db_xref="GOA:A5VXX1"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXX1"
FT                   /protein_id="ABQ76731.1"
FT                   /translation="MARKKASLDFEQSLADLQALVERLENGELSLEESLAAFEQGIALT
FT                   RDCQGALAQAEQKVQILLERDGELAAQPFDAEPEA"
FT   gene            complement(629620..630270)
FT                   /locus_tag="Pput_0564"
FT   CDS_pept        complement(629620..630270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0564"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76732"
FT                   /db_xref="GOA:A5VXX2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXX2"
FT                   /protein_id="ABQ76732.1"
FT                   /translation="MFTQHHTQFPTVSAAIAAFQAGRPVLLLDDDDREDEADIIAAAEN
FT                   ITLQTMAMMIRDCSGIVCLCLDEATVDELQLAPMVQNNQARHGTGFTVTIEAAEGITTG
FT                   VSAQDRITTIDAALRSSAEQRHIVSPGHVFPLRARNGGVLTRRGHTEGSVDLARLAGLR
FT                   PAAVLCELMNPDGSMARGEQVAVYARQYNLPVLTIEELARYREAMMEREAATA"
FT   misc_binding    complement(630351..630492)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 124.10"
FT   gene            630642..631622
FT                   /locus_tag="Pput_0565"
FT   CDS_pept        630642..631622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0565"
FT                   /product="Zeta toxin family protein"
FT                   /note="PFAM: Zeta toxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76733"
FT                   /db_xref="GOA:A5VXX3"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXX3"
FT                   /protein_id="ABQ76733.1"
FT                   /translation="MSSLYPFTDTDLHLAFRKVVDTLFDKKRDYVDGVLKPKMLIIAGT
FT                   QGSGKTYLLENTLLKSGRYDNYVRLYETHFRELHPHYRAMEDKGVLHVYEHTESFIWRL
FT                   GAMICTYAMENKYNIIMETALDSPHFADFPPEAARQGYQSEVHLIACQKEFSHWSTLDR
FT                   VVNSVGNHEIERVVSLTQIEEAQINGRSIIDAFENACIEVPGSEIVIYRRGLETEKNSL
FT                   PVCHSTCPEKGLLVPQQTYQGRAFFRGADLKINFKVQRSPQADFPCSYIQYAQVVHAGL
FT                   LGSEHRRAMAELNCKTLGQAQRLMSQLPVDVYRELCLYVLKYAQR"
FT   gene            complement(631644..632537)
FT                   /locus_tag="Pput_0566"
FT   CDS_pept        complement(631644..632537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0566"
FT                   /product="putative esterase"
FT                   /note="PFAM: putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76734"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXX4"
FT                   /protein_id="ABQ76734.1"
FT                   /translation="MSKKTLMLALALALAAPLVLAQPEHDQKMDTSVLQRQDLAYHFSQ
FT                   LDLDSADGLRHYRLWVGKPNRPAPASGYPVLWMLDGNAALGTLDQQQLDRLAAGQAPLL
FT                   VAVGYRTELRIDRAGRTLDYTPALPEQVQQRDPLTGQPSGGVDAFLKLLTGRMRTMVSA
FT                   VAPIDPQRQTLWGHSYGGLAVLHALFTCPGAFSLYAAASPSLWWRDGVIVREAQGLSSR
FT                   LGEARPHLLLMRGGQEPASPHGSPHENDELPARQLAADLAAIKGLDVRFERFEGLGHGP
FT                   MLGASLRRVIEGMSGQ"
FT   sig_peptide     complement(632472..632537)
FT                   /locus_tag="Pput_0566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(632638..633966)
FT                   /locus_tag="Pput_0567"
FT   CDS_pept        complement(632638..633966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0567"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76735"
FT                   /db_xref="GOA:A5VXX5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031930"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038428"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXX5"
FT                   /protein_id="ABQ76735.1"
FT                   /translation="MRRHPLLWKLALLQVSFCLLLIWLIWTWGLSVERSTYFLSQADQD
FT                   YLARYAQQAEQAWEQDGAAGTEAWRKQVALAEDTWVAVIGPHLQSLGTTPLSAEEASHL
FT                   TFMRKLDWPMSRRLQDELPYVSIEFPQHPEHGRLVLQLPERLLPTGLTPWTHVVTHGVA
FT                   PALLALLLGLALYRHLVVPLNRLRDRADALRADDLDSPALPLQQRRDELGELAQAFEHM
FT                   AGRLRQSLEQQRLLLRTLSHELRTPLARLRIAHDSDLPPPQLRERLDREVADMQKLLEN
FT                   TLDLAWLDTEQPSLSTEPVLVLSVWEALCEDVCFESGWDRARLPCSLGTDCLVQAHLDS
FT                   LAQALENLLRNAIRHSPTEGRVSLDGWREGACWHLRLSDQGPGVPDTDLERIFKPYQRL
FT                   ADSGAGFGLGLAIARRAIELQGGRLWASNGHPGLYLHMTLPAA"
FT   gene            complement(633966..634658)
FT                   /locus_tag="Pput_0568"
FT   CDS_pept        complement(633966..634658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0568"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76736"
FT                   /db_xref="GOA:A5VXX6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXX6"
FT                   /protein_id="ABQ76736.1"
FT                   /translation="MPTSLLLAEDDPRLLQDLDRHFRNRGFQVHACASGTQALNAIQQS
FT                   QFELVLLDIMLPGIDGLSLLDALRRQQAVPVMLMSALGAEQDRISGFTRGADDYLPKPF
FT                   SLAELDARVDALLRRVAFDRGTALRPDVGEVMLDHDRQDVIHNGNAAGLTASEFRLLVT
FT                   LLAHPDEALSKPFLYQTVLHRAYTRLDRGLDVHVCNLRRKLADINAQHLQIQAVRGQGY
FT                   ILVDTEQT"
FT   gene            634840..637014
FT                   /locus_tag="Pput_0569"
FT   CDS_pept        634840..637014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0569"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76737"
FT                   /db_xref="GOA:A5VXX7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXX7"
FT                   /protein_id="ABQ76737.1"
FT                   /translation="MTGFKSVGSLQRVRGWLALGLLAPFSLSAVAETVAAQAAEDNSLD
FT                   LPALTIEGNRLYDMLPSEETGGYSVDAATVGTKTPAALKDIPQSITVYTQDYVKDRQFV
FT                   HLDDLAKYTAGLRTLTNDSGRSSIYARGYEYSEFNIDGLPAPMASIFGTVPSLAAFDRV
FT                   EIMRGPAGLFSSTSELGGIVNMVRKRPTAEFQGHIEGSYGTWDTNHEEIDLSGPLDEAG
FT                   RVRGRFIASRDDTNGEVDYNANTSNTYYGALDIDLDDATTLSFGLMHEVKNITPHNGYP
FT                   ATLSGEVPDFSHSRFLGADWNYFDGKTTDLVAELTHRFDNGGYGRVAARGSHRDTNYLY
FT                   AFTATNATTGANSERASARDFTQDTYSLDASYSQPFETFGQVSEFVVGSDYKNYDTEYL
FT                   NGTTNLGAINVNTYSPKQFAKPSPNYSTETGMQEEEYGLYSKVTFRPVERLALIAGGRF
FT                   SWYRGDFYTTTLSSGATTNDSKRVDGHFTPYGGLVYDLTDNHALYASYSQVFKPQSDTD
FT                   SNGRVLKPREGEQYEFGLKSSYFGGDLNTRFSVFRLTDKNRATTVYDADGVATTDSVAS
FT                   GKTRVKGAEVEVSGKLTPNWELLAGYTWMETETVKGDAETTFFIMPRNQASLWSKYTIS
FT                   QGPLTGLAVGGGISAMSNFHSESGGVRIDAPGYATVDAMLSYPVTSKLTATLNVNNLFD
FT                   RDYLSRVGSTSTFNFYGPSRSMMVGARYDF"
FT   sig_peptide     634840..634935
FT                   /locus_tag="Pput_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.895 at
FT                   residue 32"
FT   gene            complement(637191..637655)
FT                   /locus_tag="Pput_0570"
FT   CDS_pept        complement(637191..637655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0570"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76738"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXX8"
FT                   /protein_id="ABQ76738.1"
FT                   /translation="MNAMLKELHAYHHEVATKITQIKELLERIRHGSAGADDCKLLFKQ
FT                   LEALHGDAERHHHENEELIRLALLATDAPIHQRVMAIEQDHKAFKRIAGQLKMLEQSTQ
FT                   EARVIADTIEDFIKKYYDHMDAEENIFFPVADKWLSDTQWQEIKHQWHPA"
FT   gene            complement(637784..637939)
FT                   /locus_tag="Pput_0571"
FT   CDS_pept        complement(637784..637939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76739"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXX9"
FT                   /protein_id="ABQ76739.1"
FT                   /translation="MHSTQPLAPPVVLSPPLFKDSTQAILVCLRLLAMHRDIKLIFQNL
FT                   PRGRFF"
FT   gene            complement(638151..638924)
FT                   /locus_tag="Pput_0572"
FT   CDS_pept        complement(638151..638924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76740"
FT                   /db_xref="GOA:A5VXY0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXY0"
FT                   /protein_id="ABQ76740.1"
FT                   /translation="MKRTITTLVVAGAAASAGVLGAAYLGLVNVGADDPHFPAVHAFLV
FT                   MARDRSIEVRARNIEVPNLKDENLIRVGAGNYNAMCIGCHLAPGVEKTELSQALYPSPP
FT                   NLGKLGIGGKPAVAFWTIKHGIKASGMPAWGKSMGDEYIWGLVAFLDQLPQMNAQQYNA
FT                   MVAISGGHQHGGGESEMHSHEGQHGDNVPNHPAEAVSGRDHHDRGHAQAHHPKSPSPEP
FT                   APEHHGHDETGSDHHSKPAQKKPIHRDGAEHTHEG"
FT   sig_peptide     complement(638859..638924)
FT                   /locus_tag="Pput_0572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.686 at
FT                   residue 22"
FT   gene            complement(638934..639869)
FT                   /locus_tag="Pput_0573"
FT   CDS_pept        complement(638934..639869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0573"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76741"
FT                   /db_xref="GOA:A5VXY1"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXY1"
FT                   /protein_id="ABQ76741.1"
FT                   /translation="MANSLARPSLLALTLSAGMLGAVPSFAADEMDHSAMGHGSMKMSR
FT                   APSHDSMAGMDHGAMDHSTMNHGSGEPATSSRTPIPELTDADRQAAFPPLGGHQMHDSA
FT                   INSFFLLDQLEYQDADDGSALSWDASGWIGGDINRLWLRSEGERTNGVTEDAELQVLYG
FT                   RSISPWWDVVAGVRQDFKPESPQTWAAFGIQGMALYDFEAEATAFIGENGQTAARLEGD
FT                   YDILLTNRLVLQPTVEANFYGKNDPARDVGSGLANTEVGLRLRYEIVRQFAPYIGVTWS
FT                   RSYGKTADFIRDEGGDVDEARFVAGIRMWF"
FT   sig_peptide     complement(639786..639869)
FT                   /locus_tag="Pput_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(640191..642050)
FT                   /locus_tag="Pput_0574"
FT   CDS_pept        complement(640191..642050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0574"
FT                   /product="copper-resistance protein, CopA family"
FT                   /note="TIGRFAM: copper-resistance protein, CopA family;
FT                   PFAM: multicopper oxidase, type 1; multicopper oxidase,
FT                   type 2; multicopper oxidase, type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76742"
FT                   /db_xref="GOA:A5VXY2"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXY2"
FT                   /protein_id="ABQ76742.1"
FT                   /translation="MSGRNGMQSKTTRRSFVKGLAATGILGGLGMWRMPVWALTSPGQP
FT                   NVLTGTDFDLYIGELPVNITGAKRTAMAINGSVPGPTLRWREGDIVTLRVRNRLKQDTS
FT                   IHWHGIILPANMDGVPGLSFHGIAPDGMYEYKFKLHQNGTYWYHSHSGFQEQVGVYGAL
FT                   VIDAKEPEPFAYDRDYVVMLSDWTDEDPAHVLSKLKKQSDYYNFHKRTVGDFVNDVSEM
FT                   GWSAAMADRKMWAEMKMSPTDLADVSGYTYTYLMNGQAPDGNWTGVFKPGERIRLRFIN
FT                   GSAMTYFDVRIPGLKMTVVAADGQYVHPVSVDEFRIAVAETYDVIVEPEDEQAYTIFAQ
FT                   SMDRTGFSRGTLAIREGLQAAVPTVDPRPLISMNDMGMDHSSMAGMDHSSMAGMDHSKM
FT                   AGMDHGSMAGMDHSKMAGTDHGSMAGMDHSKMAGMDHGSMAGMSKEMQSHPDSELNNPL
FT                   VDMQTMTPTAKLDDPGIGLRNNGRRVLTYADLRSTFIDPDGREPSRNIELHLTGHMEKF
FT                   AWSFDGIKFSDAAPLRLKYGERLRITLINDTMMTHPIHLHGMWSDLEDENGNFMVRKHT
FT                   IDMPPGSKRSYRVTADALGRWAYHCHLMFHMETGMFREVRVDE"
FT   sig_peptide     complement(641934..642050)
FT                   /locus_tag="Pput_0574"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.991 at
FT                   residue 39"
FT   gene            complement(642327..642482)
FT                   /locus_tag="Pput_0575"
FT   CDS_pept        complement(642327..642482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76743"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXY3"
FT                   /protein_id="ABQ76743.1"
FT                   /translation="MLFLGTRLPGLLYPLRQGEALPITRNEEIAPCSWPFQFAASNATN
FT                   VKLTEK"
FT   gene            complement(642990..643691)
FT                   /locus_tag="Pput_0576"
FT   CDS_pept        complement(642990..643691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0576"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76744"
FT                   /db_xref="GOA:A5VXY4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXY4"
FT                   /protein_id="ABQ76744.1"
FT                   /translation="MNTSGDRLRALLQECGLTPSDFAAQRSVTAQHVNNWFKRGVPLAR
FT                   LDELADLFCVHRRWLRTGEGPKHPNPLLRNGLPRPVPANPLTPLSGHRGRLLKVPYYEV
FT                   SNGLLSPVSSKHLRLPAKALKGLGVQAGNAICLAMPASNMLPLIPLEATLAIDLGMTQV
FT                   VEGETYALLQNGMLRVNNLSLGPHDTLYLHSHDRRNYTVERYTAAQRQAQGLEILGWVF
FT                   HWSHFRQQRPS"
FT   gene            complement(643878..644405)
FT                   /locus_tag="Pput_0577"
FT   CDS_pept        complement(643878..644405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0577"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76745"
FT                   /db_xref="GOA:A5VXY5"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXY5"
FT                   /protein_id="ABQ76745.1"
FT                   /translation="MSYSKIPAGKDLPNDIYVAIEIPANHAPIKYEIDKDSDTLFVDRF
FT                   MATPMFYPANYGFIPNTLADDGDPLDVLVVTPYPVAPGSVIRARPVGVLNMTDDGGGDA
FT                   KVIAVPHDKLSQLYVDVKEYTDLPALLIQQIEHFFANYKDLEKGKWVKIEGWEGADAAR
FT                   AAITKSVAAYKG"
FT   gene            complement(644498..645313)
FT                   /locus_tag="Pput_0578"
FT   CDS_pept        complement(644498..645313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0578"
FT                   /product="protein of unknown function DUF980"
FT                   /note="PFAM: protein of unknown function DUF980"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76746"
FT                   /db_xref="GOA:A5VXY6"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXY6"
FT                   /protein_id="ABQ76746.1"
FT                   /translation="MWSFSAWRRKRTLARYPITPQQWQAVRERLPMLDGISDAEDRWLR
FT                   EACILFLLDKHLTCLPGVELDDEQRLMLAAQAQLPLLHLGELNWYQGFHEIILYPDDFK
FT                   SPQRHRDASGVEHVWDGEHSGEAWQQGPIILAWNGVQASGGWEAYNLVIHELAHKLDML
FT                   NGDANGLPPLHSSMPVDEWATAMQQAYDDLNQQLDANPDAETAIDPYAAENPAEFFAVT
FT                   SEYFFSAPDLLHQAYPQVYHQLSLFYRQDPLARLCRLQAEHPEYRESHA"
FT   gene            complement(645334..645981)
FT                   /locus_tag="Pput_0579"
FT   CDS_pept        complement(645334..645981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0579"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76747"
FT                   /db_xref="GOA:A5VXY7"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXY7"
FT                   /protein_id="ABQ76747.1"
FT                   /translation="MDFNPLDLILHLDAYLDLLVTNYGPWIYAILFTVIFCETGLVVMP
FT                   FLPGDSLLFIAGAVAAGGGMDPVLLAGLLMAAAILGDSTNYVIGRTAGERLFNNPNSKI
FT                   FRRDYLQRTHDFYERHGGKTVTMARFLPILRTFAPFVAGIAHMHYPRFLGFSVAGSLLW
FT                   VGGLVTLGYFFGNVPFIKQHLSLMVVGIIILSLVPMILGLLRGRLGRTAKAH"
FT   gene            complement(646199..646657)
FT                   /locus_tag="Pput_0580"
FT   CDS_pept        complement(646199..646657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0580"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76748"
FT                   /db_xref="GOA:A5VXY8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXY8"
FT                   /protein_id="ABQ76748.1"
FT                   /translation="MRIIKATLEHLDLLTPLFVKYREFYGQLPYPDSSRSFLEKRLKRD
FT                   ESVIYLALPDDDDSKLLGFCQLYPSYSSLSLKRVWILNDIYVAEDSRRMLVADHLIREA
FT                   KKMAKETNAVRMRVSTSANNEVAHKTYESIGFREDTEFKSYILPISQD"
FT   gene            complement(646765..647583)
FT                   /locus_tag="Pput_0581"
FT   CDS_pept        complement(646765..647583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0581"
FT                   /product="Ethanolamine ammonia-lyase light chain"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76749"
FT                   /db_xref="GOA:A5VXY9"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5VXY9"
FT                   /protein_id="ABQ76749.1"
FT                   /translation="MDHRTPTPDNPWLALRNLTPARIALGRTGTSLPTGAQLDFQFAHA
FT                   QARDAVHLAFDHAGLASQLSDRGRESLVLHSAASDRHQYLQRPDLGRRLNEDSITTLRQ
FT                   HAQANPGGVDLAIVVADGLSALAVHRHTLPFLTRFDEQAAADGWTSAPVVLVQQGRVAV
FT                   ADEVGELLGARMTVMLIGERPGLSSPDSLGLYFTYAPKVGLTDAYRNCISNIRLEGLSY
FT                   GMAAHRLLYLMREACRRQLSGVNLKDEAEVHSLENEDSASQKGNFLLGKE"
FT   gene            complement(647592..648986)
FT                   /locus_tag="Pput_0582"
FT   CDS_pept        complement(647592..648986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0582"
FT                   /product="Ethanolamine ammonia-lyase heavy chain"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76750"
FT                   /db_xref="GOA:A5VXZ0"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXZ0"
FT                   /protein_id="ABQ76750.1"
FT                   /translation="MASFVHTVGHLVYRFDSLKDVMAKASPARSGDCLAGVAASNDGER
FT                   VAAQMALANIPLTHFLNEALIPYEADEVTRLIIDTHDAQAFAPVSHLTVGGLRDWLLSE
FT                   EANEDSLRALAPGLTPEMAAAVSKIMRVQDLVLVAQKIRVVTRFRGTMGLRGRLSTRLQ
FT                   PNHPTDEPAGIAASILDGLLYGNGDAMIGINPATDSIASICALLEMLDAIIQRYDIPTQ
FT                   SCVLTHVTTSIEAINRGVPLDLVFQSIAGTEAANAGFGINLNVLQEGYEAGLSLKRGTL
FT                   GQNLMYFETGQGSALSANAHHGVDQQTCETRAYAVARHFKPFLVNTVVGFIGPEYLYNG
FT                   KQIIRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDTLLTLLGVAGINFIMGIPGS
FT                   DDIMLNYQTTSFHDALYARQTLGLKPGPEFEAWLARTGIFTQADGRVRFGDNLPPAFRQ
FT                   ALAQLA"
FT   gene            complement(649033..650481)
FT                   /locus_tag="Pput_0583"
FT   CDS_pept        complement(649033..650481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0583"
FT                   /product="ethanolamine:proton symporter, EAT family"
FT                   /note="TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region; TC 2.A.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76751"
FT                   /db_xref="GOA:A5VXZ1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXZ1"
FT                   /protein_id="ABQ76751.1"
FT                   /translation="MPSEHSAGSPAGSSVDFEKVGSDYFQQRELKKGAAGWVLLVGLGV
FT                   AYVISGDYAGWNFGLAQGGWGGMFLATLLMATMYLCMCFSLAELSSMIPTAGGGYGFAR
FT                   SAFGPWGGFLTGTAILIEYAIAPAAIAVFIGAYCQSLFGIGGWMIYLAFYIVFISIHIF
FT                   GVGEALKLMFIITAIAAIALAVFLIGMVPHFDAANLFDIAKTDAVGASSFLPFGYVGVW
FT                   AAIPYAIWFFLAVEGVPLAAEETKNPKRDLPRGLIGAMLVLLAFALLILVVGPGGAGSE
FT                   ALKASGNPLVEALSKAYGGSTWMGGFVNLVGLAGLIASFFSIIYAYSRQIFALSRAGYL
FT                   PRKLSETNKSKAPVLALVIPGIIGFALSLTGQGDLLILVAVFGATLSYVLMMAAHITLR
FT                   IRRPKMERPYRTPGGIFTSGLALVLACIAVVAGFLVDPRVVIGAAVIYAVLIAYFAFYS
FT                   RHHLVAGTPEEEFAAIQKAEEALH"
FT   gene            complement(650709..652229)
FT                   /locus_tag="Pput_0584"
FT   CDS_pept        complement(650709..652229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0584"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76752"
FT                   /db_xref="GOA:A5VXZ2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXZ2"
FT                   /protein_id="ABQ76752.1"
FT                   /translation="MRYAHPGTEGAKVSFKSRYGNYIGGEFVTPVKGPYFDNTSPVNGK
FT                   LIAEFPRSTAEDIEKALDAAHAAADAWGRTSVQDRSNVLLKIADRIEQNLELLAITETW
FT                   DNGKPIRETLNADIPLAVDHFRYFAGCIRAQEGGAAEINEGTVAYHIHEPLGVVGQIIP
FT                   WNFPILMAAWKLAPALAAGNCVVLKPAEQTPLGITVLLEVIGDLLPPGVLNVVQGYGRE
FT                   AGEALATSKRIAKIAFTGSTPVGSHIMKCAAENIIPSTVELGGKSPNVYFEDIMQAEPS
FT                   FIEKAAEGMVLAFFNQGEVCTCPSRALVQESIYPQFMEVVMKKVLQIKRGDPLDTDTMV
FT                   GAQASQQQFEKILSYLQIAQDEGAELLTGGKVEKLEGSLATGYYIQPTLLKGNNKMRVF
FT                   QEEIFGPVVSVTTFKDEAEALAIANDTEFGLGAGVWTRDINRAYRMGRGIKAGRVWTNC
FT                   YHLYPAHAAFGGYKKSGVGRETHKMMLDHYQQTKNLLVSYDINPLGFF"
FT   gene            652484..654499
FT                   /locus_tag="Pput_0585"
FT   CDS_pept        652484..654499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0585"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; GAF domain protein;
FT                   ATPase associated with various cellular activities, AAA_5;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76753"
FT                   /db_xref="GOA:A5VXZ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXZ3"
FT                   /protein_id="ABQ76753.1"
FT                   /translation="MQSNHFTRHARQVHSVAHGGAGEGGSDPSIARSWLRCLEDYHLDP
FT                   AVIEAPVVLEHGRLLESRERLHQVLQIADHEMNSLHQQLSGAGHAVLLTDARGVILNCV
FT                   SAPAERRSFERAGLWLGADWSEAREGTNGIGTCLVERQALTIHQNEHFRGRHTGLTCSA
FT                   SPVFDPHGDLLAVLDVSSARPDVSRQSQFHTMALVNLSAKMIESCYFLRHFEQQWLLRF
FT                   HLQAESVGLFSEGLLAFDGDGRICAANQSALNLLGTVRGGVLGKPLTCFFACSHDEMFS
FT                   RATPGGSTAWPLRTLDGRQVFASLRGQARAPVWSVPAAQPRPAGEVEPLVCLLDPALQN
FT                   DFRRSVRVFERDVPLLLRGETGCGKEAFAQAVHQASERRGKPFVAINCASIPESLIESE
FT                   LFGYRGGSFTGARKEGMRGKLLQADGGTLLLDEIGDMPLALQTRLLRVLEERQVVPIGG
FT                   EPQAVDVRIVSATHRDLLERVEQGSFREDLYYRLNGLEVALPAVRERSDKAQLLDFLLR
FT                   QETQGQRIDIEPRARQALLAFNWPGNVRQMRNVLRTLVALCEDARITFTDLPAVIRTSP
FT                   PPVGAGEPAKISDQAIEGEGVALVRGQARSHRSGGAAEIEGESVGTEVLLDAERQALKE
FT                   VLEAKHWHLTRVAEHLGISRNTLYRKLRKHGITRGD"
FT   gene            654566..655915
FT                   /locus_tag="Pput_0586"
FT   CDS_pept        654566..655915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0586"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase, middle
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76754"
FT                   /db_xref="GOA:A5VXZ4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXZ4"
FT                   /protein_id="ABQ76754.1"
FT                   /translation="MHIHILGICGTFMGSLAVLAKELGHRVTGSDANVYPPMSTQLEAQ
FT                   GIELTQGYDPAQLDPAPDLVVIGNAMSRGNPAVEYVLNKGLPYVSGPQWLADHVLQGRW
FT                   VLAVAGTHGKTTTSSMLAWVLEHAGMSPGFLIGGVPQNFSVSARLGDTPFFVVEADEYD
FT                   SAFFDKRSKFVHYHPRTAILNNLEFDHADIFPDLASIERQFHHLVRTIPSEGLVIHPTT
FT                   EQALERVIGMGCWTPVQTTGEGGQWQARLLSPDGSRFEVLFEGEVQGVVDWALTGQHNV
FT                   ANALATLAAARHVGVVPAMGIDGLSAFKSVKRRMEKVAEVQGVTIYDDFAHHPTAIATT
FT                   LDGLRKRVGEAPVIAVIEPRSNSMKLGAHRDGLPESVNDADQVIWYAPANLGWDLAATA
FT                   AQCKVPSVVADSLEAIIERIKGQARPGTHVVIMSNGGFGGLHGKLAEALK"
FT   sig_peptide     654566..654628
FT                   /locus_tag="Pput_0586"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            655912..656541
FT                   /locus_tag="Pput_0587"
FT   CDS_pept        655912..656541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0587"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76755"
FT                   /db_xref="GOA:A5VXZ5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXZ5"
FT                   /protein_id="ABQ76755.1"
FT                   /translation="MNGPERITLAMTGASGAQYGLRLLDCLVREDREVHFLISKAAQLV
FT                   MATETDVVLPAKPQAMQAFLTEYTGAADGQIRVYGKEDWMSPVASGSGAPAAMVVVPCS
FT                   TGTLSAIATGACNNLIERAADVTLKERRQLILVPREAPFSTIHLENMLKLSQMGAVILP
FT                   AAPGFYHQPQTIDDLVDFVVARILNLLNIPQDMLPRWGEHHFGVDD"
FT   gene            656538..656825
FT                   /locus_tag="Pput_0588"
FT   CDS_pept        656538..656825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0588"
FT                   /product="protein of unknown function DUF1375"
FT                   /note="PFAM: protein of unknown function DUF1375"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76756"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXZ6"
FT                   /protein_id="ABQ76756.1"
FT                   /translation="MKRALAGLLALVMLGGCATVRTLDANKPGAPVVYAGTRLDLYVIN
FT                   GGCCPRDHYGADAPAYPRLDLPGSMLLDTLLLPLSLLTAAGIGFQASGGL"
FT   sig_peptide     656538..656606
FT                   /locus_tag="Pput_0588"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.649 at
FT                   residue 23"
FT   gene            complement(656932..657576)
FT                   /locus_tag="Pput_0589"
FT   CDS_pept        complement(656932..657576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0589"
FT                   /product="nucleoside-diphosphate-sugar epimerase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76757"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXZ7"
FT                   /protein_id="ABQ76757.1"
FT                   /translation="MYLTPQHVLLAGATGLTGEHLLDRLLNEPTITRVLAPTRRPLAEH
FT                   PHLENPVGDPAVFLPQLAGRVDIAYCCLGTTLKQAGSESAFRAVDLDMVVAFSKRAREM
FT                   GARHLLVVSAVGADPKSSIFYNRVKGEMEEALKAQDWPQLTIVRPSFLLGERLEPRLTE
FT                   QLVAPFSRLIPGKYRGIEACTLARALWRLALEEEDGVRVVESDELRRLGKI"
FT   gene            complement(657604..659415)
FT                   /locus_tag="Pput_0590"
FT   CDS_pept        complement(657604..659415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0590"
FT                   /product="MORN repeat-containing protein"
FT                   /note="PFAM: MORN repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76758"
FT                   /db_xref="GOA:A5VXZ8"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXZ8"
FT                   /protein_id="ABQ76758.1"
FT                   /translation="MRRHRGSLSQDPILRHTRQTYCPVIAMRPLLPITLVLLLAACGDG
FT                   ESLLPPDARLPDGGRYRGQVVDGLLQGEGRIDYPNGSWYAGSFKDGQWHGQGEWHGQNG
FT                   EVYRGQFAEGLFQGLGELTTPGSHYSGTFRHGRRDGEGTLKQADQTYRGQFKDDLYDGA
FT                   GQLDLADGSRYQGLFAKGKPNGAGVRSDASGNQFSGHFVNGQLQGAGTYDSVDGEQYIG
FT                   EFKDNRLEGRGRYENADGDVWIGEFKDGSLIGEGELLGSDGSHYKGEFADWRLSGQGSL
FT                   QLADGSKYIGGFLNDAYHGHGRLILPTGKVESGTWANGVRVRDQNGKLLPDPLDLALLN
FT                   QGRLLDEALARVPRSAPPIQLYSLVVAGDGQQSVFLREADYVSNLLKVRFGARGQVTLV
FT                   NHRDHMATRPMATRENLSRAAATLAERSGPEDLVFIYLTSHGSQDHQLVLDQPRLQLAD
FT                   LAADELATALAPLKDRDKVIVISACYSGGYIAPLKDERTLIMTAARADRVSFGCSEEAD
FT                   FTYFGDALFAEALNQTDDLKQAFELARASVAEREQREGFKASEPQLWAPPAVLEHWHHL
FT                   RQQQAEEALRNATQANVREQAKMPGTH"
FT   gene            complement(659551..660639)
FT                   /locus_tag="Pput_0591"
FT   CDS_pept        complement(659551..660639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0591"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76759"
FT                   /db_xref="GOA:A5VXZ9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR027399"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5VXZ9"
FT                   /protein_id="ABQ76759.1"
FT                   /translation="MNDLSHTHMRAAVWHGRNDIRVEQVPLPADPAPGWVQIKVDWCGI
FT                   CGSDLHEYVAGPVFIPVEAPHPLTGIQGQCILGHEFCGHIAKLGEGVEGYAVGDPVAAD
FT                   ACQHCGTCYYCTHGLYNICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAGALI
FT                   EPLAVGMHAVKKAGSLLGQTVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARKAKAK
FT                   EVGANVVLDPSQCDALAEIRALTAGLGVDVSFECIGNKHTAKLAIDTIRKAGKCVLVGI
FT                   FEEPSEFNFFELVSTEKQVLGALAYNGEFADVIAFIADGRLDIRPLVTGRIGLEQIVEL
FT                   GFEELVNNKEENVKIIVSPGVR"
FT   gene            complement(660668..661774)
FT                   /locus_tag="Pput_0592"
FT   CDS_pept        complement(660668..661774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0592"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; biotin/lipoyl
FT                   attachment domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76760"
FT                   /db_xref="GOA:A5VY00"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5VY00"
FT                   /protein_id="ABQ76760.1"
FT                   /translation="MSQIHTLTMPKWGLSMTEGRVDTWLKQEGDEISKGDEVLDVETDK
FT                   ISSSVEAPFSGVLRRQVAKPDETLPVGALLAVVVEGEAEESEIDAVVQRFQAEFVAEGG
FT                   ADQSQGPAPQKAEVGGRLLRWFELGEGGTPLVLVHGFGGDLNNWLFNHPALAAERRVIA
FT                   LDLPGHGESAKALQRGDLDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARLAPQR
FT                   VASLSLVASAGLGEAINGQYLQGFVTAANRNALKPQMVQLFADPALVTRQMLEDMLKFK
FT                   RLEGVDQALQQLARALADGDRQRHDLRGVLGNHPALVVWGGKDAIIPASHAEGLEAEVL
FT                   VLPEAGHMVQMEAAEQVNQQLLAFLRKH"
FT   gene            complement(661771..662793)
FT                   /locus_tag="Pput_0593"
FT   CDS_pept        complement(661771..662793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0593"
FT                   /product="Transketolase, central region"
FT                   /note="PFAM: Transketolase, central region; Transketolase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76761"
FT                   /db_xref="GOA:A5VY01"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A5VY01"
FT                   /protein_id="ABQ76761.1"
FT                   /translation="MARKISYQQAINEALAQEMRRDSTVFIIGEDVAGGAGAPGEDDAW
FT                   GGVLGVTKGLYHQFPGRVLDAPLSEIGYVGAAVGAATQGLRPVCELMFVDFAGCCLDQI
FT                   LNQAAKFRYMFGGKAVTPLVMRTMYGAGLRAAAQHSQMLTSLWTHIPGLKVVCPSSPYD
FT                   AKGLLIQAIRDNDPVIFCEHKLLYSMQGEVPEEVYTVPFGEANFLRDGDDVTLVTYGRM
FT                   VHVALEAANNLARQGIDCEVLDLRTTSPLDEDSILESVEKTGRLVVIDEANPRCSMATD
FT                   ISALVAQKAFAALKGPIEMVTAPHTPVPFSDALEDLYIPDAAKIEAAVRKVIEAARSAA
FT                   "
FT   gene            complement(662827..663804)
FT                   /locus_tag="Pput_0594"
FT   CDS_pept        complement(662827..663804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0594"
FT                   /product="Pyruvate dehydrogenase (acetyl-transferring)"
FT                   /EC_number="1.2.4.1"
FT                   /note="PFAM: dehydrogenase, E1 component"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76762"
FT                   /db_xref="GOA:A5VY02"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5VY02"
FT                   /protein_id="ABQ76762.1"
FT                   /translation="MSNQLSTDQLLHAYEVMRTIRAFEERLHVEFATGEIPGFVHLYAG
FT                   EEASAAGVMAHLRDSDCIASTHRGHGHCIAKGVDVYGMMAEIYGKKTGVCGGKGGSMHI
FT                   ADLEKGMLGANGIVGAGAPLVAGAALAAKLKGRDDVSVAFFGDGASNEGAVFEAMNMAS
FT                   IMNLPCIFVAENNGYAEATASNWSVACDHIADRAAGFGMPGVTIDGFDFFAVYEAAGAA
FT                   IERARSGQGPSLIEVKLSRYYGHFEGDAQTYRAPDEVKNLRESRDCLMQFRNKTTRAGL
FT                   LKAEQLDAIDARVEDLIEDAVRRAKSDPKPQPADLLTDVYVAYP"
FT   gene            complement(663827..664882)
FT                   /locus_tag="Pput_0595"
FT   CDS_pept        complement(663827..664882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0595"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76763"
FT                   /db_xref="GOA:A5VY03"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR011391"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR039065"
FT                   /db_xref="UniProtKB/TrEMBL:A5VY03"
FT                   /protein_id="ABQ76763.1"
FT                   /translation="MPLPAPIVGIIANPASGRDLRRLTANAGLYSSTDKASAIQRLLAA
FT                   FGATGIGQVLLPSDMTGIAAAVLKASQGPGARDQHWPAIEILDLPLSQTVADTRLATRR
FT                   MVERGVAMIAVLGGDGTHKAVAAEAGDVPLLTLSTGTNNAFPELREATSAGLAGGLLAS
FT                   GRVPASIGLRRNKRLLVNVPEQQLAEWALVEVAVSPQRFIGARALSRSEDLCEVFACFA
FT                   EPHAIGLSALCGLWCPVSRQDPHGAWVRLAPDAEQALLAPLAPGLLQACGISACGQLTP
FT                   GVAQRLSLASGTLALDGEREIEFAEHDTPTITLDHQGPLSVDVEAVLAHAARHHLLAVP
FT                   RGHRLHPANPC"
FT   gene            665166..667019
FT                   /locus_tag="Pput_0596"
FT   CDS_pept        665166..667019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0596"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76764"
FT                   /db_xref="GOA:A5VY04"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A5VY04"
FT                   /protein_id="ABQ76764.1"
FT                   /translation="MLAANSRAHVDCVSRVLKNADRLPQAPVPPLILDSWRRSMDVYRL
FT                   DPGSQQGPRILSQSLLNECRERAELFLRIASDAVARLHERVRGADYCVLLTDAQGRTID
FT                   YRVESAIRNDCRKAGLYLGTCWSEGEEGTCGVAAVLTSKAPITVHKRDHFRAAFIGLTC
FT                   TAAPVFDPLGELLGVVDVSALQSPDDRRSQHLIRQLVEQTAREIENAFFMHSAQGHWVM
FT                   RAHGTPGYVESQPDYLLAWDADGRLQAINSLARQRLVERLGRLPEHIGELFDIDQLRRV
FT                   SASSAQRLPGLGGLYGRVSAPQQRQRAQPLRQAQDTRIEQHLRLATRVKDCNLAVLVLG
FT                   ETGAGKEVFARQLHQQSQRCDGPFVTLNCAAIPETLIESELFGYVAGAFTGASSKGMQG
FT                   LLQQADGGTLFLDEIGDMPLNLQTRLLRVLAEGEVAPLGAARRERVDIQVICATHRDLA
FT                   AMVEDGRFREDLYFRLANARFELPPLRERDDRLGLIHQLLAEEAAACGVEVVLADDALQ
FT                   ALLVYRWPGNLRQLRQVLRYACAVSEGGQVRLQDLPQEVRGEAVGSAESGVSCPARQLL
FT                   LDALIRHRWKPADAARALGISRATLYRRVHEHRIDMPRMKG"
FT   gene            complement(667213..668568)
FT                   /locus_tag="Pput_0597"
FT   CDS_pept        complement(667213..668568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0597"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /EC_number="6.3.4.14"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: phosphoribosylglycinamide synthetase; ATP-dependent
FT                   carboxylate-amine ligase domain protein, ATP-grasp;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76765"
FT                   /db_xref="GOA:A5VY05"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A5VY05"
FT                   /protein_id="ABQ76765.1"
FT                   /translation="MSGKLEKVLIANRGEIALRILRACKELGIKTVAVHSTADRELMHL
FT                   GLADESVCIGPASSKDSYLHIPAIIAAAEVTGATAIHPGYGFLAENADFAEQVEKSGFA
FT                   FIGPKADTIRLMGDKVSAKDAMIKSGVPTVPGSDGPLPEDEEVALAIARDVGYPVIIKA
FT                   AGGGGGRGMRVVHKEEDLISSAKLTRTEAGAAFGNPMVYLEKFLTNPRHVEVQVLSDGQ
FT                   GNAIHLGDRDCSLQRRHQKVLEEAPAPGIDEKARQEVFKRCVDACIEIGYRGAGTFEFL
FT                   YENGRFYFIEMNTRVQVEHPVSEMVTGIDIVKEMLSIAAGNKLSFRQEDVVIRGHSLEC
FT                   RINAEDPKKFIPSPGKVKHFHAPGGNGVRVDSHLYSGYSVPPNYDSLIGKLITYGKDRD
FT                   EAMARMRNALDEIVVDGIKTNIPLHRDLVRDEGFCKGGVNIHYLEHKLANQE"
FT   gene            complement(668586..669047)
FT                   /locus_tag="Pput_0598"
FT   CDS_pept        complement(668586..669047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0598"
FT                   /product="biotin carboxyl carrier protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76766"
FT                   /db_xref="GOA:A5VY06"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A5VY06"
FT                   /protein_id="ABQ76766.1"
FT                   /translation="MDIRKVKKLIELLEESGIDELEIKEGEESVRISRHSKTPAAQQFY
FT                   APAPMAAAPAAAPVAAAAPAAEATAAAPALKGTVIRSPMVGTFYRKPSPTSPNFAEVGQ
FT                   SVKKGDTLCIVEAMKMMNHIEADVGGVIDAILVEDGQPVEFDQPLFTIV"
FT   gene            complement(669148..669603)
FT                   /locus_tag="Pput_0599"
FT   CDS_pept        complement(669148..669603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0599"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76767"
FT                   /db_xref="GOA:A5VY07"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:A5VY07"
FT                   /protein_id="ABQ76767.1"
FT                   /translation="MATLLVLHGPNLNLLGTREPGHYGAVTLAQINQDLEQRARAAGHH
FT                   LQYLQSNAEYELIDRIHAARNEGVDFILINPAAFTHTSVALRDALLAVSIPFIEVHLSN
FT                   VHKREPFRHHSYFSDVAVGVICGLGASGYRLALESALEQLAANAQPK"
FT   gene            complement(669783..671555)
FT                   /locus_tag="Pput_0600"
FT   CDS_pept        complement(669783..671555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0600"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; Thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76768"
FT                   /db_xref="GOA:A5VY08"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A5VY08"
FT                   /protein_id="ABQ76768.1"
FT                   /translation="MRRLFLMLFLLLASPAFATGLLDNRPSATLGAASLANNADFLPVH
FT                   EAFKLNLVQADAQTIKLRFVATDGYYLYRHRFQFHTEPADITLGTPNIPKGEAKHDEFF
FT                   GDVEVYHGVLDIELPRKDPRAFTLLVGYQGCADKGLCYPPETARLSIDGEGVANTPATR
FT                   EHGWNWKSLLLFFLAGVGLTFTPCVLPMLPILSGVVLRGQVGGVRGLALSLAYVLPMAA
FT                   SFAVLGALMGLFGASLNLQARLQSAWVLVPFALFFVVFALAMFGLFELRLPQALSNRLN
FT                   NVANHTRGGSLLGAAVLGVLSSLLVSPCVSAPLAGALLYISASGDALGGALKLFTLGLG
FT                   MGAPLLLVATGGAAWLPKSGPWMNTVKNAIGVLLLGLAIGLLSRVLPGPVTLLLVGFLA
FT                   AGVALFLGALEFVVKTAAQRLAQLLGLALLVYALACWYGALTGQGDPLRPLPGASLAAS
FT                   GSLPTAKADAWQTITTPDALDAALAQAQAAGQPVLLDWYADWCISCKVIEHEVLNAPQV
FT                   QTQLAGFKLLRFDITDSNAEQRTLLDRYQLFGPPALLFFAANGSEITADRVIGEINAGE
FT                   FAQILTRVRGKVGL"
FT   sig_peptide     complement(671499..671555)
FT                   /locus_tag="Pput_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 19"
FT   gene            complement(671745..673706)
FT                   /locus_tag="Pput_0601"
FT   CDS_pept        complement(671745..673706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0601"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Pput_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ76769"
FT                   /db_xref="GOA:A5VY09"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A5VY09"
FT                   /protein_id="ABQ76769.1"
FT                   /translation="MRLKWLTNFNTLLLVTVCIALGATLWWSQRALERPYQLMERYLGL
FT                   SQQFQNQTARNIQAYLGSGDALRQAAAMEATQQLQAALTDWPVELAEKLRPSLDSLQAF
FT                   TANELLAAGKLAGDPQALLLQAERELGANFEQMASYARDSGNAEANRYLLPLLDATLHL
FT                   GRLSLARDKLVSSGRPELADEVERELQLIRAQAQTVDGLPLLGVTRTAESGADDFAAMM
FT                   GLESRASAQQEDIAVGLKRELQSLLNRYPAELQRTREQIERRVALAATTGQRLEAVQQA
FT                   IAALEPEVRGQHAKIAAEVRIIQGLMIGLILLIALLIDTLQRRLAGTLTGLAPALSCWA
FT                   EGDFAQAIALGKTNRELHDIQESLNRLRQYLVELVGTIRHNAEQVAGSSHALAGMSAAL
FT                   HGGAERQAGDTGQIRDALGELEATIQQVAGDASAAAEASRDAGRAVEQGQAVIGQSLSG
FT                   LRELVDEVQGNARMIEQLAEESATIGGVLTVIRAIAEQTNLLALNAAIEAARAGEMGRG
FT                   FAVVADEVRSLAQRTTGATGEIQALIDRLQQAARSSVAGMRAQLEHAEATANQAQAADG
FT                   ALDEIVCAIRTIADTAVRIADVTAQQSGAVSEIRDHSERIHALGEDNLQRIGEGREQGE
FT                   QLLSLGGELNRAVRAFRV"
FT   sig_peptide     complement(673638..673706)
FT                   /locus_tag="Pput_0601"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.429 at
FT                   residue 23"
FT   gene            complement(673950..675305)
FT                   /locus_tag="Pput_0602"
FT   CDS_pept        complement(673950..675305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pput_0602"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes