(data stored in SCRATCH3701 zone)

EMBL: CP000713

ID   CP000713; SV 1; circular; genomic DNA; STD; PRO; 2978976 BP.
XX
AC   CP000713; AAPX01000000-AAPX01000042;
XX
PR   Project:PRJNA15759;
XX
DT   06-JUN-2007 (Rel. 92, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 9)
XX
DE   Psychrobacter sp. PRwf-1 chromosome, complete genome.
XX
KW   .
XX
OS   Psychrobacter sp. PRwf-1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Moraxellaceae; Psychrobacter.
XX
RN   [1]
RP   1-2978976
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Tiedje J., Richardson P.;
RT   "Complete sequence of chromosome of Psychrobacter sp. PRwf-1";
RL   Unpublished.
XX
RN   [2]
RP   1-2978976
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Chain P., Malfatti S., Shin M., Vergez L., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Tiedjej J., Richardson P.;
RT   ;
RL   Submitted (24-MAY-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 92dd09361b92eaffe1a50e49cc21d8d4.
DR   BioSample; SAMN02598345.
DR   EnsemblGenomes-Gn; EBG00001460403.
DR   EnsemblGenomes-Gn; EBG00001460404.
DR   EnsemblGenomes-Gn; EBG00001460405.
DR   EnsemblGenomes-Gn; EBG00001460406.
DR   EnsemblGenomes-Gn; EBG00001460407.
DR   EnsemblGenomes-Gn; EBG00001460408.
DR   EnsemblGenomes-Gn; EBG00001460409.
DR   EnsemblGenomes-Gn; EBG00001460410.
DR   EnsemblGenomes-Gn; EBG00001460411.
DR   EnsemblGenomes-Gn; EBG00001460412.
DR   EnsemblGenomes-Gn; EBG00001460413.
DR   EnsemblGenomes-Gn; EBG00001460414.
DR   EnsemblGenomes-Gn; EBG00001460415.
DR   EnsemblGenomes-Gn; EBG00001460416.
DR   EnsemblGenomes-Gn; EBG00001460417.
DR   EnsemblGenomes-Gn; EBG00001460418.
DR   EnsemblGenomes-Gn; EBG00001460419.
DR   EnsemblGenomes-Gn; EBG00001460420.
DR   EnsemblGenomes-Gn; EBG00001460421.
DR   EnsemblGenomes-Gn; EBG00001460422.
DR   EnsemblGenomes-Gn; EBG00001460423.
DR   EnsemblGenomes-Gn; EBG00001460424.
DR   EnsemblGenomes-Gn; EBG00001460425.
DR   EnsemblGenomes-Gn; EBG00001460426.
DR   EnsemblGenomes-Gn; EBG00001460427.
DR   EnsemblGenomes-Gn; EBG00001460428.
DR   EnsemblGenomes-Gn; EBG00001460429.
DR   EnsemblGenomes-Gn; EBG00001460430.
DR   EnsemblGenomes-Gn; EBG00001460431.
DR   EnsemblGenomes-Gn; EBG00001460432.
DR   EnsemblGenomes-Gn; EBG00001460433.
DR   EnsemblGenomes-Gn; EBG00001460434.
DR   EnsemblGenomes-Gn; EBG00001460435.
DR   EnsemblGenomes-Gn; EBG00001460436.
DR   EnsemblGenomes-Gn; EBG00001460437.
DR   EnsemblGenomes-Gn; EBG00001460438.
DR   EnsemblGenomes-Gn; EBG00001460439.
DR   EnsemblGenomes-Gn; EBG00001460440.
DR   EnsemblGenomes-Gn; EBG00001460441.
DR   EnsemblGenomes-Gn; EBG00001460442.
DR   EnsemblGenomes-Gn; EBG00001460443.
DR   EnsemblGenomes-Gn; EBG00001460444.
DR   EnsemblGenomes-Gn; EBG00001460445.
DR   EnsemblGenomes-Gn; EBG00001460446.
DR   EnsemblGenomes-Gn; EBG00001460447.
DR   EnsemblGenomes-Gn; EBG00001460448.
DR   EnsemblGenomes-Gn; EBG00001460449.
DR   EnsemblGenomes-Gn; EBG00001460450.
DR   EnsemblGenomes-Gn; EBG00001460451.
DR   EnsemblGenomes-Gn; EBG00001460452.
DR   EnsemblGenomes-Gn; EBG00001460453.
DR   EnsemblGenomes-Gn; EBG00001460454.
DR   EnsemblGenomes-Gn; EBG00001460455.
DR   EnsemblGenomes-Gn; EBG00001460456.
DR   EnsemblGenomes-Gn; EBG00001460457.
DR   EnsemblGenomes-Gn; EBG00001460458.
DR   EnsemblGenomes-Gn; EBG00001460459.
DR   EnsemblGenomes-Gn; EBG00001460460.
DR   EnsemblGenomes-Gn; EBG00001460461.
DR   EnsemblGenomes-Gn; EBG00001460462.
DR   EnsemblGenomes-Gn; EBG00001460463.
DR   EnsemblGenomes-Gn; EBG00001460464.
DR   EnsemblGenomes-Gn; EBG00001460465.
DR   EnsemblGenomes-Gn; EBG00001460466.
DR   EnsemblGenomes-Gn; EBG00001460467.
DR   EnsemblGenomes-Gn; EBG00001460468.
DR   EnsemblGenomes-Gn; EBG00001460469.
DR   EnsemblGenomes-Gn; EBG00001460470.
DR   EnsemblGenomes-Gn; EBG00001460471.
DR   EnsemblGenomes-Gn; EBG00001460472.
DR   EnsemblGenomes-Gn; EBG00001460473.
DR   EnsemblGenomes-Gn; EBG00001460474.
DR   EnsemblGenomes-Gn; EBG00001460475.
DR   EnsemblGenomes-Gn; EBG00001460476.
DR   EnsemblGenomes-Gn; EBG00001460477.
DR   EnsemblGenomes-Gn; EBG00001460478.
DR   EnsemblGenomes-Gn; EBG00001460479.
DR   EnsemblGenomes-Gn; EBG00001460480.
DR   EnsemblGenomes-Gn; EBG00001460481.
DR   EnsemblGenomes-Gn; EBG00001460482.
DR   EnsemblGenomes-Gn; EBG00001460483.
DR   EnsemblGenomes-Gn; EBG00001460484.
DR   EnsemblGenomes-Gn; EBG00001460485.
DR   EnsemblGenomes-Gn; EBG00001460486.
DR   EnsemblGenomes-Gn; PsycPRwf_R0001.
DR   EnsemblGenomes-Gn; PsycPRwf_R0002.
DR   EnsemblGenomes-Gn; PsycPRwf_R0003.
DR   EnsemblGenomes-Gn; PsycPRwf_R0004.
DR   EnsemblGenomes-Gn; PsycPRwf_R0005.
DR   EnsemblGenomes-Gn; PsycPRwf_R0006.
DR   EnsemblGenomes-Gn; PsycPRwf_R0007.
DR   EnsemblGenomes-Gn; PsycPRwf_R0008.
DR   EnsemblGenomes-Gn; PsycPRwf_R0009.
DR   EnsemblGenomes-Gn; PsycPRwf_R0010.
DR   EnsemblGenomes-Gn; PsycPRwf_R0011.
DR   EnsemblGenomes-Gn; PsycPRwf_R0012.
DR   EnsemblGenomes-Gn; PsycPRwf_R0013.
DR   EnsemblGenomes-Gn; PsycPRwf_R0014.
DR   EnsemblGenomes-Gn; PsycPRwf_R0015.
DR   EnsemblGenomes-Gn; PsycPRwf_R0016.
DR   EnsemblGenomes-Gn; PsycPRwf_R0017.
DR   EnsemblGenomes-Gn; PsycPRwf_R0018.
DR   EnsemblGenomes-Gn; PsycPRwf_R0019.
DR   EnsemblGenomes-Gn; PsycPRwf_R0020.
DR   EnsemblGenomes-Gn; PsycPRwf_R0021.
DR   EnsemblGenomes-Gn; PsycPRwf_R0022.
DR   EnsemblGenomes-Gn; PsycPRwf_R0023.
DR   EnsemblGenomes-Gn; PsycPRwf_R0024.
DR   EnsemblGenomes-Gn; PsycPRwf_R0025.
DR   EnsemblGenomes-Gn; PsycPRwf_R0026.
DR   EnsemblGenomes-Gn; PsycPRwf_R0027.
DR   EnsemblGenomes-Gn; PsycPRwf_R0028.
DR   EnsemblGenomes-Gn; PsycPRwf_R0029.
DR   EnsemblGenomes-Gn; PsycPRwf_R0030.
DR   EnsemblGenomes-Gn; PsycPRwf_R0031.
DR   EnsemblGenomes-Gn; PsycPRwf_R0032.
DR   EnsemblGenomes-Gn; PsycPRwf_R0033.
DR   EnsemblGenomes-Gn; PsycPRwf_R0034.
DR   EnsemblGenomes-Gn; PsycPRwf_R0035.
DR   EnsemblGenomes-Gn; PsycPRwf_R0036.
DR   EnsemblGenomes-Gn; PsycPRwf_R0037.
DR   EnsemblGenomes-Gn; PsycPRwf_R0038.
DR   EnsemblGenomes-Gn; PsycPRwf_R0039.
DR   EnsemblGenomes-Gn; PsycPRwf_R0040.
DR   EnsemblGenomes-Gn; PsycPRwf_R0041.
DR   EnsemblGenomes-Gn; PsycPRwf_R0042.
DR   EnsemblGenomes-Gn; PsycPRwf_R0043.
DR   EnsemblGenomes-Gn; PsycPRwf_R0044.
DR   EnsemblGenomes-Gn; PsycPRwf_R0045.
DR   EnsemblGenomes-Gn; PsycPRwf_R0046.
DR   EnsemblGenomes-Gn; PsycPRwf_R0047.
DR   EnsemblGenomes-Gn; PsycPRwf_R0048.
DR   EnsemblGenomes-Gn; PsycPRwf_R0049.
DR   EnsemblGenomes-Gn; PsycPRwf_R0050.
DR   EnsemblGenomes-Gn; PsycPRwf_R0051.
DR   EnsemblGenomes-Gn; PsycPRwf_R0052.
DR   EnsemblGenomes-Gn; PsycPRwf_R0053.
DR   EnsemblGenomes-Gn; PsycPRwf_R0054.
DR   EnsemblGenomes-Gn; PsycPRwf_R0055.
DR   EnsemblGenomes-Gn; PsycPRwf_R0056.
DR   EnsemblGenomes-Gn; PsycPRwf_R0057.
DR   EnsemblGenomes-Gn; PsycPRwf_R0058.
DR   EnsemblGenomes-Gn; PsycPRwf_R0059.
DR   EnsemblGenomes-Gn; PsycPRwf_R0060.
DR   EnsemblGenomes-Gn; PsycPRwf_R0061.
DR   EnsemblGenomes-Gn; PsycPRwf_R0062.
DR   EnsemblGenomes-Gn; PsycPRwf_R0063.
DR   EnsemblGenomes-Gn; PsycPRwf_R0064.
DR   EnsemblGenomes-Gn; PsycPRwf_R0065.
DR   EnsemblGenomes-Gn; PsycPRwf_R0066.
DR   EnsemblGenomes-Gn; PsycPRwf_R0067.
DR   EnsemblGenomes-Gn; PsycPRwf_R0068.
DR   EnsemblGenomes-Gn; PsycPRwf_R0069.
DR   EnsemblGenomes-Gn; PsycPRwf_R0070.
DR   EnsemblGenomes-Gn; PsycPRwf_R0071.
DR   EnsemblGenomes-Gn; PsycPRwf_R0072.
DR   EnsemblGenomes-Gn; PsycPRwf_R0073.
DR   EnsemblGenomes-Gn; PsycPRwf_R0074.
DR   EnsemblGenomes-Gn; PsycPRwf_R0075.
DR   EnsemblGenomes-Tr; EBT00001614080.
DR   EnsemblGenomes-Tr; EBT00001614081.
DR   EnsemblGenomes-Tr; EBT00001614082.
DR   EnsemblGenomes-Tr; EBT00001614083.
DR   EnsemblGenomes-Tr; EBT00001614084.
DR   EnsemblGenomes-Tr; EBT00001614085.
DR   EnsemblGenomes-Tr; EBT00001614086.
DR   EnsemblGenomes-Tr; EBT00001614087.
DR   EnsemblGenomes-Tr; EBT00001614088.
DR   EnsemblGenomes-Tr; EBT00001614089.
DR   EnsemblGenomes-Tr; EBT00001614090.
DR   EnsemblGenomes-Tr; EBT00001614091.
DR   EnsemblGenomes-Tr; EBT00001614092.
DR   EnsemblGenomes-Tr; EBT00001614093.
DR   EnsemblGenomes-Tr; EBT00001614094.
DR   EnsemblGenomes-Tr; EBT00001614095.
DR   EnsemblGenomes-Tr; EBT00001614096.
DR   EnsemblGenomes-Tr; EBT00001614097.
DR   EnsemblGenomes-Tr; EBT00001614098.
DR   EnsemblGenomes-Tr; EBT00001614099.
DR   EnsemblGenomes-Tr; EBT00001614100.
DR   EnsemblGenomes-Tr; EBT00001614101.
DR   EnsemblGenomes-Tr; EBT00001614102.
DR   EnsemblGenomes-Tr; EBT00001614103.
DR   EnsemblGenomes-Tr; EBT00001614104.
DR   EnsemblGenomes-Tr; EBT00001614105.
DR   EnsemblGenomes-Tr; EBT00001614106.
DR   EnsemblGenomes-Tr; EBT00001614107.
DR   EnsemblGenomes-Tr; EBT00001614108.
DR   EnsemblGenomes-Tr; EBT00001614109.
DR   EnsemblGenomes-Tr; EBT00001614110.
DR   EnsemblGenomes-Tr; EBT00001614111.
DR   EnsemblGenomes-Tr; EBT00001614112.
DR   EnsemblGenomes-Tr; EBT00001614113.
DR   EnsemblGenomes-Tr; EBT00001614114.
DR   EnsemblGenomes-Tr; EBT00001614115.
DR   EnsemblGenomes-Tr; EBT00001614116.
DR   EnsemblGenomes-Tr; EBT00001614117.
DR   EnsemblGenomes-Tr; EBT00001614118.
DR   EnsemblGenomes-Tr; EBT00001614119.
DR   EnsemblGenomes-Tr; EBT00001614120.
DR   EnsemblGenomes-Tr; EBT00001614121.
DR   EnsemblGenomes-Tr; EBT00001614122.
DR   EnsemblGenomes-Tr; EBT00001614123.
DR   EnsemblGenomes-Tr; EBT00001614124.
DR   EnsemblGenomes-Tr; EBT00001614125.
DR   EnsemblGenomes-Tr; EBT00001614126.
DR   EnsemblGenomes-Tr; EBT00001614127.
DR   EnsemblGenomes-Tr; EBT00001614128.
DR   EnsemblGenomes-Tr; EBT00001614129.
DR   EnsemblGenomes-Tr; EBT00001614130.
DR   EnsemblGenomes-Tr; EBT00001614131.
DR   EnsemblGenomes-Tr; EBT00001614132.
DR   EnsemblGenomes-Tr; EBT00001614133.
DR   EnsemblGenomes-Tr; EBT00001614134.
DR   EnsemblGenomes-Tr; EBT00001614135.
DR   EnsemblGenomes-Tr; EBT00001614136.
DR   EnsemblGenomes-Tr; EBT00001614137.
DR   EnsemblGenomes-Tr; EBT00001614138.
DR   EnsemblGenomes-Tr; EBT00001614139.
DR   EnsemblGenomes-Tr; EBT00001614140.
DR   EnsemblGenomes-Tr; EBT00001614141.
DR   EnsemblGenomes-Tr; EBT00001614142.
DR   EnsemblGenomes-Tr; EBT00001614143.
DR   EnsemblGenomes-Tr; EBT00001614144.
DR   EnsemblGenomes-Tr; EBT00001614145.
DR   EnsemblGenomes-Tr; EBT00001614146.
DR   EnsemblGenomes-Tr; EBT00001614147.
DR   EnsemblGenomes-Tr; EBT00001614148.
DR   EnsemblGenomes-Tr; EBT00001614149.
DR   EnsemblGenomes-Tr; EBT00001614150.
DR   EnsemblGenomes-Tr; EBT00001614151.
DR   EnsemblGenomes-Tr; EBT00001614152.
DR   EnsemblGenomes-Tr; EBT00001614153.
DR   EnsemblGenomes-Tr; EBT00001614154.
DR   EnsemblGenomes-Tr; EBT00001614155.
DR   EnsemblGenomes-Tr; EBT00001614156.
DR   EnsemblGenomes-Tr; EBT00001614157.
DR   EnsemblGenomes-Tr; EBT00001614158.
DR   EnsemblGenomes-Tr; EBT00001614159.
DR   EnsemblGenomes-Tr; EBT00001614160.
DR   EnsemblGenomes-Tr; EBT00001614161.
DR   EnsemblGenomes-Tr; EBT00001614162.
DR   EnsemblGenomes-Tr; EBT00001614163.
DR   EnsemblGenomes-Tr; PsycPRwf_R0001-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0002-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0003-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0004-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0005-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0006-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0007-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0008-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0009-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0010-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0011-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0012-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0013-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0014-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0015-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0016-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0017-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0018-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0019-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0020-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0021-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0022-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0023-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0024-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0025-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0026-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0027-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0028-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0029-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0030-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0031-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0032-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0033-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0034-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0035-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0036-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0037-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0038-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0039-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0040-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0041-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0042-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0043-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0044-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0045-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0046-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0047-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0048-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0049-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0050-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0051-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0052-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0053-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0054-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0055-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0056-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0057-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0058-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0059-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0060-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0061-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0062-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0063-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0064-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0065-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0066-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0067-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0068-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0069-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0070-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0071-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0072-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0073-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0074-1.
DR   EnsemblGenomes-Tr; PsycPRwf_R0075-1.
DR   EuropePMC; PMC3275731; 21811795.
DR   EuropePMC; PMC4378888; 25822626.
DR   EuropePMC; PMC4754876; 26879123.
DR   EuropePMC; PMC6514802; 31022896.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01705; Flavo-1.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02064; STnc370.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; CP000713.
DR   SILVA-SSU; CP000713.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001101
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@pilot.msu.edu)
CC   Contacts: James Tiedje (tiedjej@pilot.msu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LLNL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2978976
FT                   /organism="Psychrobacter sp. PRwf-1"
FT                   /strain="PRwf-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:349106"
FT   gene            complement(59..193)
FT                   /locus_tag="PsycPRwf_0001"
FT   CDS_pept        complement(59..193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0001"
FT                   /product="ribosomal protein L34"
FT                   /note="PFAM: ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92961"
FT                   /db_xref="GOA:A5WBC0"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBC0"
FT                   /protein_id="ABQ92961.1"
FT                   /translation="MKRTFQPSVIKRKRTHGFRARMATKKGRQVLARRRAKGRHRLTV"
FT   gene            1311..2723
FT                   /locus_tag="PsycPRwf_0002"
FT   CDS_pept        1311..2723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0002"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator, DnaA
FT                   C-terminal domain; Chromosomal replication initiator, DnaA;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92962"
FT                   /db_xref="GOA:A5WBC1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBC1"
FT                   /protein_id="ABQ92962.1"
FT                   /translation="MSDSLSLWDRCLNDLRYQLKENEFTMWLRPLSAHIIGDKLELLAP
FT                   NQYFVSHVQQHHFAAIEVLAKQHSNGEIRQVVIQVESSVHSGGQTKAGHTTLASAQNGP
FT                   VVMSAQQNLQTQNEEDADAAQMASDKSLSYINPYFTFETFVSGKSNMLAYKACQELGKK
FT                   QSQNRHNPLFLYGPSGLGKTHLMHSVAHRYLKIGKTFYYFSSEKFINQLVYALRNQKIE
FT                   EFKRKIKRVDLLIIDDVHVLAGKNKSSNEFLSLFADFMVEGKQVILASDRHPSQMTEFD
FT                   ERFRSRFSSGLAVAIEPPEMETRMQILQKKAHLSGVDLPKECALFIAQNVVSNVRRLEG
FT                   ALNQVVATANLTGNPIDLDMVQYALKDVIAIRSQAVSMDNIRKVVAEYYDVSVKDLMSK
FT                   KRTRSIARPRQIAMALARELTKDSFPDIGQSFGGRDHTTVMHACDKIAQLRSEDPVLDK
FT                   EYKALSMTLQAG"
FT   gene            2984..4159
FT                   /locus_tag="PsycPRwf_0003"
FT   CDS_pept        2984..4159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0003"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92963"
FT                   /db_xref="GOA:A5WBC2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBC2"
FT                   /protein_id="ABQ92963.1"
FT                   /translation="MQLSINRELLLKAINLIAKAADKRHNMVVLGNIKLEVTEQLLILT
FT                   ASDLEVELSAQVKLGNGATGSIGATTLPASKLHEICKLLPKDTMINLAAESNERCVINS
FT                   GKSRFVLGTLPAADFPILGNPANITPLTLSRNVLMDLMAKTQFAMAIQDVRYYLTGMLF
FT                   EVSQRQLTTVATDGHRLALARSVIEVADDFSMQAILPRKAVIELERLANELGKLVGGND
FT                   GNLTLSFGREFLQVSLPFGNVDSTGQIDDSVRVTFTARLIDGKFPDYRRVMPNNTDKIA
FT                   LANKEQMTDVLRRVSILSNEKSRGVIFKFSQDGNVEVRANNAEQDEAVEALQVKYQGAP
FT                   IELSFNAAYLQDVLDVLGGDVQLHMSQANSSVLVNQLNDSQHQYVIMPMRI"
FT   gene            4455..5834
FT                   /locus_tag="PsycPRwf_0004"
FT   CDS_pept        4455..5834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92964"
FT                   /db_xref="GOA:A5WBC3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBC3"
FT                   /protein_id="ABQ92964.1"
FT                   /translation="MLTQLSIHQLRNLHSVNIKVGQCNVFVGANGSGKTSLLESLYLLS
FT                   RGKSFRHHQPKRYISHHAAHATVHAKFANGSSMAIQKAQDASTILRLDQQTVYVQSALA
FT                   KQLPTLLIDPSSMDVLEIGSSSRRQLLDWITFHVKPGFHAQWLAYQRLLKQRNTILRQS
FT                   GYLSDYQRQELAAWDKGLANHAALITHYRHEAFEEWQPLFNQLIEQLLPDYAPFIQLRF
FT                   SAGYNTDLPLDELLQQRLAQDFQTGYTRVGCHRADIQVLWLEDAQARQTVQQAAETSGM
FT                   AQTAAHSNIHSHADIKLSTDLVDNIEDMNNWEDETAYALTGNVREQAANVLSRGEKKLL
FT                   ITALRLSQLPLLSTKLSTKLSLTESAAVTDTVIGSNSASEDQPYPSALSDAILPVVLLD
FT                   DITAELDERALSILLKTLSELSCQIFITSLDGDIMPQIKQYWPQAQRFHVKQGHIQKMT
FT                   E"
FT   gene            6078..8732
FT                   /locus_tag="PsycPRwf_0005"
FT   CDS_pept        6078..8732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0005"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase,
FT                   subunit B domain protein; ATP-binding region, ATPase domain
FT                   protein domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase, type IIA, subunit B, region 2 domain
FT                   protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92965"
FT                   /db_xref="GOA:A5WBC4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBC4"
FT                   /protein_id="ABQ92965.1"
FT                   /translation="MSESNHNTEQALVQGLPEGVDATDLPAGAEPEEYSSKNIRVLRGL
FT                   EAVRVRPGMYIGDTDDGTGLHHMVFEVVDNSIDEALAGHCDQIDIIIHEDESVSVMDNG
FT                   RGIPIDVHPEEGVSAAQVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSKKLEMNI
FT                   WREGHHYQQTYSDGVPDSDIQELEKTNKTGTQIRFYPSPEVFTGTVFDFDILAKRLREL
FT                   SFLNSGVRIVLTDERTDKQHVFEHKGGLSEFVAYINSGKEGLNDVFHFVSEQEDGIVVE
FT                   AALQWTDTYNEKVLCFTNNIPQKDGGTHLSGFRSALTRCLNSYMDNEKLVKKEKVNTTG
FT                   DDAREGLTAIVSVKVPDPKFSSQTKDKLVSSEVKSAVESAMHDKFNDYLLEHPGAAKSI
FT                   ANKIIDAARARDAARKARELTRRKTTLDIAGLPGKLADCQEKDPALSELYIVEGDSAGG
FT                   SAKQGRSRKTQAILPLKGKILNVERARFDKMLSSAEVGTLITALGCGIGPDEYNPDKVR
FT                   YHKIIIMTDADVDGSHIRTLLLTFFFRQTPELIERGYVYIAQPPLYKIKKGRQELYLKD
FT                   DEALKAYLLSSTIDEMNLHISEDAPAITGQALETLLNDYNQTQLVKARLQIRYPAILLD
FT                   ALTHVPKLTTDMTYDFDAMTEWKQQLQAQLEHFGSDLRPSIELDNIHAPRTDELSEAAK
FT                   DANNQFKFKIGAKVDSPNSDIEDAEVVEGQDSDMLSTKPQWLPRITIYVHNLAQHYLLD
FT                   AGFFNSGEYARLMRLSKQWNTLLTESAFIRRDTTAGGSKDTLIRNFDHLWQQVMQEARR
FT                   GLSVQRYKGLGEMNADQLWDTTMDPENRRMLKVTIEDAIAADHLFMCLMGDDVEPRRQF
FT                   IEENALTVTNLDI"
FT   gene            8933..9520
FT                   /locus_tag="PsycPRwf_0006"
FT   CDS_pept        8933..9520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0006"
FT                   /product="protein of unknown function DUF204"
FT                   /note="PFAM: protein of unknown function DUF204"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92966"
FT                   /db_xref="GOA:A5WBC5"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBC5"
FT                   /protein_id="ABQ92966.1"
FT                   /translation="MIDVLFLAIALAMDAFAVSIGLGAKQANTAFSSAAKAKSMLLKLA
FT                   LMAALYFGVAQGVMPLIGYLLGSALLGWLASAAPWIGCIILIGLGAKMLYEAIQGDHEE
FT                   EELGLDDNQSVDHKLMGTMAIATSIDAMAAGFTLNLLAVNAWLACLIIALVTALFSFFG
FT                   VYLGRQSGTWLEDKAEVVGGVVLIAIGIKMVL"
FT   sig_peptide     8933..8986
FT                   /locus_tag="PsycPRwf_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.719) with cleavage site probability 0.581 at
FT                   residue 18"
FT   gene            complement(9752..10735)
FT                   /locus_tag="PsycPRwf_0007"
FT   CDS_pept        complement(9752..10735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0007"
FT                   /product="23S rRNA m(6)A-1618 methyltransferase"
FT                   /note="PFAM: protein of unknown function DUF890"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92967"
FT                   /db_xref="GOA:A5WBC6"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="InterPro:IPR016909"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBC6"
FT                   /protein_id="ABQ92967.1"
FT                   /translation="MTHPVTPKNTTRPTPANKPAASTLHPRNPHQGRYDFDKLIKALPE
FT                   LEKHAITNPSGEATINFSDADAVLTLNKALLAHHYNIKYWDLPKGYLCPPIPGRADYIH
FT                   QVADLLNNNNSGSENKKPHVLDIGTGASLIYPIIGSQSYGWYFTATDIDPVSINTAKAI
FT                   CEINPNLKKLVTVKQQKNPKNIFKGIIGEHDYFDITVCNPPFHGSMQDVLDANNRKQSK
FT                   LQKNRARRNPNGQANKFADAKNNLNFGGQNAELWTEGGEFSFISRMINESVGYAQQVNW
FT                   FTTLVSRAENLKPLDALLRKVGARQIKTINMQHGQKASRILAWRFK"
FT   gene            11220..12026
FT                   /locus_tag="PsycPRwf_0008"
FT   CDS_pept        11220..12026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0008"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92968"
FT                   /db_xref="GOA:A5WBC7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBC7"
FT                   /protein_id="ABQ92968.1"
FT                   /translation="MSNNSQNNAPFTRLTYQQDGHICLIGLNRVDKRNAFDSHMIAQLS
FT                   KALTDYEADSNLRCALIFAHGEHFTAGLDLMELQDKLDKGVFAFDESQIDPWGISGKLR
FT                   TKPVVVAVQGTCFTAGIELMLNSDVVIASDDCNFAQMEVQRGIMPFGGATVRFVAAAGW
FT                   QKAMPYLLTGKPFDANTADKLGLVSDVVPKGEQYDRAYELATEISKAAPLGVQGVLASA
FT                   LDGARNGADSAMANIHSFLPPLFESEDAREGVMAMVERREANFKGR"
FT   gene            12247..13194
FT                   /locus_tag="PsycPRwf_0009"
FT   CDS_pept        12247..13194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0009"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92969"
FT                   /db_xref="GOA:A5WBC8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBC8"
FT                   /protein_id="ABQ92969.1"
FT                   /translation="MLDIINITAPIFIIIALGYLTVRLKVIDPRHAKGMGSLVLKIALP
FT                   ALVFNAIADMPFEEVIRPYYLIIYGLGSLLAFVIGLILTKLIWKQDNVSAALNSTALSF
FT                   SNSAFIGYAVAAMVVGSSVAASYLSMGVIIENLLILPMLFIMAELNGNSGKSLAGVLLG
FT                   IAKNFTRNPLIISIVVSIVFSIFRLPIPSIVAGTIKMLTGAAAPVALFVIGMSLYALEL
FT                   KGDLPKITTIGLGKLIVHPLMILLAISMISGGSLQDNYVAMLFASAPVFSTIAIIGQHY
FT                   GLVNRMSAIVIVSTIGSFFSMSAVLIYWKMTIGF"
FT   gene            complement(13470..15656)
FT                   /locus_tag="PsycPRwf_0010"
FT   CDS_pept        complement(13470..15656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0010"
FT                   /product="KAP P-loop domain protein"
FT                   /note="PFAM: KAP P-loop domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92970"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBC9"
FT                   /protein_id="ABQ92970.1"
FT                   /translation="MQNESYSSDAPVSKIDEDAFSRWSFSKRVAQVIANRQDPSSIVIG
FT                   LYGAWGDGKTSVLNFIDQSLTNNEAVICIRFNPWRFGTEDQLLLGFFNQIADALDNKLT
FT                   TSSDKLKDIGNKILKPVTKLANVEAVGEIVTSFISMPDIDIFKERTEKLLEESKKRVLI
FT                   LIDDVDRLDKTEIHTLFRLVKLTADFKYTSYILAFDKDIVSSSLQDRYSSSQGNSGEAF
FT                   LEKIIQVPLNLPYIDKSTLRSFCYQGIDEALQLANIELTQEQIQRFSSNYLSAFESCIS
FT                   TPRKAKLYSNTLMFSLPILKGEVNPIDLMLIEGIRLFYPKLYDFIKNNQDLFAGTFISS
FT                   QYGNDNANKEYIKKLIDETILNLSATEKEGIVELLKDIFPRLQAVYNNTYHSGDSLKIW
FT                   EENQNICSKNYFFRYFGYSLLPNDISDTNLNLLVQDINNWQPPYSTETNPLYVALTPEN
FT                   ADTLIQKLYKKVASLDSGGSTKMAIAITQISEKLPAENSFMWSDAYTQSTWLIADLILN
FT                   ISKVERVKVIKNLFNHANTIDYQTKIFRFLKHDQRDDAQLNYLSSEEMRDIGTHLARKI
FT                   LAEIQDKDITLDEKNPTSYIFWLLNKYINQDVVNDYIEKIIRTDDNAIYRILDNYTTTF
FT                   TNLVNGIERKDDLNQNSFNYLSKHINVSIIYQAIERHYPELTRVLKNYPNIEKGENDRE
FT                   TPIIQQFLWWYRRDMTHRSFEFVSSKAGLISVLI"
FT   gene            complement(15781..16209)
FT                   /locus_tag="PsycPRwf_0011"
FT   CDS_pept        complement(15781..16209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92971"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBD0"
FT                   /protein_id="ABQ92971.1"
FT                   /translation="MTLFNTASPKALAALLFAFVVPLTACQTTSTSQPNMQSTQQKSKI
FT                   AADIEKLTYDLSLVEENHLETKLAGDTYILDTFIVPFEQPYYVLVRRTDEKRISKNAAE
FT                   LIAETYIQPRGCTEPLKRREDLDKQNAKGSVHLVGIEC"
FT   sig_peptide     complement(16132..16209)
FT                   /locus_tag="PsycPRwf_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.933 at
FT                   residue 26"
FT   gene            16359..16811
FT                   /locus_tag="PsycPRwf_0012"
FT   CDS_pept        16359..16811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0012"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92972"
FT                   /db_xref="GOA:A5WBD1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBD1"
FT                   /protein_id="ABQ92972.1"
FT                   /translation="MSIRQMTLNDYQAVYQLWINTPNMGLNDVDDSKDGIARMLKRNPT
FT                   LSFVAEVEREENTQIVGVIIAGEDGRRGYIYHTAVDVAYRNQGIGEALVNHVMDAMKAL
FT                   SISKVGLFIFQRNEIGNGFWERLGFSVRDDLYYRNKAIIELERIDT"
FT   gene            16859..18010
FT                   /locus_tag="PsycPRwf_0013"
FT   CDS_pept        16859..18010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0013"
FT                   /product="aminotransferase, class I and II"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92973"
FT                   /db_xref="GOA:A5WBD2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBD2"
FT                   /protein_id="ABQ92973.1"
FT                   /translation="MQYNFDEVIDRNNTGSLKWHYEDDTIPLWVADMDFKAAQPILDSL
FT                   QQIITHGILGYTKQTDRLYQAIINWHSSRYGLELEASNILFSPGVVPSIALLVNLFTEV
FT                   GDAVLINDPIYAPFVAKTKLNGCKVVSSALQEVNGRYEFDLEDIEAKIKKHKIKLFLLC
FT                   NPHNPGGRVWTKDELKAVLELCKKYQVAIVSDEIHQDLTLTGHTFTPFLNLASGYEHMV
FT                   VSLTSMTKTFNIAGIKGSMIFAKDKALLKQISNQQRLNDEYELNMFAYSAMQSAYEQGG
FT                   EWLEQALAYIEKNIELTVDYLAKHLPDIKVMHPEASYLIWLDCSAYADDNQALYDSLRD
FT                   AKVELNAGISYGNEGHLKMRINVACPESVLLEGLARIKQALNH"
FT   gene            complement(18165..19919)
FT                   /locus_tag="PsycPRwf_0014"
FT   CDS_pept        complement(18165..19919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0014"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92974"
FT                   /db_xref="GOA:A5WBD3"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBD3"
FT                   /protein_id="ABQ92974.1"
FT                   /translation="MQISQRRPDHEPDTRIDKFTFGMVLAILLGICIPLIFFPEQGKEW
FT                   VGIARNFVTTNFGFAYLTFGVLAMMFVIYIIFSDIGKIKLGRPEDTPEFGDASWAAMLF
FT                   CGGIGASILYWGLIEWAYYYQGPPFNIAAGSPDAIRWATTYGIFHWGPVAWAIYLVPAV
FT                   PIAYFYYVRQTPVLKVSQTLMPLLGEKLASSNWAKMLDVLFVFGMVGGGATTLGLASPL
FT                   INEGLYNLFGLPRNITMQLAVLFVTTMIFAYSAYQGLKGGIQKLSNINFYLAVAFLLFI
FT                   LVTGPTVFIFNTGLEALGRSLTEMPRMMTYIEPFKDFGSFGFEHTTFPQDWTVFYWAWW
FT                   LVFAPTIGLFIAKISRGRTIQNMVVGSMFYGSLGCAMFMIILGNYGLYLQLTGTVDVVS
FT                   ILNNETATAAIFAILNSLPMSYLVISVFTFLAIIFTATTFDSISYILASVVQVEVDDEP
FT                   HRWNRLFWAFTLCLLPAILMFLGDLATLQTASIIAGAPLIIILSMMMLSLIKAARYDLH
FT                   YQPDYNLKTIHIEELAENAPWEEGETSEAPEGSVLAQQEEWETMIEDEEAQLAEEEKQD
FT                   ELDKDSDK"
FT   gene            20646..22244
FT                   /locus_tag="PsycPRwf_0015"
FT   CDS_pept        20646..22244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0015"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; ExsB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92975"
FT                   /db_xref="GOA:A5WBD4"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBD4"
FT                   /protein_id="ABQ92975.1"
FT                   /translation="MSIAAPTIKEDRILIIDYGSQYSQLIARRVREAGVFCEMYPYDID
FT                   TSRIEAFGAKGVILSGGPESVHDENSPRINQALFDLNVPILGICYGMQAMADHFGGKVQ
FT                   ASDVHEFGAATIDVTGHSALLDGIEDEHKDNSRLHVWMSHGDKVVEAPKGFDIVASTPS
FT                   CPIAVMVNEDKKYYGLQFHPEVTHTLQGDVLLSRFVHQVCGCAGDWTPDNIIDMRVEQL
FT                   KEQIGDKQVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLHEGDQVMQVFAEN
FT                   MGVKVVRVDAEDRFLSALAGESEPEAKRKIIGKTFIDVFADAARDISQGSDGKPVEFLA
FT                   QGTIYPDVIESAKSHQGKAHVIKSHHNVGGLPDDLQFELVEPLRDLFKDEVRKLGIALG
FT                   LPHKMIYRHPFPGPGLGVRILGEVKKEYADILRQADAIFMQELERSGWYEKTAQAFAVF
FT                   TPVKSVGVVGDGRRYAWVIALRAVETIDFMTARFAHLPYELIETVSNRIMNEIKDVSRV
FT                   TYDVSSKPPATIEWE"
FT   gene            complement(22432..22764)
FT                   /locus_tag="PsycPRwf_0016"
FT   CDS_pept        complement(22432..22764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92976"
FT                   /db_xref="GOA:A5WBD5"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBD5"
FT                   /protein_id="ABQ92976.1"
FT                   /translation="MNLWDRIRADFSQNKAIFWLKFIISIVMLYCSVQLIFILIADFRR
FT                   SEFTSTVTLYPFFIVLLTGVMYLIRLYQISFDKQSPQFKPLRTNVIANFALSALLLFTY
FT                   FVSNSA"
FT   gene            complement(22768..23745)
FT                   /locus_tag="PsycPRwf_0017"
FT   CDS_pept        complement(22768..23745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0017"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92977"
FT                   /db_xref="GOA:A5WBD6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBD6"
FT                   /protein_id="ABQ92977.1"
FT                   /translation="MRAASYTQFGKPSDVLSITDRPIPEPAPHEVRIKTILATIHNHDL
FT                   ITIRGQYGDKPNLPAIAGSEALGVVDAIGSEVEGFEVGQRVAAASVHATWAEYFTAPAK
FT                   MVFPIADAIDDEIAAQLIAMPLSALMLLEFLELKAGKWALLNAANGAVGKSFAMLAAAR
FT                   GVNSISLVRRAEAANSLKELGVAHVVDVSESDWQDQVRKIVGAAQIDAAVDSLGGEASN
FT                   DLLTLLGSGGTLVSFGVMAGQPMVLNPSNLIFKEVVVKGFWGSKTSREMSLDNKLRLID
FT                   ELKQRVLEGTLSLPVHAIYKLDDITTAVSGEVQKGKKGKVLLRV"
FT   gene            complement(23938..26958)
FT                   /locus_tag="PsycPRwf_0018"
FT   CDS_pept        complement(23938..26958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0018"
FT                   /product="Uncharacterized membrane-anchored protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92978"
FT                   /db_xref="GOA:A5WBD7"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="InterPro:IPR025513"
FT                   /db_xref="InterPro:IPR025833"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBD7"
FT                   /protein_id="ABQ92978.1"
FT                   /translation="MTQPAPKSNLPASDPNSAVALASQPNGVRPSPLAWIKFFDNSLLI
FT                   IAATALALALIFFVAYNWTAMGKMGKFALVQSALIVSVLGYVAFAYKRSTVSAQHKTYL
FT                   IEPLLLLIASVVVGSLLALFGQIYQTGADSWQLFFYWALLITPWAVIARLPALWLLWLL
FT                   LINISLKLSFADVSFWFVDSWLGTGMDYQLFRGVYLMLMTAINSVALLMALSAAVNGFF
FT                   GQKLLNTSIFNKLFFYKKANSKNLPQAASSASADANFQSTALPWSVYLVGLLATYFATR
FT                   LGLFAVLQQSFHLDMISIACLSLWLVFIGFFYAQFRRRRTDLFMLTCLSGSVIIVVLGL
FT                   ATRILSQFMSTSALFILALLLIAMSAYAVSWLRNLHSQQPPNQQPPSEPLDTPGRVQQT
FT                   HAKQLPANVPNDLATKLTPPAPTASKTPSCSQNTPWYLQLFLILSGLLAGGLISGFIVL
FT                   LLNVALKDDIIKLTVGLLLLFVSFVLSRQELFIRRDLNTPLKQQAFSDSLAFALSLSGQ
FT                   AFLAVFLFEIIDDIALSIAAFMLMQALLLTLFTDVLSRFFSSVMGLLALVWLLAYAQLP
FT                   EASPAILALLAVLFGVHLQSVKQPLKGRKTFSPSLLNAMAYATSFVLLLISVVFIAAEY
FT                   QDGLIGIGSDFQYRYALAQLLLTLSSLYAAYIILQRYQLKRISKTGGLIALAIGLLAVV
FT                   SVYVSGVLASSLVIIIAMANQNRTLRGLGISALVGYIFWYYYQLDSSLLLKAGSMLAVA
FT                   AALFMIRWVMRRLVGIPKSTEHLTQSHLASQADAQSLIYANARTYANVRTYANVPTTTR
FT                   AWCTNLAAAILGLLLTLSVVNISIAKNEKLLATGEIVLLKLAPVDPRSLMQGDYMALNY
FT                   ALSEQIIRALEAQLAAKNPDQKGVSEVYNLSKNGWVIVKKDAQGIGHFVRLQDTAPTEA
FT                   NTLGPHELALYYRLRHGEVRLASNAFFFQEGHAKAFEKAEYGLFRVGPSGKLLLTDMAD
FT                   DTRQVITGSSIDPTEAN"
FT   gene            27558..29159
FT                   /locus_tag="PsycPRwf_0019"
FT   CDS_pept        27558..29159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0019"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92979"
FT                   /db_xref="GOA:A5WBD8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBD8"
FT                   /protein_id="ABQ92979.1"
FT                   /translation="MMMVGCGDKSASSGSSAKVDPNVLADKQELVINNAAEPESLDPQK
FT                   VSGVPEAAVIRQMLVGLTTTDRDGKTIPGMAESWESTDNKVWTFKIRDAKWSNGDPVTA
FT                   NDFVYSWRRLLDPNTASPYASYLVDAKVAGAEAIMEGKAAVDSLGVKALDDKTLQVTLS
FT                   EPVPYFPDTLIHTSVKPVNQKAVEQFGDKWTDPANIVVNGPYKISEWQVNDKIVLTRNE
FT                   SYYDNANTTLEKITMLAIPSSTTDVARYQAGEIDVTNEELPSEQFKSLKEQLGDEVSVS
FT                   PMLCTYYYEFNTVKPPFNDARVRRALALALDRNTITDKVVGQGQTPAYQLTPVSTNGME
FT                   NNTPEWQNWDQARRVEEAKKLLNEAGYSESKPLKFELLYNTSDNHKKIAVAASSLWKQS
FT                   LGFVDVSLINKEWKTYLDTRRNGNYQVARAGWCGDYNEPSTFLNIVKSGNSNNQGKYSS
FT                   AAFDSLMTQTLKAGVTPEQRANLYKQAEVQLDKDMPNINVYHYVSPRLIKPYVVGFPVN
FT                   DPLNNWQGKDLKIAKH"
FT   gene            29321..30997
FT                   /locus_tag="PsycPRwf_0020"
FT   CDS_pept        29321..30997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0020"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92980"
FT                   /db_xref="GOA:A5WBD9"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBD9"
FT                   /protein_id="ABQ92980.1"
FT                   /translation="MVSSSRRTLKALPSITLTAAITTAVFLSGCGDKEASNAGASAKID
FT                   PNVLAEKQQIVINNGTEPESLDPHKISGLPEANIIRQQLVGLVTTDAKGKTIAAMAKSW
FT                   QSEDNKVWVFKLRDAKWSNGDPVTAQDFVYSLRRVVDPKTASPYGNYLVDAKVVGAEAI
FT                   INGKQSPDTLGVKALDNKTLEVRLTEPVPYFVDMLIHTSTSPVHPATVEKFGVKWTDPK
FT                   NIVVNGPYKISEWSVNDKIVLQRNPAYYDNAHTTIDTITLLPIESETTNVARYKAGEID
FT                   IGAGMPTEQFDELKAELGDQIQVSPSLCSFYYQYNNKKPPFDDVRVRRALAIALDRDTI
FT                   TQKVMGQGQTPAYQYTPPSIQGMTPFTPEWQSWDQKKRVTEAKKLLNEAGYNEQHPLKF
FT                   ELLYNTNEGNKKLAVATSSLLKEAIGFVDVSLMNKEWKTFLDTFRNGNYQLARYTWCGD
FT                   YNEPSTFLNIAKSGNSNNWGGYSSVKFDSIMNQTLKEGVTAEQRAELYRQAEAQLDADM
FT                   PQLNVFHIVKLSMVKPYVINFPLQDPLSNWQIKDVSIAKHD"
FT   sig_peptide     29321..29410
FT                   /locus_tag="PsycPRwf_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.890) with cleavage site probability 0.597 at
FT                   residue 30"
FT   gene            31051..32736
FT                   /locus_tag="PsycPRwf_0021"
FT   CDS_pept        31051..32736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0021"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92981"
FT                   /db_xref="GOA:A5WBE0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBE0"
FT                   /protein_id="ABQ92981.1"
FT                   /translation="MKILSRTTLPTRLPLVMAVLAGLSLSACGDKNPQESGSTAKTSEQ
FT                   IEQTALADTQHIVINNTAEPESIDPHKVSAVPEGNIIRQMFTGLVDTDREGKTVPGMAE
FT                   SWESSDNKVWTFKLRDAKWSNGDPVTAGDFVYSWQRLIDPNTAAPYASYLVDAKVAGAE
FT                   AIMEGKAAVDTLGIKALDDKTLQVTLTEAVPYFPDMLIHTSTKPVPQKVIAEFGEKWTA
FT                   PEHIVVNGPYTLSEWSVNDKIVLTRNTHYFDNANTKIDQVTILPLSSPTTDVARYRAGE
FT                   VDVSAEVPPEQFDMLKKELGDELRVAPRLCTYYYKYNTVKPPFNDARVRRALALALDRD
FT                   TIATKIMGQGQAPAYQLTPPITNGMENFTPQWESWSKQQRIDEAKKLLNEAGYNASHPL
FT                   KFELLYNTSDNHKKIAVAFSALMKQALGEDTVDVTLVNQEWKTYLDTRRLGNYDIARSS
FT                   WCGDYNEPSSFLNTLKTDNTNNHGKYSSAKFDSIMNQTLVEGVDATLRAKLYQQAEAQL
FT                   DADMPNLNMFHYVGVRLVKPYVVGFPENDPLDVWQAKDLAIAKH"
FT   sig_peptide     31051..31140
FT                   /locus_tag="PsycPRwf_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.884 at
FT                   residue 30"
FT   gene            32839..33759
FT                   /locus_tag="PsycPRwf_0022"
FT   CDS_pept        32839..33759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0022"
FT                   /product="Alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92982"
FT                   /db_xref="GOA:A5WBE1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBE1"
FT                   /protein_id="ABQ92982.1"
FT                   /translation="MLKLIFRRLLEAIPTMFILITVSFFMMRLAPGSPFSGERSFSPAV
FT                   MANIEAKYHLNDPMWLQYVHYLKQIAVGDFGPSFKYKDYTVNELLSQALPVSVELGLYA
FT                   FILALVLGLIFGIVAALKQNSWIDYIVMAFANIGVVIPSFVKAPLLVLIFAITLKWLPG
FT                   GGWNDGAVQNLILPVTALALAYTASIARIMRGSMIEVMNSQYIRTARAKGLPMQRIVFK
FT                   HALRPAMLPVISYLGPAFVGIITGSIVIETIFGLPGIGQLFVNGALNRDYGMVLSLTIL
FT                   VGVLTIAFNAIVDILYAVIDPQIKY"
FT   gene            33858..34763
FT                   /locus_tag="PsycPRwf_0023"
FT   CDS_pept        33858..34763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0023"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92983"
FT                   /db_xref="GOA:A5WBE2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBE2"
FT                   /protein_id="ABQ92983.1"
FT                   /translation="MSVITDKPIDLVAPTAPAIKGRSLWQDAWRRFYKNKAAIASLVIL
FT                   FLVTVFVIFVPMFAPFGYAETDWGYMQGAPSLENKHYFGTDSLGRDLLVRTAIGGRISL
FT                   LVGIAGATVAVIFGTVYGAASGYLGGKIDAIMMRFLEILNAFPFMFFVILLVTIFGRNL
FT                   MLIFVAIGLVSWLDVARIVRGQTLSLKSKEFIEAAHVGGVSGFNIIMRHIVPNVLGVVV
FT                   VYASLLVPSMILFESFLSFLGLGVQEPMTSWGALLQEGSQTMQVAPWQILIPSVFLVVT
FT                   LFCFNFIGDGLRDAFDPKDR"
FT   gene            34884..35930
FT                   /locus_tag="PsycPRwf_0024"
FT   CDS_pept        34884..35930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0024"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92984"
FT                   /db_xref="GOA:A5WBE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBE3"
FT                   /protein_id="ABQ92984.1"
FT                   /translation="MSVLQDSKAPDLLQVKDLSVQFKTEDGLVTAVNGLNFNLHQGETL
FT                   GIVGESGSGKSQTAFAIMGLLAKNGLTKGSVLFEGRELLGMSQKHLNKLRAEQVSMIFQ
FT                   DPMTSLNPYMKIGDQLAEVLILHKGMSKKEAWEEAIKMLDAVKIPEARKRIGMYPHEFS
FT                   GGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMTLMNELKRDFGTTIIMITHDL
FT                   GVVAGICDRVLVMYAGRTMAYGHTEEIFYNPTHPYTKGLLRAIPRLDNDSGQLETIPGS
FT                   PPNLLNLPAGCPFYERCTYAMELCRDVPPPLEFLPNERQRACHWKPEDVANTEPQDAQA
FT                   QLANNIEG"
FT   gene            35934..36977
FT                   /locus_tag="PsycPRwf_0025"
FT   CDS_pept        35934..36977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0025"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92985"
FT                   /db_xref="GOA:A5WBE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBE4"
FT                   /protein_id="ABQ92985.1"
FT                   /translation="MTQTTSNRIDVVNDAPLLQVKDVVTSFDIKQKGSYFWQKPATLKA
FT                   VNGVSFELFAGETLGVVGESGCGKSTLARTIIGLVTARSGSIKFNGEEMMGATKKQMRL
FT                   KRKDIQMIFQDPLASLNPRMTVGDIIAEPLRTYYPKMPKSEVEQEVRAMMKKVGLLPNQ
FT                   VNRYPHEFSGGQCQRIGIARALILRPKLIICDEPVSALDVSIQAQVINLLQDVQKEMGL
FT                   ALIFIAHDLSVVKHISDRVLVMYLGNAVELGVDKAIYDNPTHPYTQALMSAVPIPDPQI
FT                   ERNKTIQLLEGDLPSPINPPSGCVFRTRCPIADDGCAQTKPVLEGTPDHQVACLKNKVT
FT                   QLPGAVA"
FT   gene            37111..37845
FT                   /locus_tag="PsycPRwf_0026"
FT   CDS_pept        37111..37845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92986"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBE5"
FT                   /protein_id="ABQ92986.1"
FT                   /translation="MNKALKLPNKGLKLAVGGASLMALLLASGCATTELLNSGSSSSHT
FT                   TTSEQVLVEDQLVAFGRPATPLANMPSSSVVIVGEKYSYVLSQGGPEMVNLLTNLTPKN
FT                   IRVDNDMRFYSPNNDGHFQGQMKLSYAKLKDEFQRSDYNFFLQNGGKECSSSSDERMNA
FT                   QRFCFTVPIKGGVYPAVSNLSLIQSKYSALTKPYPVTIYTNGKTTTTTNNGASAAGKLV
FT                   LLPFALAFDVVTFPFQLLDAAN"
FT   sig_peptide     37111..37212
FT                   /locus_tag="PsycPRwf_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.685 at
FT                   residue 34"
FT   gene            37945..38505
FT                   /locus_tag="PsycPRwf_0027"
FT   CDS_pept        37945..38505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92987"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBE6"
FT                   /protein_id="ABQ92987.1"
FT                   /translation="MNRGIKTLAIALASLLTVSGCATLNEVQQRNIDKQAMRSLPTAQE
FT                   YQDILDAVKKVEPTTVVGSEKPRRWLLVNEIPPLLGNAENQKEYLDVDSPYRSRNVAYG
FT                   EVRSVKASGAYTDTTYRVFCEDGYYRAYSVNQYTRNHNKIPWLLALGRDDYDKGVFEHH
FT                   IKMAKHICALSGFYKGMPDSSKK"
FT   sig_peptide     37945..38019
FT                   /locus_tag="PsycPRwf_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.629 at
FT                   residue 25"
FT   gene            complement(38638..38913)
FT                   /locus_tag="PsycPRwf_0028"
FT   CDS_pept        complement(38638..38913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92988"
FT                   /db_xref="GOA:A5WBE7"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBE7"
FT                   /protein_id="ABQ92988.1"
FT                   /translation="MNERVSDNPYQGLRIHTKYYRLIFTGLMALLMSLIISSALILLKQ
FT                   GYSQHFFSELMHSWGTSFIFAWPSAYVCAYVIQTKILTRIHFHDDD"
FT   gene            complement(39113..40153)
FT                   /locus_tag="PsycPRwf_0029"
FT   CDS_pept        complement(39113..40153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0029"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92989"
FT                   /db_xref="GOA:A5WBE8"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBE8"
FT                   /protein_id="ABQ92989.1"
FT                   /translation="MSLLTTLNLTCPIVQAPMAGGATTPELIAAVSNFGGLGSLGAGTT
FT                   APSKINEQINQIKALTDKPFAVNLMVLSVTESTTFDTPMPEWLQAHYDTLNIPVDLPSH
FT                   PAQSFEAQFAVLLNNPVPVASFTFGIISKAQVAALHAVGTQVVGTANHPLEAKAWADIG
FT                   ADAVCVQGVEAGGHRGGWLPQSQQDPLGLLTLITQTKAVTDVPLIAAGGIMSAEAIKAV
FT                   QAAGAQLAQLGTAFLTTTESGVSDLYKAQLLKAAQGERRAQTRLTRLFSGKQARGLMND
FT                   YLERFSSYDNETLPAYPQLNAMTQPMRAAAATANNPEYMSLWAGQGVSQVQALSVNELM
FT                   TQLTNG"
FT   gene            complement(40323..41258)
FT                   /locus_tag="PsycPRwf_0030"
FT   CDS_pept        complement(40323..41258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0030"
FT                   /product="protein of unknown function DUF511"
FT                   /note="PFAM: protein of unknown function DUF511"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92990"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBE9"
FT                   /protein_id="ABQ92990.1"
FT                   /translation="MTTRVQMIIETLRDYPDQMFTARQLGKLFLERYPHDLDEKRKNPR
FT                   YKTDADLIIQLAAEIGGERTEAAKRLCPNIVTQDKPRPRRYYWQTTPDTFDLIEEDDID
FT                   ANDDLAENIAPSLSSFSEHDLYPMLISYLSEDLGLFCRRIDERRSRNMRGSGGNHWLHP
FT                   DIVALETLDKGWSEVVRACVRGSNDSFFRLWSFEVKKSLNRSNVRKSFFQAVSNSSWAN
FT                   FAYLVTANLDSAVEAELQMLSGLHGVGVLLLNQQSLFDSQILIPARERTNIDWLSVNRI
FT                   VEENQDYEAFIDQVGIYSQTGRLTKSLWNK"
FT   gene            complement(41323..42834)
FT                   /locus_tag="PsycPRwf_0031"
FT   CDS_pept        complement(41323..42834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0031"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92991"
FT                   /db_xref="GOA:A5WBF0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBF0"
FT                   /protein_id="ABQ92991.1"
FT                   /translation="MSQKTTPNKQLDLTQGSIAKTMLLFALPTLGSSILQSLNGSINAV
FT                   WVGRFLGEEALAATANGNIVMFILISFVFGFGMASTILIGQAMGQRDNVMVKRTLGTAL
FT                   GSIIPISAILATIGWLFAPNLLDILGTPSSAFDLALTYLRMIFVAMPITLTFTLMMMAL
FT                   RGTGDSKTPLWFIALSVAIDLILTPLLIIGVGPFPEWGIFGSAFATAVANTLALIGMII
FT                   TLYLRGSVLALNRSDLRFLRPDRGILASMFSKGLPMGLQMIVISSAALTMLSLINREGV
FT                   QTTAAYSATQQLWTYVQMPAMALSAAASAMVAQNIGANQWHRVSDITRWGLIFNVLLTG
FT                   LLIGALTLFDKSILSLFLGTDSTALPIASHIQIMATWGFLFFGIAQVFFGTMRANGYVI
FT                   WPLMVMVISMYPVRLGFAFGFYSWLGADALWLSFPAGMVATAVMGAGLYLHGKWRKGQV
FT                   LPPKEAAQITEGYRAQGSCSASCRDVASTTAWEPLEDQQVAARRS"
FT   gene            complement(43098..44633)
FT                   /locus_tag="PsycPRwf_0032"
FT   CDS_pept        complement(43098..44633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0032"
FT                   /product="Uncharacterized iron-regulated membrane
FT                   protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92992"
FT                   /db_xref="GOA:A5WBF1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBF1"
FT                   /protein_id="ABQ92992.1"
FT                   /translation="MSPSNIPSHPPLHGLADTPANNPLNKSPAPLHTTAKPNINKPAKG
FT                   DGKNNKKYATIWRWHFYAGMFIAPFLLILSLSALGMLFMANTVGPNNELLTVSKQDTIT
FT                   PVSVQAHSALSAVPDGTLKQYIAPKSDHNVALFRVGSETGQTMVAVDPYSAKVIKIAPS
FT                   DSNLYHTFDNIHSDLLIGKVGDYLLETAASLTTLLVLTGWYLWWYRRKSIKAMLIPDAK
FT                   LNNKRSTFVTIHATLGTWLSVLLLLFCVSGMAWAGIWGGKVVQAWSQFPAGKWGNGPMP
FT                   ASTLPPTHGEALNSSGIKEVPWILELTPMPTSGSTLGEKGIDPSLPITLDTVDRFARDS
FT                   GFEGRYQLNLPQGETGVWTLSQDSMSYDTPSPMADRTMHIDRYSGKVLADIRFEDYNAF
FT                   GKFMAAGNAIHMGTLGLWSLMANVLFCLSVITICISGYVMWWQRRPSKLNTAATQKSGL
FT                   NPPPSKGDIPWGLAIILLIVSVIFPTAIIAIVAIAVLDFVIIGRVPVLKRLLK"
FT   gene            complement(44949..45491)
FT                   /locus_tag="PsycPRwf_0033"
FT   CDS_pept        complement(44949..45491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92993"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBF2"
FT                   /protein_id="ABQ92993.1"
FT                   /translation="MYPFYRYTKSIVKAIVAQKKGDTVGLEDVATMQFRCSLTDIDNFL
FT                   EMNNGRVFTLYDLGRTDFAVRSGLGKQLLENRWGLVVAGSTIQYRKRIRAFDLVTIKTR
FT                   IAAIDERWIYVEQSMWVKGQPCSSALLRTGVTKGGRVLQTQQVLDALGKSDWKLPPTGY
FT                   VAEWIKSDADRPWPPSV"
FT   gene            complement(45621..46781)
FT                   /locus_tag="PsycPRwf_0034"
FT   CDS_pept        complement(45621..46781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0034"
FT                   /product="hydrolase of the alpha/beta-hydrolase fold-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92994"
FT                   /db_xref="GOA:A5WBF3"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBF3"
FT                   /protein_id="ABQ92994.1"
FT                   /translation="MIDLIKKQIKLQTRIVAVKAAKKKRATARSQLSLSKRGQFNPPPF
FT                   NPPFWLSNPHLQTILPKFVAPQAPKYRREILRDSLNESDVAYDFYDAHPVDNTDDKIET
FT                   TPLVVLFHGMEGSSDSHYARVLAHQMHAEGWHFVVAHFRSCGGVPAKGRVFYNAGDTAE
FT                   IHHMLQTLRQHYQNIYAVGVSLGGNALAKYMGEYADDAQCEAAVVVSAPVDMSSAAVSM
FT                   HRFVSHKIYTPYLLNPIIKKALLNEISEEEIEAIKSVDRISDFDTIFTAPRHGYRSNTD
FT                   YYYRSSALPHLGDVTHPMLLISAKDDPFIGFTATANDVSDQVTILDTKHGGHIGYLRYQ
FT                   PKAAKTTRNGAAKPSTKEGKFDINWIPETVSAYFKSVGIDEAAHSS"
FT   gene            complement(46962..47558)
FT                   /locus_tag="PsycPRwf_0035"
FT   CDS_pept        complement(46962..47558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0035"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92995"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBF4"
FT                   /protein_id="ABQ92995.1"
FT                   /translation="MTYQTLAAPVSARLEIKKSDFITYAYPVHSREKAMFHVEQLRAKY
FT                   PDARHHCWAYIIGDPNNTTSAGFDDDGEPNGTAGRPILNVLQHKSIGNVIVIVVRYFGG
FT                   IKLGAGGLTRAYAGSAQAVVDEMTLTTYVPMTQVEIEADFANESQVRYVVEDMGGEIGD
FT                   VSYSKCVTLTATLPEADVEALKERLSIYGRLLEQE"
FT   gene            47808..48512
FT                   /locus_tag="PsycPRwf_0036"
FT   CDS_pept        47808..48512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0036"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /note="PFAM: RNA-binding S4 domain protein; pseudouridine
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92996"
FT                   /db_xref="GOA:A5WBF5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBF5"
FT                   /protein_id="ABQ92996.1"
FT                   /translation="MRLDKFISKATELSRKEAKKVLHASEITVNDEVVKDGSVHVDVLN
FT                   DEVMWAGEPLSVATGSRYILLHKPEGFECTLKPKEYPIVTELIAVPELSNLRIAGRLDV
FT                   DTTGALILSDDGSWLHRVTSPRHLHEKVYELTLADAMDEEAQAHAIKKVGQGILLDGDY
FT                   EPTKPALLEFIDETHARLILTEGKYHQVKRMMAYFGNKVVELHRASIGGITLEGLEKGD
FT                   SRFLTEDEVNSF"
FT   gene            48862..49977
FT                   /locus_tag="PsycPRwf_0037"
FT   CDS_pept        48862..49977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92997"
FT                   /db_xref="GOA:A5WBF6"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBF6"
FT                   /protein_id="ABQ92997.1"
FT                   /translation="MSHFLNTLRLICSKSLTLSLAMPVLISALVIMPSAHADLSAFNEA
FT                   YDKLAANDSRPLKAPTPQQQDFIKQILSNAGMMTPIASIQPSKLPSMYQITLVQNPSTE
FT                   PQPPLHITADGAYILQGELKPNPSPVKVPTPQQLPSKTLSGMPVSDDLRASMLKNSSLL
FT                   KNMTPDVALYHTAVPGVIWGATLKGQPFITNTEATVFTSGEISVIENGQFAGLDADFEQ
FT                   KKNLHVLSSLDDDNLVIYPATTTEKAVIYVATDINCPYCRVLHQDMAKLNAKGVTVKVI
FT                   AYPYYEQSPEQMRQIWCAADKAARKQALDEAMSGKPVNNTCRSGIDHLKANQVKAAGLA
FT                   VFATPAIYREDGAAFNAPYKDPSFLPFLGLN"
FT   sig_peptide     48862..48975
FT                   /locus_tag="PsycPRwf_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            complement(50008..50667)
FT                   /locus_tag="PsycPRwf_0038"
FT   CDS_pept        complement(50008..50667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92998"
FT                   /db_xref="InterPro:IPR021330"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBF7"
FT                   /protein_id="ABQ92998.1"
FT                   /translation="MKSLKFLLISLVIIAVVIFAGSPYYAAYQLKNAYDTHDGATLTHH
FT                   IDFEQLQPNIQNQLTSKFANTLQQYPLVAQLGGEALTEAADEFIHASVTKAVTEENIRS
FT                   LINTQGQANQATKELAAAWAIASNKVDLQRLIQDIIVQRGDINAVLKNQMQQIMSAQST
FT                   ELESHVQSGEDSAKPKLSYCGINCFTLSGQVKGYPLTLQMQREGLIGWKIINVVLP"
FT   sig_peptide     complement(50587..50667)
FT                   /locus_tag="PsycPRwf_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.565 at
FT                   residue 27"
FT   gene            50881..52014
FT                   /locus_tag="PsycPRwf_0039"
FT   CDS_pept        50881..52014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0039"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ92999"
FT                   /db_xref="GOA:A5WBF8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBF8"
FT                   /protein_id="ABQ92999.1"
FT                   /translation="MSKRDFYEVLGVDRSADEREIKKAYRKLAMKYHPDRNSDDPDAEE
FT                   KFKEASMAYEVLSDKEKRSAYDRMGHAAFENGMGGGGFGGAGAGNFQDIFGDIFGNFGD
FT                   IFGQSRGGGGRQRRGSDLRYVIELSLEEAVRGCKKEISFTAPAPCETCDGKGAKNASDI
FT                   QTCSTCGGHGQVRMQQGFFAVQQTCPNCGGSGQEIKNPCNDCHGTGVKDKSRTLEVSIP
FT                   AGVDDGDRVRLAGEGEAGGAGVQNGDLYVEVRVKEHPVFKRQGADLYMDVPVSITDAAL
FT                   GKEVEIPTLDGKVKIKVAEGTQSGKLLRVRGKGVTPVRTTMKGDLICRIMVETPVNLTR
FT                   EQKDLLRQFQDTLDGDSKHHQSPKKKSFFEKLGDLFD"
FT   gene            52036..52179
FT                   /locus_tag="PsycPRwf_0040"
FT   CDS_pept        52036..52179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93000"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBF9"
FT                   /protein_id="ABQ93000.1"
FT                   /translation="MAHMFHVKRMGFFMGYLLPPLWLDNGAIKIKGRLSGRRQTYHGNL
FT                   QI"
FT   gene            52237..53064
FT                   /locus_tag="PsycPRwf_0041"
FT   CDS_pept        52237..53064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0041"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93001"
FT                   /db_xref="GOA:A5WBG0"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBG0"
FT                   /protein_id="ABQ93001.1"
FT                   /translation="MTQTASQTIKVGVIGAGGRMGRMLIEAVHNNANTVLAAAIERSGS
FT                   SLIGVDAGELIGQHKNQVALSDDLAAELGNIDVLIDFSLPDATEKNVQLCAKHKVAMVI
FT                   GTTGLSEAQEAMLNAASAQIPVVYAGNYSTGVNVSLKLIEMAAKAFGDSADIEVIESHH
FT                   KHKVDAPSGTAFMMANAAATARGQDLKQVAVYGREGQTGERKPGSIGIHAIRGGEIIGD
FT                   HSVMLIADGEMVEIKHHARERMTFAAGAVRAATWVVAQAPGRYDMQDVLGLKG"
FT   gene            complement(53180..53710)
FT                   /locus_tag="PsycPRwf_0042"
FT   CDS_pept        complement(53180..53710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0042"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93002"
FT                   /db_xref="GOA:A5WBG1"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBG1"
FT                   /protein_id="ABQ93002.1"
FT                   /translation="MAILPILSYPDPRLRTIAEPIKTVDAEIKQLIKDMIETMYDAKGI
FT                   GLAATQVDRHIQLIVMDLSENNDSPRVFINPKVTPLVEDKKPYEEGCLSVPDVYDSVDR
FT                   PVKVKIEALDADGNAFEEIAEGLLAVCIQHEMDHLNGVLFVDYLSRLKQTRARDKVKKY
FT                   LKTREKQLQHNKA"
FT   gene            complement(54039..54287)
FT                   /locus_tag="PsycPRwf_0043"
FT   CDS_pept        complement(54039..54287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0043"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93003"
FT                   /db_xref="GOA:A5WBG2"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBG2"
FT                   /protein_id="ABQ93003.1"
FT                   /translation="MSIIWTIIIGLIAGLLARAIKPGNDAMGWIMTIVLGIAGALVGGF
FT                   IASAIGVNADGGFIGLAFSVIGAIILLFIYELIMSKR"
FT   gene            complement(54628..56139)
FT                   /locus_tag="PsycPRwf_0044"
FT   CDS_pept        complement(54628..56139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0044"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase, middle
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93004"
FT                   /db_xref="GOA:A5WBG3"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBG3"
FT                   /protein_id="ABQ93004.1"
FT                   /translation="MHVHILGICGTFMGSLALLARDLGHTVTGSDANIYPPMSTQLERA
FT                   GVSIQEGYHATHLQPAPDLVIVGNAMKRGIEAVEYMLDTGIPYTSGPQFLSEHVLQHRH
FT                   VLAVAGTHGKTTTTTMLAWVLHYCGIDAGFLIGGVPLVESENDNLTKAFAHSSYLGADK
FT                   NAQGGRGYFVIEADEYDSAFFDKRSKFVHYRPRTAILNNLEFDHADIFKDLDAIQTQFH
FT                   HMIRMIPSSGQIIMPAHTPSLEATIDKGCWTPIWRTQIANNGQQDKSAQDKAVQDDSIA
FT                   WQAELISEDGSQFAIHFTNTQGDILSGEVHWGMSGRHNVENAMVAVAAAYDIGISVADA
FT                   CAALSQFSGIKRRMELIAELGAAESGSNFGVKVFDDFAHHPTAITTTLDGAKKKLKGAK
FT                   IWAIIEPRSNTMKLGVHKDNLAASAQLADEVIWYEPAGLEWGLTDVIEGANISNQQYVM
FT                   NDTQKIIDHICAKLGQSSQDDAIIIMSNGGFEGIHQRLIAALKKD"
FT   sig_peptide     complement(56077..56139)
FT                   /locus_tag="PsycPRwf_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.946 at
FT                   residue 21"
FT   gene            complement(56198..56713)
FT                   /locus_tag="PsycPRwf_0045"
FT   CDS_pept        complement(56198..56713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0045"
FT                   /product="disulfide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93005"
FT                   /db_xref="GOA:A5WBG4"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBG4"
FT                   /protein_id="ABQ93005.1"
FT                   /translation="MQRLLTYRALNFILFIASVVAMLFAIIFLQNYKGLEPCPLCIFQR
FT                   IGLMVMGGFSLIAAVGHPKKMGMQLLLWIGSMAGILWSAGVAARHVWIQHLPADQVPAC
FT                   GPGLDYFLEALPMKQVINQVLSGSGECAEISWRFLGLSIPEQALILFTALILVNLLVLW
FT                   RIISKRTA"
FT   sig_peptide     complement(56636..56713)
FT                   /locus_tag="PsycPRwf_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.676) with cleavage site probability 0.365 at
FT                   residue 26"
FT   gene            complement(56949..58529)
FT                   /locus_tag="PsycPRwf_0046"
FT   CDS_pept        complement(56949..58529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0046"
FT                   /product="glutamate-cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="TIGRFAM: glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93006"
FT                   /db_xref="GOA:A5WBG5"
FT                   /db_xref="InterPro:IPR006334"
FT                   /db_xref="InterPro:IPR007370"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBG5"
FT                   /protein_id="ABQ93006.1"
FT                   /translation="MTEVTAPNHQPLIPSWLTSQHLSGMLRGIEKEGLRMQSDGYLAQT
FT                   PHPQSLGSKLTHPYITTDYSESLLELITSPKSTVAETLNMLRELHVLVYQSLEDGELMW
FT                   PLSMPCMLSSDDNDIPLAEYGSSNVGRLKTLYRSGLGIRYGRRMQTIAGLHYNLSFGDD
FT                   LFSAWRDNTPKSEQLESLSEFKNAKYLGLIRNFKRMSSLVLYLTGASPSVCPCFLTGRK
FT                   HNLQLMNNTTYYSPKATSLRMGKLGYTNSVQDQLDIRYNNLPEYIEGLRRAINTPFSGF
FT                   TELGLDDDEGNPIQINDHILQIENEYYSPIRPKQIAESEEAPSHALEARGIAYVEFRAV
FT                   DLDPYSDIGIRLSTACFLEVLALYCLLTDSPDLLPEEDAVLAENLERVVNNGRAPGLTI
FT                   QTCDGSEQNLSEWMQQHLEAMMPLATLLDAEYGGNNYRVAVTLMLGKAVYPDATLSAQV
FT                   LADTQRLGSTWQLGHALAQQHRESILRSSLSPKTQAKYEVLAEKSWLQQQELEKDDSQD
FT                   FYDYIQHYR"
FT   gene            complement(58951..59280)
FT                   /locus_tag="PsycPRwf_0047"
FT   CDS_pept        complement(58951..59280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0047"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93007"
FT                   /db_xref="GOA:A5WBG6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBG6"
FT                   /protein_id="ABQ93007.1"
FT                   /translation="MTTITLTDSAANKVRKLREEEGDNNLMLRVYVTGGGCSGFSYGFN
FT                   FADEEGEDDASFENADVTLLVDSLSYQYLQGSTVDYTEGLEGARFVVTNPNATTTCGCG
FT                   SSFSI"
FT   gene            59540..61534
FT                   /locus_tag="PsycPRwf_0048"
FT   CDS_pept        59540..61534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0048"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93008"
FT                   /db_xref="GOA:A5WBG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBG7"
FT                   /protein_id="ABQ93008.1"
FT                   /translation="MIEFNKVSVRRDGRVLFSEATFQIHPGQKVGLTGNNGIGKSTLFG
FT                   VILTYMGERTTDELTVDAGNISIPSGWEVAHMAQEVEGSAQPAIDYVLSGDKEWYEINQ
FT                   KMMAPDELSDDDIAHLYQRFDEIDGYRTPTTAAQIMAGLGFQPTQHELPVNDFSGGWRM
FT                   RLNLAKTLMSRADLLLLDEPTNHLDLDAILWLEDWIAKFDGTVLLISHDQTFLDATIGF
FT                   ILHVENQRLTLYTGNYSQFVRTRSERLAQQQQAYEKQETTRAHLEDFVRRFRAKASKAK
FT                   QAQSRLKQLERMADLSPVMADNPFTFQFYEPSHMSSPLISLKGADIGYNGKPLLTHTSL
FT                   EITPDTRIGLLGMNGAGKSTLIKALVGELEPITGTYKVSDTLHIGYFNQHQMDSLDAEA
FT                   TPLIMMRRLAGKTSDAELRSFLGSFDFRGDRIDTPSKLFSGGERARLTLALIVWQKPNV
FT                   LVLDEPTNHLDLQMRQALTMALQGFAGAVVLVSHDRELIANVCDELYLVHNGKLQEFEG
FT                   DVSDYGKWLSEQRKSDAKEAAKESRDAKTVQAAAAKKAEEAKKAAAAKAAAEDNQLTKE
FT                   ERRKLAAEQRKLTAPIRKRIEQAEKQLDKVTASLEALEQKLADTSLYEDSRKDELLTLL
FT                   DEQAKLQQQQASLEEDMLMAMTELEQYES"
FT   gene            61767..62786
FT                   /locus_tag="PsycPRwf_0049"
FT   CDS_pept        61767..62786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0049"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93009"
FT                   /db_xref="GOA:A5WBG8"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBG8"
FT                   /protein_id="ABQ93009.1"
FT                   /translation="MAEKSFYEVLGVSKDASEQDIKKAYRKLVRKYHPDVSDAKDADEK
FT                   IAEINNAYETLRDKEKRAQYDAMQANPFAGAGFGSGAGFGSGGSGAQGGFRWEDIKDQF
FT                   GEGAPFGSGSFRFDDIFSAFGAGRGGAQSSRQSGFEGYDHFGSGFKDAGPAPGQDQHAE
FT                   INVSLDSVYSGDDYSIKLNVPSRQPNGSVIQEQKTLKIKIPKGITEGKQIRLSGQGAAS
FT                   YGGGKNGDLFLKVKITHDANIRLEGADVYQTVNITPWEAALGEKINISTPAGTLGVTIP
FT                   KNSKSGSNLRVKGKGIPAKQAGDLYLTLNIVNPELTTEAQKEAFAALKASFAEAEIKR"
FT   gene            62826..63155
FT                   /locus_tag="PsycPRwf_0050"
FT   CDS_pept        62826..63155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93010"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBG9"
FT                   /protein_id="ABQ93010.1"
FT                   /translation="MQHSSEFNDIIMSLDELIAACGAERGWVLALIEENIIEYDVPEKQ
FT                   QFTGSQLATVRRASRLSRDFEASIPAIGLILELLDEVEQLRQYKRQQEAATHSVYTIEV
FT                   DFQQK"
FT   gene            complement(63310..64530)
FT                   /locus_tag="PsycPRwf_0051"
FT   CDS_pept        complement(63310..64530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0051"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93011"
FT                   /db_xref="GOA:A5WBH0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBH0"
FT                   /protein_id="ABQ93011.1"
FT                   /translation="MRALIDMYQRIGLVPLIIVGLVLGILIGWLMPSVGVALGLLGSLF
FT                   VGALKAVAPILVFILVMAAISQHQGESQVHVRPVLIMYIFGTFLAALTAVVASFAFPTE
FT                   LLGLNTIEAVADQAPPSGLKEVLTTLLMNLVDNPVNAIANANYMGILAWALIIGLALRK
FT                   ASATTRTMVSDLSEAISNVVRFVIAFAPIGILGLVANTIAETGFSALMSYGRLLTILVG
FT                   CMLFIALVVNPIIVAFNIRRNPYPLVFTCLRESGITAFFTRSSAANIPVNMNLAKKLGL
FT                   HEDTYSVTLPLGATINMAGAAITINVLTLAAAHTLGVPVDFGSALLLSVVATVAACGAS
FT                   GVAGGSLLLIPLACSLFNIPNDIAMQVVAIGFIIGVVQDSAETALNSSTDVLFTAAADP
FT                   IMKNKTA"
FT   gene            complement(65071..65571)
FT                   /locus_tag="PsycPRwf_0052"
FT   CDS_pept        complement(65071..65571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0052"
FT                   /product="DNA polymerase III, chi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: DNA polymerase III chi subunit, HolC"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93012"
FT                   /db_xref="GOA:A5WBH1"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBH1"
FT                   /protein_id="ABQ93012.1"
FT                   /translation="MQISFYVLGERYLNDNAAASSTASAANAEAVLNFVCRLTQTVLQK
FT                   SEHSLVIIDDQVERLKQLDTQLWSFDPVSFVAHDFILEEAAVSQLSAPVSLVSTLPKGF
FT                   DGVILNLAATPLPLSVETTAAVLPERVLEIITPDEAGKQLGRDKYRAYQQLGFELNYFP
FT                   INK"
FT   gene            complement(65587..67233)
FT                   /locus_tag="PsycPRwf_0053"
FT   CDS_pept        complement(65587..67233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0053"
FT                   /product="aminopeptidase A, Metallo peptidase, MEROPS
FT                   family M17"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17, leucyl aminopeptidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93013"
FT                   /db_xref="GOA:A5WBH2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBH2"
FT                   /protein_id="ABQ93013.1"
FT                   /translation="MSLSISVSKTLPKLTTKKLLKKSAPEAVQSHCLAVLVDDDANLIG
FT                   SFKGLEAYKPRIEALIAASNFKGKLGETVADFALAADAKKTPFQLLLVGIGNPDKFSST
FT                   SIKKIASALYKNTQSRVTDLAIAIGDDLADDSLHQLVLELLNASYRFDKYKSEQTDAAL
FT                   NQITLVSSSVAQADVDYAAAVHSGQSLARDVANEPGNVCFPEYMADQARALAKAYPELL
FT                   QVTVLGESEMQELGMNCFLSVSRGSAREGQLVILEYKGQANAAPTNTTSSLADTLANNI
FT                   KAVADKLPKKSAKTKAAKVAADDVVEEHFDAPIVLVGKGVTFDSGGISIKPGAAMDEMK
FT                   FDMGGSASVLGTIKALCEARLPINVVGALACAENMPSGEATRPGDIVKAMNGMNVEILN
FT                   TDAEGRLVLADTLCYVQRYNPRAIIDVATLTGACVVALGHVRSAVFSNNEDVLFDLENA
FT                   SEQSGDLIWHMPMDDEYQTQLDSPIADIQNIGGRDGGAITAACFLSRFVKEDQAWAHLD
FT                   IAGTAWVSGKEKAATGRPVPLFMQYLKNLAQ"
FT   gene            67680..69164
FT                   /locus_tag="PsycPRwf_0054"
FT   CDS_pept        67680..69164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0054"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93014"
FT                   /db_xref="GOA:A5WBH3"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBH3"
FT                   /protein_id="ABQ93014.1"
FT                   /translation="MQAVLDLAHPCNLSFFNNLSLPVILRRYMTRQVASTTALVLGFLV
FT                   VLLLGGRMIRYFGIAAEGRLDVGLLFSIIGYNLPYFLELVLPLSFFIGLMLVFGRLYVD
FT                   HEMAVLNGSGISRGRLARLIIPLILVLFVLEAGLSLYGKPWGVKNSESIWQQQSLSSAF
FT                   DLIRPQTFINSDDYHLYVGSMNDNKTELQDVILIQTAKDAAKSVKPGATVPEATTNAPA
FT                   VRLGQQELEGSNSANQSVSSIDKDKAITAVTNPVAASQDKPAAKPAITADDDRDIIVLA
FT                   KRAVQVKGSEESGKTQLDLFQGRRYEVGADSLVYSQIGFERYRISINQPPADVLTEENV
FT                   TTQSVPALWKAATGQKVATKADGSTEPEPQQILSAQAELGYRLALPWLIILAPMLAVPL
FT                   AQVKPRQGRWLRLLPAILIFTSCVLVIISLKNAITKGTLSVLSYPLVLIGFIVLALYLN
FT                   WASRIHHRVRFRLGQRALQSQTNHSSNPDINQGGRS"
FT   gene            69161..70510
FT                   /locus_tag="PsycPRwf_0055"
FT   CDS_pept        69161..70510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0055"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93015"
FT                   /db_xref="GOA:A5WBH4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBH4"
FT                   /protein_id="ABQ93015.1"
FT                   /translation="MKPRHTDHSDASKDIRSGRIISRYVKKNALFAMLFAVLGLWALQM
FT                   VFAYLAELEDISDAYTYVDALTYIFYRSPYFLQQFMPTGALLGAVVGLGLLANNSELIV
FT                   MRAAGLSIYRIVGWVLQPAFIFVILALLINQFILPQSNVKASQIRKPDTALLASVNGYW
FT                   TLQNAPTEAGSTTDNKEGLSSEQAHNIIFIDYADANGNIGEVKRWHLDADNNLTAVSKA
FT                   TGGTYVPSLQQGQDKPVVAAQDQSDSLANYQWQLDNVTTLKVADKAAILESDTLGNQPA
FT                   AQLTDTQATSVDSDQSGQAMALTSQPLVAKQAESTDVINLPISPSSVYLLTRRAEDLSL
FT                   TQLYEHKRFNASQGTRSLEHEVAFWQKLLSPFSVLSLVIVACSFVFGSLRTHSLGLRIV
FT                   VAIIFGLLFSYIQDLTSFVSLATGAPPLLMVLLPIIGSGLLGFYLIRRQG"
FT   sig_peptide     69161..69307
FT                   /locus_tag="PsycPRwf_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.423 at
FT                   residue 49"
FT   gene            complement(70721..71329)
FT                   /locus_tag="PsycPRwf_0056"
FT   CDS_pept        complement(70721..71329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0056"
FT                   /product="16S rRNA m(2)G 1207 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="PFAM: methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93016"
FT                   /db_xref="GOA:A5WBH5"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBH5"
FT                   /protein_id="ABQ93016.1"
FT                   /translation="MMHRPPADLLEKANHWREDIAFTQEVLGAPMHFTTTWGIFSPEKL
FT                   DAGSLMLLDHIDFQSDDDSIDLGCGYGVLGMTAARECPQGQHTLIDKDFMAVEYARRNC
FT                   QNNGLSNVDVHLSNGFNHVDPNKDFSLVMSNLPAKVGKEQHYLYLLDAYSKMRTGGRFY
FT                   VVTINGLRQFMKRAFTEVFGNADKVKQGKTYTITRAIKE"
FT   gene            complement(71419..72117)
FT                   /locus_tag="PsycPRwf_0057"
FT   CDS_pept        complement(71419..72117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0057"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93017"
FT                   /db_xref="GOA:A5WBH6"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBH6"
FT                   /protein_id="ABQ93017.1"
FT                   /translation="MIMTMTAKKLLIFDFDGTLIDSVPDLAEATNTMLTRLNKTPYPVD
FT                   MIRNWVGNGSRMLVKRALVGAIEVAEGQLTSTAVDHAESVFFDAYAQISGQNTVAYPHV
FT                   DSGLKQLKQAGFTLALVTNKPIQFVPKILQSFGWQSLFEQVLGGDSLPVKKPDPAPLLH
FT                   VCETLDISPEQAVMIGDSKNDILAGQNANMDTLGLSYGYNYGQDIRSLNPTEAFDDFQS
FT                   LVDWLIKHGA"
FT   gene            complement(72142..72642)
FT                   /locus_tag="PsycPRwf_0058"
FT   CDS_pept        complement(72142..72642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93018"
FT                   /db_xref="InterPro:IPR025494"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBH7"
FT                   /protein_id="ABQ93018.1"
FT                   /translation="MSQFDYSLDYINLDLRKHPELYRIGRGEQGVLLVEPYKSEILPHW
FT                   RFATPEVALKSSDKIYQMFLEYLDNEDFVGADMARKFLQMGYTRARRYANHKGGKKYKG
FT                   PVPDDKKGQSGSHGREELPRQPEDPIKAESARIFKHKWDLCRSNDTYLALKKAHKQHYE
FT                   KQG"
FT   gene            complement(72770..72845)
FT                   /locus_tag="PsycPRwf_R0001"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(72770..72845)
FT                   /locus_tag="PsycPRwf_R0001"
FT                   /product="tRNA-Phe"
FT   gene            complement(72940..73383)
FT                   /locus_tag="PsycPRwf_0059"
FT   CDS_pept        complement(72940..73383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93019"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBH8"
FT                   /protein_id="ABQ93019.1"
FT                   /translation="MTDMPLEAVAINSFDAPLMRETKHDGELRERIAKLYKAQNANLGD
FT                   LADSEAVMTLFEKAFKRGNVMYVGMFNDKPIAVVGCFDDGQTDTKRLQYLALHPENINR
FT                   GIDAKFIKLVYDKETKKGVRQFMPADTQIHKIMTEYELIRVKS"
FT   gene            73612..74238
FT                   /locus_tag="PsycPRwf_0060"
FT   CDS_pept        73612..74238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0060"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93020"
FT                   /db_xref="GOA:A5WBH9"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBH9"
FT                   /protein_id="ABQ93020.1"
FT                   /translation="MTTEIHSNPANRPNRIASVERNTAETQVSVTVNLDGTGQGKIDTG
FT                   VPFLDHMLDQIKRHGLFDLDITCKGDTYIDDHHSIEDTGITLGQAFAKALGDKKGIRRY
FT                   GHFYAPLDESLTRAVVDISGRPGLHMDIPFTRSHVGNFDVDLFSEFFFGFVNHAWMTVH
FT                   LDNLKGKNSHHQIECTFKAFARALRMACEYDERALNTLPSTKEAL"
FT   gene            74243..74878
FT                   /locus_tag="PsycPRwf_0061"
FT   CDS_pept        74243..74878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0061"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93021"
FT                   /db_xref="GOA:A5WBI0"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBI0"
FT                   /protein_id="ABQ93021.1"
FT                   /translation="MTKIALLDYGMGNLHSASKALAAVGAEVSITNDPNIIRAADKIVF
FT                   PGVGAMRDCMAQMREQGIDEVVKEAAFNKPVMAICVGMQALFTESLEFEHTECLDILQG
FT                   QVKQFDPSWIDPKGETIKIPHMGWNTIEGMDLSHPLWQGIDEHAHFYFVHSYYCAPEDN
FT                   SVVAAVCDYGQPFCASVLKDNLFATQFHPEKSHNDGLQLLKNFVEWNI"
FT   gene            75246..75593
FT                   /locus_tag="PsycPRwf_0062"
FT   CDS_pept        75246..75593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93022"
FT                   /db_xref="GOA:A5WBI1"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBI1"
FT                   /protein_id="ABQ93022.1"
FT                   /translation="MDDNVIDFQQFKIKVIELTGLERDALHIYVGIGVFLITLMLARKW
FT                   VRYHRTRLKLALLVAIAFALMGEFLDLRHSYPNISGDILAASIHDIINTCFWPLMLYVI
FT                   NRWTPLFNKDD"
FT   gene            75685..76128
FT                   /locus_tag="PsycPRwf_0063"
FT   CDS_pept        75685..76128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0063"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93023"
FT                   /db_xref="GOA:A5WBI2"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBI2"
FT                   /protein_id="ABQ93023.1"
FT                   /translation="MTSAVQPEQKMRSRNDRIRHALGFEILGLMLFAPLGSWVFGYELH
FT                   TMGVIAVAASIVATVWNYFYNILFDNAMVKLRGSVHKTLLIRILHALLFEGGLLLLFMP
FT                   IIAWYLGITLWEAFIMDIAMALFYLVYAFFYNIAYDKVFPIDR"
FT   gene            complement(76195..78975)
FT                   /locus_tag="PsycPRwf_0064"
FT   CDS_pept        complement(76195..78975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0064"
FT                   /product="aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93024"
FT                   /db_xref="GOA:A5WBI3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBI3"
FT                   /protein_id="ABQ93024.1"
FT                   /translation="MSDIFNVKDSLTVAGKDHAYYSLPKLAEKYPNINRLPYSMKVVLE
FT                   NLLRNEDGGQSVGENHIEAVANWDAGAEASKEIAFMPARVVLQDFTGVPSVVDLAAMRD
FT                   AVVKLGGKADQINPFIPSELVVDHSVQVDVYGREDSLDLNEKIEFKRNNERYEFLHWGK
FT                   NAFENFVVVPPATGIVHQVNLEYLARVVMASEQNGELTAYPDTVFGTDSHTTMINGIGV
FT                   LGWGVGGIEAEAAMLGQPSSMLIPQVVGFEMTGKLQEGVTATDLVLRVVEMLRAHGVVG
FT                   KFVEFYGEGLHSMPLADRATIANMAPEYGATCGIFPIDQMAIDYLRLSGRDEAQIELVE
FT                   QYAKAQGLWHDADTPAATYSSNLHLDLSTVQPALAGPNLPQQRINLADMHQKFGETLHA
FT                   MTKDRASEKEGKVRFDEEGGEQEQAERLSAKPKVFSSIDIDNKTHQLHDGSLVIAAITS
FT                   CTNTSNPAVMIGAGLVAKKAAAKGLKAKPWVKTSLAPGSKVVTDYLEKTKLMDELEKTG
FT                   FYLVGYGCTTCIGNSGPLLEAVEKGIEENNLVAAAVLSGNRNFEGRIHSHVKASYLASP
FT                   PLVVAYALAGTVDIDLTTQPLGQDQEGNDVFLKDIWPTSAEINELIANNIDAEMFRKNY
FT                   GEVFNGSEAWNAISSADSQLYPWSDESTYIKNPPFFDDMTMEPEGIKDITGARILGLFG
FT                   NSITTDHISPAGNIDPNSPAGKYLQQRGVLQADFNSYGSRRGNDAVMTRGTFANIRIKN
FT                   KMMGGKEGGYTYYFSGDKATLEQGEEMAIYDAAMKYKEDKRPLVVLGGEEYGSGSSRDW
FT                   AAKGTILLGVKAVLTSSFERIHRSNLVGMGVLPLTFKKGENADTYNLDGSEVLSITGLE
FT                   NGESRTATVTATRADGSSESFEVNVMLQTPKEREYVRHGGVLHYVLRQLAAENQA"
FT   gene            complement(79483..79842)
FT                   /locus_tag="PsycPRwf_0065"
FT   CDS_pept        complement(79483..79842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0065"
FT                   /product="protein of unknown function DUF1622"
FT                   /note="PFAM: protein of unknown function DUF1622"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93025"
FT                   /db_xref="GOA:A5WBI4"
FT                   /db_xref="InterPro:IPR012427"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBI4"
FT                   /protein_id="ABQ93025.1"
FT                   /translation="MPYLIESIDLIAKIVEFIGVMIMFIGLILAFYKAAISSNKFSHDT
FT                   YLGVRQGVGKSILLGLEVLIAADIMATVVTEPTLRSVVVLGVIVIIRTFLSLSLQVELE
FT                   GRFPWQHKNTPQDKE"
FT   gene            complement(79932..81788)
FT                   /locus_tag="PsycPRwf_0066"
FT   CDS_pept        complement(79932..81788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0066"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93026"
FT                   /db_xref="GOA:A5WBI5"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBI5"
FT                   /protein_id="ABQ93026.1"
FT                   /translation="MNNNFKKKNLILFAGAASVLSACATQSTPQGSYNTLQSADMIVTN
FT                   AKVAVMDDKRTTAEAIAVKDGKVLRTGSAAEILRLRDAHTQVIDGHGRTLIPGLNDSHL
FT                   HITRGGRFYNSELRWDGVTSLKEALRMLKEQAERTPKGQWVRVIGGWSPYQFEEKRMPT
FT                   IEEINEATGDTPAFVLYLYSRGWLNKAGMKALNIDRNTQPPNNDSRYEKDANGDPTGVL
FT                   LAEPNAMILYQVIGKMPQLSEEEMINSTKHFHHELNRFGLTSAIDAGGGGHTFPDDYEA
FT                   SKALATSGDSSLRISYYLFPQKAGEEKQAFEKWMANNKASVNEDIAHDHGYELKGGGEY
FT                   MTWAAGDFENFLADKPLIKDNEGWREATKEIIQMHVDKGWPFRQHSTYGENTKLIVDLV
FT                   DEIDRENNGKIKNEMRWAIDHGETITDETLREIKRLNGGVSVQDRMAYAGEYFVERYGA
FT                   QAAKTTPPFKKIYDMGIPLGSGTDGTRVASYNPWISLYWMTTGKTVGGMKLYDKDNLLD
FT                   RDDALEVYTSGSAWFSNEEDVKGSLEPGKYADFVLLSDDYFTVPEEKIKGIESVLTVVG
FT                   GKIAYGAGEYNKLDPQLPAVIPSWSPVKYYGGYHNAQKPVAK"
FT   sig_peptide     complement(81714..81788)
FT                   /locus_tag="PsycPRwf_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.770 at
FT                   residue 25"
FT   gene            complement(82072..83142)
FT                   /locus_tag="PsycPRwf_0067"
FT   CDS_pept        complement(82072..83142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93027"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBI6"
FT                   /protein_id="ABQ93027.1"
FT                   /translation="MKKHVVIFEARGGSDKSKYGYRRDTYPIIESLKARGWSAEVIFYS
FT                   DENRGEIYRYTIDKADAYVSRINPGNLKDETGYFQMLRELVHQGVKGLPHPDVMINYGA
FT                   KNVVERLKGTSLVPEDVYCYYDYDALKHQFPQTLARGERVLKQNRGSTGEGIWRVQLKD
FT                   PKKYKDLAEIPEDALLKLTEARDNHTEEKTLGEFIEFCYQYLEGDSGLILDMPFLPRIK
FT                   EGEIRVLMLRDKAVSIVHKKPDQSADAFSATLFSGATYRYDKPEQWQEMVDTVESSIPM
FT                   LQSRLGGYALPLLWTADFILDTDAEGKDVYVLGEINSSCVGFSTHLELSENIADEIMNL
FT                   IEAESVINSRFPAFTI"
FT   gene            complement(83647..84540)
FT                   /locus_tag="PsycPRwf_0068"
FT   CDS_pept        complement(83647..84540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0068"
FT                   /product="2-hydroxymuconate semialdehyde hydrolase"
FT                   /EC_number="3.7.1.9"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93028"
FT                   /db_xref="GOA:A5WBI7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBI7"
FT                   /protein_id="ABQ93028.1"
FT                   /translation="MTLLVPEFKTDPFFNLEDNWAQTAPNELTHYYDQGQGVPLLLMHG
FT                   SGMGTSAAVTWWQNLPFISQYARCIAFDFIGYGETLSAANTSPDTAYGIRQWGEHTLRL
FT                   MDALHIEKAWLAGSSLGGWVALQLAIDHPERVCGVISIGTGGAKKPKPDTRAAQPKPKG
FT                   PLSAELILQDLQKNIRNDAIISDTLVNLRYQAALKEANLGLRPYLMAARDRDREVLPLD
FT                   LDALAQLSLPVLLVHGRDDKVVPVARSLELLEAITTADAHFYKGAGHWPHIGRADEFNG
FT                   LMRDYLAAHHFPSLNN"
FT   gene            84811..86415
FT                   /locus_tag="PsycPRwf_0069"
FT   CDS_pept        84811..86415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0069"
FT                   /product="Cholesterol oxidase"
FT                   /EC_number="1.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93029"
FT                   /db_xref="GOA:A5WBI8"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBI8"
FT                   /protein_id="ABQ93029.1"
FT                   /translation="MKRRKFIQSMGLGLGASATLSGCQTLAKTAQPLSAPQVQAGHFSN
FT                   IIVGSGYGGAVSALRLSEQGHKVLILEMGMRWDRSPNHDTFCKMITADERSSWFSHWPN
FT                   APIPIPIPIKKYPGVLDLIEYDDMKVFAGRAYGGGSIVNGAIAIEPRRSHFEQTFPWID
FT                   ANEMYDTFFPRAMKTLKVSKIPEDFFNNSEHYEYTRAAERQADKAGLTTEFFGNSYDFD
FT                   YMQKEAKGEVYPSALGGEVIYGNNAGKYSLDLTYLKQAEATGNVSVRTLRKVNSIQALD
FT                   NHQLRLEVQVLNKTGGIDAIEYYTCDKLFLNAGSTGTSELLLKSQAQGKLTQLNEHIGQ
FT                   HWGPNGNIMTGRNFVHAAGKIQSTIPVKGINMWDGDRGGSKYKIFAELAPLPLGLETWT
FT                   TLYLAITDNPERGHYYYDKASQSVKLNWKRSQNEYSVNAAKELIEKLAQANGGRVSSLL
FT                   FNQGFGDDFCYHPLGGCVLGKATDELGRVKGHRNIYVQDGALIPGSAGVNPYVFITGLA
FT                   ERNMAYILQQDFSSSTP"
FT   sig_peptide     84811..84894
FT                   /locus_tag="PsycPRwf_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 28"
FT   gene            86426..87457
FT                   /locus_tag="PsycPRwf_0070"
FT   CDS_pept        86426..87457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0070"
FT                   /product="lipoate-protein ligase"
FT                   /EC_number="6.-.-.-"
FT                   /note="TIGRFAM: lipoyltransferase and lipoate-protein
FT                   ligase; PFAM: biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93030"
FT                   /db_xref="GOA:A5WBI9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="InterPro:IPR023741"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBI9"
FT                   /protein_id="ABQ93030.1"
FT                   /translation="MTLPIKLRILKSSVTNPWFNLATEDWIFQELDAHSHTLFLWRNSE
FT                   TVVIGRSQNPWVECKTDKMAEDGVYLARRQSGGGAVFHDLGNTNFTFLSPKDGYDQQAN
FT                   FDIIINALKKLGIEASLSGRNDMQVGDRKISGSAFKHATDRSFHHGTLLVNANMQKLGD
FT                   YLNPHPLKLQAKGIKSVRSRVANLVEFNDSITHESLSQAIIEAFCDYYGKTVEIEELDE
FT                   DSLKQEPHLNRYYEQMADWDWRFGKTPQFNHHIETRFEWGIIDLHLEVAQAIMTEVVIF
FT                   SDALNVELIEALKQALTGAKYTVDAVTSRLNDLKQQPAAGSESSWITQITDFEQWLTGQ
FT                   MVT"
FT   gene            87576..87959
FT                   /locus_tag="PsycPRwf_0071"
FT   CDS_pept        87576..87959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93031"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBJ0"
FT                   /protein_id="ABQ93031.1"
FT                   /translation="MFDLKSLFKKEVEKQLTDVEDYIFMPERIQLKVDDGQLNCVLNSD
FT                   GSVNIFYTKQGVTDVRVATRKHPLTSFEAELQHGLYDDVIEDVVDMVNKTVDGKSKYFR
FT                   SAVILPATPSLQAPEPTQTKTFD"
FT   gene            complement(88199..88789)
FT                   /locus_tag="PsycPRwf_0072"
FT   CDS_pept        complement(88199..88789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0072"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93032"
FT                   /db_xref="GOA:A5WBJ1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBJ1"
FT                   /protein_id="ABQ93032.1"
FT                   /translation="MSLRNTRNNYGSIAKWMHWIMAFAFIGAYVAVYFRHWFTVDETPI
FT                   NWTALQLHLSFGVVVGTLIIFRILWRLNNIQPDEEPGSKLAHLSAHLGHFGLYAVMIIM
FT                   PLTGYLGAKVDTEFFGLFVIPRFESTSMFQDFIAPTWNLTYEEFEVPFDFLHKEIVGKW
FT                   LGWMLVVGHILAALYHHYVKKDRTIIKMTRGKD"
FT   gene            complement(89243..91897)
FT                   /locus_tag="PsycPRwf_0073"
FT   CDS_pept        complement(89243..91897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0073"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93033"
FT                   /db_xref="GOA:A5WBJ2"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBJ2"
FT                   /protein_id="ABQ93033.1"
FT                   /translation="MTSHTTPTPSSKPLNPYNNLGSKSVQRSWWRSWIYPLLFLLAMVL
FT                   SLSTYLTLDSIQQSVRDYVTDNQRALVGGDLILESKQAWTPQVLQKVEQFEAQSADQKV
FT                   VYDYQFNAMISSVSEPKAAQTLTQNQVIHHAAAESAAHTLLARIKAVSSDYPLYGEVEL
FT                   ASGKPLWQQLTPHSVVVETQVLTGLHLKIGDTVKIGEGLFTIADELITEPDRPLTAFGF
FT                   GARVLMADTDLAITGLMGQRSRVDYQIELAGSEPAIVDERQQLEALLGDTSEVKITDAN
FT                   EADTSVTQVSDNVLMFLKLLVIAVLFLSAVALLSVVKAFVSLQQNANAIRRALGESISD
FT                   IKHSYYRVFIAMAVLACLVSGLLSLGMLKVGAQYLTAILPPDVNLSIKLISLIKISIVA
FT                   LVITLLVVQHSLYSVMHTKPSAVLKQATTNSRQHPPIYWYGLVLLASFGLMAYEFGSLL
FT                   NGLQVLGGMMLLAASFWLIGKGWLWLLATLASNGLFGKKSGWMVRTAVHNLSRKGNQSG
FT                   LFFVTLALSVSVLSMITLLNDSLNTQFVKAYPKDAPNLFFLDIQSDQHSALDSMIKAPI
FT                   TYYPVVRARVSEAGGVPAADIVVPQSEGDDPTRVFNLSYADSVMETEFITDAVHPNQLY
FT                   APLDKMATEAGVVPLSILDGAAELLNVGLGDQVAFNIQGIEIVGQITSIRERYERGPSP
FT                   FFYFLFQPEVLADAPQIQFATARVDSAQIPQLQTDLARKFPAITTIDGGAIAKQVQGYV
FT                   SQMSRLVQVFTLLAIITGIMVLITSLLSTSQDRLRDSASFRLLGMQTADLYKINMLEIG
FT                   LLGVSAGVFAVVLASATAYVLITEWFNLRFSVPWLSFGIGGLMLVAVLIIIAVSYVRLV
FT                   IGRGIMARVREMV"
FT   gene            complement(92102..92863)
FT                   /locus_tag="PsycPRwf_0074"
FT   CDS_pept        complement(92102..92863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0074"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93034"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBJ3"
FT                   /protein_id="ABQ93034.1"
FT                   /translation="MLMLMSYNKNILLIGGTSGIGKALLERLSTDHKVTKIFATYHRHK
FT                   PDTNTTDKVVWLNMDVREEGSIKQAIADINRQTQHIDWVINAVGLLHTDTNQPEKAVRQ
FT                   LDAEFFLQNMTLNALPSLLIAKHIKSLLKAGTPSELHPAIYATISARVGSISENELGGW
FT                   YSYRMSKAALNMGMKTLSIEWQRTLKNVCVAVIQPGTVDTPLSKPFQANVAKDKLFTPD
FT                   ACAKHLLKVLNELTVEDTGCFIDWAGKTIAW"
FT   gene            93199..93774
FT                   /locus_tag="PsycPRwf_0075"
FT   CDS_pept        93199..93774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0075"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93035"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBJ4"
FT                   /protein_id="ABQ93035.1"
FT                   /translation="MALSLSKGGNLSLTKTDPNLNKLLVGLGWDERATSGAEFDLDASV
FT                   FLLNNTGRVRGDHDFIFYNQLKSDNGAVEHTGDNRTGEGDGDDEVIKVDLSRLPADVDK
FT                   VVVTVTIHDAQVRNQNFGQVANAFIRVVNEETGVEVVRFDLAEDYSVETAMVFGEVYRH
FT                   NNEWKFRAVGQGYSGGLQAMCQNYGVVI"
FT   gene            93929..95017
FT                   /locus_tag="PsycPRwf_0076"
FT   CDS_pept        93929..95017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0076"
FT                   /product="protein of unknown function DUF475"
FT                   /note="PFAM: protein of unknown function DUF475"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93036"
FT                   /db_xref="GOA:A5WBJ5"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBJ5"
FT                   /protein_id="ABQ93036.1"
FT                   /translation="MRHFYFDFIFTTLALIVAAWWGYSHGGMGGLISALSITAILAVME
FT                   ISLSFDNAVVNASVLKHWDKFWKMIFLTVGILIAVFGMRLVFPIVIVAVTADMGMMDVI
FT                   NLALYNPTEYSAKLMAHHAEISAFGGMFLLLVFLNFLFDDKDVHWFDWLERRLAKFGEV
FT                   DAMSVFVALAILMISLSWVHEEQTLAVLIAGVWGILVYLGVQVVSGMLEGDLEEAEEAL
FT                   EDGTVANSSNGSGNVGSAVMKGGIAGFLYLEVLDASFSFDGVIGAFAITNDVIIIMLGL
FT                   AIGAMFVRSMTIFLVEKGTLDEFVYLEHGAHYAIGALAVIMLLSMKFHVPEIVTGLIGI
FT                   AFIAWAVVASIRFKKLEQAGKI"
FT   sig_peptide     93929..94009
FT                   /locus_tag="PsycPRwf_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.704) with cleavage site probability 0.593 at
FT                   residue 27"
FT   gene            95318..95893
FT                   /locus_tag="PsycPRwf_0077"
FT   CDS_pept        95318..95893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0077"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93037"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBJ6"
FT                   /protein_id="ABQ93037.1"
FT                   /translation="MAISLTKGGNVNLSKEAPGLTNITIGLGWDPRATDGQDFDLDAIA
FT                   FLLNDAGKVRNDQDFIFFNNLKSGDGSVEHTGDNRTGEGDGDDEAIKVDLTRVPSDVSK
FT                   IAVCAIIYEGQARNQNFGQVADAFIRVVNDNGATEIARFDLSEDGSTETAMIFGEIYRH
FT                   NGEWKFRAVGQGFSGGLGPLAASYGVAV"
FT   gene            95983..96735
FT                   /locus_tag="PsycPRwf_0078"
FT   CDS_pept        95983..96735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0078"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93038"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBJ7"
FT                   /protein_id="ABQ93038.1"
FT                   /translation="MAATFSLIGTIEPFLHCNLKPGDSIYCEANAMVMMENNLELKGKL
FT                   QGGLMQSLMRRFANDESLFQQEIAATNGEGDCLLAPTLDGDMQILDIGPQQYTLSDGAF
FT                   VAATREVEVKANIQRNLGGAVFGDTGGFVVMQTQGQGQLVVSGFGSLFEIEVTPGKDVV
FT                   IDNGHVVCWDSNLQYSLSVSTSKKKGFMSNIINSVTSGEGMVLNFSGQGKVIICSRNRD
FT                   TYRGWVQSILGSSSGGRGGSGGFLDNIL"
FT   gene            96792..97409
FT                   /locus_tag="PsycPRwf_0079"
FT   CDS_pept        96792..97409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0079"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93039"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBJ8"
FT                   /protein_id="ABQ93039.1"
FT                   /translation="MAVNLQKGQKISLSKEAGGTLTQIKMGLGWDVAGSAAPAKKGGFL
FT                   GALFGGGGSGGGDSIDLDASCIMFDDNKQPVDAIWFNQLRSKDGSILHTGDNRTGAGDG
FT                   DDEVINVDLSKIPAHVKSLVFTVNSFTGQNFSTVENAYCRIVDAGNNAEVARYNLSSQG
FT                   NHTAMIMAKVYRHNGEWKMHAIGEVASGRTFNDLMPAITPHA"
FT   gene            complement(97552..98790)
FT                   /locus_tag="PsycPRwf_0080"
FT   CDS_pept        complement(97552..98790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0080"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93040"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="InterPro:IPR017115"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBJ9"
FT                   /protein_id="ABQ93040.1"
FT                   /translation="MSQTLIAGANAPLPTDNISVRILSDQPIDCAAYRLAETGKVRGDG
FT                   DMVFYGQTRSDDGSVSHRGHDTDAFFDISLPTQPQTIQKIALAFSSNQPLSQLGDIQLQ
FT                   VLQGTTVLMTCHVQSANRSEKALILGECYRRQGQWKFRFISQGFDGGLKPLSEHFGVEI
FT                   ADEAPAPSPVATPPAQNRSSQMPPPISAPAPSSPAPRSVNLSKISLTKNQSSINLKKKD
FT                   DFGKITVNLNWNRQNASGANTAVKKKGFLNDLFAAKSTGIDLDVGAMVHLNNGERTLIQ
FT                   ALGGRFGDLQRAPYVLLRGDDRTGQSLDGEWLDINGARWSDIKEVFIFAFIYEGAPNWA
FT                   QTDGTVTIYVPGQPPIETRMTEGNNASGMCAVARLMNQNGSINVERINRYFSGHQQMDE
FT                   AFGWGFNWKRARK"
FT   gene            99115..100233
FT                   /locus_tag="PsycPRwf_0081"
FT   CDS_pept        99115..100233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93041"
FT                   /db_xref="GOA:A5WBK0"
FT                   /db_xref="InterPro:IPR011226"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBK0"
FT                   /protein_id="ABQ93041.1"
FT                   /translation="MCPSTFSCAPSVWLAEGQSSQRDMLQSLQQLKRRSITPFEVIASH
FT                   RSQRPEIFEFADHVFIEPSVKQEQQSGLARWQFVLQHAIKANTKVLLTGRNSITYEAQR
FT                   AQFEQAGIRLLTGATSTEMLQKIDDKFAFMSHCQAHNIAAAEGWRFDTVDELKQLIETH
FT                   GHQPLCVKPISGIFAQGFWCLDTHAQASLDVQSASYDSFEHLYFTDNRRIATSEFISAY
FT                   SNSVMVKQRPIPMLLMPYLPGKEYSIDVVCERGEVLAAVTRYKVGKVQHLGYDESVMAV
FT                   VIPLIRAFGCDGIVSVQTKADEAGNHKVLEINSRPSGGIGYTVHSGIDLTQIAFGYWLG
FT                   VEDKPDLPLITTQIKPCQVRSIMCSVLIEPSE"
FT   gene            100375..101655
FT                   /locus_tag="PsycPRwf_0082"
FT   CDS_pept        100375..101655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93042"
FT                   /db_xref="GOA:A5WBK1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR011214"
FT                   /db_xref="InterPro:IPR022537"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR041688"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBK1"
FT                   /protein_id="ABQ93042.1"
FT                   /translation="MTCDSKHPPTDSLSYQQKRVELPRGTLDLSYRLSGEHSYQLDDLL
FT                   GFAQRINPKRAFLFVSKVLGRHIPVSPQIMRQAFSHLAHTVPDNLPEPIVVVGMAETAV
FT                   GLSAGVHQALQARYPNALLLNSTRHAQQQASLLTTFSEDHSHASTHLIYQSDEPHIQAQ
FT                   LMASKTLIMVDDEASTGNTCVNVVSALREAGLTELEQVHLVTLVDWSLGQADNDDHIAL
FT                   RLEGIAFERHHLMAGDWQWTDAPDPQPITMPSVDTTDAGSQPLLATGNWGRQPTLDSTE
FT                   GFAHFLARFKQAYQRARGIDVVSDPFIKDSGTTDNAQSTRILVLGSNEFVWLPFLLAEW
FT                   IEQQALTTSQSRAQVSFSALTRSPIALGGAIDAVLSFQDNYGLGMTNFVYNVVPEQWDI
FT                   IVLCVETPTESVDALWHNLDNVIVVSP"
FT   gene            101658..102512
FT                   /locus_tag="PsycPRwf_0083"
FT   CDS_pept        101658..102512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93043"
FT                   /db_xref="InterPro:IPR024197"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBK2"
FT                   /protein_id="ABQ93043.1"
FT                   /translation="MTINTHSLTPFMPDSLIIKPYALMDLDDTLFQTQRKIAAWQLPTA
FT                   EPHHLVYAAVNKQGEPLSLMTQRQQLFFNWLLSSTELIVVTARDRHEIKRVVLNFSSWQ
FT                   VLTHGALILQPSGEPLKAWQHQMGAILAPLQAKLQQLIAIIEAYNHRQQGPLRLALHHD
FT                   DFVAPGTDSSDDSLSEMLIYLAIKHHQKDAMALQQFGEWLLAEHPQLADDFYIHSNANN
FT                   LAILPKGIHKRHAVAYLLEQHLDHARPSFGFGDSLADLPFLQQLDWYGTPNHGQLHDHI
FT                   HVL"
FT   gene            102631..103830
FT                   /locus_tag="PsycPRwf_0084"
FT   CDS_pept        102631..103830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93044"
FT                   /db_xref="InterPro:IPR011215"
FT                   /db_xref="InterPro:IPR028157"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBK3"
FT                   /protein_id="ABQ93044.1"
FT                   /translation="MDLHKTTPPSDITSYCGSYLPSDVTLLLDIVDKSGVRDVPVAQKE
FT                   ALIQSGQQHYSDMLTLEKAPSDAHEQMYQQALQQGKLRLAQDIIRLSTTLKSLFETQTN
FT                   SRSPLILVSLVRAGLPIGVLLQRALSDGSAPYHLPSQHYGVSIIRDRGLDPVAVTKILS
FT                   AHPTSPIVFVDGWTGKGAIYGELSRSLKAYLDKHWTADASFSNVFHQGRGVVPLLTLAD
FT                   PAGVAWLSASNEDWLIPSGLLGSTVSGLISRTLYSAPNHDLTSGLHQSVIYHDLAHKDH
FT                   SLSFIEAIEDMRHQLLLQNANTTALPTYAAPRYHAQRIIETLANHYQISNINRIKPTIA
FT                   EATRAVMRRDPEQVLLASADHPDTALLRHLCQQKGVAVTVIGEQILPYQAVTIIKKRDQ
FT                   "
FT   gene            103978..105015
FT                   /locus_tag="PsycPRwf_0085"
FT   CDS_pept        103978..105015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0085"
FT                   /product="Citrate lyase beta subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93045"
FT                   /db_xref="GOA:A5WBK4"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039480"
FT                   /db_xref="InterPro:IPR040186"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBK4"
FT                   /protein_id="ABQ93045.1"
FT                   /translation="MNEPNFLSSVSAISESPLHPYQLGASLYMPATREDIWAVISRSKL
FT                   PNLDSVIICLEDAVSESDVPYAWSNIQKLLSHWASVQQDTPLSVSRSQCVNQIDEATGV
FT                   QISAVQKSNRPLVFIRPRNPQMLMQLAALPNINLVDGYVLPKVDMDSLSNWRLACQQVQ
FT                   EDSLLMPTLETGRLFDPAHNQALATALAHAFDERVFALRIGGNDLFSALRLRRPSTQTI
FT                   YETPVGTLMHQLIGTFVPQGYYLTAPVCEYFDNTALFIQELATDVSLGLVGKTVIHPAQ
FT                   IALVQQAFSVSTRVLEEAQAILAQDAKAVFKHNNTMLEPATHYAWAVQTVKRAQIFGVL
FT                   ANQML"
FT   gene            complement(105041..105742)
FT                   /locus_tag="PsycPRwf_0086"
FT   CDS_pept        complement(105041..105742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0086"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93046"
FT                   /db_xref="GOA:A5WBK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBK5"
FT                   /protein_id="ABQ93046.1"
FT                   /translation="MSSQIDNPNSDVKSSPLLTARNLSKSVMIGDTKTDIIKGVDVSID
FT                   AGEFVVIMGKSGSGKSTLLGLLAGLDYPDSGEIWLDGQNLTTLSEDELAQKRQQDMGFV
FT                   FQSFHLLPTLTVAENIAFPLDIARRPDPERVVQLLTAVGLTHRRDSLPHQLSGGEQQRT
FT                   ALARALVARPKIIFADEPTGNLDEQNAQQVMHLLLELQQQSGTALVVVTHDPAMTEHAD
FT                   QVITIHDGRVE"
FT   gene            complement(105835..106635)
FT                   /locus_tag="PsycPRwf_0087"
FT   CDS_pept        complement(105835..106635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0087"
FT                   /product="lipolytic enzyme, G-D-S-L family"
FT                   /note="PFAM: lipolytic enzyme, G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93047"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBK6"
FT                   /protein_id="ABQ93047.1"
FT                   /translation="MSMPFFKPLSAVVIASALLMGCQPSSNDKTATQSQAESSPTAKTQ
FT                   TNTSAPAASQSTTSVQSSAPAEVMEQPITILALGDSLTEGLGLPETEAYPAQLEAALKQ
FT                   AGYVNAKVINSGLSGETSTGLVNRLDWVLKTKPDITILTTGANDAMRGIDVATIDSNIR
FT                   TAIKRLQDQGSVVVLGGMQIYDNLGDDYVKSFSAIYPNIAKDTGVVFIPFFLDGVGGDA
FT                   SLNQADAIHPTKEGYARIVNNNILPVLKPALEKVAAQKQAQTAQ"
FT   sig_peptide     complement(106552..106635)
FT                   /locus_tag="PsycPRwf_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.627 at
FT                   residue 28"
FT   gene            complement(106771..107388)
FT                   /locus_tag="PsycPRwf_0088"
FT   CDS_pept        complement(106771..107388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0088"
FT                   /product="[SSU ribosomal protein S5P]-alanine
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.267"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93048"
FT                   /db_xref="GOA:A5WBK7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBK7"
FT                   /protein_id="ABQ93048.1"
FT                   /translation="MPSTTETVPHSAMNKLFGTDSTEVYLISQEWAQPLQAYLTANETR
FT                   LAPYEPAREPDYYTLEGVQARIAAALDMHRQRQGISMLFTSKNSTQVIGMINFSGFMYG
FT                   VFQAGYVGYSIDSDYEGKGIMSEVLSQALEYVRKHYGLHRIMANYLPDNHRSARLLNTL
FT                   GFEQEGYAKSYLKINGQWRDHVLTALVFDESHSTTTSTIEDQ"
FT   gene            complement(107494..108798)
FT                   /locus_tag="PsycPRwf_0089"
FT   CDS_pept        complement(107494..108798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0089"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93049"
FT                   /db_xref="GOA:A5WBK8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBK8"
FT                   /protein_id="ABQ93049.1"
FT                   /translation="MKFSKYGQQFTQTSAISQLMDDLGDALKSPTPVNMLGGGNPARID
FT                   KVNEAYFEVYKSLEKGGIEGGAIESVGNYSNPQGDAKFIEALVAFFNRHYHWNLTTEHI
FT                   VLTNGSQNAFFYLFNLFGGQFEDEKGNTTTKSILLPLAPEYIGYSDVHIDGKHFIAIKP
FT                   EIEEVEHEGESGFFKYKIDFDALENLPALKNGEIGAICCSRPTNPTGNVLTDEEMAHLS
FT                   QLAKQYDVPLIIDNAYGEPFPNIIYPDVNLNWDENTVLCFSLSKIGLPGARTGIIIAAP
FT                   EVVKTVSAMNAVVNLAPTRFGAAITGPLLNDDSLKQLCDETIQPFYAAKAKLAIEYLKQ
FT                   QLGEYPVFIHKPEGAIFLWVWFKDLPISTTELYELLKQKATLIVPSEHFFPGLDISDYP
FT                   HAHQCIRMSIAASDETLASGIKVIGEVVRSLYDAQ"
FT   gene            complement(108859..110148)
FT                   /locus_tag="PsycPRwf_0090"
FT   CDS_pept        complement(108859..110148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0090"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93050"
FT                   /db_xref="GOA:A5WBK9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBK9"
FT                   /protein_id="ABQ93050.1"
FT                   /translation="MSHSTSAQNSLSSKATTPNASQPAHTLGQKTPPAVFWLVVIAILL
FT                   MASNMRSPIVALGAIAPVVQDALNINATHIGWLGAIPMLMFALGALISPAIGKRFGLEN
FT                   TLIAVLFVITAGIIMRSTWVSWHGFLVGTVLLSLAIGFANTLVAPVIKQRTPHNIALVT
FT                   GLFSLTMSVMAGIVSGLVYPLTERIGWQWALGGWAILGIAAIIAWVILRLRLGSSHKLP
FT                   AAVMNSEQQAQEDICIWKSALAWQMAVFMGLQSLLFYTVAAFLPSIWISKGLSEVEGGS
FT                   MGSVFQFMAPIAIIGMTWLIRRGMQIQTVAIAATILNVIGLVGITYLSPHLAWLWTAIM
FT                   GLGCASIFTLCIMLFSLRTYSPNQASKLSGMAQTVAYLVAFAGPFGAGWLHEATGGWDG
FT                   PLLFILILTIINLIIAWLASRPIMIDGKPA"
FT   gene            complement(110349..110597)
FT                   /locus_tag="PsycPRwf_0091"
FT   CDS_pept        complement(110349..110597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93051"
FT                   /db_xref="GOA:A5WBL0"
FT                   /db_xref="InterPro:IPR007495"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBL0"
FT                   /protein_id="ABQ93051.1"
FT                   /translation="MLAQLLPMLLITFGVFVLFFLMMGIGYMVKKEPLRGSCGRVANLM
FT                   GDETCQFCGNDPNLCEQINDEKAFDSKKAADLGKSAL"
FT   gene            complement(110832..112007)
FT                   /locus_tag="PsycPRwf_0092"
FT   CDS_pept        complement(110832..112007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0092"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93052"
FT                   /db_xref="GOA:A5WBL1"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBL1"
FT                   /protein_id="ABQ93052.1"
FT                   /translation="MTPLFSALLSPTGSSSNLSASKAIMGTLMLSTTVLMSGCDQPPTY
FT                   DYIKGETMGTSYHITFQNPKGVNQDEIRQAIDKRLQQINLSMSTYMQDSTISKFNRLGA
FT                   GESITVDADFIKVLNDSKQVYQQSGGAFDPTVMPLINLWGFGTVMTAERLQNPPSASEI
FT                   ATAKALLDFKGIKLTEDKLSKDKPNVALDFSAVAKGYGVDVIAEVLHKDYKINNYMVEI
FT                   GGEVSTSGVNQNAQPWQIAIDAPILDSTVSERYTLAAIRQPLLSNKLHLATSGNYRNSV
FT                   VFDGRRYSHTIDPTTGQPIAGGAPSVSVVADSVSLADAWATALTAMTYEKALATAKQHN
FT                   LTVLFVIPKDGKIHDEVPSLEEIKKNKADPLAYWEVVETPAMKTLRSGQKD"
FT   sig_peptide     complement(111945..112007)
FT                   /locus_tag="PsycPRwf_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.982) with cleavage site probability 0.742 at
FT                   residue 21"
FT   gene            complement(112127..112927)
FT                   /locus_tag="PsycPRwf_0093"
FT   CDS_pept        complement(112127..112927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0093"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93053"
FT                   /db_xref="GOA:A5WBL2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBL2"
FT                   /protein_id="ABQ93053.1"
FT                   /translation="MKTKLNNLTIWITGASSGLGEALAIEFARRGATIILSGRNKQKLE
FT                   AVKAKCKKPTKHVVVPFDILDVAQAEAAYATVIQNAGHVDWLINNAGVSQRSLIMQTSE
FT                   AVERQLMEIDYFAQTRLTRLVLPDMIAQGGGKVVMVSSVAGLLGTQYRGAYGAAKAAIH
FT                   MWANSLRAELSEDNIKVATIFPGFIQTNVSINALTADGSAQGTMDDATDQGLSAKAFAK
FT                   QAVKALVQDEEYIIVAGQKEKFATLVNRVSPPKLYKLIRGAKVK"
FT   sig_peptide     complement(112853..112927)
FT                   /locus_tag="PsycPRwf_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.784) with cleavage site probability 0.605 at
FT                   residue 25"
FT   gene            113061..114344
FT                   /locus_tag="PsycPRwf_0094"
FT   CDS_pept        113061..114344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0094"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93054"
FT                   /db_xref="GOA:A5WBL3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBL3"
FT                   /protein_id="ABQ93054.1"
FT                   /translation="MTLDTRLIKRYQQLVRNHTHPNGYLHAGMKATMDTKSSFAQTQAL
FT                   WRFVHNDNISYQELSKPLLENSLRGCREDCKRYGLVMHDWSRLSLTHHNKQDTYAMTHN
FT                   LDVGYELQSSVLVSDINGRPIATPAQNLVTANGVHSSYQDTPAKQTHLNELTTRIEYLE
FT                   QQGFDKPLIHIIDREADSAYQMRQWDEHDYKFITRVKAGSYLSYEGKSQRCSQIAGQLN
FT                   FSYQRQVNYKGKAAKQYIATAKVVLTRSAKPQAIDPATGKRIAPIKGKPLSLLLTVSRI
FT                   YDDQDKRLATWYLLSNLQEPSVNGADISQWYYWRWQIESYFKLLKSAGLQLESWLQQSG
FT                   DAYFKRLLIASQACTLVWRIMQKTDKQSKEFALFLVRLSGRQMKRSKPITAPAVMAGLF
FT                   QWLNFNELVNHYSPDKLRQFADTASKFV"
FT   gene            complement(114491..115729)
FT                   /locus_tag="PsycPRwf_0095"
FT   CDS_pept        complement(114491..115729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0095"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit F"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit F;
FT                   PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93055"
FT                   /db_xref="GOA:A5WBL4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR010205"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBL4"
FT                   /protein_id="ABQ93055.1"
FT                   /translation="MELFGTAIGGVAMFTLIIMSLVAIILIARSRLVSSGDVTIHINGN
FT                   PDNDVVTPAGGKLLQTLASEGIFLSSACGGGGTCAQCRCKVIEGGGSILPTEEGHFTQG
FT                   EIRDNMRLACQVAVKQDMKIEIDPEFFDVQKWECEVVSNDNVATFIKELVLKIPDGEEV
FT                   NFRAGGYVQLEAPPHEVHYKDFDVAEEYRGDWDHFGLFKYVSKVDEPVIRAYSMANYPD
FT                   EKGIIKFNIRIASPPPRGPEGIPPGKMSSYVFSLKPGDKVTVSGPYGEFFAKDTKAEMV
FT                   FIGGGAGMAPMRSHIFDQLKRLHSDRKISFWYGARSVREMFYVEDYDMLAEQFDNFEWH
FT                   VALSDPQPEDNWEGYTGFIHNVLFEEYLKDHPNPEDCEFYMCGPPVMNAAVIDMLHSLG
FT                   VEDENILLDDFGG"
FT   gene            complement(115794..116402)
FT                   /locus_tag="PsycPRwf_0096"
FT   CDS_pept        complement(115794..116402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0096"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit E"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit E;
FT                   PFAM: RnfA-Nqr electron transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93056"
FT                   /db_xref="GOA:A5WBL5"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBL5"
FT                   /protein_id="ABQ93056.1"
FT                   /translation="MGHYVSLFITSVFIENMALAYFLGMCTFLAVSKKVSTAIGLGVAV
FT                   IVVMSITVPLNNLLFQFILKNGALAWAGFPDIDLSFLGLLSYIALIAATVQILEMFLDK
FT                   FVPSLYNALGVFLPLITVNCAIMGGVLFMVERDYNFTESLTYGVGAGFGWALAIALLAG
FT                   IREKLKYSDVPAPLRGLGITFITVGLMSLGFMSFGGMSI"
FT   gene            complement(116402..117076)
FT                   /locus_tag="PsycPRwf_0097"
FT   CDS_pept        complement(116402..117076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0097"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit D"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit D;
FT                   PFAM: RnfA-Nqr electron transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93057"
FT                   /db_xref="GOA:A5WBL6"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011292"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBL6"
FT                   /protein_id="ABQ93057.1"
FT                   /translation="MATETKKILTTPIFDNNPIALQILGICSALAVTTSVKNALVMCIA
FT                   LTLVTAFSSFFISTIRNRIPSSIRIIVQMTIIASLVIVVDQILKAVAYDVSKSLSVFVG
FT                   LIITNCIVMGRAEAFAMSNPPVPSFLDGIGNGLGYSAVLLFVATIRELLGNGSILGITL
FT                   LQPVTDGGWYVPNGLLLLPPSAFFIIAMFITVVRIWKPEQVEEPEFVIKPQSKGMAHGG
FT                   GH"
FT   gene            complement(117078..117941)
FT                   /locus_tag="PsycPRwf_0098"
FT   CDS_pept        complement(117078..117941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0098"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit C"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit C;
FT                   PFAM: FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93058"
FT                   /db_xref="GOA:A5WBL7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010204"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBL7"
FT                   /protein_id="ABQ93058.1"
FT                   /translation="MSQQTKKSSNSNMTTIMVALVLCLVCSVMVSAVAVGLKPAQLDNQ
FT                   LLDRNKNILVAAGLFDPAKDTNQDVEERFKDFEVKLVDLQKGQYATEQELTTAGITDID
FT                   KYDADQASKNKALSIDLGNDDPAGIGSTPKFAKVYVKNDANGKPELMVLPVHGYGLWGT
FT                   MYGFLTLEGDLNTVKGISWYAHKETPGLGARIEEDKWRDQWKGVHAYNDQGEVATGVTK
FT                   AGQPKPNENWVDGISGATLTSAGVKNLIQFWLGDRGYKPFLDNLRSGTPNNTANAQTST
FT                   TAGEEA"
FT   sig_peptide     complement(117837..117941)
FT                   /locus_tag="PsycPRwf_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.752 at
FT                   residue 35"
FT   gene            complement(117925..119157)
FT                   /locus_tag="PsycPRwf_0099"
FT   CDS_pept        complement(117925..119157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0099"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit B"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit B;
FT                   PFAM: NQR2 and RnfD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93059"
FT                   /db_xref="GOA:A5WBL8"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR010966"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBL8"
FT                   /protein_id="ABQ93059.1"
FT                   /translation="MKFLHNMFDRLEPNFTKGGKLEKYYAVFEMFDTFLRQPSSTTHSA
FT                   AHVRDGIDLKRIMIVVWLCTFPAMFWGMYNVGHQALMAISQLGLQPEGWRTAITNMVGY
FT                   DPNSMWAAFVYGAMQFLPIYIVTFAVGIFWEIVFAVVRGHEVNEGFFVTSVLFALCLPP
FT                   DIPLWQVALGISFGVVVAKEVFGGTGKNFLNPALSGRAFLYFAYPAYMSGDTVWTAVDG
FT                   FSGATPLGLAAIGVTPDKFVDAYGSAITWMDAFLGNMQGSIGEVSTLAILLGMIVLIWT
FT                   RIASWRIIAGCVVGLVATSMVFNAVGSSDNLMMSLPWYWHLVLGGFAFGAVFMATDPVS
FT                   AAHTNKGRWAYGILIGFMTVLIRVINPAFPEGIMLAILFANLFAPLFDYFVTQANIKRQ
FT                   TARRMRHVPAD"
FT   gene            complement(119163..120527)
FT                   /locus_tag="PsycPRwf_0100"
FT   CDS_pept        complement(119163..120527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0100"
FT                   /product="NADH:ubiquinone oxidoreductase, subunit A"
FT                   /note="TIGRFAM: NADH:ubiquinone oxidoreductase, subunit A;
FT                   PFAM: Na-translocating NADH-quinone reductase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93060"
FT                   /db_xref="GOA:A5WBL9"
FT                   /db_xref="InterPro:IPR008703"
FT                   /db_xref="InterPro:IPR022615"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBL9"
FT                   /protein_id="ABQ93060.1"
FT                   /translation="MITIKKGLDLPIAGAPSSEITQHSPKHVALVGYDYVGMKPTMNVK
FT                   EGDIVTKGQPVFEDKKRVGVIYTAPASGKVVAVNRGDRRVFESLVIEIDPNAGPNANEV
FT                   TFKQYASNELAGLDAEAVQAQLIKSGEWTAFRTRPYSRTPEIGARPQAIFVTAMDTNPL
FT                   AFDPMLLIQQEQQAFDDGLAVLSTLSPKTYVCHHGNANLPKVAKTAPGNSTEYHAFAGK
FT                   HPAGNAGTHIHFLHPVSRDVTVWTIGFQDVIAIGKLFTTGRLYTSRLISLAGPAVAKPH
FT                   LVLTERGAELTQLTQGELISGDNRIITGSVLSGRKTIGTTAYLGRFHNQISVLQEGYER
FT                   PAFHFFSPGFNRFSKLPIYISQFFKSKKYNFTTTTNGSPRAMVPIGVFEEVMPQDYLPT
FT                   QLLRALIVEDIISAVDLGALELDEEDLALCTFVSPGKYEFGDILRDNLTRIELEG"
FT   gene            120917..121696
FT                   /locus_tag="PsycPRwf_0101"
FT   CDS_pept        120917..121696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0101"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93061"
FT                   /db_xref="GOA:A5WBM0"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBM0"
FT                   /protein_id="ABQ93061.1"
FT                   /translation="MRTQSPFTQNTDVTTAVAPLLIPAIDLKDGKCVRLKQGRMEDDTV
FT                   FSDDPVAMATRWVNEGARRLHLVDLNGAFDGVPVHKDVVMQIAKAHPNLPVQLGGGVRS
FT                   LQTIEHYLAAGLTYIIIGTKAVENPEFVEEACREFAGHIIVGIDAKDGMVATHGWANVT
FT                   DTKATELAKRFADAGVSSIVYTDIARDGMMQGVNVEQTVNLARVGGLPVIASGGVTDMK
FT                   DIELLKPYGDCIEGIITGRAIYEGTLDLGEAQAYLDK"
FT   gene            121869..123482
FT                   /locus_tag="PsycPRwf_0102"
FT   CDS_pept        121869..123482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0102"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel;
FT                   transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93062"
FT                   /db_xref="GOA:A5WBM1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBM1"
FT                   /protein_id="ABQ93062.1"
FT                   /translation="MLLVSAWLWCLPAQALTEAEQQGTNSEAASVSAEPVASNQEIEQQ
FT                   PVDSDKPDIAETPGAVNVPTAGNITDKDTVIATKPDQVNDQDIKQRISGIYSEIEGLKA
FT                   LSVTVSQGVVSISGEVPNEKKAQQAISLANRVSDVVAVEDRISRTLDVQDNVTPVISSL
FT                   NQQIRAFIQALPLLVVAILVFAAVVWFGSWLARRESLWQRITPNPFIAELLAQTVKVLF
FT                   FIIALLLGLSLMGAEAIIGTLLGGAGVIGIAVGFAVKDTIENYIASLMLSIRQPFQARD
FT                   LVSINGQQGIVVRLTSRATILMTSDGNQLRLPNSEVFKGTILNYTKNPERRFTFQLGVD
FT                   ANDDPLAAIKVGLEAVNSLDFVLDNPKAVCIITEVGDSNIMLEFQVWVDQTDTDIMKAR
FT                   SIAIREAKHALEDHGFSLPEPIYRLRFNQDVEHAIMQLHSALSGESAESTEYDNSFVAN
FT                   NPKLIEALSKQIAALNNQAKPDTAQKEQAKQRAKQILGDKAVKEIFDAKPDPKLMQKVE
FT                   EEIQDHSGDKDLLDGNSPQE"
FT   gene            complement(123597..123812)
FT                   /locus_tag="PsycPRwf_0103"
FT   CDS_pept        complement(123597..123812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0103"
FT                   /product="L-lactate dehydrogenase (FMN-dependent) and
FT                   related alpha-hydroxy acid dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93063"
FT                   /db_xref="GOA:A5WBM2"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBM2"
FT                   /protein_id="ABQ93063.1"
FT                   /translation="MAMGADAVAVGRPVLYGLGLGGAQGVQSVLEFLEQDLKTAMLLSG
FT                   AAKLSDLNPSYIDIVGENEKYDTYNG"
FT   gene            123847..125037
FT                   /locus_tag="PsycPRwf_0104"
FT   CDS_pept        123847..125037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93064"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBM3"
FT                   /protein_id="ABQ93064.1"
FT                   /translation="MILRGETQENGELPTLSFSRTDGIALTKNNRIKDLNIQADASHRA
FT                   IYNILQEQDLGSFQFENLSLVGQLSFITRPGTKSAKVSIKDVDIIACDARHYPEQPQKY
FT                   GVNVLQGALTVYNFNSEKDSRIDLTIDNITIGRKNAPVLGSGLFVSGFGDEGGTVVADR
FT                   ITTGAVYSNGKLPFGVPDIITAAIFIVYGATVKQLTHNETIVTYGVSDMVLDTWGHVDN
FT                   WLSEKDVISYGPSGIGFVNFGTVGNFVVKGDVKTYGLGARGYNQYDGTVDNIEFGSIET
FT                   FGDGSIGIQLSRKIGKLTVHRDVITHGGEGQSLVKGVLSTLKAIGLSVKEGGEAEQINI
FT                   GGNLETQGNEVNTVEVNKGGKIHAIQVGGGIVAKGEKSKRLDIEDGADVPESLKEA"
FT   gene            125180..126169
FT                   /locus_tag="PsycPRwf_0105"
FT   CDS_pept        125180..126169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0105"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93065"
FT                   /db_xref="GOA:A5WBM4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBM4"
FT                   /protein_id="ABQ93065.1"
FT                   /translation="MSSTYPQTQSAIIITEFGEADVLQYRSDMVVPTLDTGMVLVKIAY
FT                   AGINPVDYKTRQGLGWGAQNIKDNQFAANQPAILGFDMAGEVVDSTVADFKPGDKVAAL
FT                   NFQGGCYAQYNTVDAQVLTKVPEAVDLKTAGALPCVGTTAKQMIDFADIKPGEHVVMSA
FT                   PAGGVGHLTLQMLVNAIEEKGIKITLICSAEKYQKIGSFIDPSKLEGWIDYTKQEAFPE
FT                   LEADLLLDLVGGEAGKKALAVVKTGGRVVVLPSIWADELKKAGADKQLQVEGFIAKPNA
FT                   QDLAAVLNQIAQGKLVLQIQDTYPLAKTADAHQALETVDSFGKIVLEM"
FT   gene            complement(126261..126899)
FT                   /locus_tag="PsycPRwf_0106"
FT   CDS_pept        complement(126261..126899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0106"
FT                   /product="DNA-N1-methyladenine dioxygenase"
FT                   /EC_number="1.14.11.-"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93066"
FT                   /db_xref="GOA:A5WBM5"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBM5"
FT                   /protein_id="ABQ93066.1"
FT                   /translation="MSTLFAPAPTDNLLPYDGIVNDLGRLITDDKALYQQLLAELPWQS
FT                   DKVTLFGKTHITTRQIVWMGDTPSASTQALSYTYSGHTRPIEPWHPAVFHVKHMIEQQL
FT                   QPLKICTQFNSCLLNYYPSGEEGMGYHADDEPELGYQPIIASLSLGATRKFVFKHKKTQ
FT                   DKVELYLESGQLVVMRGDTQQYWKHSITKTKKVDTGRISLTFRHMLNHP"
FT   gene            complement(126926..127873)
FT                   /locus_tag="PsycPRwf_0107"
FT   CDS_pept        complement(126926..127873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0107"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93067"
FT                   /db_xref="GOA:A5WBM6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBM6"
FT                   /protein_id="ABQ93067.1"
FT                   /translation="MKGLQVNDTAQFEHSIKLSGKQARYYDFAQLHTASDSTVSEIESS
FT                   NDQPQPKPMAHFYGGNGFTVGVYKPLLSALSDQFHVTSLAMRGYWHDLPQDKVMTREQD
FT                   AEMLIEFLEQTQSGPVIGIGHSQGATATALAAAKRPDLFCAIYLIDPVTFTKAQSLLYS
FT                   RIPRRVLLTRQPFKSTKVKQADWESVEAYYQHLRAQSPFRRISDENLRLFAANSLIEKP
FT                   EGGFTLLFGPQYELASYFGTPYITPALKKLNQLNLPYHLILAKPTMFVSDDVRKSWQGI
FT                   VPRDRITTLADYGHLVPMEAPEQCAKLIFKLQSR"
FT   gene            complement(128077..129987)
FT                   /locus_tag="PsycPRwf_0108"
FT   CDS_pept        complement(128077..129987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0108"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93068"
FT                   /db_xref="GOA:A5WBM7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBM7"
FT                   /protein_id="ABQ93068.1"
FT                   /translation="MKKLFHYFETRLSAFPENKIPLPKEGLFKFLWACTYGLRGWLLLF
FT                   MILTAGIGMYEAMLFAWIGNLVDWLGMYTPSSLWAEKSGALKLMAVVLIISPFWVGFAA
FT                   LVHFQVIQGVFPMQMRWRFHKRMLGQSMQFYQNEFSGRVSAKVMQTALAVRDTVITVVD
FT                   MMIYVLVYFVTSGIILFKLDSLLLIPFALWLVLFGFTLWYFLPKLKQTASIQADARALM
FT                   TGRITDAYANIMTVKLFSHSQRELSYAKSAMKQFLATVHGQMRWVTALEFVNHLISVIL
FT                   IGSTAAIGLHLWQRGDVGVGAIAAATAMALRLNGLTHWIMWQMASLFESVGTVQDGIRT
FT                   LSAPQSVVDKPGAPDMVVREGHIKFKNVDFGYEGSDLSIATEDSKPEASTKHKNYIKLL
FT                   DNFNLDIKPGEKIGLVGRSGAGKSTLVNLLLRFYDVDGGHIIIDGQAIDAVTQESLRQQ
FT                   IGMVTQDTSLLHRTVRENIAYGRPTATDAEIIAACKQAQAWDFIQGLHDAKGNTGLDTQ
FT                   VGERGVKLSGGQRQRIAIARVMLKNAPILLLDEATSALDSEVEHAITESLNSMMMGKTV
FT                   IAIAHRLSTIAALDRLVVMDKGCIIEQGSHEELLAKNGVYASLWQRQSGGFLGDDEDIA
FT                   T"
FT   gene            130474..131358
FT                   /locus_tag="PsycPRwf_0109"
FT   CDS_pept        130474..131358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93069"
FT                   /db_xref="GOA:A5WBM8"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBM8"
FT                   /protein_id="ABQ93069.1"
FT                   /translation="MTYLVIAVLCSVAVSILLKVLRHQQVDIRQTIAAGYPVAFLLTFV
FT                   LLKPDLSGIGQLGDAWGIILLLGILLPLVFVILGRAIESVGIIATDAAQRLSLIIPIVA
FT                   AFVLFGETLTTQRTLGIALGFLALLALITRHPEPAVVGQSVYSSTPNTAPIKRPVGLWL
FT                   LGVWLGYGVIDILFKQVAKQGAAFALTLFMAFGLSAVLLFMYLIAKKTVWDSKALIAGV
FT                   LLGALNTGNIYAYVKAHQVLSDSPSVVFTGMNVGVIAVATLVGVFGFKESLSKLNIVGI
FT                   LLAMACVFVLFWA"
FT   gene            complement(131560..132525)
FT                   /locus_tag="PsycPRwf_0110"
FT   CDS_pept        complement(131560..132525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0110"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93070"
FT                   /db_xref="GOA:A5WBM9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBM9"
FT                   /protein_id="ABQ93070.1"
FT                   /translation="MKAVFLDRGTFLEGLALPKPQGIDEYQTFDETPQDDQLIIERCQG
FT                   AQIIFTNKVKISAEVIAALPDLKLIQLTATGMNNVDADACKKQGVELYNVAGYAVKSVP
FT                   EHTFMLMLAALRSGVHYHNKVIDGSWEASGNFSLMDVPLIDLEDTTLGIIGVGTIGKRV
FT                   TEIAKAFGMTVLWAEHQGQAPRNDEYTDFDTVLETSDVISLHCPLTEKTAHLINADTLA
FT                   KMSKKPLVVNVARGGIVDSKAIVEALEQGQVLGYATDVFEQEPTTQEDPLWQLGQKNHP
FT                   RLIFSPHNAWASKAAQQKLWDILTEQVSEFITTHKHSVSS"
FT   gene            132728..132952
FT                   /locus_tag="PsycPRwf_0111"
FT   CDS_pept        132728..132952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93071"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBN0"
FT                   /protein_id="ABQ93071.1"
FT                   /translation="MWRQVQKGVFKDNGQPTSLSILIDGKVTAPKTVLKSADSEQNLIK
FT                   SAKQTQNWLKKSQIRRKIDSFYIIYYKLP"
FT   gene            133133..136015
FT                   /locus_tag="PsycPRwf_0112"
FT   CDS_pept        133133..136015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0112"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   type III restriction enzyme, res subunit; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93072"
FT                   /db_xref="GOA:A5WBN1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBN1"
FT                   /protein_id="ABQ93072.1"
FT                   /translation="MTIAALIPEFAVGQRYLSDTEAELGLGVVIDVDDRCVHILFAQSE
FT                   ETRVYAKNSAPLSRVTFKVGDEITDQDGNAHIVTGVDEVMGVIKYHVDGHPRGIMETRL
FT                   AANITLAKPLERLLAGRVERGDWYELRQDILRMQSALAGHPLKGLMGARVDIIPHQLYI
FT                   AHEVGKRIAPRVLLADEVGLGKTIEAGLIIHQQLLTGKAQRVLILVPDSLQYQWMVEMR
FT                   RRFNLNFALFDLVRTAAIKEHDPDQNVFTTEQCIIASLDLLLDHHDLYEQAMEAGFDLL
FT                   VVDEAHHLHWDPEQGGNDKYELVADFAHETPGVLLLTATPEQLGVESHFARLRLLDSDR
FT                   FDDLDDFIAGQAAFSDTAAVAEVLMDDKPLTDGQINALTHLLGMPNPEELAGINEDDKL
FT                   RTYALNQLLDRHGTGRVLFRNTRDSVQGFHGRTSRPHPLPCPDSWQGNYQTCGKLREQL
FT                   WGEENQPDGGWLEDDPRVPWLISLLKEELKQKKVLLIARSGATVESLEAVLRLHAGIKT
FT                   AIFTEQMSLLERDQAAAFFADDAGAQILLCSEIGSEGRNFQFASHLILWDLPANPDTLE
FT                   QRIGRLDRIGQSQKITLHVPYVQGTAQERMYKWYDAALNIFNHISPTAQTVQEQFIVDL
FT                   KPLLEGADTPENRTALEDLITEAGAVRQALEAELQSGRDRLLEYNSCRPRVAGRIADAM
FT                   SDFDANNLLPAFLDRFFSSVNLDHSVQRDGSWIIHPPEAENSQHTDVDNLPISEDGMTL
FT                   TFKRSQALMREDMDFLTHEHPLMLAIYDMANSGTFGNTTVAMLKSNTVPEGMLLLEVNF
FT                   RVTTIAPKVLNLTANLPTQMLRVFLGEQGGDLSERITADMILPHIERLDKNRARQVVKV
FT                   RSQVIESRYHDAEAIAQGKLDTISAQALARFSQIWEREINRLKQLQQVNPNVRDEEIER
FT                   LESLKAQGEQALTNLSLVPDSIRVLVAVKP"
FT   gene            136158..136625
FT                   /locus_tag="PsycPRwf_0113"
FT   CDS_pept        136158..136625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0113"
FT                   /product="ybaK/ebsC protein"
FT                   /note="TIGRFAM: ybaK/ebsC protein; PFAM: YbaK/prolyl-tRNA
FT                   synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93073"
FT                   /db_xref="GOA:A5WBN2"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBN2"
FT                   /protein_id="ABQ93073.1"
FT                   /translation="MTPAVNLAKKLKLDYQLHEYQHDPSAESYGLEAADKLGLPPEHVF
FT                   KTLVVATESDKLAVAILPVIATLNFKKMAKAMGCKKVQMADPKVVERSSGYVLGGVSPL
FT                   GQKKRLPTVIHESAQQLTTMHVSGGRRGLEIELPPAQLAQALTAKFADIID"
FT   gene            136691..137065
FT                   /locus_tag="PsycPRwf_0114"
FT   CDS_pept        136691..137065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0114"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93074"
FT                   /db_xref="GOA:A5WBN3"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBN3"
FT                   /protein_id="ABQ93074.1"
FT                   /translation="MPHVIVQATPNVTINRPERLLKQLNSCLWETGHFDKPQAIKARLL
FT                   DVETFLVGIEDDQQQEGFIYLQLRLMPGRSQQIRDELAEKLRICLQQELEAQQSGRVTV
FT                   QYCVEVIELSAAYSKVRVQP"
FT   gene            complement(137070..137558)
FT                   /locus_tag="PsycPRwf_0115"
FT   CDS_pept        complement(137070..137558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93075"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBN4"
FT                   /protein_id="ABQ93075.1"
FT                   /translation="MAIIHPVNASHKHKLSRKSRSKIGGAKLCLLALLGVSQLGVAASI
FT                   KPLHFEKGAVSSKVSGVLAAKQQDTWYQFKAQKGQFALINITPLKGTAETANVGVLHMP
FT                   SGQQDGSKGGIVYQNCLPETGTYKLRIARNLMATQGGKAGYQAEVIILPTYASQDLCQ"
FT   sig_peptide     complement(137430..137558)
FT                   /locus_tag="PsycPRwf_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.700 at
FT                   residue 43"
FT   gene            complement(137725..139545)
FT                   /locus_tag="PsycPRwf_0116"
FT   CDS_pept        complement(137725..139545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0116"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93076"
FT                   /db_xref="GOA:A5WBN5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBN5"
FT                   /protein_id="ABQ93076.1"
FT                   /translation="MLSYKAPLRDMKFLLNDVFDFQNHYKDLSNGANADPETVDMILQG
FT                   MADFAENILSPLYQPADAEGCHFENGVVTTPKGFKDAYNQFVEGGWQGISYPEEYGGMN
FT                   LPMSLNLIKSEMMGTANWPWAMYPGLTTGCINTLMQYGTEEQKDTYLPKLVEGTWSGTM
FT                   CLTEPQAGTDLGQVKTKAVPQEDGSYTLNGTKIFISSGEHDLTDNIIHIVLARLPDAPE
FT                   GTRGISLFIVPKFNINEEGEAGERNGVSCGSIEHKMGIASSATCVLNFDNAKGYLIGEP
FT                   NRGLKAMFTFMNTARIGTGIQGLAHCELAFQNALPYAKERRSMRTLSGTKEPEKVADAI
FT                   INHADVRRMLLTMKAFAEGGRSMIYHAARYADKMSQGVAENNNEEFEKWDDKLGFYTPI
FT                   LKGFLTELAIEAAKEGQQVYGGHGYIKEWGMELIARDARISTLYEGTTGVQALDLLGRK
FT                   VILQSKGKIIRDYTSSIMKWCGEYALDKNMRKFVWALTKLCAEWNTLTVRLMLSARKDR
FT                   EIISAASVDYLMYSGYIMMAYHWARMAAVAYDKLENGGVEAPEFYKAKIQTAEFYFDKI
FT                   LPRTSGHAESMVAPSSSMTDMDIEHFAFLD"
FT   gene            complement(139848..140954)
FT                   /locus_tag="PsycPRwf_0117"
FT   CDS_pept        complement(139848..140954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0117"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93077"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBN6"
FT                   /protein_id="ABQ93077.1"
FT                   /translation="MKTLKLRIKDKHANQLNKLAGSVNYAWNYVNVLSFEHVRRTGKYF
FT                   SAYDLSQYTKGSGEYLGLHSQTLQAINETHAKSRKQFKKAKLNWRTNRPDAKRKSLGWI
FT                   PFKKSAIKYLNTRQTGKKALKSTIQLSLCKGQKLIIDVFDSYNLSLYQINTLEIVQDSR
FT                   HRWYACITVKDFPRQASGKGSVGIDLGLKQSATTSTGDKLQIKQTQKWANKLAVAQRAN
FT                   NKSRAKAIHAKIKNSRLDAIHKFTTQLVKDNALIVVGDIKSRSFTNSMTNLAKSTYDAG
FT                   WFELKRQLEYKCKYAGCQLEIVNESYTTQTCSCCLKISDSSPKGRAGLGIRGWRCAECG
FT                   TWHDRDINAAKNILAVGLDRLAVGIPSV"
FT   gene            141266..142369
FT                   /locus_tag="PsycPRwf_0118"
FT   CDS_pept        141266..142369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93078"
FT                   /db_xref="GOA:A5WBN7"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBN7"
FT                   /protein_id="ABQ93078.1"
FT                   /translation="MSIKRLKQIAKREAEHLFTVRPSAKPWHVSLSAALIIASTILIGA
FT                   LCNNLPMGILASLGAMIILNQPVAGSLRQRQGLLLLMGIIMVLSFSVGLIAHQVQLLKW
FT                   PLFTLLCFIVVAIGRYMHLPPPGSMFVLMASVIAIFMPGGWEDMPGRISVVAAGALYAW
FT                   VMSLFYNLAVVGVASEPAPSKHYYELGLITESLIVCFFVVLSLELALWLDMPYPYWVPV
FT                   SCYIIMQGMQLRTMWIRQLHRVLGTGIGVFVAAFLLSFSWSNVGVALVIFCLLLWIETL
FT                   VSRHYASAVIMITPLTIFIAEYGKSAAHTEVGAMAYQGIMQARFLDTLLGCVVALLGGV
FT                   VMQSTWLRRPLMTLEAKVFQDKIRLQK"
FT   gene            complement(142442..143326)
FT                   /locus_tag="PsycPRwf_0119"
FT   CDS_pept        complement(142442..143326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0119"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93079"
FT                   /db_xref="GOA:A5WBN8"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBN8"
FT                   /protein_id="ABQ93079.1"
FT                   /translation="MSPSDISRNLTIDSNSDTKCSVDAQTQHFMVIGNPIAHSKSPQIH
FT                   QQFAKQTGLDIRYARQYCPDDKASFTAVVEAFFNGGGVGANVTVPFKQIAYQMCAEQGG
FT                   LSAHAQVAGAVNTLLLKDGKLFGDNTDGQGLVNHLRQLGWPLQGAKVAILGAGGASRGV
FT                   VLPLIEAGISELTIANRTLSKAEDLIDQLCSAHPLIATIAPTSCTIEALTGQYDLIINA
FT                   TSIGLSGDSLPLREALRCGYAYDMMYGRELPFLTHFHSHSAQVSEGYGMLIGQAALSFT
FT                   QWTGKAVDSNLFI"
FT   gene            143813..144508
FT                   /locus_tag="PsycPRwf_0120"
FT   CDS_pept        143813..144508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93080"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBN9"
FT                   /protein_id="ABQ93080.1"
FT                   /translation="MIFSIISNKPANASLPQSSAQGLATRIGALGLAACLLVTGCSKVE
FT                   ESTTSVETTAEQALADSGAAESTPDMANNRTKAAVVPEGKPVSYDVENWKSDDSKRLEP
FT                   TDLKQLQRKLGKVTVTDENSLDYASNTAIKYRFMKGDEPYLDIIDSQEYLEFGWYYANP
FT                   NDSDSEKKMSIDHAKKMYQVAAELMGSEGSQLVANMLSGQITKNKKIGERQVELAKCEF
FT                   YSCMLVLKK"
FT   gene            144592..145572
FT                   /locus_tag="PsycPRwf_0121"
FT   CDS_pept        144592..145572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0121"
FT                   /product="aminodeoxychorismate lyase apoprotein"
FT                   /EC_number="4.1.3.38"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93081"
FT                   /db_xref="GOA:A5WBP0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBP0"
FT                   /protein_id="ABQ93081.1"
FT                   /translation="MSHAMQWYQMSDTGLVAWDKSASDTAPNLRALAYGDGFFTTMAVY
FT                   DGSLLWQSYHQARLRSHCHALNLSLPTPTSEALWQALQACAANITHGLIKIIISRPTQS
FT                   VRGYAYSASTEHNEALIWVGIMPSDILAQQQARFLDLPLGIKAPSAHLSGSLGQVILQQ
FT                   PATIATCLQSRLASFPAPLAGLKSLNRLDGVMIAGELQRMKQQHPKLTEALVADMAGNW
FT                   VEGVMSNVFYQLTSDDDHIKHQWFTPPIEASGVRGTMRQVIIDRLAALGQPVVLRALQD
FT                   ADLLSLEALFFCNAVRGVMPVRELIVGNQWLELSLSVFNSNSVCT"
FT   gene            complement(145518..145718)
FT                   /locus_tag="PsycPRwf_0122"
FT   CDS_pept        complement(145518..145718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93082"
FT                   /db_xref="InterPro:IPR025575"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBP1"
FT                   /protein_id="ABQ93082.1"
FT                   /translation="MAPKAKRYKVEVTEVLSTIVEVMASTEEEAIKKVKKAYRQEQIVL
FT                   SDEHYVQTEFELNTDKDNSNH"
FT   gene            145859..146422
FT                   /locus_tag="PsycPRwf_0123"
FT   CDS_pept        145859..146422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93083"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBP2"
FT                   /protein_id="ABQ93083.1"
FT                   /translation="MRSIYEDTRIPVQMRRMMVFDEICKKAKLNPNNMVHLSRFTQLAF
FT                   GVIYIKNLKKYMAYGGVFEYAHTREEVIEQGISVIPVNDYVMCALTVNLEPFTQPVATP
FT                   LQLLWQWNKYVKNRLHCYIDYQDECLFLINDEVDDEYAPHQFHERLVATAHLPMWDDRE
FT                   ELISNIHSTVEKRRLRPSCYDNII"
FT   gene            complement(146473..147237)
FT                   /locus_tag="PsycPRwf_0124"
FT   CDS_pept        complement(146473..147237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0124"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.4"
FT                   /note="PFAM: Dam-replacing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93084"
FT                   /db_xref="GOA:A5WBP3"
FT                   /db_xref="InterPro:IPR010324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041368"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBP3"
FT                   /protein_id="ABQ93084.1"
FT                   /translation="MDLQFNQQLAKGYKSKSQIIRVLSEGWVAHQGYCPNCGNNRLSGF
FT                   ANNQPVADFYCPQCHEQYELKSKKAKLSHVINDGAYATMIERIKSDDNPNFFFLTYSDE
FT                   LVVNNFLIIPKHFFTTDMIIKRPPLPPTARRAGWIGCNINLKKVPEIGKVFLVKNQQPV
FT                   ATEQVTEQFQKSLFLRQQKQQSRGWTLEIMSCVDKLPPQFSLNDIYQFSNYLRTRYPNN
FT                   NNIEAKIRQQLQILRDKGLLQFLGNGRYRKIG"
FT   gene            147359..148540
FT                   /locus_tag="PsycPRwf_0125"
FT   CDS_pept        147359..148540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0125"
FT                   /product="aminodeoxychorismate lyase"
FT                   /note="PFAM: aminodeoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93085"
FT                   /db_xref="GOA:A5WBP4"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBP4"
FT                   /protein_id="ABQ93085.1"
FT                   /translation="MSDSNSKNPSNTPHNPSDVDQNEAPHTDVSLVCDDPSRHKKPPQK
FT                   PTSNRSYQLLLVLGLMAAFVVAMAYQTLFGHSDRPAGDLVVEEGQSYYGFLPQFQRDVP
FT                   MFSASLAKLYIKSAVDTPLKAGTYEVPANASLKQLIDAFKQGEKVDMVAIQIIEGKTAA
FT                   DLYKVIANTPGVTLEVLQKDGKPKPNLKQLLGIDAVTPEGEFADNLEGWFTPDTYHYAK
FT                   GVTDKQILTDLYQRQQKALDEAWASRSKGLPYKSPYEALIMASIIEKETSVDSERELVS
FT                   AVFVNRLNKPMRLQTDPTIIYGMGERYEGNIRRADINEKTAYNTYQIDGLPPTPIALPS
FT                   PASIDAALHPADSDVLYFVATGTGGHKFTKTYAEHNQAVKEYLAVMRQQKSGQ"
FT   gene            148636..149262
FT                   /locus_tag="PsycPRwf_0126"
FT   CDS_pept        148636..149262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0126"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93086"
FT                   /db_xref="GOA:A5WBP5"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBP5"
FT                   /protein_id="ABQ93086.1"
FT                   /translation="MSLGKFVSFEGTEGVGKTTAINGLCERLQAQGIEYVRTREPGGSP
FT                   FAEQLRELLLDTRTQINDDTELLLMFAARSDHLAQVIMPALSAGKWVICDRFIDSTVAY
FT                   QGYGRGFGNADMLHKIEALIAGFVPRLPDITLWLDLPVAEGMQRAGKRSVADRFEQQQL
FT                   DFFDRVYQGFEAQQQAQPQRIQRIDAQGEVEQVADRIWQSVSQQL"
FT   gene            complement(149406..151688)
FT                   /locus_tag="PsycPRwf_0127"
FT   CDS_pept        complement(149406..151688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0127"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="PFAM: sodium/hydrogen exchanger; TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93087"
FT                   /db_xref="GOA:A5WBP6"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBP6"
FT                   /protein_id="ABQ93087.1"
FT                   /translation="MDTALLLSGVVGLGIAAQWLAWYLKQPSILFLLLIGIFVGPVMGY
FT                   FDPDAVIGDLLFPFISLGVAIILFEGSLTLEFEEIKQHGKVVQMLVSLGVVITIAVVAL
FT                   STYLLFDVDPLIALLFGSLVCVTGPTVIMPLLRSVRPNKTISNILKWEGIIIDPVGAIA
FT                   VVLVYEYIISGGEANSIFLFAEIVVIATAIGMFGAFVLANLIKRHMIPEFLHNVFTLAF
FT                   VLLLFSLSNHLEHESGLLAVTVMGVALANWKGFPREQILEFNESLTVLLISVLFIVLAA
FT                   RVELNSLLSVGFQGLVLLAIVMFVARPLSVWASSMGSNLKTSEKMMISWIGPRGIVAAA
FT                   ISSLFAIRLQEYDIQGVELLVPLVFMVIIGTVLIQGLGAKMVGNLLGVREPASNGVLIV
FT                   GSNPVALKVAESLQDQGFDVLVAHNNYTNIAKARMSGLRTYFGNPISDHADRHLDLIGI
FT                   GHLFAMSTDKEMNTLSELHYRHEFGEQKIYRLKFTEDKAKTERETRRANFTSRWLFGKD
FT                   ATYTKMASMLSKKARIKITNITDSYSYSQYRADNKQFVPLYTIDKEGHLHVITDSFEND
FT                   IPRDHKLVALVIEDEVQPKTVDVTEKQNQARALADLQFESTSKAPEKRKEKTLNEDVRD
FT                   PNYGAQAATTPAKAESKLAASDVQTAAVDSQVVQDTAHANTASKSAASTLPATQLEADL
FT                   ANKLEQSLQKHSDSATAAPKVSKAASVKSLQSQDNGNSQAPRQPDGSLDPQRLPDTHAK
FT                   NSSDKLS"
FT   gene            152506..153930
FT                   /locus_tag="PsycPRwf_0128"
FT   CDS_pept        152506..153930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0128"
FT                   /product="protease Do"
FT                   /EC_number="1.3.1.74"
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6,
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93088"
FT                   /db_xref="GOA:A5WBP7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBP7"
FT                   /protein_id="ABQ93088.1"
FT                   /translation="MLALSGFGIGSLGLTAGTALLATSATIPTAAQAAVVASDFSDLVE
FT                   QVSPGVARVNVVTKVSEEELAKAQTVELLRQFFGDRIRIPGAQTAPAIEYNYGTGFFVT
FT                   SDGYLLTNHHVIAGADKITVTLNDRTELDATLVGSDERSDVAVLKVKAQPGKSYPALPT
FT                   GDSNAVKVGEPVLAIGSPFGFDYSASAGIVSAKSRNFSRDISVPFIQSDVALNPGNSGG
FT                   PLFNRNGQVIGINSRIFSGTGGYMGLSFSIPINEAMDIYQQLKQTGTVSRAYLGIFPQD
FT                   IDRNLAEAYGLSKPQGALLIKVTPKSPAEAAGLKAGDIITHYNGKMILESSDLLNIINR
FT                   SKPGESFKADVLRQGKKIAVIGKLSAAPDDVAPDAVVTKSNNSQIRLGLRIQALPRESL
FT                   AQLDGEGVLVTEVDPTGIAARAGIRAGDVITNLHQKSIKSIDDFQRALRQLPEAGVVTI
FT                   EVVRQGIPAIIGLRLD"
FT   sig_peptide     152506..152607
FT                   /locus_tag="PsycPRwf_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.976 at
FT                   residue 34"
FT   gene            complement(154137..154212)
FT                   /locus_tag="PsycPRwf_R0002"
FT                   /note="tRNA-Glu3"
FT   tRNA            complement(154137..154212)
FT                   /locus_tag="PsycPRwf_R0002"
FT                   /product="tRNA-Glu"
FT   gene            complement(154345..154420)
FT                   /locus_tag="PsycPRwf_R0003"
FT                   /note="tRNA-Ala6"
FT   tRNA            complement(154345..154420)
FT                   /locus_tag="PsycPRwf_R0003"
FT                   /product="tRNA-Ala"
FT   gene            complement(154567..155451)
FT                   /locus_tag="PsycPRwf_0129"
FT   CDS_pept        complement(154567..155451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0129"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Pirin
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93089"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBP8"
FT                   /protein_id="ABQ93089.1"
FT                   /translation="MTTSVKNDVTITQPRQVEQLYAGVDTQDGAGVKLTRVLTHQLQHR
FT                   LDPYLMLDNFKSDNPDDYIAGFPSHPHRGFETVTYMIEGRMRHKDSAGNEGLLENGGVQ
FT                   WMTAASGVIHSELPEQEDGAMEGFQLWLNLPAKDKMNAPWYKDFQDADLPKFVTENGTK
FT                   VTVIAGESNGVEGAVTREVTEPTYLDIHLPAGASFSHNIPASHNSFVFVYRGSASIEDK
FT                   RIPVKNMAILKNDPNADGVTIQAGNEDTKVILVTGRPLNEPIVQYGPFVMNSQQQIIQA
FT                   VNDFQQGRFGEGA"
FT   gene            155658..156164
FT                   /locus_tag="PsycPRwf_0130"
FT   CDS_pept        155658..156164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0130"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93090"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBP9"
FT                   /protein_id="ABQ93090.1"
FT                   /translation="MTALKYIAHYPEQVQSQARALIAQDKLGDYLQQKYPNRHQIQSDK
FT                   ALYQYVTELKNRYMRNVGTLSQVSYNSKLSVLKNALGIHTHQSRVQGSKLKSHNSITVA
FT                   SIFREAPFEFLQMIVVHELAHFKESDHNKAFYQMCCHMQPQYHQVELDMRLWLLWRDLE
FT                   SKKRG"
FT   gene            complement(156290..157807)
FT                   /locus_tag="PsycPRwf_0131"
FT   CDS_pept        complement(156290..157807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0131"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   glutamyl-tRNA synthetase, class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93091"
FT                   /db_xref="GOA:A5WBQ0"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBQ0"
FT                   /protein_id="ABQ93091.1"
FT                   /translation="MTQTTAQRPVRTRIAPSPTGFPHVGTAYIALFNLAFAKAHGGEFI
FT                   LRIEDTDQSRSTEQSEQMILDALRWVGLDWAEGPDNGGPHAPYRQSERSEIYKQYAQEL
FT                   LDKGHAFRCFCTPEELDAMRAEQIARGENPHYDGRYANLPREESDKMAAEGKPFVIRMK
FT                   VPTEGVCKVQDMLRGEVEIPWEQVDMQVLLKTDGLPTYHLANVVDDHLMEITHVIRGEE
FT                   WLNSAPKHQLLYDYFGWEMPVLCHMPLLRNPDKSKLSKRKNPTSITYYRDAGVLPEALL
FT                   NYLGRMGYSMPDDKEIFTLDEMIESFDITRVSLGGPIFDLEKLHWLNGEWLRALTPEQL
FT                   KNKILDWANDSDKLTAIAAAIQPRIHLLSDAVNWGGFYFQNLPSITAESFEHKTLTPEQ
FT                   IMEILQIATWKLEALPEWSEDNIFKTLKGLSAALDIKLRDMMAPFFIAIAGSTSSTPVM
FT                   NSMYVIGADMTLTRLRHAVEVLGGIGKKKLKKLEKTAADMPDFLAAE"
FT   gene            158286..159305
FT                   /locus_tag="PsycPRwf_0132"
FT   CDS_pept        158286..159305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0132"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93092"
FT                   /db_xref="GOA:A5WBQ1"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBQ1"
FT                   /protein_id="ABQ93092.1"
FT                   /translation="MTDVPTSAPRSTSKSEFSHETVLLFETVAAVLGEKSLNDNTPKHD
FT                   GIYVDATFGRGGHSKLLLNYLSDDAKLFVFDKDPEAIDVANDLAAEDKRVIVVHDSFAD
FT                   MTQCLNSRGVSQVDGIMADLGVSSPQLDDGSRGFSFMRDGAIDMRMDTSRGQPVGEWLQ
FT                   TVDEETLADVLYDFGEERHSRRIARAIKGMTQYTSTLELAEVIKQAHPKWQKGKHPATQ
FT                   SFQAMRIFINNELGDIDSFLAQSLTLLAPQGQLAVISFHSLEDRRIKQFLQRHSRGQYP
FT                   EDENLPMPPQRPRYFSKPKRIAPSKAEVTVNNRSRSAWLRVATRTDTPYNTDPSPQHS"
FT   gene            159459..159917
FT                   /locus_tag="PsycPRwf_0133"
FT   CDS_pept        159459..159917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0133"
FT                   /product="cell division protein FtsL"
FT                   /note="PFAM: cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93093"
FT                   /db_xref="GOA:A5WBQ2"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBQ2"
FT                   /protein_id="ABQ93093.1"
FT                   /translation="MANNNTQSSTQIDKDSLEISEFLTKRYRGVSVYGTVMILLAIGII
FT                   WTAVLTSEQVQQYHEDYMALQKMKVEHRNLQIENQRLVIEQQTFSATPQIASRAVTQLS
FT                   MYSPSNKDKLILQPMAAKPGDRLNIEQPKTASEETDTTTAPSLGGKDE"
FT   gene            160003..162012
FT                   /locus_tag="PsycPRwf_0134"
FT   CDS_pept        160003..162012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0134"
FT                   /product="peptidoglycan synthetase FtsI"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93094"
FT                   /db_xref="GOA:A5WBQ3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBQ3"
FT                   /protein_id="ABQ93094.1"
FT                   /translation="MVTPKKTAANKTSKANNKAEPNSGLSKLKFWKKDQSDSEVYTSVK
FT                   HRSGKIFKSTTVGASSRGSIESDLIRFKIMWGFAAIFLVVLIGRAMYLQIFNAQKFIDK
FT                   GNEIITSERTQHSYRGMITDRNLQPLAVSAPLASVSFSPYDYAQAYYELQKRIQKNADD
FT                   PEAQARLLKKLKEMDLAQLASVSGMSLERLQQSVAIDKSVDATNEEAVKAAMPKGAGSH
FT                   YLPLLNKVTPEIADAVMALNFPGVYENQEFRRYYPQPQPNAQLLGFMGHNANDPNSGYE
FT                   GRAGIERQFEKQLAGQDGKVRVLKDRYQNSIEELEQIKPVVPGQDVALSIDSRLQYLLY
FT                   KELERVGRVQEARWSTGMVVDVHTGEVLALSTWPSFNNNNLNEMTGNNQRNRAVLDVFE
FT                   PGSVMKPFTVATALKSGKYTENSLINTSPGSIRVKGYTIRDHNNLGSITMATLIQKSSN
FT                   VASTKIALSLPPDAITNMQKNFGFGQKTALQFPGEQPGIIPTPKENETSRRATVSYGYG
FT                   LQVTLAQIAQAYAALGSGGVMHPLTLIKQDQKPAGKRVLDEKDAMAVVKMMETVTQPGG
FT                   TATAAAIDGYRIAGKTGTSRRVNPKGGYYTDQYRTVFAGIAPASNPRLVTVILVEDPRQ
FT                   TYYAGIVAAPVFKNVMQEALRLYNVPLDKPLKAE"
FT   gene            162117..163826
FT                   /locus_tag="PsycPRwf_0135"
FT   CDS_pept        162117..163826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0135"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93095"
FT                   /db_xref="GOA:A5WBQ4"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBQ4"
FT                   /protein_id="ABQ93095.1"
FT                   /translation="MTHTQPAPHLRSIVNAAVKILPQHQSTLQLLRVPAVLDVPFSKFV
FT                   LDSRQLAKRDASSAPAAFVLLKSQTQPLQKSQQYVQTALPQAAFIISEIDPQQLGLEGL
FT                   DKPSDSSPDCPILFVPDIRDVLGTLIQLSLLSDDALSQIGDAQSLAQTLPQVIAVTGTN
FT                   GKTTISQLMAQLCQFSEVAQLQNSAVMGTAGNGRLDSLVQASHTTGDALAVQGFLRKMG
FT                   DEGVDLLALEASSHGLDQQRLQGVPVTVALYTNLSRDHLDYHPDMQDYAQAKARLFDKA
FT                   YFPQLTHAVINADDEFAPLMIETAQNSGVSVWLYSLQGDFIEKSDLQRNAYFIAKTIEP
FT                   SLDGVKIEAATSFGPLTLHSPLLGRFNVANLLAAVAGAIALGIEPESIPALVKQLHGAS
FT                   GRMQRVSLDEQGSQPEQGVFIVDYAHTPDALTQVLTSLKSHCSGNLWAIFGCGGDRDKG
FT                   KRPLMAQAGLATADKVVLTSDNPRSEDPQMILQDMQQGMSDEQHAKTTVIADRKQAIEY
FT                   AVEHAAADDIVVIAGKGHETYQEIKGVRYDFDDRLVLQQALIAAHSSEASSR"
FT   gene            163891..165408
FT                   /locus_tag="PsycPRwf_0136"
FT   CDS_pept        163891..165408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0136"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93096"
FT                   /db_xref="GOA:A5WBQ5"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBQ5"
FT                   /protein_id="ABQ93096.1"
FT                   /translation="MSQRHPENGLFIWTPEQLLAATAQLNGEWIGLEAADSSSLRATRI
FT                   ITDTRKIEAGDIFLAIVGENFDGHSFVASAVEKGAIATIVSQPLSEVNVPQLKVDDTRL
FT                   AFGQIAAYRRQQHPNLKVIALTGSSGKTTVKEMLRHIFAQVEAASADVQSTTLVTRGNL
FT                   NNDFGVPMMLLELEQQHRYAVLELGANHVGEIAYTAAMVKPDVACILNIGTAHLGEFGG
FT                   RDNIAKTKAEIYQPLTQASTAVVPCDDDYSDQLMSTAKQHTDTIIGFGWHSLEQRTAKL
FT                   PAVYATEVKTTALQSRFQLHFAIEGKAPAMVSVLLPMAGEHNVSNALAAAACAYAAGVS
FT                   AELIAQGLNQAKSSKGRLGRQRLGQHHIIDDTYNANPNSMRAAADVLAAQEGTRILVLG
FT                   DIGELGDDAVSEHYKLGEAIANKAVDYMLCAGEFAKDTVAGASSQGMTQAYSFDTKADL
FT                   LPKLIELVQTQQQQGQLCTLLFKGSRTTTMETLIDDLTQISTSPSSL"
FT   gene            165724..166845
FT                   /locus_tag="PsycPRwf_0137"
FT   CDS_pept        165724..166845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0137"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase, family 4"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93097"
FT                   /db_xref="GOA:A5WBQ6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBQ6"
FT                   /protein_id="ABQ93097.1"
FT                   /translation="MLYWLFDSWLSQFYSPFSAVSSVTLRTLLTVITSLAFSIILGPRT
FT                   IAYLRSVKYDQAVRDDGPKTHLAKTGTPTMGGVLILTSIGFSTLCWANLANPYVWILMV
FT                   VMVIFGAVGWADDWLKIKYKNPKGLIARKKYFWLSVGALFVGSSLYYIASQQPDPAQTK
FT                   AMVDLLIPLFKNWIVPLSALPLGLGFIIFTYFVINGSSNAVNLTDGLDGLAILPVVFVA
FT                   AGLGVFSYVSGDVRFADYLHVPYIAYNSEVTIVCAAMIGSGLGFLWYNAHPAQVFMGDV
FT                   GALALGAMLGTIAVMTRQEIAFAIMGGLFVAEALSVILQVGSFKLRKKRVLLMAPLHHH
FT                   FEELGWKETQVVVRFWIIAILLVVLGLMTLKLR"
FT   gene            167017..167979
FT                   /locus_tag="PsycPRwf_0138"
FT   CDS_pept        167017..167979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0138"
FT                   /product="23S rRNA m(1)G-745 methyltransferase"
FT                   /note="PFAM: Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93098"
FT                   /db_xref="GOA:A5WBQ7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBQ7"
FT                   /protein_id="ABQ93098.1"
FT                   /translation="MISKPSARYQPQFLCPYCQSPLLINAKTWLCDGSQNEKGTRHPFD
FT                   VARQGYVNLLPVQNKKSKDPGDSQQSIDARHRFLNQGFYQPLQQLIASLVMPSLEASAP
FT                   PVQAKAKTWLDVGCGEGYYTGAIAAALAATPNNHACLVALDISKPAVATTARVAKQHSG
FT                   LWYQVEADGLSATAMYPMVASASHLPLADASLDAISTIFSPILPEEFARVLTLGGRLII
FT                   AKPDAGHLQSMREALFDEVRPHDSDKFLEELLPYFKEVATHTVAADLILDAQALADLLT
FT                   MTPYSYRARAGKREALLASAERQPFETTARFVVYELVKI"
FT   gene            complement(168080..169018)
FT                   /locus_tag="PsycPRwf_0139"
FT   CDS_pept        complement(168080..169018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0139"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="TIGRFAM: tyrosine recombinase XerD; PFAM: phage
FT                   integrase family protein; phage integrase domain protein
FT                   SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93099"
FT                   /db_xref="GOA:A5WBQ8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBQ8"
FT                   /protein_id="ABQ93099.1"
FT                   /translation="MSRDRAIQPRQPKALAVDDEPAYITEFRQAMLARGLSTRTRNAYV
FT                   RDLKLCETTHSKALTLWSDMDVMQCLTALDRQGKTPRTQARMLSSLRQFYLWMVGNERR
FT                   EDNPCERIKTPKIGRSLPKDLSENDVESLLSAPDTSTALGLRDKAMLEVLYACGLRVSE
FT                   LMNLSLEQVNLNAGWLQITGKGNKTRLVPLGEYASDALDDYLTHARGELVAHLKSGNCQ
FT                   AVFLTTQGGYMTRQNFWYMIKKYAKQAGIQSDLSPHTLRHAFATHLLNHGADLRSVQLL
FT                   LGHSDLSTTQIYTHVATARLQQLHEAHHPRG"
FT   gene            complement(169059..169352)
FT                   /locus_tag="PsycPRwf_0140"
FT   CDS_pept        complement(169059..169352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0140"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93100"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBQ9"
FT                   /protein_id="ABQ93100.1"
FT                   /translation="MSIADTTPEHPIEHHLDTQGLICPEPVMLLHRTVRKAEAGDYIEI
FT                   LATDPATTRDIPNFCRHLGHNLISQSEENNPAGDPERHTDTLYRYVVQKKQS"
FT   gene            complement(169445..170551)
FT                   /locus_tag="PsycPRwf_0141"
FT   CDS_pept        complement(169445..170551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0141"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93101"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBR0"
FT                   /protein_id="ABQ93101.1"
FT                   /translation="MKTLKLRIKDKHVNQLNKLAGSVNYAWNYVNALSFEHLRRTGKYF
FT                   SAYDLSQYTKGSGEYLGLHSQTLQAINETHAKSRKQFKKAKLNWRTNRPDAKRKSLGWI
FT                   PFKKSAIKYLSTRQTGKKALKSTIQLSLCKGRKVIIDVFDSYNLSLYQINTLEIVQDSR
FT                   NRWYACITVKDFPRQASGKGSVGIDLGLKQSATTSNGDKLTTKQTQKWAKKLAIAQRAK
FT                   NKQRVKAIHAKIKNSRLDAIHKFTTQLVKDNALIVVGDVKSRSFTNSMTNLAKSTYDAG
FT                   WFELKRQLEYKCKYAGCQLEIVNESYTTQTCSHCRKISDSSPSGRAGLGIRGWRCAECG
FT                   TWHDRDINAAKNILAVGLDRLAVAIPSV"
FT   gene            complement(170628..171128)
FT                   /locus_tag="PsycPRwf_0142"
FT   CDS_pept        complement(170628..171128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93102"
FT                   /db_xref="GOA:A5WBR1"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBR1"
FT                   /protein_id="ABQ93102.1"
FT                   /translation="MSTETKHHPTPSTTAANGSVAGFPVLAIERLRGAQKINRLSIFVI
FT                   VLAIFAFVVFGTLASLKMFHGSQQMYWLFHYLPYVLVGLTIPFTLYQAFLVYRYRLSQP
FT                   SMLVTSVGGASLLLIICLLFSLSDWLWLAMAAWIGVTYWFQATFKRFFKFITGRLKTTH
FT                   FSG"
FT   gene            complement(171218..171751)
FT                   /locus_tag="PsycPRwf_0143"
FT   CDS_pept        complement(171218..171751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0143"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase, RNase H domain protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93103"
FT                   /db_xref="GOA:A5WBR2"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBR2"
FT                   /protein_id="ABQ93103.1"
FT                   /translation="MLNDASNKENANSDVAADAAARPEQTVLLGLDYGVKKMGMALGNT
FT                   VTQDARPFDILAMNNGQPADWDNLLGIIDTWRIGRVVVGLPLNMDGSSSMIAKRAHKFA
FT                   RRLAHRLMEQRIHVPVQLFDERLTSVEAREMAWELGLIKNERDPIDDISACLLLQSYLA
FT                   NPDHAEDIATYKAD"
FT   gene            complement(171889..172455)
FT                   /locus_tag="PsycPRwf_0144"
FT   CDS_pept        complement(171889..172455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0144"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93104"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBR3"
FT                   /protein_id="ABQ93104.1"
FT                   /translation="MTLDNLTHHFLIAAPSMPDERFAQSLVYICRHDRHGVLGLVVNRP
FT                   IFDTQVGHLLDNLDIEVTDTSVMYDTPLDGGPVYPEVGFVLHTGQPTWASSFPISENVC
FT                   ITTSKDILQNIAAGSAGIGHYHLCLGHASWHEGQLEKEISQGDWLVSPGDLSLLFEIPF
FT                   EERWRHAAEKIGVHLDFLSDEVGRA"
FT   gene            complement(172579..174390)
FT                   /locus_tag="PsycPRwf_0145"
FT   CDS_pept        complement(172579..174390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0145"
FT                   /product="DNA replication and repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93105"
FT                   /db_xref="GOA:A5WBR4"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBR4"
FT                   /protein_id="ABQ93105.1"
FT                   /translation="MLTSLTLQNFALINHHELSLYDGFNVITGETGAGKSLLLDALSLC
FT                   IGGRADTSMVRHGKDNADIYAQFEFVLPATKNRSTTAKDSANNNTEPSANSNDKGTVAL
FT                   IQDWFERHEREFDGEILIRRQLSSNGRSKAWLNGVPVSLTELKELGAMLVNIHSQHAQQ
FT                   ALLKPAFVVQWLDNIAGLQPLAAQTEHAYRAYQKLKRQAEEVAAKEAHRNDRIELLNSQ
FT                   LADISPLLAVDYEQVEAEHDELSNLEALMLEASHAVQLLDNDSDDPDAMDLLGKAIRLC
FT                   DNQSDVSPTFSQASESLHLAQQHVSEAAALLTDYAEQQLPDPERLEELNALISLGHRLS
FT                   RKHGLPASNLVQEAQIWQQELDGLVNQPSSEVLEAQIQDAWAEFKHLALTLDTARQQVA
FT                   PSIGEKLVAQLQPLALPNARCEFVFTPKDESHYNAQGAHDIELMFSANVGMPMQPLYKI
FT                   ASGGELSRMALVMQVLLATHQTLDGQSAHSQNQHSDFSEPMLVFDEVDVGISGGTAQVV
FT                   GELLRQLGSRRQLLAITHQAQVAAQAHQHILVQKHHDTKEGQTTSQIDIISHDAQVDEL
FT                   ARMSGGVNITEITREHARSLLADVSSE"
FT   gene            175039..175371
FT                   /locus_tag="PsycPRwf_0146"
FT   CDS_pept        175039..175371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0146"
FT                   /product="protein of unknown function DUF1255"
FT                   /note="PFAM: protein of unknown function DUF1255"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93106"
FT                   /db_xref="GOA:A5WBR5"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBR5"
FT                   /protein_id="ABQ93106.1"
FT                   /translation="MPTTYDQVSVVKNATISYDGRCSSHTVLFEDGSKKMLGIILPCDE
FT                   HVREYEFATHTSERMEITSGECEVKITGEDEFTYYRAGQAFVVAGDSSFALRTEQIVQY
FT                   ICHLEG"
FT   gene            175574..176359
FT                   /locus_tag="PsycPRwf_0147"
FT   CDS_pept        175574..176359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0147"
FT                   /product="23S rRNA Gm-2251 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase, substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93107"
FT                   /db_xref="GOA:A5WBR6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBR6"
FT                   /protein_id="ABQ93107.1"
FT                   /translation="MAKPVHFYGIHAIHALLSHRPTDAMALFIQQGRAHKDSSTQDEAD
FT                   STFEEILQLAEQMGVSIQEASRDKLTALCGSPQHQGVVLNARPLAMADEGEIASLAQSD
FT                   DALFLVLDQITDAHNLGACLRTAAAMGVDAVICPKHHSASLTPTVAKVSVGAMEIMPVI
FT                   AVTNLARCIENLKQAGVFVYGTALDATAKALPDVDLKGKVAIIMGSEGEGMRRLTTERC
FT                   DELVYIPMTGNKHGSLQSLNVSVATGMVLYEVSRQRHQP"
FT   gene            complement(176463..177110)
FT                   /locus_tag="PsycPRwf_0148"
FT   CDS_pept        complement(176463..177110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0148"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="TIGRFAM: dephospho-CoA kinase; PFAM: Dephospho-CoA
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93108"
FT                   /db_xref="GOA:A5WBR7"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBR7"
FT                   /protein_id="ABQ93108.1"
FT                   /translation="MIDPPQKFETFYVSKPIIGLTGGIGSGKTAVSNWFATQGIDVVDA
FT                   DVVAHQIMHKGSPTLQALVEALGEWVVDAQGEMNRRAVREHVFANNKALLTLESITHPA
FT                   IRQEIKNQLSQAQSAYVILSAPLLLESYEAGLVSLCDRVLVVDASEETQLKRASSRDTQ
FT                   SIDKIKAIMANQLTREARIEQADDVVCNNGDLDALYAQLLPLHHNYLNLKKM"
FT   gene            complement(177662..178582)
FT                   /locus_tag="PsycPRwf_0149"
FT   CDS_pept        complement(177662..178582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0149"
FT                   /product="type 4 prepilin peptidase 1, Aspartic peptidase,
FT                   MEROPS family A24A"
FT                   /EC_number="3.4.23.43"
FT                   /note="PFAM: peptidase A24A, prepilin type IV; peptidase
FT                   A24A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93109"
FT                   /db_xref="GOA:A5WBR8"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBR8"
FT                   /protein_id="ABQ93109.1"
FT                   /translation="MQFWQVWQFFEPHNLATPDVFALGVFAIVGLCVGSLLNVVIYRTP
FT                   LILQRQWRLGSLQFLQSQPDVPADALAPVAACIIQDMPLSLWRPSSQCPQCHTPIAWRH
FT                   KLPIISWLWLKGRCASCRRRIGLRYPLIELLTAVLSILVIYQLGVSLAGLCGLVFLWLL
FT                   IALVGIDFETQYLPDNLTYPLAILGLMVNSHSVFVSPSLSIWGLILGYLSLWVVVKVFY
FT                   LFTRKQGMGQGDFKLLAALGAWLGPFMLPFVILLSSVLGTIMGLILLKERRESQPFAFG
FT                   PYLALAGLVALLYGEALMHWYLGRY"
FT   gene            complement(178666..179898)
FT                   /locus_tag="PsycPRwf_0150"
FT   CDS_pept        complement(178666..179898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0150"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93110"
FT                   /db_xref="GOA:A5WBR9"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBR9"
FT                   /protein_id="ABQ93110.1"
FT                   /translation="MSPVPNRTTLKTLEFVYQGINPQGMKVKGILTSSSMALAKAQLRK
FT                   QGIVTQRIRRKPKALWRRQKKITALDISLFVRQLATMTKAGVPIVQAFELIAQALDKPS
FT                   MKQLVLRVKQQLETGMSLEDSLRAHPKQFDDLFCALVSAAEHSGTLDTLLERIADYKEN
FT                   NELLKIKLKKAIKYPLAVMLVAMIVSIILLLKVVPVFADLYDSMGSQLPAFTQFVVTLS
FT                   HIMQKLWPIFLLLTIAAVIAFRQAQKRSLGFNQWLDKAILKLPIFGSIAYQAIIARFCR
FT                   TLATTYAAGVPLLEALGATAAATDNHVFETATYQMRQQVAAGQRLERSMRSSQLFPALA
FT                   VQMVSIGEESGSLEQMLNKVADYYEAQVTHAIDGLTDLMEPIIMVIIGLLVGGLIVAMY
FT                   LPIFQMGSILG"
FT   gene            complement(179959..181221)
FT                   /locus_tag="PsycPRwf_0151"
FT   CDS_pept        complement(179959..181221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0151"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93111"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBS0"
FT                   /protein_id="ABQ93111.1"
FT                   /translation="MSRPPSLNQLAAAPSATLAQAEHGAHQPHDLQQDPVVQLVQDLLC
FT                   QAVDKGASDLHFEPYEHTFRVRFRIDGVMQQVATPALELQAKICARLKIMAQMDISERR
FT                   MPQDGRIRLQLNGMPTLHFRANALPTLFGEKIVLRVINPAASIAGIDSLGLEPEQKQQF
FT                   LQALQQPQGILLITGPTGSGKTLSLYTGLDILNTVATNICTVEDPVEINLTGINQVTVN
FT                   PKVGLSFAVALKSFLRQDPDVLMVGEIRDFETADTAIKAAQTGHLVLSTLHTNSAAETL
FT                   TRLHHMGVAYFNIATAISLVVAQRLARCLCRHCKIPCVVPEVSLIEIGFSAEELAQPEH
FT                   IIYKAVGCDKCCEGYKGRIGVFEVMPMNTALAQVIMQGANAIEIKAAATEQGFFDLRRA
FT                   AILKVLQGILSIEEMTRMTAQ"
FT   sig_peptide     complement(181156..181221)
FT                   /locus_tag="PsycPRwf_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.884) with cleavage site probability 0.444 at
FT                   residue 22"
FT   gene            181557..182354
FT                   /locus_tag="PsycPRwf_0152"
FT   CDS_pept        181557..182354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0152"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="PFAM: triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93112"
FT                   /db_xref="GOA:A5WBS1"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBS1"
FT                   /protein_id="ABQ93112.1"
FT                   /translation="MKSWVIGNWKLNPTSLEQVQHLVTDLVEGVDAQTRSMDNCHLMLA
FT                   PSFLHLSPVQQALNANSSTLKLAAQDVSALSAESGAYTGDVSAKQLKDMGVQWVIVGHS
FT                   ERRQYYKESNAVLLKKLLNSAEQGLGVILCIGESESDFEAGHTEQVLDEELQVIADFLQ
FT                   QLKPEQAGYAEQNLIIAYEPVWAIGTGKVPSVEQVTQIHRFIRQQLHSFDNKLDTTPVI
FT                   YGGSVKPENAADFAASDQINGVLVGGAALQADSFLAIAKCFNN"
FT   gene            182520..182837
FT                   /locus_tag="PsycPRwf_0153"
FT   CDS_pept        182520..182837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0153"
FT                   /product="protein translocase subunit secG"
FT                   /note="TIGRFAM: preprotein translocase, SecG subunit; PFAM:
FT                   Preprotein translocase SecG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93113"
FT                   /db_xref="GOA:A5WBS2"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBS2"
FT                   /protein_id="ABQ93113.1"
FT                   /translation="MFNIILAIHIIVAIAMIGLILIQHGKGADAGASFGAGASGTVFGA
FT                   AGSANFLTRATAILAIIFFTTSLTLAVHARKQAEGQYRLDVPAASQAPVTAPEPTPAPA
FT                   E"
FT   gene            183117..183201
FT                   /locus_tag="PsycPRwf_R0004"
FT                   /note="tRNA-Leu1"
FT   tRNA            183117..183201
FT                   /locus_tag="PsycPRwf_R0004"
FT                   /product="tRNA-Leu"
FT   gene            183580..183656
FT                   /locus_tag="PsycPRwf_R0005"
FT                   /note="tRNA-Met1"
FT   tRNA            183580..183656
FT                   /locus_tag="PsycPRwf_R0005"
FT                   /product="tRNA-Met"
FT   gene            183800..184300
FT                   /locus_tag="PsycPRwf_0155"
FT   CDS_pept        183800..184300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0155"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93114"
FT                   /db_xref="GOA:A5WBS3"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBS3"
FT                   /protein_id="ABQ93114.1"
FT                   /translation="MKLSNKVTQLTDIIAPAVAACDVALWGVEFLPQGGRSLLRIYIEA
FT                   LPEDKAADKQVTIENCAAVTHQVSGVLEVHDPIAGEYVLEVSSPGLDRPFFAPEQMTDY
FT                   MGQTINLRLIQAVGSGSSKRRKVTGKLEQLDDKQLSVVTADGERYDIALDNIDKANLIY
FT                   QDL"
FT   gene            184592..186079
FT                   /locus_tag="PsycPRwf_0156"
FT   CDS_pept        184592..186079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0156"
FT                   /product="NusA antitermination factor"
FT                   /note="TIGRFAM: transcription termination factor NusA;
FT                   PFAM: RNA binding S1 domain protein; NusA N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93115"
FT                   /db_xref="GOA:A5WBS4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBS4"
FT                   /protein_id="ABQ93115.1"
FT                   /translation="MSREILTVVETVSNEKGLNPEDIFEAIEEALVVSTKKRVYTEQPE
FT                   VAVRVEIDRDTGDYDTYRYWTVVADEDHEMPACQLAISDLDENEWSIGDIKEEQIESIE
FT                   FGRIAATQAKQVIIQKIREAERALTADAFEPRIGEMMYGEVKKQTRDGYIIDLGDNAEG
FT                   YLSRDQMLPREQLRVKSRINAILYHVNRDNRGAQLLLSRTSPDMLVALMNKEVPEINEQ
FT                   IIEIRDVARQPGVRAKISVKTNDHRIDPVGACIGMRGTRIQAVQSELDGERIDVIVWSD
FT                   DPAQYIISALEPADVSSIILDEDAKTADIIFTANDQLARAIGAQGQNVRLASELTGYKL
FT                   NMMLEAEYLERQQNETKAYLELFYNRLEVDEDLAQALVDVGFTSIEEVAYVPVETFYDI
FT                   EGLDDDAIEMIQERAKEVVIADELVKQQNMKEPSKELLTMDGMTTDWAYKLAQRDIITL
FT                   DDLAEQAVFDLEDIEGLDEKTAGELIMKARESWFNEE"
FT   gene            186097..188814
FT                   /locus_tag="PsycPRwf_0157"
FT   CDS_pept        186097..188814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0157"
FT                   /product="bacterial translation initiation factor 2
FT                   (bIF-2)"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; GTP-binding protein, HSR1-related; elongation
FT                   factor Tu, domain 2 protein; translation initiation factor
FT                   IF-2 domain protein; Initiation factor 2 associated domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93116"
FT                   /db_xref="GOA:A5WBS5"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBS5"
FT                   /protein_id="ABQ93116.1"
FT                   /translation="MADKTVKELADMVSKTVSAVQKQLTDAGLPARGEDDLVTELEQEQ
FT                   LVAFLKQSHGQKEKRRISLKSKTTSTARVTGSSGKSKSVNVEVRKKKVFEKPDPNKLAE
FT                   EIAAREQAALEAKKRAEEEAKKREQVKKEAEERQAATLAAMRANLGGGSSSSDKKEELS
FT                   TVVVKKGSKAAAAAKEAPKKKVAQTKPKVETAAERKARETREAEEERLRQIEAETRRKQ
FT                   AEEAQKKTLEQMRKMAGKYSDKDPVAEVRKDEPLAEGLVGEALEESFEKERREIKRGSA
FT                   STATRGRRRKGQEEREIRNRKHGLKSSQASQHKFEKPVEKIVHDVEIGEQIVVSDLAQR
FT                   MAVKAREVTKLLMKMGEIVSADQEIDQATASLIVEEMGHNPIPVSDTKVEDDLQEAVEE
FT                   RRSNVQTRPPVVTIMGHVDHGKTSLLDKIRETKVATGEAGGITQHIGAYHVETDRGVIT
FT                   FLDTPGHAAFTAMRSRGAQATDIVILVVAADDGMMPQTEEAIDHARASGTPLIVAINKM
FT                   DKSTADPDRVLNELTTKEVVTEAWGGDVPMAKISAKTGEGIDELLELINLQAELMELEA
FT                   PTDGAAQGVVIESRLEKGRGAVASILVKKGTLNQGDLVLAGEFYGKVRAMTDETGKRVK
FT                   SAGPSIPVEILGLPDTPAAGSEFLVVSDEKKAREVAEFRATRERERQLERQNKMRLESM
FT                   FEQMGQDDLSFLNIILKTDVRGTLEALLAALEDLSTDEVKVKVISSGVGPIAESDVTLA
FT                   ESSEAVLLGFNVRADNAAKRKADEAGIDIRYYSVIYGLIDDVKAAMSGMLSPEHREKIL
FT                   GIAEVRDVFRSSKFGAAAGCMVVEGTIYRNKSIRVLRDDKVAFTGQLQSLRRYKDDVNE
FT                   VRSGMECGLAVRGYDVEVGDKIEVFEIQEIQRTI"
FT   gene            189011..189433
FT                   /locus_tag="PsycPRwf_0158"
FT   CDS_pept        189011..189433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0158"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93117"
FT                   /db_xref="GOA:A5WBS6"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBS6"
FT                   /protein_id="ABQ93117.1"
FT                   /translation="MNQRLQRLGDQIQRELAVLIRDDVNDPRLTGFVTISSVKVSSDLG
FT                   YADVYVTIMEPELNDAMSKHSHEESLKVLNKAAGFLRTELSHSLKTRTTPRLRFHYDEV
FT                   TARGNYMMDLINKAVTKTEQTSADDDADRLDSEDRS"
FT   gene            189456..190490
FT                   /locus_tag="PsycPRwf_0159"
FT   CDS_pept        189456..190490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0159"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93118"
FT                   /db_xref="GOA:A5WBS7"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBS7"
FT                   /protein_id="ABQ93118.1"
FT                   /translation="MMTEEIIQSAPAAPLKKSRVSGVILIDKPQGLTSQQVVSKVKYLL
FT                   KSPLHDSKKAGHTGTLDPMATGLLPVCLGEATKFSHYQLDADKAYQATIKLGIQTDTGD
FT                   AEGQSIATAAVPKLTAAELEAVAQQFMGDIKQIPPMYSALKKDGKKLYEYARAGIEIDR
FT                   PARPITIQAISLTLGAQSDELILNVTCSKGTYVRVLGEDIAAALGTLGHLTALRRTQVG
FT                   HFDIAEAVSLEALEDLSHEQRLAYLLGIDACINGIPTLEVSDSQCARLHMGQRLNIKPQ
FT                   LDEDITNYIQAMLSQRHSDADDSGKDEALDSVDIKLVNPKGEFLGLGAVELNGRLQPKK
FT                   MIQR"
FT   gene            191213..191740
FT                   /locus_tag="PsycPRwf_0160"
FT   CDS_pept        191213..191740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0160"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93119"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBS8"
FT                   /protein_id="ABQ93119.1"
FT                   /translation="MSKRIAFLLNSHFEQAEYADVDRLLQDKGYETVLITTNDNKTVQA
FT                   MQQDVDKADTFTADLFLSEASAEDYDAVVLPGGTVNADTIRIDKSAQNFVKQFYDANKP
FT                   VAAICHAPWLLVNSGLVKGKTVTAYPSLQTDIENAGGTFVDKSVQQDGNIITSRKPDDI
FT                   EDFVAAIDKALS"
FT   gene            191834..192013
FT                   /locus_tag="PsycPRwf_0161"
FT   CDS_pept        191834..192013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93120"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBS9"
FT                   /protein_id="ABQ93120.1"
FT                   /translation="MTQSNDNKFEQQQSDAELAGLKNQVEGNLGENKDKSEEQAAEGIA
FT                   DNLAADNLAQGNDK"
FT   gene            192085..192246
FT                   /locus_tag="PsycPRwf_0162"
FT   CDS_pept        192085..192246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93121"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBT0"
FT                   /protein_id="ABQ93121.1"
FT                   /translation="MSNTQQGATPLNGDAIEEALEERQTPDSLAEATTAEEDSQALGRH
FT                   TTEADAEK"
FT   gene            192402..192668
FT                   /locus_tag="PsycPRwf_0163"
FT   CDS_pept        192402..192668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0163"
FT                   /product="SSU ribosomal protein S15P"
FT                   /note="PFAM: ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93122"
FT                   /db_xref="GOA:A5WBT1"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBT1"
FT                   /protein_id="ABQ93122.1"
FT                   /translation="MLTNTDRQQVIAQYQRAPGDTGSPEVQIALLSARINDLQAHFKEH
FT                   KGDHHSRRGLIRMVNQRRKLLDYLKRKDLTRYASLISELGLRR"
FT   gene            193089..195203
FT                   /locus_tag="PsycPRwf_0164"
FT   CDS_pept        193089..195203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0164"
FT                   /product="Polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="PFAM: 3' exoribonuclease; RNA binding S1 domain
FT                   protein; KH, type 1, domain protein; SMART: KH domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93123"
FT                   /db_xref="GOA:A5WBT2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBT2"
FT                   /protein_id="ABQ93123.1"
FT                   /translation="MSMFNTISREFQYGNEQVVIETGRIARQANSVLVHMGGVSVLVAV
FT                   VVKSDAKEGQNFFPLTVNYQEKMYAAGKIPGAYGKREGRPTEFETLTSRLIDRPIRPLF
FT                   PEGYVNEIQITATVISSDKKHYADIAAMIGASAALSISDAPFNGPIGGARVGFINGEYV
FT                   LNPSIEELKSSDLDLVVAGTKSAVLMVESEAAELSEDQMLGAVLYGHEQQQIVIDNIAE
FT                   LAKAVGTQKQDFVAPELNAELKEKVTTQFGEQVAEAYAISDKQARYEKLDEIKAAAIDA
FT                   LAGDPESEEFAEKEAQIKEIYNDLKYRTVRDAILSGKPRIDGRDLDTVRALDIQVGVLP
FT                   YTHGSALFTRGETQALVTTTLGNSRDVNLIDSLAGTIQDHFMLHYNFPHYSVGETGREG
FT                   VPKRREIGHGRLARRGVQAMLPDSDRFPYVIRVVSEITESNGSSSMASVCGASLALMDA
FT                   GVPLKAPVAGIAMGLVKEGDRFAVLSDILGDEDHLGDMDFKVAGTKDGITALQMDIKIE
FT                   GITSDIMEKALEQAHAGRIHILNAMNEVLPASRTEINAHAPNYAVIEINSDKIRDVIGK
FT                   GGATIRQLTEDTGAVIDIDDNGTIRIFGENKAATKEAIRQIEAITAEVEVGKVYKGTVA
FT                   RVVDFGAFVTVLPGTDGLVHISQIADERVESVSDYLSEGQQINVLVQDVDNRGRIKLTM
FT                   KGVEQEQTQA"
FT   gene            complement(196042..198876)
FT                   /locus_tag="PsycPRwf_0165"
FT   CDS_pept        complement(196042..198876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0165"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93124"
FT                   /db_xref="GOA:A5WBT3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBT3"
FT                   /protein_id="ABQ93124.1"
FT                   /translation="MHSLKQRLKKQRQTQKSNRDNSSDAQRSALSFQEQAAQAGAAISR
FT                   SGRSVNQLYRKLSGKSLELAVKPKVIGELPEINTEEGALTFYVLREYSRSNSVLVDLQT
FT                   KKHGFPSALVGVEDSVHHIDENAAVIFLNHPDAKGRKVSPRLARLVSACRQNSAPKINL
FT                   VPVSILWGRAPENEDSLFKLLMADNWEEPTIAKQLFNIGVMGRDTFVQFHPPQSLHDII
FT                   ETFSQSGADHIPGDEAEKVANDLFDDAKLADTALPKSEKELLLQAKKNIEALPTSTALL
FT                   TATEANFSLTLLVQHKLNGFLDSQRQSMIGPDLSDKRNLVDKLIRSPAINHACEQEATA
FT                   SNISINEARQLARGYANEIVNDYNYSVVKFFYKFLDWLWTQLYDGVEVHHFERVRSLAA
FT                   THELIYVPCHRSHVDYLLLAYIIFEKGLGLPYVAAGNNLDVPVIGPLLRSAVAFYIRRS
FT                   FKDNELYKAVLREYLHTLIQRNTPIEYFIEGGRSRSGRLLPPKLGMLAMTVHSHLRGSN
FT                   KPLAFIPTYIGYERIMEGGTYIGELKGKPKESESLLGLLKVSRKIERIFGHVHLSFGTP
FT                   LHMEDFMQKFDVAPNSLPADRTNTPLDTKAAAMVDNLGVKIMQNINKAAVINPISLLSL
FT                   VLLSTPKAALDEESCREQIALYQAIANGSPYAEDTIITDMSAQSIIDYGIKLKLIERTP
FT                   HILGDMIKVMPKQIAILSYFRNNILHVFIISSFLAALIYRNGRIERKHLDSIVTQLYPF
FT                   LQSELFLYRAARNLPSLIDEKLSNLIDLGIIVDLGNGILGTPEKNSEQYQQLDMLASPV
FT                   SQSLERYFMSLALLAQQGSGNLTADQVVDLCHLLGQRLSVLYADDIPDFFDRALFTSFL
FT                   NALIRLDYVQKDAETGVLTFDERINNIARHAHYILNPDIMQILQHVASLDEEEINHAIS
FT                   EINNKKLIKFSRKR"
FT   gene            199482..200375
FT                   /locus_tag="PsycPRwf_0166"
FT   CDS_pept        199482..200375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0166"
FT                   /product="Palmitoyl-CoA hydrolase"
FT                   /EC_number="3.1.2.2"
FT                   /note="PFAM: acyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93125"
FT                   /db_xref="GOA:A5WBT4"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBT4"
FT                   /protein_id="ABQ93125.1"
FT                   /translation="MPDYKQLVDQLLDTVKLTEISENIFEGKSYDYVGKRIFGGQVLAQ
FT                   AIMAAAQTLDEDKPCHSLHGYFLRGGSIGQPVIYQVRRLRDGRSLSAREVTAVQMKQDN
FT                   DGNMIEQVVFSMIASFSPMEGGLDYQEEMPAYPPPEDLESEQSLKEHHVGSVPEPLRER
FT                   FMRPRHVEIKPVKPRDPVYPEPMVPRQANWLRIRELGEQPVAIQQALLAFSSDYYLVGT
FT                   GLMPHGISFMTKGLQAASIDHSMHFHRPFDINEWLLYDMWSDTTSHSKGLNHGQFWQNG
FT                   NLVATVQQEGLMRLRG"
FT   gene            complement(200529..201866)
FT                   /locus_tag="PsycPRwf_0167"
FT   CDS_pept        complement(200529..201866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0167"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase; PFAM:
FT                   Peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93126"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBT5"
FT                   /protein_id="ABQ93126.1"
FT                   /translation="MLNSPSLPHQIDTQPSKKLTLLKSTLALVPAIILASCASQAPIQQ
FT                   VPIQKPAPVIVVKPQPTPQPKPQPAPQPQASYSSFSEWKSDFSRRAMSQGYSAYDVSRI
FT                   LDSAQLNQQVISLDSNQAEFVKMPWDYADSAVSGGRVSSGKSKFNEQRSLLSRLESQYG
FT                   VNAEIIAAIWGMESSYGAVTGNSYIPSSLATLAFEGRRRQWAEDQLLALMQLIQHGDIY
FT                   PSQLNGSWAGGMGHTQFIPGTWLAQGVDGDGDGRRSPWVTADALSSTANYLSNSGWMRG
FT                   LSPFYEVTLPASFDYKLLGQKMPGSTWRSMGITPIDGAYLDAGTPFEMWLPAGKDGPAL
FT                   LLSPNFDVIKVYNNSSNYALGVSLLGRAINGQPGIQKAWPRYEQPLTSAQVRNLQQRLT
FT                   SAGYDTKGIDGIMGTNTRNAFAKWQAANGQTADGFVTQRSASALIW"
FT   sig_peptide     complement(201744..201866)
FT                   /locus_tag="PsycPRwf_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.922) with cleavage site probability 0.548 at
FT                   residue 41"
FT   gene            complement(202029..203303)
FT                   /locus_tag="PsycPRwf_0168"
FT   CDS_pept        complement(202029..203303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0168"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   HhH-GPD family protein; SMART: iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93127"
FT                   /db_xref="GOA:A5WBT6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBT6"
FT                   /protein_id="ABQ93127.1"
FT                   /translation="MSQPIANVNTNINTSTSTNTNTHLKPHTFNHSDAELTDFAPRILN
FT                   WFDISGRHDLPWQQHKTDTPNPYIVWLSEVMLQQTQVTTVIPYFQRFITSFPTVQDLAN
FT                   AQWDTVAEHWAGLGYYARARNLHKGAKQLVEIIKTTGRFPQTVEDWEAISGVGQSTAGA
FT                   IVAMGLHGYGVICDGNVKRVITRWAGIDGDITKSATNKALWALAERLTPTEDSGHFAQA
FT                   MMDMGATLCTRRHPSCEVCPINSDCIAYAEGKQDFYPVKAKKKAKPSKFSKVILIQNVQ
FT                   GELLWLQRPDSGIWGGLWVLPMQFEKKTQGKTVISTSLQEAAYESENTLAEQIIDKWIA
FT                   DNNGQLQLQSISAELFDDAPIKHTLTHFHWYLQPQALPLTPAQSQELSATLADAGIHFV
FT                   WQTATHAKAHLGLPKAMLKILQSLA"
FT   gene            complement(203433..204404)
FT                   /locus_tag="PsycPRwf_0169"
FT   CDS_pept        complement(203433..204404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0169"
FT                   /product="GTP-binding protein, HSR1-related protein"
FT                   /note="PFAM: GTP-binding protein, HSR1-related"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93128"
FT                   /db_xref="GOA:A5WBT7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016478"
FT                   /db_xref="InterPro:IPR019991"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBT7"
FT                   /protein_id="ABQ93128.1"
FT                   /translation="MIQNPSIQWFPGHMNKARNEIKEIMPDMDVVIEVIDARIPFSSEN
FT                   PMVAALRSNEAGFQKPVIKILNKADLADPELTQIWIEQLEQQSQVKAIACDDNKANDVK
FT                   RIIQMCKDLIPNKVGTGRQIKVLIMGIPNVGKSTLINTLAGRSIARTGDEPAVTKSQQL
FT                   IKIDDDIMLYDTPGMLWPKIENPNSGFRLAATGGIKDTAFDFSDVAGYTAEYLIKAYPE
FT                   LLKERYKIDELPQSDWEFFEMAGRNRGFLKKGGVVDTYRMSEILINELRSGQLGRITLE
FT                   TPAMRIEEDKLVEQLRAEAEERRLAKIEEKKLRKKRARKNRK"
FT   gene            complement(204627..205367)
FT                   /locus_tag="PsycPRwf_0170"
FT   CDS_pept        complement(204627..205367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0170"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93129"
FT                   /db_xref="GOA:A5WBT8"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBT8"
FT                   /protein_id="ABQ93129.1"
FT                   /translation="MSIKTYEIKTTADYGMELISYIALPESATDESSVPGILVAPEWWG
FT                   VVEHPREVTERLAKAGFAAIAMDIYGEGKLTTDAAQANEWMTQMLEDQDKLMGRCRAIL
FT                   NDFADQLPVDGKRLGVVGYCFGGKIALDMAREGMPVKAVATFHGNPTPKQPAEKGKFTA
FT                   KALIAHGRDDSMVSMQAIDGLKQELDNAGVDYTVDVYDDAQHGFTNPNADKRAEENGVD
FT                   LGYNEKAANQSWDKMIDFMTANLK"
FT   gene            205637..206113
FT                   /locus_tag="PsycPRwf_0171"
FT   CDS_pept        205637..206113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0171"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93130"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBT9"
FT                   /protein_id="ABQ93130.1"
FT                   /translation="MSEAQLRANFWQHYPLHELSTAEWEALCDGCGGCCLEKFLDDPDE
FT                   PYEVEYTDVACKLLDCSTGYCSNYEHRQQFVPECVSLTADKLPDMMWLPSNCAYKRIYL
FT                   GEGLPSWHLLLTQDIELTRQGMRRAGVGVAGRCVSEDFVNEDELEERIVRWIQA"
FT   gene            complement(206272..207525)
FT                   /locus_tag="PsycPRwf_0172"
FT   CDS_pept        complement(206272..207525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0172"
FT                   /product="ammonium transporter"
FT                   /note="PFAM: Rh family protein/ammonium transporter; TC
FT                   1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93131"
FT                   /db_xref="GOA:A5WBU0"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR019879"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBU0"
FT                   /protein_id="ABQ93131.1"
FT                   /translation="MENQIFELQYALDTFYFLVCGALVMWMAAGFAMLEAGLVRSKNTT
FT                   EILTKNIGLFAIACTMYLICGYHIMYDGGFFLNGIAGGETLVADALADSAKNGFEGDAV
FT                   YSAASDFFFQVVFVATCMSIVSGAVAERMKLWVFFAFAIVMTGFIYPMEGSWTWGGNAV
FT                   PFIGELNFVDFAGSGIVHMAGAAAALAGVLLLGARKGKYGKNGEIRAIPGANLPLAALG
FT                   TLILWLGWFGFNGGSVLKLGDIASANSVAMVFLNTNAAAAGGAIGALLLARLIFGKADL
FT                   TMLLNGALAGLVAITAGPDTPTPLLATVFGMMAGIIVVCSILILDKMKIDDPVGAISVH
FT                   GVAGFFGVMIVPLTNDSATFLGQLGGAAVIFGWVFVCSLIVWSVLKAVVGLRISEEEEY
FT                   EGADIAECGQEAYPEFVN"
FT   gene            complement(207634..207972)
FT                   /locus_tag="PsycPRwf_0173"
FT   CDS_pept        complement(207634..207972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0173"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93132"
FT                   /db_xref="GOA:A5WBU1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBU1"
FT                   /protein_id="ABQ93132.1"
FT                   /translation="MKLITAVLKPFKLDDVREALSEIGVKGVTVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKVEVAVTDEMVEPAIEAITRIASTGKIGDGKIFISPLEQVIRIRT
FT                   GETGPDAI"
FT   gene            complement(208359..209219)
FT                   /locus_tag="PsycPRwf_0174"
FT   CDS_pept        complement(208359..209219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0174"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93133"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBU2"
FT                   /protein_id="ABQ93133.1"
FT                   /translation="MSNLRPDSVIACLDCPSHVQAVLNASLWAAKMLQAPVGLLHAAPS
FT                   VHRKAAVDYSGCLVADDGNHLLNQLALEEKDSNGKLRDQGRLLLKQAESYCEQQQGRYQ
FT                   HHLYTLHRHASIAESLDYVDESAQLVVIGHQVTCKDTLSQLIRASRCPTLVTHETFKAP
FT                   KTALFAFDNRPTCHALLDWLCSNALVRNTSLHVVMVGEENERNKDALREAYARLTQSGI
FT                   QCKKALIEGRDVTAALMYYQQQHELDMLITGAFGESRLHEFLHGSNTRKLLSASRTPYL
FT                   LYPRM"
FT   gene            complement(209376..210878)
FT                   /locus_tag="PsycPRwf_0175"
FT   CDS_pept        complement(209376..210878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0175"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93134"
FT                   /db_xref="GOA:A5WBU3"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBU3"
FT                   /protein_id="ABQ93134.1"
FT                   /translation="MTVLSINTLRDEWFSNVRGDVLSGLVVALALIPEAIAFSIIAGVD
FT                   PKVGLYASFCIAVVISFVGGRPGMISAATGAMALVMVTLVADHGLQYLLAATLLCGVIQ
FT                   FFMGVFKLGNLMRFVSRSVVIGFVNALAILIFMAQLPELNPTVDRVGLPVYIMTAAGLA
FT                   IIYGFPLIPKIGKLIPSPLICIVGLTAVALYMGLDIRNVGDMGELPDTLPMFLLPDIPL
FT                   TLDTLLIIAPYSIALAIVGLLESMMTATIVDDLTDTTSDKNRECRGQGIANVASGFFGG
FT                   MAGCAMIGQSVINVKSGGRTRLSTFIAGVVLLIMVVFLSDWVSQIPMAALVAVMIMVSI
FT                   GTFNWESLREFKTHPVSFNVVMVATVITTVFTHNLAYGVLVGVLLSALFFANKIGQFLS
FT                   VLSEYDETNNTRYYYVHGQVFFSSTTQFLDSFDTKEALDQVVIDVSQAHFWDVTAVDTL
FT                   DKLVIRFQREGIDVKVVGLNSASRTLIDKFSVHDRRDIGLLD"
FT   gene            211558..213015
FT                   /locus_tag="PsycPRwf_0176"
FT   CDS_pept        211558..213015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0176"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93135"
FT                   /db_xref="GOA:A5WBU4"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBU4"
FT                   /protein_id="ABQ93135.1"
FT                   /translation="MSHYTPAHTDQTEPQSGGLIQKGEGLQVVIGLGQSGLATANYLAR
FT                   RGYKVAVTDGNSAPKLAEQLEPNISIRAFGDIDAELLLQASRIIISPGVSLATPAVAAA
FT                   KQAGIAIVSDIQLFKEACKAPIVAITGSNAKSTVTTLVGQMAKDAGVNVGVGGNIGVPA
FT                   LSLLEDEALGEAMQLAVLELSSFQLETVTNLGAKVATVLNMSPDHLDRHGDMLGYHQAK
FT                   HRIFQGAQSVVVNRDDALSRPLIADNTPRLSVGSGAPDLGEYGLITEGDGRIYLAKGTE
FT                   KLLAADQLKVKGKHNLVNALAALALGGLAGLPKQSMLKTLQEFSGLPHRCQFVDNVAGV
FT                   DYFNDSKGTNVGSTLAAILGLGSVYGNQSGAKTKLMLILGGQGKGQQFGELVPLINKYV
FT                   SQILLIGQDAELIESHLQQANLSGDVETHQCHDLAQAMTKANSLLSSSLSQVTTVLLSP
FT                   ACASLDQYPSYAKRGEHFCELVGKLKD"
FT   gene            213137..214345
FT                   /locus_tag="PsycPRwf_0177"
FT   CDS_pept        213137..214345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0177"
FT                   /product="cell division-specific peptidoglycan biosynthesis
FT                   regulator FtsW"
FT                   /note="PFAM: cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93136"
FT                   /db_xref="GOA:A5WBU5"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBU5"
FT                   /protein_id="ABQ93136.1"
FT                   /translation="MAKNTANASGYTPNALSKRKRDKTGVFSWPSASSVLLASVGSLMV
FT                   LSLIMVASASIPFANMHDIDQLYFFNHQLMYMTMGLVAGFMAYKVRLPWIYDMLSLASA
FT                   LVVVILLLLATLAFGDAINGSKRWIELGSFNFQVAELVKLVMVLFTADFVVRRGNEVRQ
FT                   GYGGIARMGIVVTILAALFLSQPDFGSLVIIIGTILAIFFVAGAPRSQSIFLLIGVLIG
FT                   AAYAVMFQEYRMTRASSFLDPFDDIQGSDYQLARSLIAFGRGEITGVGYGESVQKLAHL
FT                   PEAHTDFLLAITAEELGFVGVLTVLFLEAMVIVSAMRISYIALKNRQMRLSYTAFGFAT
FT                   IFIGQGIINSGMNMGLMPTKGLTLPFFSYGGSSMLVSLIMVGLLLNIYKFSPQIPSAQC
FT                   RHY"
FT   sig_peptide     213137..213301
FT                   /locus_tag="PsycPRwf_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.945) with cleavage site probability 0.791 at
FT                   residue 55"
FT   gene            complement(214403..215509)
FT                   /locus_tag="PsycPRwf_0178"
FT   CDS_pept        complement(214403..215509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0178"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93137"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBU6"
FT                   /protein_id="ABQ93137.1"
FT                   /translation="MKTLKLRIKDKHANQLNKLAGSVNYAWNYVNALSFEHLRRTGKCF
FT                   SAYDLSQYTKGSGEYLGLHSQTLQAINETHTKSRKQFKKTKLNWRTNRPDAKRKSLGWI
FT                   PFKKSAIKYLNTRQSGKKALKSTIQLSLCKGQKLIIDVFDSYNLSLYQINTLEIVQDSR
FT                   HRWYACITVKDFPRQASCKGSVGIDLGLKQSATTSTGDKLQIKQTQKWANKLAVAQRAN
FT                   NKSRVKAIHAKIKNSRLDAIHKFTTKLVQNNALIVVGDVKSRSFTNSMTNLAKSTYDAG
FT                   WFELKRQLEYKCKHAGCQFEMVNESYTTQTCSCCLKISDSSPKGRAGLGIRGWRCAECG
FT                   TWHDRDINAANNILAVGLDRLVVGIPSV"
FT   gene            complement(215789..216727)
FT                   /locus_tag="PsycPRwf_0179"
FT   CDS_pept        complement(215789..216727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0179"
FT                   /product="Glutamate--tRNA ligase"
FT                   /EC_number="6.1.1.17"
FT                   /note="PFAM: glutamyl-tRNA synthetase, class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93138"
FT                   /db_xref="GOA:A5WBU7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBU7"
FT                   /protein_id="ABQ93138.1"
FT                   /translation="MPVSINRPAATFTKLAVGRFAPSPTGALHLGSLTTAIASYCHIKS
FT                   IGGRWLLRIEDTDHQRCLPEFSHQILLDLERLGLHWDGEVWYQSQREAIYNELLEDTLL
FT                   PRVYGCQCSRKQLAGHEIYPRYCLPEASVRRHVDQKSQSLAGKKVRIELPDYSIGFLDG
FT                   IQGMQWANPQRRLGDVVLRRADGTINYFLAASVDDGLQGITHVMRGLDILPLTSAQIAI
FT                   MQYLTLPAVAHWYHLPLVENQYGQKLSKQNLATPIDTSSKHHCQRLIQHALLLLKQPKV
FT                   EIDTPEMMLKQATQQWQHTPLHNQSRLGHSS"
FT   gene            complement(216759..217193)
FT                   /locus_tag="PsycPRwf_0180"
FT   CDS_pept        complement(216759..217193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0180"
FT                   /product="transcriptional regulator, TraR/DksA family"
FT                   /note="TIGRFAM: RNA polymerase-binding protein DksA; PFAM:
FT                   zinc finger, DksA/TraR C4-type"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93139"
FT                   /db_xref="GOA:A5WBU8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBU8"
FT                   /protein_id="ABQ93139.1"
FT                   /translation="MNQTATDDLTFKPYEAKADEEYMSDAQLEHFENILKTWKAQLVGD
FT                   AESTKTYIQDESASLSDTNDRATQEEEFALALRTRDRERKLIRKIDKSLAEINSGDYGF
FT                   CQTCGVEIGLRRLEARPTATQCIDCKTLAEIKERQNWGHS"
FT   gene            complement(217357..218379)
FT                   /locus_tag="PsycPRwf_0181"
FT   CDS_pept        complement(217357..218379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0181"
FT                   /product="Calcineurin phosphoesterase C-terminal domain
FT                   protein"
FT                   /note="PFAM: metallophosphoesterase; Calcineurin
FT                   phosphoesterase C-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93140"
FT                   /db_xref="GOA:A5WBU9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBU9"
FT                   /protein_id="ABQ93140.1"
FT                   /translation="MAPLPHSVSPRHTQVADNGRLSEPTDYHPPTEISTDDGTVNILQL
FT                   TDLHLYFDTPKATHEQDINKDSAHQTITGICQNNSAKRGNPHSADAINHSVTPVIHNYA
FT                   SFEACLTQALSEDVRCDLIVVTGDLVSEIHPQLYQHLYQRLHQSGIPFACIAGNHDVTD
FT                   EIGKDLPFEQRSFEPHEPDSRLLSRYSMKLNGWEILFINSSVPGQIFGRIGNKNLYWLS
FT                   QKLANSHHPVIIAMHHHLLPMHSAWIDAHITQDATEFWQTVAPFNALKAVVGGHVHQSS
FT                   TRSYQGVQLYSTPSTGYQFKPGCDDFTLDDEAKPGYRWLSLKANGTLQSWVVRLEDNAG
FT                   "
FT   gene            complement(218419..219213)
FT                   /locus_tag="PsycPRwf_0182"
FT   CDS_pept        complement(218419..219213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0182"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93141"
FT                   /db_xref="GOA:A5WBV0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBV0"
FT                   /protein_id="ABQ93141.1"
FT                   /translation="MLTEWLDIIAPAWIAGSLLALLSAPLGCLVLWRRMSFFADALAHG
FT                   TLFGVALAALWHLPFGIGIALVSVLVVVGLLWLEDVRLPNDALLAVVSVTLLCLGLLTL
FT                   TQLTQMQSNVLSYLFGNLLEVSWTDLPLLSACVGVGIVVLAVIWRPQVILATHPDLAQV
FT                   AGIKATRQRLFFMGVLAGFCALALQAVGSLLISGLLILPALTARLFAHSPKQMVIIAVI
FT                   LAQLAVTGGVWGSVLLDIQTGLAIVLGLALAFFAAFVASRAL"
FT   gene            complement(219327..220154)
FT                   /locus_tag="PsycPRwf_0183"
FT   CDS_pept        complement(219327..220154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0183"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93142"
FT                   /db_xref="GOA:A5WBV1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBV1"
FT                   /protein_id="ABQ93142.1"
FT                   /translation="MDNVGFSISGRGLDRQEGVSEPAKGKLSGWLKGARSAKAKSLALA
FT                   DDPAQKVLLSNISLSIERGEKISVIGPNGAGKSTLMKLILGLLTPTSGHIKRHPKLEIG
FT                   YVPQKFSIPAILPLRVQDLLSQTKNRLTAEQQAFLYQRLSVTPLLKKQVIHLSGGETQR
FT                   ILLARSLLSKPDLLILDEPMQGLDPESERWLYEFIDDLPPFLQCAMVVVSHDLHWVMRG
FT                   SRRVICLNKHICCEGQPSDLGVSQEFKKLFGHQYEQPYIHQPHECQHHAPHEH"
FT   gene            complement(220278..220856)
FT                   /locus_tag="PsycPRwf_0184"
FT   CDS_pept        complement(220278..220856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0184"
FT                   /product="putative ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93143"
FT                   /db_xref="GOA:A5WBV2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBV2"
FT                   /protein_id="ABQ93143.1"
FT                   /translation="MSVSSNAPDAVISAPCDHHGPHLHDVHALTQAEIENRLLAAEQLC
FT                   ATKGARFTPLRRTVYQLILQSDKPLGAYDLIQSLQDSRAQDQANKAKMVAPPTIYRTLE
FT                   FLLEFGFIHQLTSLNAFVPCCHPRDEHNAVFLLCNDCQRVQECSGMPVQEISSYVKQQV
FT                   GFEVKQSVMELKGLCHTCSPSLADAVVQG"
FT   gene            221384..222361
FT                   /locus_tag="PsycPRwf_0185"
FT   CDS_pept        221384..222361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0185"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93144"
FT                   /db_xref="GOA:A5WBV3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBV3"
FT                   /protein_id="ABQ93144.1"
FT                   /translation="MFPVQPNTALHSLLSKQSLSVRLKQLARGVGALLLTSAALTTSAN
FT                   AAPSTAAAPIGIDQLPAAIRDNTQIAISNYPLFLLSEAVTKGAPSGKLLLDPGDVGHHG
FT                   SLSPSDMKTVQDSRYVIWFGSQLESNLAKPLAKTHNSISLFGLKAFHREPLRDVKAEPI
FT                   EGTLDPHIWLDPNNAKAITRALGAIYSRANPEYKAIYAANVQRFAQQMDSAVQQAFISS
FT                   KSPRPYWAYHDAFHYIEPALNLRLAGALTSDHHLPPKASQFHWLKQNRPKPTMCMLLQA
FT                   DSNQGVLSKLKPINGTVQQEDMSGATDFISGWQALAKNINTCIG"
FT   sig_peptide     221384..221524
FT                   /locus_tag="PsycPRwf_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 47"
FT   gene            222498..222965
FT                   /locus_tag="PsycPRwf_0186"
FT   CDS_pept        222498..222965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93145"
FT                   /db_xref="GOA:A5WBV4"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBV4"
FT                   /protein_id="ABQ93145.1"
FT                   /translation="MYYRKAMSIQSKAPLRASQRKELQRQKLRRQARLRALVLLVIIGA
FT                   AWIIDFAFFNNTTSNDSAYAFIIAKSVALGALLNWVAQTVFAWFVFRYSGAQARQNIVG
FT                   SLYFGQIVKWVIVIAGFSLIFMTIKSLSAAAIVVGFMTMQIGQFLTLWKIR"
FT   gene            223321..224187
FT                   /locus_tag="PsycPRwf_0187"
FT   CDS_pept        223321..224187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0187"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93146"
FT                   /db_xref="GOA:A5WBV5"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBV5"
FT                   /protein_id="ABQ93146.1"
FT                   /translation="MAAEITSTDYIAHHLTNWTYGYLPGEGWKVAHTAKEAGEMGFMAI
FT                   HLDSMLWSIGLGIVFCALFWLVAKKATAGVPGKLQAAIEMIVEFVDTNVRDSYNGTSKL
FT                   IAPLALTIFVWIFLMNLMDLMPIDYIPVLAQKVGAAMGHDPHHVFFKIVPTTDPNITLG
FT                   MSFSVFALIIYYSIKEKGLGGFVGELTLHPFSAKNPIAKIILIPINFILEFVTLIAKPI
FT                   SLGLRLFGNMYAGELIFVLIALMPFWIQWALSVPWAIFHILIITLQAFVFMMLTIVYLS
FT                   LASQTEH"
FT   gene            224222..224467
FT                   /locus_tag="PsycPRwf_0188"
FT   CDS_pept        224222..224467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0188"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93147"
FT                   /db_xref="GOA:A5WBV6"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBV6"
FT                   /protein_id="ABQ93147.1"
FT                   /translation="MDPVLGGYTVIAVALLIGFGALGTGIGFAILGGKFLEGVARQPEL
FT                   GSQLQTRMFIVAGLLDAVPMIGVGIAMLLLFANPLA"
FT   gene            224572..225042
FT                   /locus_tag="PsycPRwf_0189"
FT   CDS_pept        224572..225042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0189"
FT                   /product="ATP synthase F0 subcomplex B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93148"
FT                   /db_xref="GOA:A5WBV7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBV7"
FT                   /protein_id="ABQ93148.1"
FT                   /translation="MNINLTLIGQSIAFAIFVLFCMKFIWPALMGAISERQQKIADGLN
FT                   AAEKAKADLASAEQSVEQELATAKAKAAALIEQANKSANQLIEEAKAQAQVEGERIRQQ
FT                   ARESIDLEINQARESLRTQVSELAVLGAEQILKEKVDQQTHANMLNELAAKL"
FT   gene            225257..225886
FT                   /locus_tag="PsycPRwf_0190"
FT   CDS_pept        225257..225886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0190"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93149"
FT                   /db_xref="GOA:A5WBV8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBV8"
FT                   /protein_id="ABQ93149.1"
FT                   /translation="MAELSTLARPYAKAAFDYAHENSVIGEWEDFLFIASSVVGDSAFV
FT                   QMLENPAITAEQKADMLVSIYDEQVTSTEETPLKSLLLSTQSHTDEAQSNQALPAATPQ
FT                   IKNFVHQLAEQERLSLIPQVYEQFRLHRAQALKQVNAYVTSAYPLSETQRVMIQKRLEE
FT                   SLKASVIIHEDVDPSLLAGATVKIGDKLVDDSVRGKLKQLKTQLTA"
FT   gene            226051..227595
FT                   /locus_tag="PsycPRwf_0191"
FT   CDS_pept        226051..227595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0191"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="7.1.2.2"
FT                   /note="TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93150"
FT                   /db_xref="GOA:A5WBV9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBV9"
FT                   /protein_id="ABQ93150.1"
FT                   /translation="MQQLNPAEISQLIKQRIQDLDTSATAKNEGTIVKVSDGIVQIHGL
FT                   EDAMYGEMIEFEGDVYGMALNLEQDSVGAVVLGDYLGLQEGQKAYCTGRILEVPVGPEL
FT                   LGRVVDALGNPIDGKGPINAKLTDKVEKIAPGVIARQSVDEPVMTGYKAVDTMIPIGRG
FT                   QRELIIGDRQTGKTAMAIDAIIAQKNSGIKCVYVAIGQKRSTIANVVRKLEETGALAYT
FT                   TVVVASASEPAALQYIAPYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRP
FT                   PGREAYPGDVFYLHSRLLERASRVNAAYVEEFTNGEVKGQTGSLTALPIIETQAGDVSA
FT                   FVPTNVISITDGQIFLESSLFNSGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRTALA
FT                   QYRELAAFAQFASDLDDATKQQLDHGERVTELMKQKQYQPMSIAEQAAVIFASNEGYLS
FT                   AIPVEKIGAWEEAYLRYMYDEQADLMQEINDTANYNDDIAGRLKSSVETFLQNHTF"
FT   gene            227691..228572
FT                   /locus_tag="PsycPRwf_0192"
FT   CDS_pept        227691..228572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0192"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="7.1.2.2"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93151"
FT                   /db_xref="GOA:A5WBW0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBW0"
FT                   /protein_id="ABQ93151.1"
FT                   /translation="MASLKEIRAKVTSIKSTQKITRAMQMVAASKMRRAQERMEVGRPY
FT                   AESMRRVVSHLVNASSDYKHPYMTNRSVNRVGYILVTSDRGLAGGLNINLFKKLMHHVQ
FT                   EFQNQSVEAEFAVIGSKGVSFFKSFGGKVTSAVTDYGDNPTFEQLNAPVQAMLDDYANG
FT                   RLDRIYMVYNKFVNAMTQQPIVTQLVPLPDSAIDSADAGINTELSWDYIYEPDVKTLID
FT                   GLLNRYIESIVYQAVMENIASEQSARMVAMKAATDNAGDLINDLQLVYNKLRQAAITRE
FT                   ISEIVGGAAAVS"
FT   gene            228611..230038
FT                   /locus_tag="PsycPRwf_0193"
FT   CDS_pept        228611..230038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0193"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93152"
FT                   /db_xref="GOA:A5WBW1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBW1"
FT                   /protein_id="ABQ93152.1"
FT                   /translation="MSSGRIVQIIGAVIDVEFNRTDVPQVYDALVVDGTDTTLEVQQQL
FT                   GDGVVRTIAMGSTEGLKRGLPVTNTGAPITVPVGEATLGRIMDVLGRPIDEQGPVNSED
FT                   KWSIHRQAPSYDEQANSTDLLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELIN
FT                   NIALKHSGLSVFAGVGERTREGNDFYHEMQEAGVVDVENFTNSKVAMVYGQMNEPPGNR
FT                   LRVALTGLTMAEYFRDQKDENGKGKDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQP
FT                   TLAEEMGVLQERITSTQTGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASQ
FT                   GIYPAIDPLDSTSRQLDPLVIGEEHYNVARGVQEVLQRYKELKDIIAILGMDELSEDDK
FT                   MVVYRARKIQRFLSQPFHVAEVFTGAPGKYVTLRETISSFRDILDGKYDNLPEQAFYMA
FT                   GGIDEVVAKAEKMKSAA"
FT   gene            230169..230585
FT                   /locus_tag="PsycPRwf_0194"
FT   CDS_pept        230169..230585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0194"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93153"
FT                   /db_xref="GOA:A5WBW2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBW2"
FT                   /protein_id="ABQ93153.1"
FT                   /translation="MATLQCRVVSAREEIYAGEISMLIATGSEGEVGILAGHTPLITLL
FT                   KPGSMRIQTPDGNEEVIYVSGGVLEVQPKLVTVLADTAVRAHDLDEAKIVEARKKAEQM
FT                   LANQTETLQTNAALASLAESVAQLQTIRKYRNRA"
FT   gene            230778..231884
FT                   /locus_tag="PsycPRwf_0195"
FT   CDS_pept        230778..231884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0195"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93154"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBW3"
FT                   /protein_id="ABQ93154.1"
FT                   /translation="MKTLKLRIKDKHANQLNKLAGSINYAWNYVNALSFEHLRRTGKYF
FT                   SAYDLSQYTKGSGEYLGLHSQTLQAINETYAKSRKQFKKAKLNWRTNRPDAKRKSLGWI
FT                   PFKKSAIKYLNTRQTGKKTLKSTIQLSLCKGQKLIIDVFDSYNLSLYQINTLEIVQDSR
FT                   NRWYACITVKDFPRQASGKGSVGIDLGLKESATTSTGDKLQIKQTQKWANKLAVAQRAN
FT                   NKSRVKAIHAKIKNSRLDAIHKFTTQLVKDNALIVVGDVKSRSFTNSMTNLAKSTYDAG
FT                   WFELKRQLEYKCKYAGCQLEIVNESYTTQTCSCCHKISDSSPKGRAGLGIRGWRCAECG
FT                   TWHDRDINAAKNILAVGLDRLAVAIPSV"
FT   gene            232013..232729
FT                   /locus_tag="PsycPRwf_0196"
FT   CDS_pept        232013..232729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0196"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93155"
FT                   /db_xref="GOA:A5WBW4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBW4"
FT                   /protein_id="ABQ93155.1"
FT                   /translation="MSNIEEEQTPRILIVEDDERLAMLTQDYLVKNGMDVAIETDGNRA
FT                   IRRIINEQPDLVVLDVMLPGSDGLTVCREVRPHYHSPILMLTARTEDMDQVLGLEMGAD
FT                   DYVAKPAQPRVLLARIRALLRRSENAPSEEIPQRLEFGELVIDNGGRSVTLNGELVDFT
FT                   SAEYDLLWLLASNAGRILSREDIFERLRGIEYDGQDRSIDVRISRIRPKIGDDPENPKR
FT                   IKTVRSKGYLFVKEGN"
FT   gene            232943..234049
FT                   /locus_tag="PsycPRwf_0197"
FT   CDS_pept        232943..234049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0197"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93156"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBW5"
FT                   /protein_id="ABQ93156.1"
FT                   /translation="MKTLKLRIKDKHANQLNKLAGSVNYAWNYVNALSFVHLRRTGKYF
FT                   SAYDLSQYTKGSGEYLGLHSQTLQAINETHAKSRKQFKKAKLNWRTNRPDAKRKSLGWI
FT                   PFKKSAIKYLNTRQSGKKALKSTIQLSLCKGQKLIIDVFDSYNLSLYQINTLEIVQDSR
FT                   HRWYACITVKDFPRQASCKGSVGIDLGLKQSATTSNGDKLTIKQTQKWANKLAVAQRAN
FT                   NKSRVKAIHAKIKNSRLDAIHKFTTQLVKDNALIVVGDVKSRSFTNSMTNLAKSTYDAG
FT                   WFELKRQLEYKCKYAGCQLEMVNESYTTQTCSHCLKISDSSPKGRAGLGIRGWRCAECG
FT                   TWHDRDINAAKNILAVGLDRLVVGIPSV"
FT   gene            234457..236148
FT                   /locus_tag="PsycPRwf_0198"
FT   CDS_pept        234457..236148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0198"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93157"
FT                   /db_xref="GOA:A5WBW6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBW6"
FT                   /protein_id="ABQ93157.1"
FT                   /translation="MPIFSSLKHSIFLRIYAGLLLVCLFVALFAQLLVDTINNERIQTY
FT                   RENVATGALYLVSSGLKQQASETQREYWLNDISQLFGNNFSIQPESSIDFKASELKRLE
FT                   QQKTVVRYVAQPAYADIFHPIEGEDNVITVRISKVTEQQVRAMAVLLLNDLSYFPDLES
FT                   KRQRLSEISEKFAFPLSIENVDKLELDDDQLRRLDRDEVVILFRDSTRSDDSSIKVIAP
FT                   SELENMALVIGPVSLFKWFPFNLIISVVLISMFLISLGVYALIFPLERKLQLIQSGVNE
FT                   VGDGNLDTRVQVVGQDEIARLAATFNAMTEHIKRLIESQRELTRAVSHELRTPVARIRF
FT                   AVDMLADTEDQESREMQRDYIDEDIESLNGLIDEILTYAKLEEGSPKLDLEPVSLKELV
FT                   DQIVRETNALGKPIEIVGIAPTAKVTAVADRRYLHRVVQNLAGNALRYAESKIVISAGV
FT                   RKGEAFVSVEDDGHGIPEEDRDKVFVPFARLDDSRTRASGGYGLGLSIVSRIAFWFNGT
FT                   MSVDESPKLGGARFTMNWPIKPLTQTISADQLTQEKGARKLIDSDS"
FT   sig_peptide     234457..234549
FT                   /locus_tag="PsycPRwf_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.732 at
FT                   residue 31"
FT   gene            complement(236205..237665)
FT                   /locus_tag="PsycPRwf_0199"
FT   CDS_pept        complement(236205..237665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0199"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93158"
FT                   /db_xref="GOA:A5WBW7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBW7"
FT                   /protein_id="ABQ93158.1"
FT                   /translation="MTHSASRSIRSRFRLKPYSNTWQTTLAVMLVVTVSVAVSIWFFWR
FT                   SLYLPELKNHARYLTTELKLVNATRQDWADNEEVSRWIFAHNHIAVVEDPSQFPDVSDK
FT                   AVVEFFTDVIQQEISQQLGRDSVVYFKFKPTPQLWVQDTASPEFWIREPVIFYAQYSPS
FT                   SLIFFLLGIPLLALVTILLLVRQLNRPLRKLQQAATNYISLGSATTLPTKTGTTEIRRV
FT                   NMAFNRLFTTLNQAQKERTIMLAGISHDLRTPLTRMRLTAEMLPDEFFREGLIYDIEDM
FT                   DAILEQFISFMKDGSDEAVSLTNLDSIFKEVMVQFAPLEFIYQSDGLREVAVRPMSIKR
FT                   LIINLIVNAQRYGKQPIYLTATITPTFNSQQVDPDDETSVSTPGMVRKAKEQLIICVRD
FT                   CGPGVANDQLERIMQPFERGESARTTQGSGLGLAIVQRITGLHHGTVEAINHPEGGLQV
FT                   CVRIPLLSQTQPTDWEPNDEDDVEAYHE"
FT   sig_peptide     complement(237552..237665)
FT                   /locus_tag="PsycPRwf_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.955) with cleavage site probability 0.641 at
FT                   residue 38"
FT   gene            237787..238050
FT                   /locus_tag="PsycPRwf_0200"
FT   CDS_pept        237787..238050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0200"
FT                   /product="SSU ribosomal protein S16P"
FT                   /note="PFAM: ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93159"
FT                   /db_xref="GOA:A5WBW8"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBW8"
FT                   /protein_id="ABQ93159.1"
FT                   /translation="MVVIRLARGGAKKRPFYQVVVADQRRSRDGRYIENLGFYNPLAKG
FT                   QEVELRLDMDAYNAWIEKGAQPSDRVKALAKGYKPTTEEATA"
FT   gene            238140..238670
FT                   /locus_tag="PsycPRwf_0201"
FT   CDS_pept        238140..238670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0201"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93160"
FT                   /db_xref="GOA:A5WBW9"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBW9"
FT                   /protein_id="ABQ93160.1"
FT                   /translation="MTKPNADSLMKIGQLKKPYGIKGWLWVFSETEEREAIFSYSPWWM
FT                   KTATGFKPLTVTQWRRQGTGIVAQFEQVPDRNVAETMNGVSIWIDKDSLPSTEEDEYYW
FT                   SDLVGLSVINKQDECLGTVKELFETGAHPIMKVVPSQDSIDDEPRMIPWHKQTVDVVDL
FT                   AAGRMVVDWERDF"
FT   gene            238761..239522
FT                   /locus_tag="PsycPRwf_0202"
FT   CDS_pept        238761..239522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0202"
FT                   /product="tRNA (Guanine37-N(1)-) methyltransferase"
FT                   /note="TIGRFAM: tRNA (guanine-N1)-methyltransferase; PFAM:
FT                   tRNA (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93161"
FT                   /db_xref="GOA:A5WBX0"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBX0"
FT                   /protein_id="ABQ93161.1"
FT                   /translation="MYFAVITILPEMFTAISEYGITGRAVQNKQVVIDCINPRDFTTDN
FT                   YRRIDERPFGGGPGMVMMAEPLAKAIAYAKSQASLHGCITDSEHCPVVYLSPQGDKLDE
FT                   AAVVSMRHYEAMILLCGRYEGIDERLLARYVDMEISIGDFVLTGGELPAMVLMDSVIRR
FT                   LPDVMGDAKSAEQDSFVEGLLDCPHYTKPHDFEGLQVPEVLLSGHHANIATWRFMQQVE
FT                   RTKQRRPDLWQSFTPNAEQARLLKKVNKTMK"
FT   gene            239796..240212
FT                   /locus_tag="PsycPRwf_0203"
FT   CDS_pept        239796..240212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0203"
FT                   /product="LSU ribosomal protein L19P"
FT                   /note="PFAM: ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93162"
FT                   /db_xref="GOA:A5WBX1"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBX1"
FT                   /protein_id="ABQ93162.1"
FT                   /translation="MSNVHPLVQAVENSQLLERPNFSAGDTVVVQVKVREGDRERLQAF
FT                   EGVVIAKRNRGLNSAFTVRKISSGIGVERAFQLHSPIIHSIEVKRRGAVRRAKLYYLRE
FT                   RSGKSARIREKLSARVQTKTSANVPEAVETAPGI"
FT   gene            240499..242013
FT                   /locus_tag="PsycPRwf_0204"
FT   CDS_pept        240499..242013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93163"
FT                   /db_xref="GOA:A5WBX2"
FT                   /db_xref="InterPro:IPR021794"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBX2"
FT                   /protein_id="ABQ93163.1"
FT                   /translation="MSNDSLPNSGHDSITDEGPVLTGTYEQLHKPSSSFASRDDYLNHE
FT                   LQIMQPKRWKPNLPFRDYRFEFEDTIPALAATIGKVVMVGAIAATFAGALNLGDAFILE
FT                   NVRYELLIVSFFVVLFSGFILPTANLAGTHGPLIPLIPIVVLAGGHPMAFGLLIGLFGI
FT                   LLAISKGGSLLANLTSKGVCGGLLLYLGFIGTTSQVTKLLNWSKDINMPHIAFVVILST
FT                   IVLYAVLENYNKRWLAVPLSCLLGGGVAFLLGAPFAFETAPGMPHMSPMYWWGENTGWM
FT                   LGLPNLESFMVVLPFAVLAVAMWSPDFLGHQVFQKISYPKRTERVVMNIDDTMTSASIR
FT                   QVVGSVLGGANFTSSWGTYIVPAAIAKRPIPAGAILTAVFCVIAAIWGYPMDLAIWEPV
FT                   MCVALIVGVFIPLLEAGMEMTREGKTTQSAAIVVFASALVNPAFGWSLTMLLDNLGLIG
FT                   SKERSAGLSKMSRWIIPAFMFVLLTVVMAMVGMLPGIPALMPSFRH"
FT   gene            242157..244001
FT                   /locus_tag="PsycPRwf_0205"
FT   CDS_pept        242157..244001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0205"
FT                   /product="Excinuclease ABC subunit C"
FT                   /note="TIGRFAM: excinuclease ABC, C subunit; PFAM:
FT                   Excinuclease ABC, C subunit domain protein; excinuclease
FT                   ABC, C subunit domain protein; UvrB/UvrC protein; SMART:
FT                   Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93164"
FT                   /db_xref="GOA:A5WBX3"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBX3"
FT                   /protein_id="ABQ93164.1"
FT                   /translation="MVTPSLTAQADDKQARLKHLIKRLPNLPGVYKMLGKNGDILYVGK
FT                   AKSLKSRVNSYFAKTIDHPKTRALVSRIHDIETIITRSETEALLLEQNLIKEHRPPYNV
FT                   LLRDDKSYLYVFISADQPYPRLAYGRGKAKHQKGKFFGPFPSAHAAKETLVLMQKMFQM
FT                   RQCTNTFFRQRKRPCLEYQIKRCRAPCVGLVSAEEYAADVQNTIRFLKGDSSDIHTTLI
FT                   EKMEHSAEALDFEKAAFYRDQLSMLREVQSRQAVYTVQGEADIISIASQAGMTCVNVLT
FT                   VRGGRVLGGKNYFPDVDSNEPINDNLSAFITSFYFQVTDDLPAEIIISHELPDQMALQE
FT                   ALSTYFEAKTVIKTNVREHRAEWLDLAKLNAHNALKTKLGDYLELHARFAALKEVLEPV
FT                   SQSSIDTIECFDISHTMGEATIASCVVFDQGGARKRDYRQYAIHGVQDGDDYAAMAQAI
FT                   TRRYKKHPLPDVLLIDGGKGQLSMAKNVLTELGLLNDTLLIGVAKGEGRKAGLEVLHFI
FT                   EHEPLDLPMDSKALHLIMNIRDEAHRFAITAHRKKRDKRRSSSVLEAIPGLGEKRRRDL
FT                   LNHFGGLQQLLGASQQELEGVNGIGKVMANTIYKVLHE"
FT   gene            complement(244034..245140)
FT                   /locus_tag="PsycPRwf_0206"
FT   CDS_pept        complement(244034..245140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0206"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93165"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBX4"
FT                   /protein_id="ABQ93165.1"
FT                   /translation="MKTLKLRIKDKHANQLNKLAGSVNYAWNYVNALSFEHLRRTGKYF
FT                   SAYDLSQYTKGSGEYLGLHSQTLQAINETHAKSRKQFKKAKLNWRTNRPDAKRKSLGWI
FT                   PFKKSAIKYLHTRQTGKKALKSTIQLSLCKGQKLIIDVFDSYNLSLYQINTLEIVQDSR
FT                   NRWYACITVKDFPRQASGKGSVGIDLGLKESATTSNGDKLTTKQTQKWANKLAVAQRAN
FT                   NKSRVNAIHAKIKNSRLDAIHKFTTQLVKDNALIVVGDVKSRSFTTKKTKLAKSTYDAG
FT                   WFELKRQLEYKCKHAGCQLEIVNESYTTQTCSYCRQISDSSPKGRAGLGIRGWRCAECG
FT                   TWHDRDINAAKNILAVGLDRLAVGIPSV"
FT   gene            complement(245311..246102)
FT                   /locus_tag="PsycPRwf_0207"
FT   CDS_pept        complement(245311..246102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93166"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBX5"
FT                   /protein_id="ABQ93166.1"
FT                   /translation="MSQVAFSHQFSHRWSNAPQPVKEALFQEFDDIVRLLEAETDLDSF
FT                   EFTVPDLHEHIEAIYAEVEAERAAARLQAEQLEAERLEYEKLEAERLAFEAQAAKQHAL
FT                   SQQQAEQAAEAQIEQDHSADNLAESRLLDTASESSLAADSTADTLDTLSDLDQEALNQS
FT                   NLDQSEIETEAYQQAAEVASPVAADTAATDKGETSKHVTAPDTSTPPAFEFAALKGELD
FT                   EEFIKGLEAHIDDYLSEQLADMSENLKAWLRDQIMYRLSSK"
FT   gene            complement(246171..247502)
FT                   /locus_tag="PsycPRwf_0208"
FT   CDS_pept        complement(246171..247502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0208"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: Beta-ketoacyl synthase-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93167"
FT                   /db_xref="GOA:A5WBX6"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBX6"
FT                   /protein_id="ABQ93167.1"
FT                   /translation="MSLPINNNNPTTKAPHYERSDHQRVVITGMGAITPLALDVDSTWQ
FT                   RLIAGESGIKPITHFDASTYRSQFAGTIEGFDVSQYMAVKEARRYDSFVHYGVAAAGMA
FT                   LKQAGFIDTLSAEPAPVQNVDPDRFGAIIGSGIGGIQIIEDNRDALANQGVRRVSPFCL
FT                   PGTIINMASGMVAIKHNLRGPNLATATACTSASHAIGLAARLIAYGDCDVMLAGGSEKG
FT                   SSPLGMAGFAAMGALSTRNDEPTRASRPFDKDRDGFVLGDGSGVLVLESLAHAKARGAK
FT                   ILAELVGFGMSDDAHHITAPPTDGNGAARSMVMAINDAGIKPCDIGYINAHGTSTPAGD
FT                   IAESQAIETVFEACKDSILVSSTKSMTGHLLGAAGAIEAVFSVKALLEQEVPPTINLDN
FT                   VDEQCRLDYVAHKARSVTDLNYTMSNSFGFGGTNGTLIFGRWSE"
FT   gene            complement(247575..247985)
FT                   /locus_tag="PsycPRwf_0209"
FT   CDS_pept        complement(247575..247985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93168"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBX7"
FT                   /protein_id="ABQ93168.1"
FT                   /translation="MPKLTFNALLASSALLGTLVLTGCASTGNVTPQYIPPSTYQNYDC
FT                   ASLSQEYNRINSYINNEKSSASGITTTGVGVGVSAGRWGISPNINIGLGKSNNNAARDA
FT                   KLSRLYGESDAVVQSARIKNCAFAAKLKVYGE"
FT   sig_peptide     complement(247908..247985)
FT                   /locus_tag="PsycPRwf_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.391 at
FT                   residue 26"
FT   gene            complement(248056..248415)
FT                   /locus_tag="PsycPRwf_0210"
FT   CDS_pept        complement(248056..248415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93169"
FT                   /db_xref="GOA:A5WBX8"
FT                   /db_xref="InterPro:IPR007360"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBX8"
FT                   /protein_id="ABQ93169.1"
FT                   /translation="MKHMHMLMAFITIALFLWQSYLVLAKGERFDKKGKIATHIVYTLL
FT                   IISGAITVMPLLSTGAPLQWVAAKIILLLAAISASIKAFRATATVAQSKAGIFIALVAY
FT                   IGIVTLAFVKPGNFF"
FT   sig_peptide     complement(248338..248415)
FT                   /locus_tag="PsycPRwf_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.899) with cleavage site probability 0.786 at
FT                   residue 26"
FT   gene            complement(248480..248812)
FT                   /locus_tag="PsycPRwf_0211"
FT   CDS_pept        complement(248480..248812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0211"
FT                   /product="transcriptional regulator, BolA protein family"
FT                   /note="PFAM: BolA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93170"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBX9"
FT                   /protein_id="ABQ93170.1"
FT                   /translation="MQVHNQLIERLNALSPTHVDLVNESMNHAGYFEGKESHFKLTIVS
FT                   PDFVSKRAVARHQLIYAQAGELMTSQGGSIHALAIHAYTPEEWDSLLQEQQSVPASPLC
FT                   AGKNKG"
FT   gene            complement(249034..249837)
FT                   /locus_tag="PsycPRwf_0212"
FT   CDS_pept        complement(249034..249837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0212"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93171"
FT                   /db_xref="GOA:A5WBY0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBY0"
FT                   /protein_id="ABQ93171.1"
FT                   /translation="MKNFLIRSTLAASLSVMALTGCSSTTNSGLIGSDRQQLLLVSSDQ
FT                   VLQMSAQSYNQLLQEASKQKVLDTNAAQLARLNSIARKLIPQAEAYRGDAKNWQWEVHT
FT                   INSPELNAFVLPGGKIMFYSGIIDKLKLTDAEIAAIMGHEMAHALREHARERMSSQYAT
FT                   QTGIGLAASIFGLSQGQAELANIAGDLGIARPHSRTQESEADQIGLVLMAKAGYDPNAA
FT                   ISLWKKMQAASQGEPPQFLSTHPSSSSRIATLQALIPQVMPYYKK"
FT   sig_peptide     complement(249751..249837)
FT                   /locus_tag="PsycPRwf_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.528 at
FT                   residue 29"
FT   gene            250123..250198
FT                   /locus_tag="PsycPRwf_R0006"
FT                   /note="tRNA-Gly1"
FT   tRNA            250123..250198
FT                   /locus_tag="PsycPRwf_R0006"
FT                   /product="tRNA-Gly"
FT   gene            250335..250410
FT                   /locus_tag="PsycPRwf_R0007"
FT                   /note="tRNA-Gly2"
FT   tRNA            250335..250410
FT                   /locus_tag="PsycPRwf_R0007"
FT                   /product="tRNA-Gly"
FT   gene            251656..252891
FT                   /locus_tag="PsycPRwf_0213"
FT   CDS_pept        251656..252891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0213"
FT                   /product="trimethylamine-N-oxide reductase c-type
FT                   cytochrome TorC"
FT                   /note="TIGRFAM: trimethylamine-N-oxide reductase c-type
FT                   cytochrome TorC; PFAM: NapC/NirT cytochrome c domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93172"
FT                   /db_xref="GOA:A5WBY1"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR009154"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBY1"
FT                   /protein_id="ABQ93172.1"
FT                   /translation="MNAIKRLFGWLRQLLFKPAAKIGLGVLIIIGFVGGVWFWAGFNSA
FT                   LEATNSEEFCLSCHTMKDNMLPELQKTVHWQNRTGVRAECQDCHVPHQFTDKIARKMQA
FT                   SREVLSHVMGDIGTRDKFLAHRGVLAQREWARFKANNSKECRACHDYDSMDFSKMRVTS
FT                   QMIMRSAAERDASCVDCHKGIAHELPVMEGMHNPAFDSLVSEAGSTKINVGETYYNIVP
FT                   QPLYLDAEKTKQAGTIEVAAPAKVIAHEKGMTQIELDMWRKNKGFGRVWYTHFGLNIVD
FT                   AVIEKDLSRDESIVKVKESKEDPLTGLEWQKVSGTFWVEDGLLMKSLEPAWDIAGQTYA
FT                   ENCSVCHRQPNPASHDANQWPGLWSGMVGFTNLDADTGGLVLKYLQLNSSDFAGAKNAP
FT                   GSPENTPQMARP"
FT   gene            252948..255470
FT                   /locus_tag="PsycPRwf_0214"
FT   CDS_pept        252948..255470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0214"
FT                   /product="trimethylamine-N-oxide reductase TorA"
FT                   /note="TIGRFAM: trimethylamine-N-oxide reductase TorA;
FT                   PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93173"
FT                   /db_xref="GOA:A5WBY2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR011887"
FT                   /db_xref="InterPro:IPR041460"
FT                   /db_xref="InterPro:IPR041954"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBY2"
FT                   /protein_id="ABQ93173.1"
FT                   /translation="MKNINRRGFLKSLAALSGTALLPTPLLADDSVLTSATGDKPQDFS
FT                   GWKMSGAHWGAFRARVEADKLVEIKPFEFDQYPTKILDGVPGIIYSPSRVRYPMIRVDW
FT                   YKNRQNSDTSQRGDNRFVRVSWDEALDILYQELERIQKDYGPWALHTANVGWRSVGNVH
FT                   SCGNHMLRAIAMHGHSVGTAGDYSTGAGQMILPYILGSTEVYSQGTSWPLILENAKVII
FT                   FWANDPIKNLQVGWNTETHEAYEYYEILRDKVRNKEIEVICIDPVKSKTQNYLECEHQF
FT                   VNPMTDVAFMLGLAHTLYTEKLYDKKFIDMYALGLEEFTPYLMGKTEDKVEKTPEWAEK
FT                   ICGVKADRIRELARKMAKNRTQLCFGWAIQRQQHGEQPYWMGAIIAAMLGQIGLPGGGI
FT                   SYSHHYSSVGVPTSGASMPGAFPLNLDTGRKPKYDNNNYNGYSSVIPVARMVDCLLEPG
FT                   KKINFNGHEVTLPPLKMGIFTGSNQWHRHQDRNRMKKGYRNMETVVSVDYNWTATCRFA
FT                   DIVLPACTPYERNDIDAYGSYSNRGVIAMHKLVDPLYHSKSDFEIWYEFTKRMGRELEY
FT                   SRAMNEIQWIEQIYEDCRAENLKKDFFMPEFKEFWEKGYVLFPEGENWVRHADFREDPE
FT                   VNALGTPSGFIEISSRKIASYGYADCKGHPIWMEKAERSHGGPGSDKYPLWLQSVHPDT
FT                   RLHSQTCESEERRVTYTVQDREPCYIGPEDARARGISDGDLVRVFNDRGQLLAGAVISD
FT                   NFPPGVIRIQEGAWYGPTGPEIGALDTYGDPNTLTLDIGTSMLAQGPSANTCLVEIEKF
FT                   VGKAPAVTSFGGPTYVNPDGTPAAEDKG"
FT   sig_peptide     252948..253034
FT                   /locus_tag="PsycPRwf_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            255591..256256
FT                   /locus_tag="PsycPRwf_0215"
FT   CDS_pept        255591..256256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0215"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93174"
FT                   /db_xref="GOA:A5WBY3"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR023069"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WBY3"
FT                   /protein_id="ABQ93174.1"
FT                   /translation="MNNSQQWQAANTARAALYRWFAELFARELTKTNLTQLQAQYPSLH
FT                   AAFSDLNLEPQSAALQTALENLQVIPAPDRALELAADFAHLFLLSGHQSAPPYASYYLE
FT                   SDQMLYGKPAQQMSEFLASHKLDLHPEFREPKDHLSIYLQVMSLWIKSSVDEQANLIEM
FT                   AVQQQHFLEDALLSWLPKFAARCQHIRVKTQVYPAIIDLLLHFVQEDRQALEDMAEAE"
FT   gene            256323..257633
FT                   /locus_tag="PsycPRwf_0216"
FT   CDS_pept        256323..257633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0216"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; MoeA domain protein, domain I
FT                   and II; MoeA domain protein, domain IV"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93175"
FT                   /db_xref="GOA:A5WBY4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBY4"
FT                   /protein_id="ABQ93175.1"
FT                   /translation="MITVAELQAAITERINSYNQTDSSLTQRTTERRDLLASQHHILAT
FT                   DIISPFDVPRQNLSAMDGYALAGGSTLDAGSYIEIVGESQAGAPFSGSSVTGEAQLQPG
FT                   QGVRIFTGAVVPSDCDTVVMQENTNFAAIKDGIDKSQSYQIQLTKTAVAGNNIRRQGEE
FT                   IESGEVVLHAGKRLNPADISLLANLGVAQVEVYQPLTVGILATGDELVAVGEPLQSLAQ
FT                   IYNSNTPTLKSMLAHLPIQIHDYGIIPDDLERTKQAVLTAMQECDVVISTAGVSVGDYD
FT                   FLTTVIEDLGQINHYKVAMKPGKPFVFGELNKDLSVPVLYFGLPGNPLSSVVGSLQFII
FT                   PALWRLSGIDVADMPLPLTVTATLSSDVKKSPGRADFQRGIVSQNEAGEYVVTPAGKQD
FT                   SHRIKQLSHANCLIVLPQQSGSMSAGEQVTVQLFPWS"
FT   gene            257966..259279
FT                   /locus_tag="PsycPRwf_0217"
FT   CDS_pept        257966..259279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0217"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein A;
FT                   PFAM: Radical SAM domain protein; molybdenum cofactor
FT                   synthesis domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93176"
FT                   /db_xref="GOA:A5WBY5"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBY5"
FT                   /protein_id="ABQ93176.1"
FT                   /translation="MTTVPHMTLLNSNLRKARLYTPSPNSVMFDGHVPLSSAHALLHPT
FT                   VNSINAFTHSAIPSVASASFSWPKATKPADFMSPFTQLARSTLTTLRSTKGSAAASVSS
FT                   HVPQTNDTDALLTDGFSRRLTYLRLSITDFCNFRCGYCLPNGYQGKRPDNELTLQEIEV
FT                   LIKAFAQVGTKKVRLTGGEPSIRKDVTQIIEQVKATPGIQTVAMTSNGYKLGKHVANWQ
FT                   QAGLDQLNISVDSFDPATFKQMTGFDMLPQLLQDMDTLLETTDIKLKLNGILMEETAYD
FT                   SLLAALHYVKTRPVTYRFIEFMQTTDNSDLFFAQHAQSALITDYLLSHGWQAQDRGQND
FT                   GPAMEYTHPDYVGRIGMIAPYAAHFCDSCNRLRVSSLGKVHLCLFDQGNYDIRQYLQQQ
FT                   DVAGLVQKLHEFMPIKPEHHHLAESNSGIMHNLSMIGG"
FT   gene            259365..259892
FT                   /locus_tag="PsycPRwf_0218"
FT   CDS_pept        259365..259892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0218"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain;
FT                   molybdenum cofactor biosynthesis protein B; PFAM:
FT                   molybdopterin binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93177"
FT                   /db_xref="GOA:A5WBY6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBY6"
FT                   /protein_id="ABQ93177.1"
FT                   /translation="MSKEKVFTPLNVAVLTVSDSRTLEQDTSGQYLVDSLQEAGHNLAD
FT                   RQLITDDIYKIRAVISGWIADPEVHAVMTTGGTGFYIRDSMPEAVSVLFDKKIDGFGEM
FT                   FRLISKDEIGMSTVQSRAIAGMANNTVIFCLPGSSGACRTGWTKIIKDQLDSRTGPCNF
FT                   VPHLMRVNPGHD"
FT   gene            259897..260715
FT                   /locus_tag="PsycPRwf_0219"
FT   CDS_pept        259897..260715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0219"
FT                   /product="molybdenum cofactor guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93178"
FT                   /db_xref="GOA:A5WBY7"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBY7"
FT                   /protein_id="ABQ93178.1"
FT                   /translation="MTDALLRRLDAEPLAGVVILAGGLSTRMGSPKALLKLPCGDTLLQ
FT                   YHVRSASQLGVPVLIADNGQGFATHIQAEHNIFAEHSMVNTEGGNTAGSIRHIADYQPC
FT                   SRSLQAKAKANANEKHSAGPLGAILAGMQQLLQDNQTDSRFADIGSHSDAGSQWMLVVS
FT                   CDSLVNGVDIWQYLTEKKAQSVSSSVDAVNEDNAQPQMYCLADNERDYPLLGLYQLSLV
FT                   SSLKSYLDSGERRVMRFIHPISQSLPMPQAWYTRSNLNTPQQFQLACEQL"
FT   gene            260928..261494
FT                   /locus_tag="PsycPRwf_0220"
FT   CDS_pept        260928..261494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0220"
FT                   /product="GTP cyclohydrolase subunit MoaC"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93179"
FT                   /db_xref="GOA:A5WBY8"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBY8"
FT                   /protein_id="ABQ93179.1"
FT                   /translation="MSLSNSESNSELTSEQSTPDLASNSVQTHAHKLSHLDADGDIHMV
FT                   DVGHKTVTTREAVAQGYVVFPQDIYSQIKAADGMTKKGSITQTAHIAGIMAAKRTHDLI
FT                   PLCHPLPLDKVGLSFSYEDEACAIKVTSTVRVTHKTGVEMEALTAVSVACLTIYDMTKA
FT                   LSHDIIIDDMRLVTKTGGKSDYQKA"
FT   gene            261699..261941
FT                   /locus_tag="PsycPRwf_0221"
FT   CDS_pept        261699..261941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0221"
FT                   /product="molybdopterin synthase subunit MoaD"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93180"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBY9"
FT                   /protein_id="ABQ93180.1"
FT                   /translation="MNITVLFFASLAEKAQQGQQQLSVEGKLSLPELYAKLTQDHGFTL
FT                   EPAKVRVAINDEFASWDDVINDGDTIAFIPPVAGG"
FT   gene            261973..262488
FT                   /locus_tag="PsycPRwf_0222"
FT   CDS_pept        261973..262488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0222"
FT                   /product="molybdopterin synthase subunit MoaE"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93181"
FT                   /db_xref="GOA:A5WBZ0"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBZ0"
FT                   /protein_id="ABQ93181.1"
FT                   /translation="MDSQSALDTANQPHQQASSISHSVDEVYQLAQSQGFALLDEAIDA
FT                   ERLKDMLQDDQCGALATFEGWVRNHNNDSQVTRLTYYGYEKLAINQGKLIIEEAKRLFD
FT                   IENAVAIHRIGALEIGDMAVWVGVSSKHRYPAFDACKWILDTIKADIPVWKQEYYQDES
FT                   SKWLSNNG"
FT   gene            complement(262616..263374)
FT                   /locus_tag="PsycPRwf_0223"
FT   CDS_pept        complement(262616..263374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0223"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93182"
FT                   /db_xref="GOA:A5WBZ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBZ1"
FT                   /protein_id="ABQ93182.1"
FT                   /translation="MSPLSPQLSDMLLPLWLSLKLAAITTLCLLLFATPLAYWLAKPSS
FT                   SNLIARVKIMLMGIIAMPLVLPPTVLGFYLLLLLSPNFALGKWLMAHDIGALAFTFKGL
FT                   VVSSIIYSLPFYMQPVYAQFLRIPKSVSDMALLLEPSRLRRFTAVSLPQAKTGIILGGL
FT                   ISFAHTIGEFGVVLMIGGSIAGETKVISIAIYEQVEALNYDMAHTMSLLLVLLGIILVG
FT                   LIASINRQVNEGSLTTTSHSPPKPKSKPKR"
FT   sig_peptide     complement(263261..263374)
FT                   /locus_tag="PsycPRwf_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.807) with cleavage site probability 0.676 at
FT                   residue 38"
FT   gene            complement(263587..264513)
FT                   /locus_tag="PsycPRwf_0224"
FT   CDS_pept        complement(263587..264513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0224"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93183"
FT                   /db_xref="GOA:A5WBZ2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBZ2"
FT                   /protein_id="ABQ93183.1"
FT                   /translation="MKMSLKLIATLPALLLLASCSGTNSPEKTDAAPQADSNTHKAQSS
FT                   EVMRIAAAANLAGVLPAVIDAYQSEEAHSPDTASTPKPKIEVTYASSGKLFAQINSGAP
FT                   YDLFLSADQDFPAKYAQQQAAANVTVQPPFTYARGQLALYSSNQDVSTVKTLDTASLQQ
FT                   LLITQPNQSKKPIKITLANPELAPYGASAKAFLQQQGIYDSLNGNKTIIQAENIGQAFQ
FT                   YAHTASTDYGFVALSQLISAKVDPSNYLILQPGSYPAILQDGIVVSDSAAAIDFSHYLQ
FT                   SKPAQKLFADAGYLPVNAGHTASGSAK"
FT   sig_peptide     complement(264442..264513)
FT                   /locus_tag="PsycPRwf_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.240 at
FT                   residue 24"
FT   gene            complement(264720..265916)
FT                   /locus_tag="PsycPRwf_0225"
FT   CDS_pept        complement(264720..265916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0225"
FT                   /product="aromatic amino acid aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.57"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93184"
FT                   /db_xref="GOA:A5WBZ3"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBZ3"
FT                   /protein_id="ABQ93184.1"
FT                   /translation="MFERVDFYAGDPILGLMVEYANDSNPNKVNLGVGVYYDENNVLPV
FT                   LECVKTAEQRIADPISARPYLPMEGLPGHRKACQDLLFGKDAQVLQDKRVATIATIGGS
FT                   GALKVGADFINAWFPQAKCYVSDPTWGNHISIFEGSGIEVGKYPYYDKATGTVKFDELI
FT                   AFFNTLNKDDVVLLHPCCHNPTGVDLTQAQWDELLQVVQQRELIPFMDIAYQGFGEDMD
FT                   SDAYAIRKAVDMDLPLFVSNSFSKNLSLYGERVGGLSVVCPTEEEAERVFGQLKFTVRR
FT                   IYSSPPSHGGRVVDIVMNDEALHKQWVDEVYGMRDRIKAMRLKLKSVLETKVPGRNFDY
FT                   LTTQNGMFSFTGLTPEQVECLKTEFGIYMVSNSRMCVAGLNGNNIDYVANAMAEVLKD"
FT   gene            266107..267591
FT                   /locus_tag="PsycPRwf_0226"
FT   CDS_pept        266107..267591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0226"
FT                   /product="transporter, NhaC family"
FT                   /note="PFAM: Na+/H+ antiporter NhaC; TC 2.A.35"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93185"
FT                   /db_xref="GOA:A5WBZ4"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBZ4"
FT                   /protein_id="ABQ93185.1"
FT                   /translation="MSSNTPAQPDHTDSTHHAQSTPNPAFTQLSSHSPQPEPQLSPIQA
FT                   FVMAGCVVLIMGVTMIGFGWVPHLSLLLAICFLLLMGRLRGLSFTHLQSAMTDGVVSGS
FT                   GAIYLFFFIGLMVAALMMSGAIPTLMYFGFELISPRFYYISAFVLTSIIGIALGSSLTT
FT                   VATLGVAFIGMSNAFDANVAIAAGAVVSGAFFGDKMSPLSDTGTIASSVVGIDLFEHLR
FT                   NMMYTTVPAWIISVLLFWMLTGPMQIANLGQVTVLQNQLVASGLVHSYAVLPFVVLIVL
FT                   AMFRVNAIYTIICTIISALMITYIHSSPSIEQLGGYLFAGYAPASNLELGEVGSMLTRG
FT                   GIQSMFFTQTIVILALSLGGLLKKLGILPALLAGVRDKLTTAGQAIFAAAMSALSINVL
FT                   IGEQYLSILLSGTAFRPTFERLSLHPKNLSRTIEDAGTVINPLVPWSVCGVFISQALEV
FT                   PVLEYLPYAFFCYLSLLLTILFGFSGVTISRLDKQA"
FT   gene            267648..268703
FT                   /locus_tag="PsycPRwf_0227"
FT   CDS_pept        267648..268703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0227"
FT                   /product="UDP-galactose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; Male sterility C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93186"
FT                   /db_xref="GOA:A5WBZ5"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBZ5"
FT                   /protein_id="ABQ93186.1"
FT                   /translation="MMSNKILVTGGVGYIGSHTCIELIAAGYEVVVYDNLSNSNLEALK
FT                   RTEQIAGKEIAFIEGDVLDSKLLNQVFDEHDFFGVIHFAGLKAVGESVAQPLRYYKNNV
FT                   TGTLVLLEVMQAHNVKNFVFSSSATVYGDPETLPIPETAPRSCTNPYGQSKLTVEHILQ
FT                   DLAQADPSWSITCLRYFNPVGAHSSGSIGEDPNGIPNNLMPYISQVAVGKLKQLSVFGS
FT                   DYYTVDGTGVRDFIHVVDLAKGHVAALDYITYNQSQQSQQASKAGLGFEAINLGTGNGS
FT                   SVLQLVEAFEKVTGQKVPYQLVDRRPGDIAACYASADKAKHLLGWQAELTIEDMCKDSW
FT                   RWQSQNPGGYK"
FT   gene            complement(268787..270280)
FT                   /locus_tag="PsycPRwf_0228"
FT   CDS_pept        complement(268787..270280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93187"
FT                   /db_xref="InterPro:IPR026950"
FT                   /db_xref="InterPro:IPR038636"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBZ6"
FT                   /protein_id="ABQ93187.1"
FT                   /translation="MKSSSSLFRLTQLSSLLLTTGLLSSVAAAQNLQLNDMSLKSELDW
FT                   LRAQGVIQISTSTWPLTANEINRALSNADIRTTEQQQIVQSIRYTLGKEPKSLVNTKVS
FT                   AYAQTDREQLPQSFADDKTANFQASAQASLSEEDWDVNLRANVKDKDMIDDEDLSFEGS
FT                   YLAGKYANQWLIAGQIPTWWGPGHDGSLIRGDASKPVVGVTMQRDIQAAPSYRYLNWIG
FT                   PWQYQLFAGQLDDYKAVPDTKLIGMRLTASPTEWLEVGASRTFMWGGDGRPESASSFWD
FT                   ALKGNKDNGGRDGGDPANQLAGFDARVNLAPLVNVPVSVYGQYIGEDEAGGLPAKNMYL
FT                   AGADFASSINTPAMGTMPYQLYTEWTDTRTSGDVRGISYDHSNYTDGYYQHGYPLGYAL
FT                   GGDAESIAVGGKLWLNNQNFINAKLQHAKVNQSGKLDARTGLSDNRAFPESDKLTVLDV
FT                   SWEHQLNPKTTISSRAWVSDSDIHSTDVGGGIGVEFANF"
FT   sig_peptide     complement(270191..270280)
FT                   /locus_tag="PsycPRwf_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.936 at
FT                   residue 30"
FT   gene            complement(270520..272040)
FT                   /locus_tag="PsycPRwf_0229"
FT   CDS_pept        complement(270520..272040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0229"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; sugar transferase;
FT                   polysaccharide biosynthesis protein CapD;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93188"
FT                   /db_xref="GOA:A5WBZ7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBZ7"
FT                   /protein_id="ABQ93188.1"
FT                   /translation="MNILVTGANGFIGEALVSSLLQTSYKPIACVRWSVKPVLDCEYRF
FT                   IDKLDSTTDWHDALKDIDVVIHCAAKASITKQEANNPAYSLKEVNTLATLNLAQQAVEA
FT                   GVKRFIFLSSIKVNGEYSLPNQPFTPEVTQSPTDPYGLSKYEAEIGLQKIADNSNMDYV
FT                   IVRPTLVYGNKVKGNFRSLIKWTYKGIPLPLAGIKNNLRSLVSVENLTDFIISSIDNPN
FT                   AKNDVFLVSDGTDLSTAALLNNIAIGLGVKNRALPIPPLLIKTGARLVGKEHIAQRLCG
FT                   SLQVDISKTENTLNWQPKVSTEEAVQRTAKYYVSSFSNLKKNSWQRPLDIAFSAAGLVA
FT                   TSPLLIGTTIVGYFDTGSPLFIQERVGKDKKPFKLVKFRTMSLDTASVASHLADNSSIT
FT                   KLGRILRKTKLDELPQLINVLKGEMSLVGPRPNLFNQEELIEARSQQGVYDVLPGITGL
FT                   AQLSGIDMSTPDLLAKTDKEMIDSLTLQKYFSYIIRTALGKGSGDAVK"
FT   gene            complement(272116..273240)
FT                   /locus_tag="PsycPRwf_0230"
FT   CDS_pept        complement(272116..273240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0230"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93189"
FT                   /db_xref="GOA:A5WBZ8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBZ8"
FT                   /protein_id="ABQ93189.1"
FT                   /translation="MKIIIIGTVAASFYGFRAELIRTLIKNRHQVYAYTTDYREEDLVK
FT                   IKQLGANPIPYKLSRGGLNPFKDIYSTLLLAKSIKTIEPDVVFSYFSKPVIFGTLAAKL
FT                   AKTPKVIGMLEGLGYVFTDQPQGIDIKTSIIKKLQVTLYRISLPRLDTFILLNHDDPID
FT                   LLDKYNIKINNIEVLGGIGLDLKKYPLTPIPKLPVNFIFIARLLKEKGIFEFIEAAKKV
FT                   KQQYPSTKFTVLGAIDWENPGALKQYELDKLIELNLVEYPGHVDNIQSWIASSHVFVLP
FT                   SYREGLPRSTQEAMAMGRPVITTDVPGCRETAVNGLNGFIVERWNSKALEEKMIYFIEN
FT                   PDQIEKMGLESYKMAQKKFDAEKTNQKLLKILGL"
FT   gene            complement(273465..274601)
FT                   /locus_tag="PsycPRwf_0231"
FT   CDS_pept        complement(273465..274601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0231"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93190"
FT                   /db_xref="GOA:A5WBZ9"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5WBZ9"
FT                   /protein_id="ABQ93190.1"
FT                   /translation="MKTKIVHIIIGLNVGGAELVLRRLVLSSQSRKNFQHEVISLTDKG
FT                   IIGAELEAANIPVHTIHMHGLSSTLTSYLKLRNLLKRINPDIVQTWMYHADFLGGIAAK
FT                   SIGVDKIIWGIRNSNVSTGMSKTTYYLSHICAKISGYIPSDIVAVSHTARDYHTAIGYD
FT                   SNKMIVIPNGFDLEKFSIDTQKRFQMRLELDIKEDQLVIGNIGRFNPVKNQLNFIKACI
FT                   TLFDEGYTFIALLAGRNVDLRNPKIYNLLNGSKYTKNFIFLGEIEDTTKFYNAIDIFCL
FT                   CSTTEGFPNVLGEAMSTERVCLSTKAGDAELILGNKSLLIHSTDCGGIASTLEQVVFKN
FT                   PNNFDFNVLGMKARERIESNYSISKIVSDFESLYLEDI"
FT   gene            complement(274836..275569)
FT                   /pseudo
FT                   /locus_tag="PsycPRwf_0232"
FT   gene            complement(275575..275700)
FT                   /locus_tag="PsycPRwf_0233"
FT   CDS_pept        complement(275575..275700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93191"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC00"
FT                   /protein_id="ABQ93191.1"
FT                   /translation="MAVSLITRLKDLEAENSHLEKMYAEESLKSDVLEDAMSRNW"
FT   gene            complement(275990..276577)
FT                   /locus_tag="PsycPRwf_0234"
FT   CDS_pept        complement(275990..276577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0234"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93192"
FT                   /db_xref="GOA:A5WC01"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC01"
FT                   /protein_id="ABQ93192.1"
FT                   /translation="MILKALIRQVFTQSGGSAGARTVSAIVTMQQGIKLTRYRAGKLMK
FT                   QMGLVSRQIKSHKYKHSDIAHKVHGNVLDRQFAPTAPNQVWTGDVTYIRIKGGWCYLAV
FT                   VMDLYARRIVGFKLSDSPNTELTTSALQMAYHTRLEPKGVLFHSDQGSHYTSESYAKCV
FT                   AQCNGMTHSMSRKGNCWDNAPTERFFRSFKTE"
FT   gene            complement(276694..277005)
FT                   /locus_tag="PsycPRwf_0235"
FT   CDS_pept        complement(276694..277005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0235"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93193"
FT                   /db_xref="GOA:A5WC02"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC02"
FT                   /protein_id="ABQ93193.1"
FT                   /translation="MTTKRGCYSTEFKLEAIQLVEEQGRKIPEVASSLGIGKTTLENWV
FT                   YKYRKEQQGIMPSEGKALTPELRRIQELEKQVKQLKMERDILKKASALLAQDNLNVYR"
FT   gene            complement(277178..278323)
FT                   /locus_tag="PsycPRwf_0236"
FT   CDS_pept        complement(277178..278323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93194"
FT                   /db_xref="GOA:A5WC03"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC03"
FT                   /protein_id="ABQ93194.1"
FT                   /translation="MSELDWTYNYGFLGIRLFDLPSFLICNLLIIFLGYRYKAPHNYQI
FT                   ILFLHCLLPFVLNYVLFDPYYMPDQFSYLEGVYAIRSGNIGLIEALIDPGNVLQASAML
FT                   AAIPLPMPVSVISIGFYNTFLYIVLFFILYAKKIFTKFSIWFYLLFPSAALYSALSLRE
FT                   TLIFFFMVLTIVYARESKLFRSALCLVPLYLIKFQNFFMLAPIVGLYLLFKVQKNGMSL
FT                   GKSLVIGLISIASLIAAAPLAIPMINKFRVAMYVEDGGYASEIALISGISDFIIQGISS
FT                   GVYFLSKPFFWEARGILPLIQSIENFIILILLFLLTYKAWKLKSDRLAFWLLFLAFSMS
FT                   VYGLVVFNYGTAVRYRYPFLIVYVLFVCLDCNIQNLRSKNR"
FT   gene            complement(278402..278605)
FT                   /pseudo
FT                   /locus_tag="PsycPRwf_0237"
FT   gene            complement(278722..279544)
FT                   /pseudo
FT                   /locus_tag="PsycPRwf_0238"
FT                   /note="Integrase, catalytic region"
FT   gene            complement(279538..279804)
FT                   /locus_tag="PsycPRwf_0240"
FT   CDS_pept        complement(279538..279804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0240"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93195"
FT                   /db_xref="GOA:A5WC04"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC04"
FT                   /protein_id="ABQ93195.1"
FT                   /translation="MKKSRLTDTQIVNILKQAEQGVPVSDILREHNISQSTFYKWRSKY
FT                   GGMDASLITRLKELESENARLKKMYAKERLKSDILQDAISKKW"
FT   gene            complement(279954..281918)
FT                   /locus_tag="PsycPRwf_0241"
FT   CDS_pept        complement(279954..281918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0241"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: glutamine amidotransferase,
FT                   class-II; asparagine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93196"
FT                   /db_xref="GOA:A5WC05"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC05"
FT                   /protein_id="ABQ93196.1"
FT                   /translation="MCGLTGFMKGTSFSPEMPFRILKKMTDSIDHRGPDSEGHWIDEDN
FT                   KIAIGHRRLSILDLSDAGHQPMLSDDNRYVIAFNGELYNHLEIRSEIESKFSEIYWNGH
FT                   SDTETLLKSIEVFGWEGTLKKLIGMFAITLWDKKEKALYLARDRFGEKPLYYGWQGDTF
FT                   LFGSELKPLTLHPVFEKELNKGTIGLLLKHGYIPAPYSIWNNIFKLPAAHYLIITEEDT
FT                   NPKPICYWSFKDLVEKANSNKLEIDDNKAIKNLEDILTQSIKRQMISDVPLGALLSGGI
FT                   DSSLVAALMQDISDTPIKTFSIGFEDPNFDESKHAEAVADYLGTDHTTLIMKPDDLLDL
FT                   VPEIAKIYDEPFADSSQLPTTIVSRLAKQHVTVALSGDAGDETFGGYSRYYLIQKLWKS
FT                   LDKLPHPLRNKLSTLLTTVTPEQSNLLLGWLFSRVNQESLADKLYKLGERLENVDSFES
FT                   LYLAYVSEINNPTQLIKGLNSLPQYLLGNIDEWPELNHPIEKLMALDTLTYLTDDILVK
FT                   VDRAAMSASLELRAPFLDHNLVEYAWQLPFEFKYRDGQTKWILRQVLYKHVPKELIERP
FT                   KQGFGIPLNDWLRGPLKDWAEKLLSVQFLEEQNIFYTDEIRDMWRHHLSGTRHYGARLW
FT                   SILMFQAWYKENFYNLEIN"
FT   gene            complement(281928..282974)
FT                   /locus_tag="PsycPRwf_0242"
FT   CDS_pept        complement(281928..282974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0242"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93197"
FT                   /db_xref="GOA:A5WC06"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC06"
FT                   /protein_id="ABQ93197.1"
FT                   /translation="MLMGNKSLTFIFLSTREAGGMERRYLNLFFYLLDQGLDVDIICTR
FT                   EFYHGFSERGVLIPKDRIQFYDYDGSQNRFFRGLRRVISFPCLIYKAHNSSRLFFVINP
FT                   GIILYSISLFSRALPSYGFTMANSILKDYNPKYLPRIVRCSSKVDCLSEDIIDYASKYI
FT                   ESNDKKKLRLSPCSFINYDLIEQTTERDIDVAFVGRFVEGKGLELLERIDSKLEDINIH
FT                   ICGFGNFNPHIDHANIYKIDNAFSTLARSKIFLSIQQYENYPSQSLLEAMASGCAIIAT
FT                   DVGLTRKILDESCCIFINYDSDELIHAINYLLSNPDLIKDLGSNAKKKAMSEHNISIYA
FT                   NYFINEFM"
FT   gene            complement(283023..284441)
FT                   /locus_tag="PsycPRwf_0243"
FT   CDS_pept        complement(283023..284441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0243"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93198"
FT                   /db_xref="GOA:A5WC07"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC07"
FT                   /protein_id="ABQ93198.1"
FT                   /translation="MAMNKKTILNYAIGPIGSGILGLVSLPIITWFFSVEDVGRISMLQ
FT                   VVVSFSVLLFCLGLDQAYVREYHEAEATPELLKLTLLPGLILTLAAYSLIFIINPTLVS
FT                   HWLYEIPSVYLSFISITCLAISIISRFLSLVLRMQERALAYSMSQLLPKVIFLIFVIST
FT                   VWLGFKKDIYTLVTAHFLSILSVFILFSWNTRKEWLGSFEYKFNWIRFKPLLLYGLPLV
FT                   IGGLASWGLNVMDRLFLRSLSTFTELGIYSVTMSIAAVATVFSGIFNTIWAPLVYKWVK
FT                   ADDVNLNKMDEISEHLLAAIYFIVVLSGLFSWILPFFLPKEYAAIRYLITLCLLAPLFY
FT                   TLSETTAVGITIARKTSYSMLASILAMLTNALGNYLLVPKMGALGAAISTAISFWLFYI
FT                   LRTELSCRVWRQIPKFKSYLIVSFLLITTAFSSMLMSKYPILITTWFFALIIGIYIFNP
FT                   SIKLAFQQINKIRV"
FT   gene            complement(284432..285613)
FT                   /locus_tag="PsycPRwf_0244"
FT   CDS_pept        complement(284432..285613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0244"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93199"
FT                   /db_xref="GOA:A5WC08"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC08"
FT                   /protein_id="ABQ93199.1"
FT                   /translation="MSNNDCNLHILIIPSWYPAFEGDIGGSFFREQAHALKKAGNKVGV
FT                   IYPQFRSITDIKGIYSKPYGIEYIDDQGLPTYKYHHLAVPKIYSVRRARWIRYGLKLFD
FT                   EYTKKFGLPDIIHVHSSVHAGHIALEIKSRYSIPYVVTEHSTSFARDMIKKNELLILRN
FT                   IVTSSDYNIAVSQPFCDLLNRTFKVKSWNYIPNIVNSAFLNEDNKVSKKTFKYLSVSFL
FT                   SEKKAIDNLIKAFSFIIDEVPNAVLYIGGDGDERKSLEKLAKDLNLKNRVIFLGSLSRE
FT                   RVKLEMAKSSVFVLPSRYETFGVVLVEALALGKPVIATKCGGPESIVNDKVGTLVEVDN
FT                   IENLSKAMLDAYLDYDKYNSKDIRQYCIDNFSEESVISKLTDIYHSVLAGSWQ"
FT   gene            complement(285617..286690)
FT                   /locus_tag="PsycPRwf_0245"
FT   CDS_pept        complement(285617..286690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0245"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: aminotransferase, class V; Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent enzymes; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93200"
FT                   /db_xref="GOA:A5WC09"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC09"
FT                   /protein_id="ABQ93200.1"
FT                   /translation="MQFIDLAAQQERIKDKLQANIQKVLAHGKYILGPEVHELEEKLAE
FT                   YTGAKYCITCANGTDALQIALMSLGIGPGDEVITPGFTYIATAETVALLGATPVYIDID
FT                   AKTYNLDPSLLEAAITSRTKAIIPVSLYGQCADFDTINQIAEKHNLPVIEDAAQSFGAT
FT                   YKGKKSCNLSTIACTSFFPSKPLGCYGDGGAIFTNDEELATVIRQIARHGQDRRYHHIR
FT                   IGVNSRLDTLQAAILLPKLEILDDEMQARRQVAATYTKLLNEAGITTTPMIESHNQSAW
FT                   AQYTIQVDNRDQVQGKLKEQGIPTAVHYPIPLNKQPAVASDAKLAVGDEVAKKVMSLPM
FT                   YPYLDNTSIETIVNSLR"
FT   gene            complement(286731..287312)
FT                   /locus_tag="PsycPRwf_0246"
FT   CDS_pept        complement(286731..287312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0246"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93201"
FT                   /db_xref="GOA:A5WC10"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC10"
FT                   /protein_id="ABQ93201.1"
FT                   /translation="MNNYYQHPSAIIDNGAIIGNDTRVWHFVHICSGAVIGSRCSLGQN
FT                   VFVGNKVIIGDDCKIQNNVSVYDNVTLEDGVFCGPSMVFTNVYNPRSFVDRKSEFMSTL
FT                   IKTGATLGANCTIVCGNTIGKFAFVGAGSVVNKDVPDYALMVGVPARQIGWMSEYGERL
FT                   DLPLTGKGDAYCEHTGAQYTLANGIVTKSK"
FT   gene            complement(287330..288286)
FT                   /locus_tag="PsycPRwf_0247"
FT   CDS_pept        complement(287330..288286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0247"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93202"
FT                   /db_xref="GOA:A5WC11"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC11"
FT                   /protein_id="ABQ93202.1"
FT                   /translation="MKNFALIGAAGYIAPRHMQAIKATGNSLIAAYDPNDSVGIIDSHF
FT                   PEAHFFTEFERFDRHVDKLARNPLSAKIDYMSICSPNYLHDSHMRFALRSGADAICEKP
FT                   LVLNDWNIDGLLDIERSTGHRVNTILQLRLHPSIIALKKKVEEQTISHKHEVDLTYITS
FT                   RGKWYLQSWKGDINKSGGIATNIGVHFFDMLHYIFGDLQSNIVNFSSATKASGYLEYEN
FT                   ARVRWFLSIDINDVPDDILATGQRTYRSITVDGDEIEFSGGFTDLHNRSYEEILKGNGF
FT                   GLEENRTAITTVSTIRNSNPIGLKGDYHPFLTKQNIK"
FT   gene            complement(288338..289360)
FT                   /locus_tag="PsycPRwf_0248"
FT   CDS_pept        complement(288338..289360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0248"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93203"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC12"
FT                   /protein_id="ABQ93203.1"
FT                   /translation="MTQYQKIQQDLVAAPKTWLITGVAGFIGSNLLETLLKLNQTVVGL
FT                   DNFATGYQKNLDEVQSLVSSEQWKRFSFIKGDIRNFVDCQKACTGVDYVLHQAALGSVP
FT                   RSLADPITTNEVNISGFLNMLTAARDAEVKSFTYAASSSTYGDHPGLPKVEDKIGKPLS
FT                   PYAVTKYVNELYADVFARSYGFKSVGLRYFNVFGRRQDPDGAYAAVVPKWTAAMIKNDT
FT                   VFINGDGDTSRDFCYIENTVQANILAATTQSNEATNQVYNVAVGDRTTLNELFNAIKSA
FT                   LADNGVSYEQEPTYRDFRPGDVRHSQANVSKAKNLLGYEPKFNISQGIDEAMAWYVNNG
FT                   "
FT   gene            complement(289427..290713)
FT                   /locus_tag="PsycPRwf_0249"
FT   CDS_pept        complement(289427..290713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0249"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase, dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93204"
FT                   /db_xref="GOA:A5WC13"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC13"
FT                   /protein_id="ABQ93204.1"
FT                   /translation="MLNVNDIKIAVIGLGYVGLPLAVEFGKKNPVIGFDINQHRIEELK
FT                   SGTDHTLEVSDEELAIAKQLQFSSDINELAECNFYIVTVPTPIDEYKQPDLTPLIKASA
FT                   AIGRVLKAGDIVVYESTVYPGATEEVCIPELERSSGLIFNKDFFAGYSPERINPGDKEH
FT                   RVTNILKVTAGSTPEVADLVDDVYNLVITAGTHKAPSIRVAEAAKVIENTQRDVNIALI
FT                   NELAVIFNKMGIDTEAVLTAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQAIGYNPE
FT                   IILAGRRLNDSMGEYVVTQLVKTMIKKRIQVEGAKVLILGLSFKENCPDVRNTKVIDIV
FT                   HELKEYNIDVDVYDPWVDADEAKQEYGIIPINDITNLESNSYDGIILAVAHDQFVEMGV
FT                   EQIRALGKSSHVLYDLKYLFNSELSDIRL"
FT   gene            complement(290754..292751)
FT                   /locus_tag="PsycPRwf_0250"
FT   CDS_pept        complement(290754..292751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0250"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93205"
FT                   /db_xref="GOA:A5WC14"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC14"
FT                   /protein_id="ABQ93205.1"
FT                   /translation="MRNNHKSNHSNKDSDNYLGSASHSSPKWSGIAETLLSLPRPVKQA
FT                   VLLVGDYIISIVCLFLALSLRQGVLDVNASPLLVALYALVPILGLYVVGFYRGVTRIFF
FT                   DTDMRRVLKLFIIILIVFTVVYLFDFITSIPRSVPLLYLFMLFIWLWGSRLFLRDLLLR
FT                   LQGKPIYQDLSKSSIERDNVLVYGAGSSGTALLEALQDSPRYQVAAFIDDDNRLTGGHI
FT                   LNKKIYPATQIESLVEELNIAQVFLAMPSVNRQRRREIINDLTNLSVKIKELPSLQDIA
FT                   EGKVTVSTMRRVDILDVLDRQTVDPNPVLLAKNIEGKNVLVTGAGGSIGSELCRQIIKN
FT                   KPKCLVLYELSEYALYAIHQDLLAWQATNSVSSDNSPTHIIALLGNVNNQQKLNMVFNE
FT                   YAINTVYHAAAYKHVPIVEYNPFEGVINNAKGTYHCVKAAVESNVETFVLISTDKAVRP
FT                   TNIMGASKRLAELVCQGFGNQNPSTKISMVRFGNVLGSSGSVVPLFTKQIAKGGPITVT
FT                   HPEVTRYFMTIPEAANLVIQAGAMAQGGEVFVLDMGKPVKIVDLARRMIHLSGYEVKDE
FT                   NNPAGDIEIVFSGLRPGEKLYEELIIGDDNIEATQHSLIMQAREHSFELTDIENTLSEL
FT                   ASRAQYHDVGWLKQQFTHYVEGYTPESNLN"
FT   gene            complement(292810..295065)
FT                   /locus_tag="PsycPRwf_0251"
FT   CDS_pept        complement(292810..295065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0251"
FT                   /product="Non-specific protein-tyrosine kinase"
FT                   /EC_number="2.7.10.2"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93206"
FT                   /db_xref="GOA:A5WC15"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC15"
FT                   /protein_id="ABQ93206.1"
FT                   /translation="MTQTVPPSPNDKAIKDDNEIDLMALLLALLRGWKTILATALLGLL
FT                   LGVTYSRYVQPTYQTDALLQIDNKSKSIAALGANISELVGEESTPAETERELIKSRMVL
FT                   QPVVEKLHLDIKLHNPELSTWDRILHSKKPTQTSSEQGVVLETSNGRAQIGHFEVPLAY
FT                   ANKPFTLVKTSTGFTLSLEINEDVVEYKGNIGTPTTIKTPDGDISIAVDALPATGHPIN
FT                   LTKVSTPNAIDSLNNALVVEERGQKTGIIELTLSGEDQKQVSRILTDIIDSYTTQNLAR
FT                   GSQQTTTTIEFMESQIPQLKQKLELSEEAFNKFREQYGTIDVTQEAGILINESAAIEKQ
FT                   TSELNLKKAELLTYYTEQHPLVIQINDQLSALSERRSQIKEGISRLPEMQREFLQLSQD
FT                   TEINREIYLTMLKNYQQLKIAQAGEIGYVRIVDLPINTYKIITPKKGLIQALSLLSGLL
FT                   LGVIIVFLKSLLRKVVKDPERLEAKTGVPVIATIPRSKTSFNLSKKKDSNRRLLAMVEH
FT                   DGLSYEGIKSLRTSLMFAMPKSSKVATVLGSDATDAHKQGKVIVISGEAPNIGKSFISS
FT                   NLAETFSQLNKKVLIIDGDMRRGELHKIFTVSQNSGLGDYLTESSANLSEFIHPTSFEF
FT                   IDFMPRGKHPHNPASLLSTEKFGNMMAQLVDIYDYIIIDTPPVLAVSDAIITAQYADKV
FT                   LMVTRYNSSIEGQLTYAVRQMNKSNITVDGIILNDVVQGITDKYSYHYSYAYGNSKD"
FT   gene            complement(295143..295574)
FT                   /locus_tag="PsycPRwf_0252"
FT   CDS_pept        complement(295143..295574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0252"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93207"
FT                   /db_xref="GOA:A5WC16"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC16"
FT                   /protein_id="ABQ93207.1"
FT                   /translation="MAFENILVVCVGNICRSPMAEALLKQRFPDKNIDSAGVGALVGHG
FT                   ADPAAIEIMQQQNIDITDHVAKQIDEDLALKYDLILTMSAGQNKWIEERFPFCRGKTFK
FT                   LGHWRDKDIADPYKHEMSAFKTAYQDIVKGIEDWQDKIN"
FT   gene            complement(295631..296734)
FT                   /locus_tag="PsycPRwf_0253"
FT   CDS_pept        complement(295631..296734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0253"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93208"
FT                   /db_xref="GOA:A5WC17"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC17"
FT                   /protein_id="ABQ93208.1"
FT                   /translation="MNVLKSPKSLFASTSLAVLIGLTSGCASVNSGLQAGELPPQGVFI
FT                   AENGMQFNVQPLSLAGLPASPVYSSRRNSGSSMKNARVHELLNGPRSSEYRLAQGDVLT
FT                   ISLGDYPQIPKSDIGYPIDQQGYIQFPLVGRVKASGLSVPQFTSQLRNQLQRYLKYPDP
FT                   QVQVLKYRSNNFFIDGAVKQSGEFSMDDRPVSLYGAISMAGGVAPEGDSNNVTLTRNGT
FT                   TYELGLNDLKSMGVSANQIYLRDGDAVHVNSRDRNKVYVLGEFGSVKPVEIPDQGLSLT
FT                   QVLGEVEGLDAHTADAAKLYVIRDHGNASYTDIYHANLQSVTNLALANRFEMQPNDIVY
FT                   VDPTGLTRWSRFIGAILPSAYALDRLN"
FT   sig_peptide     complement(296627..296734)
FT                   /locus_tag="PsycPRwf_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.728 at
FT                   residue 36"
FT   gene            complement(296953..299181)
FT                   /locus_tag="PsycPRwf_0254"
FT   CDS_pept        complement(296953..299181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0254"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93209"
FT                   /db_xref="GOA:A5WC18"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC18"
FT                   /protein_id="ABQ93209.1"
FT                   /translation="MTDSLFSTRHYSYPTLDDTIRQKMAHLQQSIAKLESNLIAPESMD
FT                   KRLSNTVYDDKVADQKIADKHSAPHNSVLSSSEVDYAGELNPSQLLAATTTEGKVLVIA
FT                   GAGSGKTKTLTYRTSYLIESGASPSSILLLTFTRKAANEIKGRVKSLLAESLADNRALS
FT                   GLDLNAITSGTFHSFCNMLLRRYSGLLGINPKFTILDTGDSEDALDMICKEQGIVRKNM
FT                   KQAFPRKKTLQNLISTSRNRHILLRDLIENDYPDIAIHIPLIEDLAMAYHKYKRANHLY
FT                   DFDDIISQVVYHLKNNLQFRKLIQDTYRHVMVDEYQDTNIPQKQLIDYLCEPDNVSLMV
FT                   VGDDNQSIYAFRGANYENILLFADGYPDAKLIKLEQNYRSTPAILDYVNALSEHITLGY
FT                   QKKLFSNLAIEGEKPTLCRRSNDKQEAVYIADKIIELKPEYDFNDFAVLSRTSFQSNEI
FT                   QLQFMQRNIPFIVVGGIKFIEKRHIKDILALVKILYNPNDTIAWHRILTLFSGVGDVTA
FT                   SKITQAITSSNDSLQPLLDPKLTKNKAPINELYHVLIKAQQQATVADILQTLIDFYAPI
FT                   LKTLEDNWRERSEDFRVLINLAQEHSSLDNFLENLALDPPNDSVAVMTNPEDKQTDAVT
FT                   ISTIHSAKGLEWPVVFVNALVDGLMPHHRSLHEFEALEEERKLFYVACSRAKTHLYLTA
FT                   PDYFSSFAGYFDKISRFISEVATDTLQVDAAESIRKSDDSQSNDPEWW"
FT   gene            complement(299255..300424)
FT                   /locus_tag="PsycPRwf_0255"
FT   CDS_pept        complement(299255..300424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0255"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93210"
FT                   /db_xref="GOA:A5WC19"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC19"
FT                   /protein_id="ABQ93210.1"
FT                   /translation="MTAASAKMPKSKLKPLLSKTLLTKPLGVANQLLQPYHIQLQHWVS
FT                   YDGSQIPVTVVGSPSATPVLLLHAFGMDARQFLPFVLPLAGQYCFYLPHFRGFGLAAGT
FT                   PSSEFNFIEQYADDVDVILTQICSKHQVKSVDVAAISMGALVMWAHFNRHAQHAQTDSA
FT                   QAEDKLAGKLQGKAKSNFETKTEATFETASRVKRYLNIDQSPIVHNHADWQGGVFGEKQ
FT                   AEVFEQFDTVLQATLPYVNQQSANGQTPLAFTQLPHQVKRQITQMETAFSLLSAGRLAS
FT                   QLFIKASGYLPDHKLAVYQHPTWQQKLRGLQAYLELPYDYRDALPVTQTPVTMLIGAQS
FT                   QLYDPKWQRQVAHILPNAQVIEIAGSGHAIPLDAPLQFSRVLKQFLVSA"
FT   gene            complement(300465..301583)
FT                   /locus_tag="PsycPRwf_0256"
FT   CDS_pept        complement(300465..301583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0256"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93211"
FT                   /db_xref="GOA:A5WC20"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC20"
FT                   /protein_id="ABQ93211.1"
FT                   /translation="MALDNIKDIIEDIRAGKMVILMDDEDRENEGDLIMAATHVNPEAI
FT                   NFMITHARGLVCLTLTEERCRRLELPLMSDRNEAKFSTNFTVSIEAAEGVTTGISAADR
FT                   ARTVQAAVSATAKAEDIVQPGHIFPIMAQKGGVLHRAGHTEAGCDLARLAGLEPAAVIV
FT                   EIINPDGTMARRDDLEKFAAEHDLKIGTIADLINYRIANEQTVNEVSKRPFETDFGTFT
FT                   LYQFKEYGASETHLALVKGNPSEGVSTVRVHGFHPLRDLFAAKRDATGRSGWSIQNSLQ
FT                   EISQSERGVLVWIGNNQPVDLGEALELASNNQSVSTLSNQPYRSIGVGAQILRHLGVRD
FT                   MRLLSTPLKFNALSGFDLNVVECIDSPDAPNA"
FT   gene            complement(301786..303105)
FT                   /locus_tag="PsycPRwf_0257"
FT   CDS_pept        complement(301786..303105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0257"
FT                   /product="Recombination protein MgsA"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93212"
FT                   /db_xref="GOA:A5WC21"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC21"
FT                   /protein_id="ABQ93212.1"
FT                   /translation="MATHPHSALYPDIPLAQRLRPKRLDEVIGQTHLLAPGAPIQRFVE
FT                   HGHLPSLILHGEAGIGKTTIAMLLADAVGRPFYPLSAINTGVKQLREVLDAGSSSGQGG
FT                   LDFASPVVFIDEIHRFNKAQQDALLGAVESGDITLIGATTENPSFSVNNALLSRCQVYR
FT                   LQPLDDTQIGELLQRALSQDEFLSQLSIDLQALPQIANLAQGDARKALNLLEMAVQASD
FT                   HSKQPIVIDDALLSSVAQTTLQRYDKDGDQHYDIISAMIKSVRGSDPDAALYWMARMLV
FT                   AGEPPEFIARRLVILASEDIGNANPNALLLADAALRSVKAIGMPEARIILGQVVVYLAT
FT                   SAKSNSTYLAINKAMQLAQQDQSPVPMHLRNGVTKLMQSQGYGEGYIYPHDYPNHYQPQ
FT                   QYLPDNLVGTRFYEYADNQREQHSLQFMQWLQTQTPSNNP"
FT   gene            303521..304216
FT                   /locus_tag="PsycPRwf_0258"
FT   CDS_pept        303521..304216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93213"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC22"
FT                   /protein_id="ABQ93213.1"
FT                   /translation="MLPKNRLSKIAVLKVAPLKIASKAIIPLKTLAHRSVSSLRLSQLK
FT                   SVASQLTPMAEQKSRPLNADEIAMAHSVFGADFDVSQVRLKTAWWVLKTYAVSPNGNIY
FT                   FNPKDWIEDFSKQSLGKKSWLIHELTHVWQLQQGLKVVRGAMMNRRYDYRLAEGRPFFS
FT                   YGIEQQARMVQDYFVRREQGKDCSAWQACIPFLQNQALGNSMVLQAQRQHQTQADAQVD
FT                   KLSTQETNT"
FT   gene            304213..305208
FT                   /locus_tag="PsycPRwf_0259"
FT   CDS_pept        304213..305208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93214"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC23"
FT                   /protein_id="ABQ93214.1"
FT                   /translation="MSFITSDVVKPSNNKSLLIKKSFMALALLSSLGVAACQPSTEQSA
FT                   ANKTPDNSTQSSQAAQTSDTQTPTPMSAEATAQVKHFEAEFVNKMLDLQQSQQAEYEAL
FT                   QAADAAEQEVATKQADAATSETGSNAEPQTVSKTGPEAGTGTGSEAGSGSEATTKTTDP
FT                   DITGITGSGEAQAATQQEAKPSQELPGLPLVDLAIKPPEQLTPTEISSRYNVGMQSLYL
FT                   EEGIPLPAQAIDTLLNIATLTPGVFHNTELAEHLVAKSPALARMLKQYQVWDQIERQQS
FT                   AELEALKQSQIEAQQKQQAEFDALAKEFNDKIAAYDEQIKNYEQKLKTFN"
FT   sig_peptide     304213..304323
FT                   /locus_tag="PsycPRwf_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.813 at
FT                   residue 37"
FT   gene            complement(305422..306702)
FT                   /locus_tag="PsycPRwf_0260"
FT   CDS_pept        complement(305422..306702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0260"
FT                   /product="citrate synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="TIGRFAM: citrate synthase I; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93215"
FT                   /db_xref="GOA:A5WC24"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC24"
FT                   /protein_id="ABQ93215.1"
FT                   /translation="MANETAYLKVDGKEYELPIIEGTLGPSVVDVSAFQTAGYWTYDPG
FT                   FKVTAPVESEITYIDGDKGELLHRGYPIDQLADNAEYLEVCYALLHGELPNAEQKADFY
FT                   EKVRSHTGVHDQLRKFFEGFRRDAHPMAIMVGVVGALSAFYHDNLDVTDEKQRDITAIR
FT                   LIAKMPTIAAMSYKYTKGEPFMYPRNDFSYAENFLYMMFATPADVNYKVNPVLIKAMDK
FT                   IFTLHADHEQNASTSTVRLTASTGANPYACIAAGIVALWGPSHGGANEAVLQMLDEIGT
FT                   VENVDEFMEKVKRKEVKLMGFGHRVYKNFDPRAKVMKETCDEVLEALGITDPKLELAMK
FT                   LEKIALEDEYFVKRNLYPNVDFYSGIILKAIGIPTSMFTVIFALARTSGWISHLLEMHS
FT                   APFKIGRPRQLYTGKTKRDFVKLEDRK"
FT   gene            308231..308608
FT                   /locus_tag="PsycPRwf_0261"
FT   CDS_pept        308231..308608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0261"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: Succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase, cytochrome b
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93216"
FT                   /db_xref="GOA:A5WC25"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC25"
FT                   /protein_id="ABQ93216.1"
FT                   /translation="MKSNRPINLPLSQVISVNSSPTARASILHRISGIILFLLIPVMLW
FT                   LLQTSLYSPQDFLAVFDNVLVRFVAWIFVAATAYHFVMGIKHLFADMGFNEELQSGRTA
FT                   SIVSFVIAAILIVLSFVWVMF"
FT   gene            308608..308991
FT                   /locus_tag="PsycPRwf_0262"
FT   CDS_pept        308608..308991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0262"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: Succinate dehydrogenase, hydrophobic
FT                   membrane anchor"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93217"
FT                   /db_xref="GOA:A5WC26"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC26"
FT                   /protein_id="ABQ93217.1"
FT                   /translation="MRRNDSGIKSATGLTGSGSRDWVMQRISAVVLAIYAVVMVGFFLI
FT                   NGDVSYQQWVSFIMSLPMRLLSLVAIIALAAHAWVGMWTVFTDYVKSTGLRLVLQAAMI
FT                   IAILVYLFWGVMIFWGPGLLNLG"
FT   gene            309198..311048
FT                   /locus_tag="PsycPRwf_0263"
FT   CDS_pept        309198..311048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0263"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase, flavoprotein
FT                   subunit; succinate dehydrogenase or fumarate reductase,
FT                   flavoprotein subunit; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93218"
FT                   /db_xref="GOA:A5WC27"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC27"
FT                   /protein_id="ABQ93218.1"
FT                   /translation="MATRQDNTISNIKTLNYDSVIVGGGGSGMRAALQLAEGGMKVAVI
FT                   TKVFPTRSHTVAAQGGIGASLGNMSDDNWHFHFYDTVKGSDWLGDQDAIEFMCREAPKV
FT                   VYELEHMGMPFDRNPDGTIYQRPFGGHTSNYGEKAVQRACAAADRTGHALLHTLYQKNL
FT                   EAGTEFFIEWIALDLIKDEKGDINGVVAIEQETGTVAVFQATNTVLATGGAGRIFSAST
FT                   NAYINTGDGLGMAVRAGIPLQDMEFWQFHPTGVFGAGVLLTEGCRGEGAILRNKDGEAF
FT                   MERYAPTVKDLAPRDLVSRSMDQEIKEGRGCGPNKDHIVMDMTHLGVETIMKRLPSVFE
FT                   IGKNFANVDITKEPIPVIPTIHYMMGGIPTTIHGQVIVPDLEGHVDEEGLYTEGKIVKG
FT                   LYAIGECACVSVHGANRLGTNSLLDLVVFGRAAGKHIIDNFGSSDHNYHPMNPRVLDFT
FT                   VGRLNKLQQSTQGYNAQEVADEIRALMQKHASVFRTQALMDEGVEKLLALKDKVDNIHL
FT                   ADKSQVFNTARIEALEVANLYEVAKATMLSAAQRHECRGAHTVLDYDRPEDDPIAPNGR
FT                   NDNEWMKHTVWYSEGNKIVYKPVRKVPLTVDYVEPKVRVY"
FT   gene            311177..311887
FT                   /locus_tag="PsycPRwf_0264"
FT   CDS_pept        311177..311887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0264"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93219"
FT                   /db_xref="GOA:A5WC28"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC28"
FT                   /protein_id="ABQ93219.1"
FT                   /translation="MSRGTRTIEIYRYDPDKDAAPYMQTYTIELLDSDRMLLDVLLRLK
FT                   KQDESITFRRSCREGICGSDGVNINGKNGLACLINMNTLPEKITIRPLPGLPVVRDLVV
FT                   DMNQFYEQYEKVHPYLINDQPAPPTERLQSPEDREKLNGLYECILCACCSTSCPSFWWN
FT                   PDKFLGPSALLNAYRFVADSRDSDTQARLARMDDPFSLFRCRGIMNCVAVCPKGLNPTR
FT                   AIGHLRNLLLEQAG"
FT   gene            complement(312460..313161)
FT                   /locus_tag="PsycPRwf_0265"
FT   CDS_pept        complement(312460..313161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0265"
FT                   /product="IS1 transposase"
FT                   /note="PFAM: Insertion element protein; IS1 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93220"
FT                   /db_xref="GOA:A5WC29"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC29"
FT                   /protein_id="ABQ93220.1"
FT                   /translation="MHITLYIKCPACLSDNIKKNGFKSYGKQNYKCKDCKRQFIGDHAL
FT                   TYQGCHSQKDSKIRYLMVRGSGIKDIACVERISKGKVLATLKKCHYPITPKQRQYDCLE
FT                   IDELWTFVGKKTNKQWLIYAYHRDTGEIVAYVWGKRDLNTVKKLKAKLKALGVSCARIA
FT                   SDTWDSFVTGFKGFTQVIGKFFTVGIEGNNCTIRHRVRRAFRRSCNFSKKLENHFKAFD
FT                   LAFFYINHGYV"
FT   gene            313445..316321
FT                   /locus_tag="PsycPRwf_0266"
FT   CDS_pept        313445..316321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0266"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E1 subunit;
FT                   PFAM: dehydrogenase, E1 component; Transketolase, central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93221"
FT                   /db_xref="GOA:A5WC30"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC30"
FT                   /protein_id="ABQ93221.1"
FT                   /translation="MNTMTNDALKADATELAGDNATYIESLYEQYLQDPSSVDADWQAY
FT                   FKNYQSDNDALHHAIQDQFLLLARNQTANKGAAAPATSGSLDSNCVDPRHMGVQKLISA
FT                   YRRRGHRRAKLDPLGLQPRADVEDLTLAYHGLSEADLDTIFSTSDLNIGKSEASLREII
FT                   EIMERVYCGHIGLEYMHVTTSTEKRWFENYMETNLGYIKFDNEKKKEILERLTAAEGLE
FT                   KYLARKYTGVKRFGLEGGESFIPAVHEIIQRAGGYGTKEMVIGMAHRGRLNLLVNILGK
FT                   NPADLFDEFDGKVMPEKGSGDVKYHNGYSSNVMTPGGEAHLALAFNPSHLEIVSPVLEG
FT                   SVRARQVRRNDKDGNLVLPLVVHGDAAIAAQGVVQETFQMSQTRAYTTGGTVHIVINNQ
FT                   VGFTTSRQEDARSTEYCTDIAKMVHAPILHVNGDDPEAVVFAAQMALDYRHEFHKDIVI
FT                   DLFCYRRNGHNEADEPSATQPLMYSIIKKLPTTRTQYAQKLMSQGVISEGDDKTLEDEY
FT                   REALDKGEYVANSLVQQPNEELYVDWSPYLGHELKDDWDTSVDIEKLKAYGRRMAEMPE
FT                   GFKLQRQVQKVVEQRLAMQTGEEPLNWGAAETLAYASLVDEDFLVRITGEDVGRGTFSH
FT                   RHSEIFNVENGDMYVPLAHLNDTQARFATYNSLLSEEAVLAFEYGYATTVPKALIIWEA
FT                   QFGDFVNGAQVVIDQFISSGETKWQRVCGLTMLLPHGFEGQGPEHSSARLERFLQLCAE
FT                   DNMQVITPTTPAQIFHALRRQAVRPIRKPLVVMSPKSLLRHKLATSELEELANGKFETV
FT                   LPEIDQLDNDKVTRIVMCGGKVYYDLLEQRRELGLDHVAIVRIEQLYPLPQQRMVEEVQ
FT                   KYANLEEIVWCQEEPLNQGAWYYLAPHMFRIFGPQADNQPRVTKARVVDPVARPASAAP
FT                   ATGLPSIHVRQQRELVAGGLGVSVDQLK"
FT   gene            316529..317758
FT                   /locus_tag="PsycPRwf_0267"
FT   CDS_pept        316529..317758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0267"
FT                   /product="2-oxoglutarate dehydrogenase E2 component"
FT                   /EC_number="2.3.1.61"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein; catalytic domain of
FT                   components of various dehydrogenase complexes; E3 binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93222"
FT                   /db_xref="GOA:A5WC31"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC31"
FT                   /protein_id="ABQ93222.1"
FT                   /translation="MAEIKAPVFPESVADGTIVEWHVSEGEQVNRDDILAEIETDKVVL
FT                   EVVAPDDGVVTKIVKQVDDTVLSDELIAEFEAGATGSAAGASEDKAEESSDTATEEKPA
FT                   AKPAASADSADDHKDQSPAVRKAAKESGVDPKNVEGTGRGGRVTKQDMASPTLKADSSI
FT                   KSDSGRPVAESVGERTEKRVPMTRLRKTVANRLLAASQETAMLTTFNEVNMKPLMDLRA
FT                   KYKDQFEKRHGTRLGFMSMFVKAATEALKRFPAVNASIDGDDIVYHGYYDVGVAVSSDR
FT                   GLVVPVLRDTDRMSMADIEGGIRDFAGKARDGKLSLQEMTGGTFTITNGGVFGSLMSTP
FT                   ILNPPQTAILGMHAINERPMAVNGQVEILPMMYLALSYDHRMIDGKDAVQFLVTIKQLV
FT                   EDPAMLLLDL"
FT   gene            317980..319437
FT                   /locus_tag="PsycPRwf_0268"
FT   CDS_pept        317980..319437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0268"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93223"
FT                   /db_xref="GOA:A5WC32"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC32"
FT                   /protein_id="ABQ93223.1"
FT                   /translation="MKDNYDLVVIGGGPGGYEAAIRAGQLGMSVACIEKRVYKGEPALG
FT                   GTCLNVGCIPSKALLDSSHRYEATKHELAEHGITTSDVEIDVAKMIERKEGIVKQLTGG
FT                   VAMLLKGNGVDWLQGWGTLVDGKGSDKKVKFTALADESETVITAKNVILAAGSVPIDIP
FT                   VAPVNNEEGIIVDSTGALDFTETPKRLGVIGAGVIGLELGSVWRRLGAEVVVYEALPEF
FT                   LAAADKDIAKEAGKLLKKQGLDIRVDTKVTGTEIKDGQVVVTSEKGGESAEETFDKLIV
FT                   CVGRRAYSEKLLGEDSGITLTDRGLVEVDDQCKTNLDGVYAIGDLVRGPMLAHKAMEEG
FT                   MMAVERIHGEKAQVNYDTIINVIYTHPEIAWVGLTEQQAVEQGYEVKTGSFNLAANGRA
FT                   LAQSEAQGSIKVVADAKTDRLLGMHAICAGAGDIVHQGMIAMEFVSSIEDLQLMTFAHP
FT                   TISEAVHEAALSADGRAIHAIQRKKRK"
FT   gene            319653..320822
FT                   /locus_tag="PsycPRwf_0269"
FT   CDS_pept        319653..320822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0269"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; ATP-grasp
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93224"
FT                   /db_xref="GOA:A5WC33"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WC33"
FT                   /protein_id="ABQ93224.1"
FT                   /translation="MNLHEYQAKLLLESYGLPIQKGIIAYNGEEAAEAFDKTPTDVAVI
FT                   KAQVHAGGRGKAGGVKLVKTREEAKEVAESLIGTNLVTYQTDAEGQPVNFVLVAEDMYP
FT                   VKTELYLGAVVDRATRRVTFMASTEGGVEIEKVAEETPEKIFSITVDPLVGLLPFQARE
FT                   VGFKLGLEGKQINQFVKLMTGAYKAFVENDFDMIEINPLAVRENGELACVDGKIGVDSN
FT                   ALFRQPKIAALHDPSQENERELKAAEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYG
FT                   GKPANFLDVGGGATKDRVVEAFKIILEDSSVQGVLINIFGGIVRCDMIAEAIIAAVKEV
FT                   NVTVPVVVRLEGNNAELGAKLLDESDVEIISAQGLSDAAQKIVDAVKAA"
FT   gene            320880..321755
FT                   /locus_tag="PsycPRwf_0270"
FT   CDS_pept        320880..321755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0270"
FT                   /product="succinyl-CoA synthetase (ADP-forming) alpha
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: CoA-binding domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93225"
FT                   /db_xref="GOA:A5WC34"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC34"
FT                   /protein_id="ABQ93225.1"
FT                   /translation="MSVLIDKDTKVLVQGFTGKNGTFHSEQAIEYGTKVVGGVTPGKGG
FT                   QTHLGLPVFNTMAEAMEATQADASVIYVPAPFVLDSIIEAVDAGVKLIVVITEGVPTLD
FT                   MLKAKRYIEEAGDVKMVGPNCPGVITPGQCKIGIMPGHIHLPGKVGIISRSGTLTYEAV
FT                   AQTTKLGFGQSTCIGIGGDPIPGMNQIDCLKMFQEDPQTEAIVLIGEIGGTAEEEAAAY
FT                   IKEHVTKPVIGYIAGVTAPKGKRMGHAGAIISGGKGTAEEKFKAFEDAGIAYTRDPSKI
FT                   GETVKQVTGW"
FT   gene            321963..322841
FT                   /locus_tag="PsycPRwf_0271"
FT   CDS_pept        321963..322841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0271"
FT                   /product="UDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.9"
FT                   /note="PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93226"
FT                   /db_xref="GOA:A5WC35"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC35"
FT                   /protein_id="ABQ93226.1"
FT                   /translation="MLMTTHVTHAVIPVAGFGTRMLPLSKSVPKELLPLGNRPAIHYVV
FT                   EEAIAAGIKHIVLVGHAQKSAIENYFDVNAELDNQLRAKGKDELADSLNWLPEDVSVSV
FT                   IRQGKPLGLGHAVLKARPIVGDNPFAVLLPDVVLNPFTTKMDKDNLAYMIQAFAQTHHS
FT                   QILVSHVADEDVQKYGIAKLKDADQLSQLTGDKNANFAVAGFVEKPQLADAPSNLAVVG
FT                   RYVFNAAIFDYLANTQPSVGGEIQLTDAIDALISTQGVDVTTMLGDSFDAGDMTSYMQA
FT                   FIYFAQQQLQA"
FT   gene            322978..324669
FT                   /locus_tag="PsycPRwf_0272"
FT   CDS_pept        322978..324669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0272"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI)"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93227"
FT                   /db_xref="GOA:A5WC36"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC36"
FT                   /protein_id="ABQ93227.1"
FT                   /translation="MDKTLPNQLPQWQRLQQLAQQPWSITELFAKDTHRSTNFSLSAQG
FT                   MFFDYSKQCLDESVKAELFELAKACRLPQKLAALYQGDKVNTSEKRAALHTALRLPKSA
FT                   RLTVDGVDVVAEVHDSLAKAEDLVDRIRGGLWRGYSGKAITDVVNIGVGGSDLGPVMAN
FT                   TALDEWADSNIRVHFVSNMDGTQLGSLLDKLNPETTLFIISSKSFGTVDTLSNAQTARA
FT                   WLLTTGASPATLLRRHFIGISANTERVSAWGIAKEHQLKLWDWVGGRFSMWSAIGLAVA
FT                   IRIGMPRFYEMLAGAHAMDEHFKHADFEHNLPVLLGLIGIWNSSFLGINAHTVLPYDGR
FT                   LKYFPSYLTQLEMESNGKSVTHGGQPVPYATCPILWGEIGSNAQHAFYQLLHQGTQKVS
FT                   CDFIACVNYYQSREADELKKQHELSLANCLAQSRVLAFGNDALAAKPDQVATELDKFKR
FT                   YRGNQPSTTLLLDELTPASFGALIALYEHKVFVMASIWDINPFDQWGVEMGKQVANEVF
FT                   AHIRLDTSVASDAAADHAHKQAQLAAEAFDGSTQALLQHINQQLDS"
FT   gene            324762..326102
FT                   /locus_tag="PsycPRwf_0273"
FT   CDS_pept        324762..326102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0273"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase,
FT                   dimerization"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase,
FT                   dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93228"
FT                   /db_xref="GOA:A5WC37"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC37"
FT                   /protein_id="ABQ93228.1"
FT                   /translation="MATSTHSPAAPSKAVTDHCVIVGHSIDAITTATVMVSLGNQVCLY
FT                   ADQQALQHTLETYTFEHQQQALWQLYLNQNSIVVQDMPQLASQLFSNTKASFYWLFYGD
FT                   LPSSWQALDGVQQAWVSELNDSQVPSQTPVIFSGISTLGVFASLAKQCQRPWVYYVPFV
FT                   FLQDGSAYPSMLSPKLWLMGEKTADSIDKVAVLQPLIAQAQQSYVSDIATIEFSRSAIM
FT                   SMLATRVSFMNEWSRLADQQGVDILEVANIMGLDTRIGSSYLKAGWGFGGQTLPAEISA
FT                   LQQTLQNTQVEHRLMQAVNIINDDQKELIFRKFWQHFDGAIENKQVSIWGASYKAGSGR
FT                   TSASAIHPLLRLLWSYNITTHIYALEAQSELASLYPDQPLLQFIDSATDKLADSDALFV
FT                   LSWPSTKRLPISAINEVVVPVFDAQNAFAKTQVAALVGTYQGIGRSK"
FT   gene            complement(326234..327697)
FT                   /locus_tag="PsycPRwf_0274"
FT   CDS_pept        complement(326234..327697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0274"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase C
FT                   terminal; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93229"
FT                   /db_xref="GOA:A5WC38"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC38"
FT                   /protein_id="ABQ93229.1"
FT                   /translation="MTTNPVISADNLPHRSITSFKAYDIRGELGVNLDEDIAYRIGRAF
FT                   AQILASQKADSEGNDTLEHSIVIGCDIRDSSETLKQATIRGIIDAGVDVIDLGMTGTEE
FT                   VYFATSHYHALGGIEVTASHNPINYNGLKLVREGSRPISADSGLAEIQALAEQGDFAAI
FT                   THAGTVVEKFDKTAYVDHLMRFIDTNKLVPLKIVINSGNGSAGPTVDLLEQRLQQKNAP
FT                   IEIIKVHHTPDGSFPNGIPNPMILANRESTQQAVIDNKADLGIAFDGDFDRCFLFDAQG
FT                   EFVEGSYVVGMLAQAFLQKHQGAAIVYDPRVLYNTEALIEEGKGEAVISKSGHSFIKQV
FT                   MRESGAVYGGEMSAHHYFRDFFYCDSGMIPWLLTIELLSTTGKSLGQLVDERIHAYPSS
FT                   GEINFKLTEAGSDDIIKAIEAYFSAQNPQKNTLDGLSLDFGQWRFNIRASNTEPLIRLN
FT                   IETKGDEGLLTEKTAEIKQWLATQGAQVA"
FT   gene            complement(327789..329057)
FT                   /locus_tag="PsycPRwf_0275"
FT   CDS_pept        complement(327789..329057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0275"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase,
FT                   dimerization"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase, dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93230"
FT                   /db_xref="GOA:A5WC39"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC39"
FT                   /protein_id="ABQ93230.1"
FT                   /translation="MSNSDSTETASHLHPSSAHAAAIGLSKIVVIGAGYVGLSNAILLA
FT                   QAHLHTQVMLFDIDQNKIQLLQQNQSPLQDTEICDYLAHKPLNLTATMQAVIEDQGIYQ
FT                   ASDLVIIATPTNYDVASGKFDTSSVEASIAAVRQQNATVPIVIKSTIPIGFTDNMRQQF
FT                   DNQILFMPEFLREGQALYDNLYPSRIIVGASLEQQDLASALMHLYQQASLAPEVATLMM
FT                   PPTEAEAVKLFANSYLATRIAFFNELDSFAEKHQLNSQSIITGVGLDPRIGQHYNNPSF
FT                   GYGGYCLPKDTQQLKANYAGIPANLIHAVVDANNTRKRFIARQIIDKNPNQVGIYRLSM
FT                   KKDADNFRDSAVLDVINTLKQHGVSISIYEPALETNSFEGCPVINDLAQFKQQNDLIVA
FT                   NRWHDELSDVKDKVYSRDVFGYS"
FT   gene            329219..330088
FT                   /locus_tag="PsycPRwf_0276"
FT   CDS_pept        329219..330088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0276"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93231"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC40"
FT                   /protein_id="ABQ93231.1"
FT                   /translation="MLKTPDMHDKKMIAPKPVMGVPEPTANIHDLLALMARLRADCPWD
FT                   IKQTNHSLIPYAIEEAYELAEAIQEGDIEDIKGELGDVLLQVVFHCQIYAEQQQFDLGD
FT                   VIYTLQSKLIRRHPHVFEADQLPDEAAVKKRWDEIKAIENAERERRGKPKRSLDAVKAG
FT                   SALMQAQSLQQAASKLGFDWEGVAGAVEKLEEEISELKQILPQAGESMDAAYKQALEKE
FT                   LGDCVFGLVNVARKLNLDAEAATLTCVHKFRSRFGFIEAQLAKQGKTAQTSSLEEMDAL
FT                   WELAKQHE"
FT   gene            330054..330434
FT                   /locus_tag="PsycPRwf_0277"
FT   CDS_pept        330054..330434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0277"
FT                   /product="competence protein ComEA helix-hairpin-helix
FT                   repeat protein"
FT                   /note="TIGRFAM: competence protein ComEA
FT                   helix-hairpin-helix repeat protein; SMART:
FT                   Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93232"
FT                   /db_xref="GOA:A5WC41"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC41"
FT                   /protein_id="ABQ93232.1"
FT                   /translation="MRYGSWPNSMNRRTSALILGMLCMMQAVLMPGAWAQQCFADAHQA
FT                   YAHLINEQQNQQLAEQSVTVHLNSATEGELTQLTGIGSNKAQQIILYRDAFGPFGSVDD
FT                   LAKVKGIGDKTVAKNRARMSIE"
FT   sig_peptide     330054..330161
FT                   /locus_tag="PsycPRwf_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.868 at
FT                   residue 36"
FT   gene            complement(330478..331008)
FT                   /locus_tag="PsycPRwf_0278"
FT   CDS_pept        complement(330478..331008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93233"
FT                   /db_xref="GOA:A5WC42"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC42"
FT                   /protein_id="ABQ93233.1"
FT                   /translation="MIYEFIATVTAGFGMAGIAMIIRHLTKLASKQAPKWLIPIFAGIG
FT                   MLGFQIHQEYHWQQQQIDRLPAQVKVVKTVEGQVWYRPWSYLKPQVIRFMAAESGKPVA
FT                   TDITSSTDDIRSTNIYLFERRISTKVIAQLVNCSQPAITSVTITPPLSATNFQQLQWQP
FT                   LAADDDLLQAVCQ"
FT   gene            complement(331231..333099)
FT                   /locus_tag="PsycPRwf_0279"
FT   CDS_pept        complement(331231..333099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0279"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93234"
FT                   /db_xref="GOA:A5WC43"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC43"
FT                   /protein_id="ABQ93234.1"
FT                   /translation="MSQFTINLIFVGASFLLYFGIAIWARAGSTKEFYVAGGGVHPVLN
FT                   GMATGADWMSAASFISMAGLLAAGGYGASSYLMGWTGGYVLLAMLLAPYLRKFGKYTVP
FT                   DFIGDRFYSKTAALVAVACLIIASTTYVIGQMTGAGVAFSRFLEVDNTTGLIIAAVVVF
FT                   FYAVLGGMKGITYTQVAQYVVLIIAYTIPAVFISLELTGNPIPGLGMFSNHTESGIPLL
FT                   TKLDQVVTDLGFTAYTADVPSKLNMVLFTLSLMIGTAGLPHVIIRFFTVPKVADARWSA
FT                   GWALVFIALLYFTAPAVGAMARLNLMDTVYPQGVDAPALPYDERPSWMQTWEETGLIKY
FT                   NDLNGDGRIQLYNDSGLGAAKAALATAQAEGGDVAAATTAVEEATTAHAGELEGKFVTA
FT                   GWQGNELDVNNDILVLANPEIANLPPWVIGLIAAGGLAAALSTAAGLLLAISSAISHDL
FT                   VKRNFNPDITDKGELLVARISMAVAIVVATYLGINPPGFAAQVVALAFGIAGASLFPAL
FT                   MMGIFSKRINNYGAIAGMLAGLITTLVYIFVYKGWFFIPHTANLPDTAEYWLFGVSPMS
FT                   FGAIGALINFVVAFLVSSMTQAPPVHIQKLVESVRSPRGAGAAIDH"
FT   gene            complement(333104..333364)
FT                   /locus_tag="PsycPRwf_0280"
FT   CDS_pept        complement(333104..333364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0280"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93235"
FT                   /db_xref="GOA:A5WC44"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC44"
FT                   /protein_id="ABQ93235.1"
FT                   /translation="MNPSQDSSGYWKANVRLILICLFIWAFCSYGCGILFRPLLAGIKF
FT                   GGADLGFWFAQQGSIICFILLIFFYAWRMNKLDKQYGVDEE"
FT   gene            333983..335491
FT                   /locus_tag="PsycPRwf_0281"
FT   CDS_pept        333983..335491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0281"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93236"
FT                   /db_xref="GOA:A5WC45"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC45"
FT                   /protein_id="ABQ93236.1"
FT                   /translation="MVESTNVFAEGFNAFVSWGNGIIWGNDSWLIMDNPWYGLLIFILI
FT                   GAGIFFTIATRFVQFRQFGHMWNLLRSSGQGRKDGGISSFEALMTSLAARVGTGNLAGV
FT                   AIAVYIGGPGAVFWMWITAILGMSTSFIESTLAQAYKVPHNDNVYRGGPAYYIEKGLGQ
FT                   RWMAIFFSLCLLVAFGLAFNGVQANTIAQATHQAFGAPTWLTGLVLVVLVAPVVFGGLR
FT                   SVARVAGKVVPVMAILYVLLALFIIVTNFSQFPAAIALIVKSAFGLEQAAGGVLGYGIA
FT                   QAMINGIKRGLFSNEAGMGSAPNAAATAKSHPDHPAVQGFMQMLGVFIDTLVICTATAS
FT                   IIILSGVVNDPNVEQEGIKLTQLALSQYVGDSGIYFIAVAIFFFAFTSIIANYSYGESN
FT                   LEFISGEKSAKSAIMIFRFMVLAMVFIGSVASLPAIWNFADLSMGLMALTNLVAIIILS
FT                   PVALRVLRDYERQVKEGKTPDQITFDPDQFVKLKDEANRDAWKD"
FT   gene            complement(335602..337269)
FT                   /locus_tag="PsycPRwf_0282"
FT   CDS_pept        complement(335602..337269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0282"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; electron
FT                   transfer flavoprotein-ubiquinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93237"
FT                   /db_xref="GOA:A5WC46"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC46"
FT                   /protein_id="ABQ93237.1"
FT                   /translation="MQDEQIERESMEFDVVIVGGGPSGLSAAIRLRQLALEAGLDEFMV
FT                   CVVEKGSEFGAHTLSGAVIEPRAINELIPDWKEKGAPLNVPVTEDRVYYLNSATRSIKT
FT                   PDALIPAPMHNEGNYIVSLGNVVRWLAEQAEELEVMMFPGFAASDILYNDDGSVRGVLT
FT                   GDMGVAADGSHKSGYEPGYELNAKYTIFAEGCRGHLGKRLISRFGLDKDSDPQHYGIGL
FT                   KELWEVDPSKHEPGVVMHGLGWPLTETGSTGGWWLYHDENNQVSFGLVIDLAYHNPYMS
FT                   PFDEMQRLKTHPVIKQVLEGGKRLSYGARALTKGGLNSLPKLTFPGGVLVGDDAGFLNP
FT                   AKIKGTHTSMKSGMLAAEAIFAALQSGRQHDEVDSYSKMYKDSWLYQDNHEARNFSPAI
FT                   HRMGPLMGGAFTFIEHNLLKGKMPFTVHDTTPDYKALDKAAQAYKPDYPKPDGKLTFDK
FT                   LSSVFISNTNHAEDQPSHLKLTDPTVPVTVNLPIYAEPAQRYCPAGVYEIVKDAEGAKF
FT                   VINAQNCVHCKTCDIKDPSQNITWVAPEGGGGPNYPNM"
FT   gene            337754..338404
FT                   /locus_tag="PsycPRwf_0283"
FT   CDS_pept        337754..338404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0283"
FT                   /product="protein of unknown function DUF1285"
FT                   /note="PFAM: protein of unknown function DUF1285"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93238"
FT                   /db_xref="InterPro:IPR010707"
FT                   /db_xref="InterPro:IPR023361"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC47"
FT                   /protein_id="ABQ93238.1"
FT                   /translation="MSQSCSNPKITANPDNHSETNSTLAKASIDSLSEYLKHQVTDRRG
FT                   RSIPPLDKWHPERVGEMDLVIKANGEWWHEGSKISRQSLVDLFSTVLWREGTDENSAYY
FT                   LKTPVEKLRIKVEDVPFLITEVNVIEQEGTQTIEFITSTGDVIHLDEDHPLQMGEYQGE
FT                   QRPYIKVRFGMKGLLSRTVLMHLVKLGELTEQDAQTSLILQSGGNAYSMTVAN"
FT   gene            338477..339499
FT                   /locus_tag="PsycPRwf_0284"
FT   CDS_pept        338477..339499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0284"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; PFAM: Asp/Glu racemase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93239"
FT                   /db_xref="GOA:A5WC48"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC48"
FT                   /protein_id="ABQ93239.1"
FT                   /translation="MTTQAVAINQSQDASQKAAADDDKAQMPPSVSGPAPIGIFDSGVG
FT                   GLSVYMHLKQALPQEHFIYYADTLNVPYGPRPSSEIQQLSLTAVDWLVAAGCKLVVIAC
FT                   NSASAHALHLARQKYPHIPIVGLVPALKPAVLNSTSKNVAVLATKATLDGPLLNTVIDE
FT                   YARPSQVTVIKWFDPELVPWVEAGMPMDSDTPMRLKQQLYQFAQQQVDHLVLGCTHYPF
FT                   FREFVLAEVAKQGLDIKVVDSGAAIAARVKALLQQQAAAESSTARLGHKFLLPTQSVLH
FT                   SMQGLSVGHTTQRHTDRLSDLEPQHASSLAVPKLAFFVSDPKADLAQVSTMVQRLIYPV
FT                   "
FT   gene            339673..339963
FT                   /locus_tag="PsycPRwf_0285"
FT   CDS_pept        339673..339963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93240"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC49"
FT                   /protein_id="ABQ93240.1"
FT                   /translation="MSNQDSLKNEIDHLEQVLHQAEGGHTLEEQIADMKRRGIDPSENY
FT                   KKWDDEEEEDWGDATWKENGKWEPKTPADLDEKARENWDGENGKPTPPPIV"
FT   gene            complement(340063..341487)
FT                   /locus_tag="PsycPRwf_0286"
FT   CDS_pept        complement(340063..341487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0286"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase; PFAM:
FT                   Peptidoglycan-binding domain 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93241"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC50"
FT                   /protein_id="ABQ93241.1"
FT                   /translation="MLRTPLAATLTTALGISLAATSAHAAKPPAPNLSNAEFQQCLSGL
FT                   KNSSTFRGVSSSTFENYRPSEPDPSVIASLNYQPEFQKDVWDYLSSLVDKERVEDGIRA
FT                   KHEMADTLRRIEARYGVTPEHVLGVWGVESNFGQTLGKKDLFQSLATLSCFDRRQSYFR
FT                   GEYANALKIVQQGDIRPQDMTGSWAGAFGQTQFMPGTFLDLAVDFDGDGRRDLVNSKAD
FT                   ALASTANFLAKRGYRSGEPWGYEVKIPQGFWGSNSRKDKKSMSYWRDKGFTLADGRPLP
FT                   YDLSSAGLLLPAGLNGPAFLVGKNFDTFYSYNASENYALAIAHLSDLITKEDSSKTDFI
FT                   TAWPTDDPGISRQQAKDIQQALLNAGYDIGEVDGIIGDNTRLAIQQYQTSKGVFPADGR
FT                   AGQKFYRLIMGNTGGSANNPRPASTYASSSYPAQPSQAPSATNDSITRLIEQQDGYRRE
FT                   IQSDGTIRLIRVDKGQ"
FT   sig_peptide     complement(341410..341487)
FT                   /locus_tag="PsycPRwf_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(341796..342761)
FT                   /locus_tag="PsycPRwf_0287"
FT   CDS_pept        complement(341796..342761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0287"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93242"
FT                   /db_xref="GOA:A5WC51"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC51"
FT                   /protein_id="ABQ93242.1"
FT                   /translation="MPHTVLSSPAATVKRIKIGALDALDIRAPAYQAVVLLQGAQLIYF
FT                   SSGKLPTKDFEQLAPQHVSDNWLWVSAQAQYDTQDSVRGGVPLCWPVFGLFSANPEAVK
FT                   TSFKDSLYDVTQHGYARTQIFDFERFSSEIGDNKTSELVLMLTGSRSPKLDLTVTFSFN
FT                   DQGVNIKLTTQNQEAHTVHFSQALHTYLPTADITQTVIGGFDGVNYSDTLQTDATNGGW
FT                   QTKTQQGDISFEGEVDRIYHGAPDITLTTPTQRYQLIATGSNSTVVWNPWIKKAKQVSQ
FT                   FAEDDYLRMLCIETANAHLDAVTLQSGQTHSLSLSLSQAH"
FT   gene            complement(342832..343524)
FT                   /locus_tag="PsycPRwf_0288"
FT   CDS_pept        complement(342832..343524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0288"
FT                   /product="Thiopurine S-methyltransferase"
FT                   /EC_number="2.1.1.67"
FT                   /note="PFAM: thiopurine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93243"
FT                   /db_xref="GOA:A5WC52"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR022474"
FT                   /db_xref="InterPro:IPR025835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC52"
FT                   /protein_id="ABQ93243.1"
FT                   /translation="MNPEFWQEKWQNPQPGFHQAKPNQLLVSYFKSLSLAPASRVFVPL
FT                   CGKSIDMLWLAEQGYDVIGSELIDSAVQQFFSENNIEMSITKHPKNESMNIYQGQYAGR
FT                   LIQIFAGDIFELSPADVGTIDAVYDRAALVAMPDKAPTHLRRQYVQQVIKLTQTAPQLL
FT                   LNFALNAPAMDEATRLSRQQGGPPFVVSDDAIYGYYQEAYQVEFLGQDAFEPTDRLINQ
FT                   AWRLINQS"
FT   gene            complement(343681..344208)
FT                   /locus_tag="PsycPRwf_0289"
FT   CDS_pept        complement(343681..344208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0289"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93244"
FT                   /db_xref="GOA:A5WC53"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WC53"
FT                   /protein_id="ABQ93244.1"
FT                   /translation="MQTIILGGGCFWCTESVFQSVKGVQKVTSGYMGGEDANLANYKDV
FT                   CSGTTGHIEVVRVDFDDTIVPLEVVLDIFFATHDPTTRDRQGNDIGSQYRSVVFYTDEE
FT                   TQKPTIDRTINKLRDMGLDIVTEVHPVHEFHVAEDYHQDYFNKNPTQGYCQAVIPPKLG
FT                   KLRKEFKQYMAK"
FT   gene            344360..345184
FT                   /locus_tag="PsycPRwf_0290"
FT   CDS_pept        344360..345184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0290"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93245"
FT                   /db_xref="GOA:A5WC54"
FT                   /db_xref="InterPro:IPR005271"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WC54"
FT                   /protein_id="ABQ93245.1"
FT                   /translation="MSNTTDADAKHPQSNILVEETVVYDNVFTTPLDKAARFSFDEQVV
FT                   ACFPDMIRRSVPGYGQMLAMLPIFAKRHCQAGQVNAEGKRVSRVYDLGCSLGGATMALL
FT                   NEKGGFGKEELQIKAVDISPAMTQKAEVLLQQNYPEHDIEVITADIRGFELEPCDMVIL
FT                   NLTLQFLPPADRTQVLQSIYNALNDGGILVLTEKTHTGDEQDDAWLVERYYDFKRANGY
FT                   SELEISGKRNALENVLITDTLDQHHQRLAEVGFNRSLTWFQFLNFASMVAFK"
FT   gene            345273..346334
FT                   /locus_tag="PsycPRwf_0291"
FT   CDS_pept        345273..346334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0291"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93246"
FT                   /db_xref="GOA:A5WC55"
FT                   /db_xref="InterPro:IPR010017"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WC55"
FT                   /protein_id="ABQ93246.1"
FT                   /translation="MTNHTITTAERELYLALIQRAQYRPIATQWLANLPQWLSDVKDKR
FT                   RYAHAPAYLSAVENLPQIKVKNVDLNSDILTIDADLTDGQSKQITALMKQLMPWRKGPF
FT                   QIGSGDNKVFIDTEWHSDWKWNRIKPHLGTLQGRYVLDVGGGSGYHGWRMAGAGAKQVV
FT                   IIDPSCLFYHQFMAIRHFVAGFDTDMDSDRTGVGYRTHYIPVGLEQLPSSSDQGNQLFD
FT                   TVFCMGVLYHRQSPFEHLIQLKNQLINGGQLVLETLVIEGDANTVLVPHNRYAKMNNVY
FT                   FIPSVAALTGWLEKVGFSEVKCVDIDITSIKEQRATDWMSYQSLKDFLDPNDPTKTVEG
FT                   YPAPMRATLIATK"
FT   gene            346462..347634
FT                   /locus_tag="PsycPRwf_0292"
FT   CDS_pept        346462..347634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0292"
FT                   /product="protein of unknown function DUF1176"
FT                   /note="PFAM: protein of unknown function DUF1176"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93247"
FT                   /db_xref="InterPro:IPR009560"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC56"
FT                   /protein_id="ABQ93247.1"
FT                   /translation="MNKLHLLSTALFGLSTLITLPAVAAEGYGKPFEDGGYSKDDWQLV
FT                   CDNTLTCRAAGYSSEDNLDRPASILITAIPKQSIPKVEVQFASEEDDNGNNEIELWLND
FT                   KFYGQLSAGSDGADGGVYQLNQKQAQALLRRARQNTKIDIVAVSNVGSKRWQVSDKGMS
FT                   AVLLKLDEAQGRVGNALALVSHSHLNKQVPKSAVAKPIIHKAFAYADAKQTTLSPSARN
FT                   YFNANIEKWVRVDSKPLMGSSDDMGACELANPKSEQSQSFREYATEGLDWSFERVDATH
FT                   TLASHLCWRGAYNMGYGYWLIDNAKPSSPQLITTSGSEYSEGEIWAIHKARGIGDCWGQ
FT                   KQWVWNGQSFVLATEATTGMCRGFAGGAWQLPTHVAKIIEHNSTQASIAN"
FT   sig_peptide     346462..346536
FT                   /locus_tag="PsycPRwf_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(347669..347899)
FT                   /locus_tag="PsycPRwf_0293"
FT   CDS_pept        complement(347669..347899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93248"
FT                   /db_xref="GOA:A5WC57"
FT                   /db_xref="InterPro:IPR021249"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC57"
FT                   /protein_id="ABQ93248.1"
FT                   /translation="MLAAVFAIAAETVTKWGLYVLLPIFIAFLFFIMWDISKKSDAGRA
FT                   GTFWIFLALGAGFVGFLLKLVLEVVFEKWVL"
FT   gene            348184..350013
FT                   /locus_tag="PsycPRwf_0294"
FT   CDS_pept        348184..350013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0294"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93249"
FT                   /db_xref="GOA:A5WC58"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WC58"
FT                   /protein_id="ABQ93249.1"
FT                   /translation="MSQAQIDEIFALLDSAAKVLIDQGVLPADWQNNSQITRSKSPEHG
FT                   DYASNIALTAAKAAKSNPRALAEQLTAALPANDSIAKLEIAGPGFINIFLNTDAKFAVL
FT                   DAIFAKNQKYGLTDEFANKKIQVEFVSANPTSSLHVGHGRGAAFGMSVANLLEAVGYEV
FT                   TREYYVNDAGRQMDILATSTYLRYLQLNGEQIHFPVGGYQGDYVTDIAQTIKTQQNDAY
FT                   VHSYADISANAPEDEVSEVNDAGEKEVVSGDKNAHIDVIIANSKQALGDNYAVFLNAAL
FT                   SEILGDIKDDLNEFGVRFERWFSEKSIADEIEPVLAELDSKGHLYEKDGNIWFRSTDFG
FT                   DEKDRVVRRANGLTTYFASDIAYHKNKFERGFDTVINVWGADHHGYIARVRAALTALGI
FT                   DEKRLEVILVQFVALWRGEEKIQMSSRSGKFVTLRELREEVGNDAARFYYVARKPEVHI
FT                   DFDLELAKSQSKDNAVYYIQYAHARVCSVLEKLAAKGFDVDDAQGSAQQHLLTADAESE
FT                   LIKLLAAYPATLKRAATGYDPHVLTNYLKDLASLFHAWYNDNRILPVSIIADETPSQEE
FT                   LDMMQARLRLSKAVRQVLANGLSLLGLSAPTSM"
FT   gene            350161..350988
FT                   /locus_tag="PsycPRwf_0295"
FT   CDS_pept        350161..350988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0295"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93250"
FT                   /db_xref="GOA:A5WC59"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC59"
FT                   /protein_id="ABQ93250.1"
FT                   /translation="MLAKKPKGAVQKRQGGGVASLLWMFVGAILTVMCLGVLYLWNPFD
FT                   LGSETKAEQKTVEPINQPKSETNDFEFYDLLPDQEMISVPDEAVFDQDTQTTTAPDVLQ
FT                   PDVVVTTPSTQTRDNSTQSIDDLAGVQDNSTQTPVKPNAPAASGDNDIVIVEEEGTYDD
FT                   PTPATSSGNQTSQSTGQANRVTQAGVKPAAASRAPSYILQINSFSSADEADKRRAQVLM
FT                   AGVDAKVVKSKMNNGQVFYQVVSPTMTSRQNVVAAQQKLQNNGIDSLIVEQRR"
FT   gene            351076..351834
FT                   /locus_tag="PsycPRwf_0296"
FT   CDS_pept        351076..351834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0296"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein, IclR; Transcriptional
FT                   regulator IclR-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93251"
FT                   /db_xref="GOA:A5WC60"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC60"
FT                   /protein_id="ABQ93251.1"
FT                   /translation="MPKVSSITRVLQIIEAVSYAAKPITPLELSQELDIPKPTIHRLLQ
FT                   QLVDEGFVTIDITGGIIAGRRVRNLSVELWQQRQFYSERHVILQRLVRDVKETCGISVP
FT                   HNMHMIYTNRAKTDLPLQIYLPVGAKSPMWCTATGKLYLSQLSPERRDKMLQNLSLDKF
FT                   TKNTITDVDKLNIELDAIAKTGIGIDNEEFISEMVAVSVPILDKKDRYLASLYMHAPTV
FT                   RVSLEDMMQSVPRLQEAALDIQALVYELQS"
FT   gene            complement(351928..352857)
FT                   /locus_tag="PsycPRwf_0297"
FT   CDS_pept        complement(351928..352857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0297"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="TIGRFAM: 3-hydroxyisobutyrate dehydrogenase; PFAM:
FT                   NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93252"
FT                   /db_xref="GOA:A5WC61"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011548"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR031629"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC61"
FT                   /protein_id="ABQ93252.1"
FT                   /translation="MTQNTPKIAFIGLGNMGGPMAKNLLKNGYQVTVYDLSEAAQQQLS
FT                   DAGASTSSSPKQAVQGADVVITMLPASKHVNTVYLGDAEATQLTADGLLSELPSGTLVI
FT                   DSSTIDAAAARNVARIATTKGIDMVDAPVSGGTAGAEAGTLTFIVGGEDSAFNRAEPIL
FT                   KAMGKNIFHAGSNGAGQVAKICNNMLLGILMSGTAEALNLGVKNGLDAKVLSDIMLQSS
FT                   GRNWTLEVYNPYPGVSETVPSSRGYIGGFMSQHMHKDLHLALQAAEDINAEVPMGAQAA
FT                   ALYDEHIKEHNTKDFSSIMAHFDSSVLR"
FT   gene            complement(352971..354254)
FT                   /locus_tag="PsycPRwf_0298"
FT   CDS_pept        complement(352971..354254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0298"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93253"
FT                   /db_xref="GOA:A5WC62"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032259"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC62"
FT                   /protein_id="ABQ93253.1"
FT                   /translation="MSDNIASTAASTEASVLFATHTTQSGHVIGEMTLNSPKSLNALSI
FT                   DMCQLMSAKLTQWQNDSKVVAVLLRGSGDKAFCAGGDIRKLYDSMLDNPPMPNPYATDF
FT                   FGSEYALYRQMHFYGKPIILWGNGIIMGGGMGLMAACSHRIVTETTKFAMPEISIGLFP
FT                   DASGSWFLQRMPAKTGLFLGLTGALCNARDAKFASLAEYALPSSQYQQVIDTLAAAAWE
FT                   DAPASSALYSQAHRVAHHSLAELEQSANAADNADVVFKPSKLAEHWASIQTLMVSGGLK
FT                   EIDARLQDDAALAEIDPNFAEDSWTQRALATYRAGCPVTAALTYELFHRVKDLSLEQIL
FT                   YVEANVAVHCANNPDFKEGVRALLIDKDKNPNWSRTLQHCLSQEGRAYINSHFDNPYPK
FT                   GEHIFQEWLSVECKGSLMAQNLTHEAQS"
FT   gene            complement(354304..355086)
FT                   /locus_tag="PsycPRwf_0299"
FT   CDS_pept        complement(354304..355086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0299"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93254"
FT                   /db_xref="GOA:A5WC63"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC63"
FT                   /protein_id="ABQ93254.1"
FT                   /translation="MSNYTNLDLKIDGHVATLTLNNPPAHTWTAESLASLKQLVTDLNN
FT                   NDSVYALVIHGDGEKFFSAGADLNTFADGDKGNAISMAIAFGEAFEALSSYRGVSIAAI
FT                   NGYAMGGGLECALACDIRIAEAHAVMALPEAGVGLLPCAGGTQNLPWLVGEGWAKRMIL
FT                   CGERVDADTALRIGLVEEVVEKGEGLSTALKLAQKVANQSPVAVTLSKQLVQSARHTPP
FT                   AYNLINEREAFVKLFDTADQTEGVNAFLQKRKPTWQNK"
FT   gene            complement(355277..356443)
FT                   /locus_tag="PsycPRwf_0300"
FT   CDS_pept        complement(355277..356443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0300"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93255"
FT                   /db_xref="GOA:A5WC64"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC64"
FT                   /protein_id="ABQ93255.1"
FT                   /translation="MDFALTDDQLAYQQTARQFAQKELKPNAAEWDRNSHFPVDVIKKT
FT                   GELGFLGLYTNPDYDGLGLPRLDSAIVFEELAWGDTAVAAYISIHNMVTWMIGEYAKDD
FT                   VRADIVPRLVSGELLSSYCLTEPNAGSDAGSLTTKAVKQDGEDYYLLSGEKTFISGAGS
FT                   TDILVVMARTGDAGPKGVSAFVVDAHSEGISYGKNEHKMGWKAQPTRTIHFKDVKVPAK
FT                   NLLGSEGEGFKFAMKGLDGGRINIGICAVGTAQAALETALNYVQERKQFGSAIAELQSV
FT                   QFKLADMLTQTIAARQMLYLAANKVDKKHSDATTYCAMAKRLATDLSFAVANEALQLHG
FT                   GYGYLNEYPLERHVRDLRVHQILEGTNEIMRVIVSRKMLSDGALDSLR"
FT   gene            complement(356685..358172)
FT                   /locus_tag="PsycPRwf_0301"
FT   CDS_pept        complement(356685..358172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0301"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93256"
FT                   /db_xref="GOA:A5WC65"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC65"
FT                   /protein_id="ABQ93256.1"
FT                   /translation="MHHVKQLINGEFVDSNTQEWIDLTDPATQEVIAKVPQTTNDEINE
FT                   AVAAAKEAFKTWRKTPITTRARIFLTYQALIREHMDELAELLTSEQGKTIADARGDVFR
FT                   GLEVVEHAAGIANLQMGDFVENVATGVDTYSIWQPLGVCAGITPFNFPAMIPLWMFPMA
FT                   IATGNTFILKPSEQDPMVTLRLVELAIEAGVPKGVLNVVHGGKPTVDAICDHPDIKAVS
FT                   FVGSTNVGHHVYDRASKAGKRVQCMMGAKNHAVILPDANKEQTLNQLAGAAFGAAGQRC
FT                   MALSVVVLVGDAKDWVDEIKAKAESLVVSAGKHDKDLGPLISPQAKERVERLIQTGVDE
FT                   GAKLLLDGRGITVEGYENGNFVGPTIFDNVTTDMQIYSQEIFGPVLCIMRADSLDEAIE
FT                   IINANPNGNGTAIFTQSGAAAHKFQQDIDVGQVGINLPIPVPLPMFSFSGSRASKLGDL
FT                   GPYGKQAVQFYTQTKTVTARWFDDEASKGKVNTTISM"
FT   gene            complement(358463..360475)
FT                   /locus_tag="PsycPRwf_0302"
FT   CDS_pept        complement(358463..360475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0302"
FT                   /product="propionyl-CoA synthetase"
FT                   /EC_number="6.2.1.17"
FT                   /note="TIGRFAM: propionate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93257"
FT                   /db_xref="GOA:A5WC66"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR012694"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC66"
FT                   /protein_id="ABQ93257.1"
FT                   /translation="MNHSHSPYVTSATESFAELHQNSLSDPNAFWGKQAERIYWHKPPQ
FT                   QVLDDSNLPFAKWFVGGETNLCYNCVDRHLEARAEQDAFVWVSSEINQELLDNHPGVAE
FT                   AFKALDNHVEFYTDYAKRRLTYNRLYKEVNYFADVLQRLGVGKGDRVVIYMPMILEAAY
FT                   AMLACTRIGAIHSVVFGGFAAHNLAVRMSDAEAKLVITVDAGLRGGKVINYKNLVNQGV
FT                   EQAEHKPEHVLVVDRGIMPYERQAIDVDYATERRISCDNRAVVEPVWLESNEPSYLLYT
FT                   SGTTGTPKGVQRDTGGYAVALTTTMDYIYDGNPGETFWAISDIGWAVGHSYTIYAPLLA
FT                   GLTSIMYEGLPHNPNPGIWWRIVEANKVNILFTAPTGVRMLKKQDESWLTRYDTSSVKS
FT                   FFLAGEPLDEPTGEWLSGHLGVPIIDHYWQTETGWPILSHVPKFDYKAHRPGTPGYPMY
FT                   GYDAKVLNEETGEPCQPGEKGLLAISAPLPPGCLTTVWRNDERFMKSYYSLFNGKQYSS
FT                   SDYAMIDEDGYYHILGRTDDVINVAGHRLGTQEIEAAISEHPEVAEVGVVGIKDELKGE
FT                   LPIAFCILRDPSVIEETENRFRVEQQIMGVVAKSLGALARPAAIYFPKALPKTRSGKIL
FT                   RRAIRALAEGQDTGDMSTLDDPTAIDAVKAAIENY"
FT   gene            complement(360701..361909)
FT                   /locus_tag="PsycPRwf_0303"
FT   CDS_pept        complement(360701..361909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0303"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93258"
FT                   /db_xref="GOA:A5WC67"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC67"
FT                   /protein_id="ABQ93258.1"
FT                   /translation="MQTDSSTPFNSLQAPSFVLKMTAMLIGVFAFLQVYSIQSILPVLM
FT                   LDFKASEVQVGMAVGATVMAVAIMSPFLGMLSDAVGRKSIIVGALLFLAVPTALIAHSQ
FT                   SIESLTIWRFLQGLSVPGITVVTIAYLGEEFKGHAVAELMSYYVSGSVLGGFLGRFILG
FT                   HLHEWVGWRIAYYFMAVLTVAGALWVAKTLPASQHFVASPKFRTSLTTLGNHLTNRYVV
FT                   SASLLGFCVLFSLVGCFTFINLHLAQQPYHLTTGQLANIFAVYLIGVIITPLSTKLLQR
FT                   FGSVRTIITAVLMSMLGVLITLSGPLWLILIGISIMSSGVFITQSATIGYIATNVHHGR
FT                   SLASGIYYMGYYAGGTAGAWLCGLAYAYGQWHFTVWVLLTVQVIALLIASIGMVKTSNN
FT                   PAD"
FT   gene            complement(362108..363037)
FT                   /locus_tag="PsycPRwf_0304"
FT   CDS_pept        complement(362108..363037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0304"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93259"
FT                   /db_xref="GOA:A5WC68"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC68"
FT                   /protein_id="ABQ93259.1"
FT                   /translation="MAPYIDQEVITHFYQGHVAAITGAGSGIGRALALNLAQAGCNLAL
FT                   SDINAKNLAETEQLLKPFEIKITTQALDVSDKQAVFGWADHVMQDHTQVNFIFNNAGVA
FT                   LSSTVEGESIEDIEWVMGINFWGMVYGTKAFLPLIKQSMQQAGNAKHGHIINISSLFGI
FT                   IAQPAQSAYNASKFAIRGFNESLRQELDIERSGVSITSVHPGGIKTNIANNARGNESVS
FT                   ALGMATGVKGLKSFNKLLKFDPDMAAKIILMAAAKNQPRCLIGDDAKLIDLLQRLCPSH
FT                   YGKIMNKANKLAAKAKKSRRKRTTTQKQ"
FT   gene            complement(363423..364700)
FT                   /locus_tag="PsycPRwf_0305"
FT   CDS_pept        complement(363423..364700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0305"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /EC_number="3.4.21.92"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, ATP-binding
FT                   subunit ClpX; PFAM: AAA ATPase, central domain protein;
FT                   zinc finger, C4 domain protein; ATPase AAA-2 domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93260"
FT                   /db_xref="GOA:A5WC69"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WC69"
FT                   /protein_id="ABQ93260.1"
FT                   /translation="MAKDKTPQCSFCGKKKDEVAQLIAADDANICNECVALCTDLIEEG
FT                   DLNTVDSEDGEVNTWLTKKLPTPKEIREHLDGYVIGQETAKKALSVAVYNHYKRLKVAA
FT                   KLAEDKKQAKLGADDAMVELSKSNILLIGPTGSGKTLLAQTLARMLDVPFAMADATTLT
FT                   EAGYVGEDVENIVQKLLQAADYDVEKAEQGIIYVDEIDKISKKGENMSITRDVSGEGVQ
FT                   QALLKLIEGTVAAIPPHGGRKHPNQELIQVDTSNILIIVGGAFSGLDKVIQQRTEKTGI
FT                   GFNAEVKSKDDGKQLSELFKQVEPEDLIKFGLIPELIGRLPVIATLEELDEEALMQILT
FT                   EPKNAIVKQYQYLFEMEDAELSFTEAGLKAIAHKAMERKTGARGLRSIVENALLDTMYE
FT                   LPSMSDAKQVVVDEDVINEGAAPKIA"
FT   gene            complement(364905..365627)
FT                   /locus_tag="PsycPRwf_0306"
FT   CDS_pept        complement(364905..365627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0306"
FT                   /product="ATP-dependent Clp protease proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="TIGRFAM: ATP-dependent Clp protease, proteolytic
FT                   subunit ClpP; PFAM: peptidase S14, ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93261"
FT                   /db_xref="GOA:A5WC70"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC70"
FT                   /protein_id="ABQ93261.1"
FT                   /translation="MTHQNTQQDIERIINNPHFETLVAAHDAVLRNMRDATVSVPQAAL
FT                   VPMVVEQSARGERSFDIYSRLLRERVIFLTGQVEDNMANLIVAQMLFLEAENPEKDIHL
FT                   YINSPGGSVSAGLAMFDTMNFIKPDVSTICMGGAYSMGSFLLAAGQKGKRYALANSRVM
FT                   IHQPSGGAQGQATDIEINAREILKIRDRLNRILAERTGQPLEKIERDVERDYWLDAQEA
FT                   KAYGLVDEVLERRPEEAK"
FT   gene            complement(366062..367399)
FT                   /locus_tag="PsycPRwf_0307"
FT   CDS_pept        complement(366062..367399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0307"
FT                   /product="trigger factor"
FT                   /note="TIGRFAM: trigger factor; PFAM: peptidylprolyl
FT                   isomerase, FKBP-type; trigger factor, C-terminal domain
FT                   protein; trigger factor, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93262"
FT                   /db_xref="GOA:A5WC71"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WC71"
FT                   /protein_id="ABQ93262.1"
FT                   /translation="MAKDLQVTTSKVNDNQTQLTVKVPVEQIQNKVEGRIRNVAKTAKI
FT                   DGFRKGKVPVSHIRAQYGAGIQQEVINDVIRDTVFEAIKAEDVRAVGMPNIDDVKLEDE
FT                   FLVYQATVEIFPEIKVEGMSDIEVERHTATITDEDVDTMIENLRKQRQEFAEKEGAADE
FT                   GDQVTFDFEGSIDGEKFEGGSAEDFKLVLGSGQMIPGFEDGIKGLAAGEEKTIDVTFPE
FT                   DYQAENLAGKEAQFKINVKKVEEAKLPEINDEFLELFGVKEGGVEQLKTDVRKNMTREI
FT                   KNAARNQVKQAAFDALLEKNEFDVPSAMVDQEVDRQRNLMMQRFAQQFGGNANSIDKDM
FT                   LPRELFEEQAIRAARLGVLVSRVIEENDLKVDQERVETFIKETAENYEDPQEVIEYYTN
FT                   DAQQRANIESVVLEDQVVDFLLEQGKVTDKEVGYQELLASQQQGMM"
FT   gene            complement(367799..368452)
FT                   /locus_tag="PsycPRwf_0308"
FT   CDS_pept        complement(367799..368452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0308"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93263"
FT                   /db_xref="GOA:A5WC72"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC72"
FT                   /protein_id="ABQ93263.1"
FT                   /translation="MTASLSSSLAHDSATQHWVLASNNQGKLSEFKRLFGAAKLNIDIV
FT                   PQGELNIEDAVEDGLSFIENAIIKARHASRISGLPAIADDSGLCVPVLGNAPGIYSARY
FT                   AGEHGNDANNNTKLLADLLPLRHKNPNAPITAYFVCVLALVRHADDPLPIIAQGLWQGE
FT                   ILEAPQGEHGFGYDPLFWVPELKLTAAQMPAEQKNAISHRGRAMQSLLQQLSAQ"
FT   gene            369362..369991
FT                   /locus_tag="PsycPRwf_0309"
FT   CDS_pept        369362..369991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0309"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93264"
FT                   /db_xref="GOA:A5WC73"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC73"
FT                   /protein_id="ABQ93264.1"
FT                   /translation="MSNITLPDLPYAKDALEPHISAETLEFHHDKHHAAYVNKLNELLP
FT                   GSGLEGKALDEIITATAKDDSKQGMFNQAAQVWNHTFYWNCMTPDNGGGEPTGDLKAKI
FT                   EEDFGSYDKFREEFKNAATSQFGSGWAWLVADSVGGKLSIMKTANADTPLAHGKVAVLT
FT                   CDVWEHAYYIDYRNRRPDYVDTFLEKLVNWDYANAKYKGQDAGVEE"
FT   gene            complement(370090..370929)
FT                   /locus_tag="PsycPRwf_0310"
FT   CDS_pept        complement(370090..370929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0310"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93265"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC74"
FT                   /protein_id="ABQ93265.1"
FT                   /translation="MSAQNTFHPTVYLGTGGYSDTDMLGTLYPLGTKKTDFLSEYAKHY
FT                   GAVEINSSFYAPLGQKAYEGMLRKSEAKIKFAIKLHQDFSHTLKATPEHAEAFIEAIQP
FT                   LIEADCLAPLLIQFPHGFDRTREHRLYLAKLADWFHDYPLAVEFRHASWHIAQVEHSFQ
FT                   KFGLIWCSVDYPQVKGLPNSRLLFTQSTVQHNTAKRIGYLRMHGNNLNWWDAMSASERH
FT                   DYRYTPQEMQNWAQAIANQRQHFDELYVFFQNSTNAHAYYNIAMLREALQALQFQVL"
FT   gene            371286..372641
FT                   /locus_tag="PsycPRwf_0311"
FT   CDS_pept        371286..372641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0311"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; Shikimate/quinate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93266"
FT                   /db_xref="GOA:A5WC75"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WC75"
FT                   /protein_id="ABQ93266.1"
FT                   /translation="MNLVVIGVNHKTAPVALRERLAFVGGDIQVAQAQLQQITAGSLII
FT                   STCNRTEIYALAPSTQLLANSDAALSKQSDLSLADEPVSTVDLTEQLITWLADFKQVPL
FT                   EETRPYLYDYVDGQALTHMLRVAAGLDSMILGEPQIFGQIKRSVNQAKEQGFLTNQLNW
FT                   VVEQIFAAAKRVRNETDVGTQAISLGYAASKLVTQIFDRPEETTFLLIAAGEMNRLVAQ
FT                   NIAGLGVKRILICNRTPERANLLAQELAHLGIQIEVHPLTELDSLLYQADIVSSCSGSM
FT                   DMLIDKAMTRRALKKRRYKPMLMVDLAVPRDIDSSVGKLDDVYLYSIDDLQHVIAGNLE
FT                   KRRQAAVEAELLVSHLVVEIERRFQVRKVGQDIHDYRALAAQKAEAVLNEALHELRTSE
FT                   ATAEEVMTELTRRLTQTLVHAPSSLMRRAARDGNNEAIDLIILGLKDAYRKK"
FT   gene            complement(372794..373414)
FT                   /locus_tag="PsycPRwf_0312"
FT   CDS_pept        complement(372794..373414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0312"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93267"
FT                   /db_xref="GOA:A5WC76"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC76"
FT                   /protein_id="ABQ93267.1"
FT                   /translation="MNSLLSSHTTLIIIITVIVSLLAWQNKEMMSKLIFYPPAVNKGEW
FT                   YRFITHGFVHADSTHLLFNMFTLYFFGRAVERFFNQFLGGFGFVAVYLGAIIVAMIPSY
FT                   LQHKNDPRYRSLGASGGVSAILFSFILMAPWSMLYLFAIVPIPAIVFAIAYVGYSIYAN
FT                   NKGNSNINHLAHLWGGAFGVVATILLSPSVLGHFFNALMHPSF"
FT   gene            373860..375473
FT                   /locus_tag="PsycPRwf_0313"
FT   CDS_pept        373860..375473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0313"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93268"
FT                   /db_xref="GOA:A5WC77"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC77"
FT                   /protein_id="ABQ93268.1"
FT                   /translation="MDIIGHLARTVTPAVLADNHNPQNESLLKQFYALFIAKLADQESF
FT                   TRVGSQEIHRDDLGLFDRLWTDEGQKNHIAEELAAHNNVDTISVKGLIASAAPLAFNEI
FT                   KSLAGSVPIPQFLRDNLESYRNHIPTWATSVLPAGLLGLGASAAGAHAAHATTTNTTAT
FT                   PAGHRISDTTSTEPLVREEKESGGFLKALLPIIGLIILAALAWALLKGCQKDPAPVATP
FT                   EQTVQQPAEPAVTGNTALAPAVLSLATGEGNELFACRINAGNEELSNTVMTAVKDVFGT
FT                   GGDNCRADIDDGFATDMPAAPHLAAILPLIKNTPNANVIIEGNDVRIDAPDQAQLDKLV
FT                   ADIKAAAPELNVVATGPVDFDAEVKQSIADATTAMDNLGENPDPKDVARALSLQVINFA
FT                   VDKTDIPAENQAVLDRAVEVMKQVPDMQLLILGHTDSDGDDAYNKDLSQRRAEAVKAYL
FT                   VSKGADAAKLMTKGMGETDPIATNETENGKFRNRRIEFTVYDESVAGMDTPITVTPSDS
FT                   ADIKAPTAEATTEPQADTAQ"
FT   gene            complement(375637..376707)
FT                   /locus_tag="PsycPRwf_0314"
FT   CDS_pept        complement(375637..376707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0314"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93269"
FT                   /db_xref="GOA:A5WC78"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022956"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC78"
FT                   /protein_id="ABQ93269.1"
FT                   /translation="MYGPLMIDVAGTELTAEDRDVLSCEQVGGVILFARNVETPEQVRR
FT                   LCDEIHQQQPDIIIGVDQEGGRVARLRQGFTPLPAMGKLGDLFDSDPCGALSLAYDCGY
FT                   LMAAEVMAVGIDISFAPVLDINGVSQVIGDRSFHARTEAIVALSSQFMRGMKAAGMATT
FT                   GKHFPGHGSIAPDSHVADVIDNRSFEQIKAVDLQPFIQCQPWLDALMPAHVIFSQVDDK
FT                   PAGFSKVWLQDIAREQLGFNGVLFSDDLSMKAAHVAGDVSARVTAALEAGCDMALVCND
FT                   REAALQAIQTSAQLPKPNQTRLEAMRSQLPTWQGSLEATCAQFDYWAVAKQNITQAFFN
FT                   EPLVAAQATDPTDYKR"
FT   gene            376938..379145
FT                   /locus_tag="PsycPRwf_0315"
FT   CDS_pept        376938..379145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0315"
FT                   /product="C-terminal processing peptidase-1, Serine
FT                   peptidase, MEROPS family S41A"
FT                   /EC_number="3.4.21.102"
FT                   /note="TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   PDZ/DHR/GLGF domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93270"
FT                   /db_xref="GOA:A5WC79"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR020992"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040573"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC79"
FT                   /protein_id="ABQ93270.1"
FT                   /translation="MRFQPTQLVLSAAAIGMAGVVLSHSYSSAVAADKSAFVATPEQKL
FT                   TTRQVAALLDRAHYSNKRFDEAMGRKVLDMYFDRLDPNHTLFLQSDINELTTKYGATFA
FT                   DRLKQGDLSAVQAIFNRYTQRSNEYYNFADKFLSKPVNLNRNDSVVLDREKEPRFKSAS
FT                   EQQGYWGRQLTLQIINLTLGQEEDKARDELYTKNPELTKGNDLILGEDRSPQEILLNRL
FT                   HRQQEQLQRIKSDEIMESVLNTATLTYDPHSNYYAPVQSVEMQVQSNLQLEGIGVSIRP
FT                   YRKNPDYTQIVTLVDGGPAAKSGKVQPNDLIMAVAKDGENMQDVVGWSTREVVALIRGK
FT                   RGTDVTIKVKQPNSPDASARTIVITRDVIEQEDAGVTHRVITVKPEGSTEEKRIGVLEI
FT                   PSFYLNYQARRSGQNYRSVSIDTQKELEKLDKENIDGLVVDLRNNPGGSLDEVAKMLGL
FT                   FIKEGPLVQIRDNQGNVQVYQDEDGGKQLYSGDMVVITNMASASASEIFAAAIQDYGRG
FT                   LVVGSTTTGKGSAQIQLDSLALGSATLTQRKFYRITGGSTQNKGVVPDVSLVNIYEGAE
FT                   FSERDQKNAMAWDTIKTSPYKPEGKFSSKTLATLNQQSKIRQTTNPQFVYLDTLNKLRN
FT                   MEDDKNAVKLNITERRAHQKQIEQKTLDAENARRKATGQKPYASWTEYQAAVEAMFEER
FT                   SRLKNDERPKLPEEEAYVIEAAKLMLDARKLQKFDELRSAK"
FT   sig_peptide     376938..377033
FT                   /locus_tag="PsycPRwf_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.603 at
FT                   residue 32"
FT   gene            complement(380014..380217)
FT                   /locus_tag="PsycPRwf_0316"
FT   CDS_pept        complement(380014..380217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0316"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93271"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC80"
FT                   /protein_id="ABQ93271.1"
FT                   /translation="MNKDTFKGEWKQLKGNIKQQWAELTDDDLTHAEGSFDKLVGRIQE
FT                   RYGDTKEKVEQQVHDWRTKHDV"
FT   gene            380341..381093
FT                   /locus_tag="PsycPRwf_0317"
FT   CDS_pept        380341..381093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0317"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93272"
FT                   /db_xref="GOA:A5WC81"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC81"
FT                   /protein_id="ABQ93272.1"
FT                   /translation="MPRTMLKDEHWTRLKPILLELNIYDKGNLRQTVEGVLYRMRVGCP
FT                   WRDLPEYFGKPNTIYKAYQRWSRSNKLIALFTLLIKDADLEWVFIDGTHIKAHQHSSSG
FT                   NENLQSISKSVAGRATKIHLAVDAHGNPITFLLSDGTTHDVKVAPDLIDKVNLSNTEVL
FT                   CADKGYDSDALRAHIEQAGTQDNIPRKRNTQYSNDHMDWDLYKARHLVENAFAKLKQYR
FT                   AVATRFDKLKQSYENTVALACAYIWLKL"
FT   gene            complement(382403..384067)
FT                   /locus_tag="PsycPRwf_0318"
FT   CDS_pept        complement(382403..384067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0318"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93273"
FT                   /db_xref="GOA:A5WC82"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC82"
FT                   /protein_id="ABQ93273.1"
FT                   /translation="MSNSTTKPSLHRKLNQPLTLFWRLFLSMLTILLLTSALSVGIERW
FT                   MNAKELNNRMQLQIARLLVARQNTMAALSEDDLDTVRQLYRDERWLMAQMRIIDQQGQI
FT                   LFPKFGRFRSQHETLGPPSPPDRDSHSRPPPELPPPLSEPSWQQVSADVLNYPELQDTT
FT                   VTSASGQTYTVQLQPRLSLRDLASLRKDHTLIRVVLILVFSILVCYWLSQALTRRIHRL
FT                   QKAVHLMSEGRFKAGEELTDLGNDELGALAKDVSKLSTRLADSELARKQMLSDISHELR
FT                   SPLARLEVATELTRDFAPEASHYLDRIEKESARMNELIEHIIRIQSLQMRQYALDIEAY
FT                   QPVNLYALLDEIREDVCFEFQDKGVTWQWQTSPTILGLSTSSYPKPSAVSSNYRSDSSH
FT                   ESRSATISRQATAYTLLGDQEQLHSAFENIIRNAYTHTAPNSVVTVVLQSIIDEKTKNP
FT                   AIKLQVMDAGDGVADTDLQRIFQPFVRLSASRERLSQTPTASVNSPQKYSGYGLGLAIA
FT                   HAIVIAHQGRLVAYNRQDGHSGLVIEAILPIHSTLES"
FT   sig_peptide     complement(383942..384067)
FT                   /locus_tag="PsycPRwf_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.525 at
FT                   residue 42"
FT   gene            complement(384181..384852)
FT                   /locus_tag="PsycPRwf_0319"
FT   CDS_pept        complement(384181..384852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0319"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93274"
FT                   /db_xref="GOA:A5WC83"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC83"
FT                   /protein_id="ABQ93274.1"
FT                   /translation="MTHILLGDDDKELTDLLQEYLTNHGIRCDCAYDGEQVLNKIKSQP
FT                   YDLIVLDIMMPKIDGLNVLRQLPTLTQTPVIMLTAKGDEIDRIIGLELGADDYIAKPCN
FT                   PRELLARINAVIKRTTMQQSDIVPLEHERLQLDQVHRICTVDGETLQVTGTEFDLLVAL
FT                   LQQQGNVASKEWLSQTVLQRELQPLDRSLDVHVSRLRKKLQPYHEDPIKAVRGKGYQLV
FT                   L"
FT   gene            385199..385756
FT                   /locus_tag="PsycPRwf_0320"
FT   CDS_pept        385199..385756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93275"
FT                   /db_xref="GOA:A5WC84"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC84"
FT                   /protein_id="ABQ93275.1"
FT                   /translation="MKKFVLGSVLALSGSLAMVGCTQASAVSESQANPATQMQHKQGGH
FT                   GQYKGHKGGHEMGRMGKKGAGFEKLNLTEQQKAQMQALRKAQMEKRQGERAQRQAQMQQ
FT                   TRAQTEALINSPTINATALNTLADRQAAIAKQQFVERIQAQHAMAQILTPEQKATLKQM
FT                   REERQAKFKNKAKGEHKGQTTQ"
FT   sig_peptide     385199..385279
FT                   /locus_tag="PsycPRwf_0320"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.864 at
FT                   residue 27"
FT   gene            complement(385909..386652)
FT                   /locus_tag="PsycPRwf_0321"
FT   CDS_pept        complement(385909..386652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0321"
FT                   /product="aminomethyltransferase related to GcvT-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93276"
FT                   /db_xref="GOA:A5WC85"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC85"
FT                   /protein_id="ABQ93276.1"
FT                   /translation="MSNLSFKQITLQGDDAAKFLQGQITVNVNRLTASYQPAAIANLKG
FT                   RIEFGLWIKKQDDKQFDIVISSDCLAPLQAHLKKFGAFSKFTISEPIDIYPYVGNEAGQ
FT                   AQPTFSENADEQNMTDWMSASIATGNYWITEATQTLFQPQELRLHQRGGVDYDKGCYLG
FT                   QEVIARIYFKAAPKAFLHRVKGTGAAPKAGESLDKIQVVNAIDLADGSGYEALVVARPE
FT                   QLEQAQQLHVLDLPPALQASVARDA"
FT   gene            386898..387248
FT                   /locus_tag="PsycPRwf_0322"
FT   CDS_pept        386898..387248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0322"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /note="TIGRFAM: alkylphosphonate utilization operon protein
FT                   PhnA; PFAM: PhnA protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93277"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC86"
FT                   /protein_id="ABQ93277.1"
FT                   /translation="MSLPNCPNCDSDLTYEDGALLVCPMCAHEWTAAEADGTSAETENV
FT                   IRDAVGNELQDGDAVTVIKDLKVKGSSTPLKVGTKVKSIRLIHDAPDDHDIDCKVEGFG
FT                   QMKLKSSVVKKA"
FT   gene            complement(387399..388283)
FT                   /locus_tag="PsycPRwf_0323"
FT   CDS_pept        complement(387399..388283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0323"
FT                   /product="DegV family protein"
FT                   /note="PFAM: DegV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93278"
FT                   /db_xref="GOA:A5WC87"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC87"
FT                   /protein_id="ABQ93278.1"
FT                   /translation="MSRIVLSTSSSGLDDMDIKHNIELIRLRIHVNNVEFIDGKNISSE
FT                   RLQHLMNEVSHSPVHTSPAPAHEVAMMLSGLQNKGVKEVFITTLSSQVSDSYQIISEVA
FT                   QSFKDSMNIYVYDTKDLNACEALLALEADYLMQQNYAMQDIASRLDALRRSHHMLFAAD
FT                   DLSYLIKNKKVSTTAGFFANLFSIKPVLQVSDAGDVVPISKIRKIDKAFEYMVNQFENV
FT                   IPRADSFAYVLSAGRPDLDSRFIAMLKQKTGVTDIAVLPVSAISLANHGPSGLGLCVFE
FT                   GDVPSAAKLFAKF"
FT   gene            388609..389718
FT                   /locus_tag="PsycPRwf_0324"
FT   CDS_pept        388609..389718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0324"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93279"
FT                   /db_xref="GOA:A5WC88"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC88"
FT                   /protein_id="ABQ93279.1"
FT                   /translation="MSKKSNKSEKISDAYVTNPKKIEKYETQKKKDSSRIKTKEVIDQV
FT                   LLKQLAEGNIEAISDRIQSLIHDASPDDLEKLKNLFANHALANAVKTGTKRDDELSDNW
FT                   REGGYPYKNRLSRKNYEKQKYHLQVELLKLQKWVRENDKKVVIIFEGRDAAGKGGSIKR
FT                   FMEHLNPRSSRVVALEKPTEREMGQWYFQRYVQHLPSAGEMVFFDRSWYNRAGVERVMG
FT                   FCTEEEYATFMRQTPEFEKHLIDSGIHLIKFWFSVSRDEQRRRFAQREAHPLKQWKLSP
FT                   IDLASLDKWDEYTLAKEAMFYNTDTAESPWIVIKSDCKKRARLNAMRYVLNRLPYDGRD
FT                   KSQVGNVDPLIVGRAGALYELGEKSDLEI"
FT   gene            complement(389854..391644)
FT                   /locus_tag="PsycPRwf_0325"
FT   CDS_pept        complement(389854..391644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0325"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93280"
FT                   /db_xref="GOA:A5WC89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC89"
FT                   /protein_id="ABQ93280.1"
FT                   /translation="MSKHPMRSHSELDSAARHAPAFRLRDMFKPSFDLWLISWGLGLIT
FT                   ALSMIALLMISGWFITGAALAGMIAVGSHSFNYMLPAGIIRMLAMARTAGRYGELMVSH
FT                   HAVFDLLKTLRLRFFNRLAALPLTQQRSALQASQYMHRLVSDIDKLDEFILRVISPWLI
FT                   GGLSVLLLGVFIGWALPIASSFKLIIYVLLALSLVIALLASYNGIAQAKQLSQVSEARR
FT                   QQLLSPLAIITQLLLWQQWQTQTQGYVAQDNQLQKLQWQAQKRRSVYMLLIQWLFYLAV
FT                   LTVLFAIYSVTQGGSETTLLPKLQSVIEVPLVLAVTLGLLGIQEIVVPLGQHYLALGNS
FT                   IAAKDRLNDLLSSSRPTPTPNQANTDTDTVSTSAPKPLHRLPQAPLQAELIYVSAKIEG
FT                   ALVGAKEVSVTVNSGTPLIIKGPSGCGKSTLLQALAGELPLQSGEIQLNGKNWFEYDWQ
FT                   DQLGYLGQQLDIFDQSLAANLRLGKPEASDEELIAALDKVGLLGWLQAQPQGLDTALGE
FT                   YGAAISGGQARRIALARLLLKPRRVLLLDEPFAGLDAPTRAQLWQNVREHQKQNLLIVV
FT                   SHHQWDMGLCDSISLPETQL"
FT   gene            complement(391637..393475)
FT                   /locus_tag="PsycPRwf_0326"
FT   CDS_pept        complement(391637..393475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0326"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD; PFAM:
FT                   ABC transporter, transmembrane region; ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93281"
FT                   /db_xref="GOA:A5WC90"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC90"
FT                   /protein_id="ABQ93281.1"
FT                   /translation="MATLSTAEKDFLKKLVNTVRRPLTMAWLLTVISSLLFVWQAWLLA
FT                   SLFSHWLSNYFNQVPLSSGVSGSWFVGLIICFALRPLLNTGRELLSTQASLQVRSDLRS
FT                   SLLITMAKLGPNLRHFGSDGSLSSQIIDQTDALDGFISRFSVQKQVTLSTPLILLVAVA
FT                   WQSKFAAALLLMTAPLVPIFMILIGHLTARKSAAQFGALSQLSGRFLDWIRGMPTLKRL
FT                   QATPIAEHDLAVSSEDYRRRTMDVLKIAFLNGAVLELLAALSIALVAVYLGFGLMGILP
FT                   WDKGDVPVPYFGALFILLLAPEFYVPLRQLGADYHAKAEAEGAVQSLLPIINAAESANA
FT                   VVIPQQPDTPPTSTTTLPQSFGLQLSKVSIQTAVVDIQAPQEDSAPLADNDCTAAVYRS
FT                   RLAPLTVDIEPGARVALVGESGSGKSSLLQALMGFVSYQGDITLYNAAENFSQNLQHIA
FT                   PEQLRQKLGYLAQQVALMPLSIAQNLRLANPDASDAQLIEVLKQVELWSLIERLPQGMD
FT                   TLLGERGQGLSGGQQQRLGIAQLLLRNDSLWLLDEPTEHLDPDTAQRIHQLLQHVSLGK
FT                   TVIWVTHAKEQLPWLDKVIAISAPVTASVAQGADYE"
FT   gene            394133..395731
FT                   /locus_tag="PsycPRwf_0327"
FT   CDS_pept        394133..395731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0327"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93282"
FT                   /db_xref="GOA:A5WC91"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC91"
FT                   /protein_id="ABQ93282.1"
FT                   /translation="MITEHLVDISRLQFAVTALYHFLFVPLTLGMVWILVIMESVYVTT
FT                   GNPIWKDMTKYWGKLFGINFALGVTTGITMEFQFGTNWAYYSHYVGDIFGAPLAIEGLM
FT                   AFFLESTMVGLFFFGWDRLSRAQHLIVTMLMALGTNLSALWILIANGWMQSPVGASFSY
FT                   ETMRMEMDSFATILFNPDAQNKFVHTVSAGYVTASMFVLSISALYLLRKRDVPFAKRSF
FT                   QVASAFGMASILSVIVLGDESGYSIGAAQQTKMATIEAMWHTEPAPASFNLIAGINEKE
FT                   QKNDWQIQIPYAMGIIGTRSLDKEIPGIHEIKEVNRGRIMNGMQAVDLLEQLRENPQDA
FT                   ALKTQFEAVKEDLGFGLLLKKYTEDVTQATPDMIQKAVDDTIPAVKPMFWSFRGMVGLG
FT                   FLMLALFAVSMWHTIKGNFAEKTWLLKWAVIMLPAPWIAIELGWFVAEYGRQPWTIYGV
FT                   LPTYLSVTNFSVANVYGSLAGFVGFYTILLIIEVYLMVKYVKLGPASLGTGRYDGETPR
FT                   NVTPVHSNKEVNDVI"
FT   gene            395721..396860
FT                   /locus_tag="PsycPRwf_0328"
FT   CDS_pept        395721..396860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0328"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="TIGRFAM: cytochrome d ubiquinol oxidase, subunit II;
FT                   PFAM: cytochrome bd ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93283"
FT                   /db_xref="GOA:A5WC92"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC92"
FT                   /protein_id="ABQ93283.1"
FT                   /translation="MLFDYATLKLIWWLLVGVLLIGFAIMDGHDMGVGSLLPFVGKNDD
FT                   ERRVVINSIGAHWEGNQVWFITAGGALFAAWPMVYALAFSGFYWAMMAVLWALFFRPVG
FT                   FKYRNLVKDQRWRNAWDWGLFVGSFVPAVVFGVAFGNLFLGVPFSFDQMMRSTYTGSFF
FT                   QLLNPFALLCGLVSVTLLIMQGGAYLAHRTEGVIQDRTVKYAMISAIVMVVLFVGAGVW
FT                   IQSIDGYAITSQIDPAALANPLTKEVVVQPGAWMANYAKYPMAWAFPALGIIMPLLTAV
FT                   LLKARKTLTAFVTSSLAIVGVIMTAGVSLFPFIMPSSTAPNASLTIWDSVSSHLTLMVM
FT                   LYVVVLLLPIVVFYTSWAYSVMRGKVTVAYIRENDHTSY"
FT   gene            396887..397042
FT                   /locus_tag="PsycPRwf_0329"
FT   CDS_pept        396887..397042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0329"
FT                   /product="cyd operon protein YbgT"
FT                   /note="TIGRFAM: cyd operon protein YbgT; PFAM: membrane
FT                   bound YbgT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93284"
FT                   /db_xref="InterPro:IPR011724"
FT                   /db_xref="InterPro:IPR012994"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC93"
FT                   /protein_id="ABQ93284.1"
FT                   /translation="MWYFAWILGLGFAVLLAIVNAVWLEHEQGRLDSYKPKPKPSENPN
FT                   LNKTLK"
FT   sig_peptide     396887..396952
FT                   /locus_tag="PsycPRwf_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.937) with cleavage site probability 0.879 at
FT                   residue 22"
FT   gene            397233..398561
FT                   /locus_tag="PsycPRwf_0330"
FT   CDS_pept        397233..398561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0330"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93285"
FT                   /db_xref="GOA:A5WC94"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WC94"
FT                   /protein_id="ABQ93285.1"
FT                   /translation="MSETMNIKMSTKNEQLFLQAKKHIPGGVNSPVRAFAGVGGTPVFM
FT                   HKAAGSKIYDTEDNEYIDYVGSWGPMILGHAHPKVIEAVKAAADDGLSFGTPTTFETSV
FT                   ADIICDIVPSVEMIRMTSSGTEATMSAIRLARGYTGRDKIVKFEGCYHGHSDSLLVKAG
FT                   SGMLDIGEPTSQGVPADFAKHTITLPYNDPQAIKDCFEKWGDEIACVIVEPIAGNMNMI
FT                   VPSQEFHDTLRAQCTQGGAVLIFDEVMTGFRVGLKGAQAHFGIEPDLICFGKIIGAGLP
FT                   VGAFGGKREIMECIAPMGGVYQAGTLSGNPLAMRAGIAMFEDLTVEGFYEGVADKVTYL
FT                   VEGIQAAAHKHGIKLRSTKLGGMFGLFFVKDEATGVPQNFDEVTACDMDKFNTFFHGML
FT                   DRGIYLAPSAYEVGFMSSKHTTEDLDATIKAADDVFAEMSAAS"
FT   gene            398881..400401
FT                   /locus_tag="PsycPRwf_0331"
FT   CDS_pept        398881..400401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0331"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93286"
FT                   /db_xref="GOA:A5WC95"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC95"
FT                   /protein_id="ABQ93286.1"
FT                   /translation="MPNNFLANDELMAAIDIGSNSFHLAIARLDHGEVRKIASMSEKVQ
FT                   LAAGLDKNKILSEDAQQRGLECLARFMGRLDSVSPDRLRIVATNALRQAKNADEFIRRA
FT                   NEILPKPIEIIAGREEARLIYLGVSHTNASSDKRLVIDIGGGSTEFIIGQEFDPLLTES
FT                   LQMGCVAYTQWFFESGDITESAFQEAIADARKEILRISTTYQRTGWTSVVGSSGTIKAV
FT                   RNVLVSQGWSDEQERITYQGVKNLQKHLLKIGRVEDIDLEGVKEHRKAVFPAGVAVLRA
FT                   AMKVLGIETIAYSDGALREGVMYDMLGRFASEDVRDRSVQALIERYSVDKRQAQRVVKS
FT                   CENLYDQTHDALGLSGEDNDLLRRTAYLHEIGLAISHSGYHHHSAYLLLHSDIPGFSQV
FT                   DQGRMSQLARNHRRKLKTENFEQALEVGGPSLVYLCLLLRLAVLVHRSRNDLDKSALKL
FT                   TVIDKNHWQVSVESDSEDYALLVFDLKDDIDQFKKWGVELSVTCAGAY"
FT   gene            400454..401260
FT                   /locus_tag="PsycPRwf_0332"
FT   CDS_pept        400454..401260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0332"
FT                   /product="acetyl-CoA carboxylase carboxyltransferase
FT                   subunit alpha"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: acetyl-CoA carboxylase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93287"
FT                   /db_xref="GOA:A5WC96"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC96"
FT                   /protein_id="ABQ93287.1"
FT                   /translation="MSSVWESVGLARHAKRPLFLDYVSQLFTEFDELHGDRAFADDRAV
FT                   IGGLARFNGEPVLIIGQHRGRSTRERIAHNFGMAYPEGYRKAIRLVKLAERFNLPVMTF
FT                   IDTQGAYPGVGAEERGQAQAIAESIATFSSLKTPIIVTIIGEGGSGGALAIGVGDKVNM
FT                   LEHSIYSVISPEGCASILWKTAEKAPEASEALKLNASNLYNMGLIDAIIPEGEGAHVDA
FT                   KPVMEKLQKLLTEQLAELKQLDSVSLVEQRYQRLKGFDSTLNLVEG"
FT   gene            401654..401863
FT                   /locus_tag="PsycPRwf_0333"
FT   CDS_pept        401654..401863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0333"
FT                   /product="cold-shock DNA-binding protein family"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93288"
FT                   /db_xref="GOA:A5WC97"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC97"
FT                   /protein_id="ABQ93288.1"
FT                   /translation="MSDTIKGTVKWFNEAKGFGFIAPETGPDVFAHYSEIASSGFKTLA
FT                   EGQEVEFTVTQGAKGPQAHGITAI"
FT   gene            402172..404508
FT                   /locus_tag="PsycPRwf_0334"
FT   CDS_pept        402172..404508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0334"
FT                   /product="oxidoreductase alpha (molybdopterin) subunit"
FT                   /note="TIGRFAM: oxidoreductase alpha (molybdopterin)
FT                   subunit; PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93289"
FT                   /db_xref="GOA:A5WC98"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010046"
FT                   /db_xref="InterPro:IPR037951"
FT                   /db_xref="InterPro:IPR041953"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC98"
FT                   /protein_id="ABQ93289.1"
FT                   /translation="MRKIPVYNHPAAGWSALIDSSRVLMDYKAFLRGSLSVFGSNQPNG
FT                   GFDCPGCAWPDHKSHKTIDVCETGIKVLASEVMSAKADAEFFAKHTVSELQGYSGHELE
FT                   QVGRLAQPLQYDASQDRYVPIAWEAAFERVAEHLHRLESPHQAMFYTSGRVTNEPAFLF
FT                   QLFVRSFGTNNLPDCSNMCHEPTSVMLSRQLGVGKATVVLEDFEQAKLILMFGQNPATN
FT                   HPRMLEMLAHAHEQGCRIISINPMREQGLSRFRNPQKVTHMVSGGSDPMVDEVIQIQIG
FT                   GDVALLTGLAKWLIENDNINHEFIDQHTSGFDALKAWVMTQNWADIERGCGIDQAKIVS
FT                   LAQLVADSPATICTWGMGITQHVQGDDNVAMITNLLLMMGMIGITGAGASPVRGHSNVQ
FT                   GDRTMGIHERPSQALLDRLQQVFERPMPQEHGYDVVSGAKAMIQKKIKVFMSMGGNFSV
FT                   AAPDTHAIQHALTDNQLNVFVGTKLNESMLYPGEDSLILPCLSRTERYITSRGEQFATI
FT                   EDSMCQVVRTQGRLKPMSDHLKSEAQIVAGIANAFFGKDTSINWSMMAEDYDVTRNYIS
FT                   QAIKGFENFNQRIREVERGFHLYHPARHHKWETESGKAQFEVPKYDITYVADEMASQAD
FT                   TKADPARAQMVWQLTTVRSHDQFNTTIFGLEDRYRQTTHRDVLFMHPDEISRLGWQAGD
FT                   KVVVSRVDSQGGARSLGPLVLTQMDIAANAVAAYYPECNDLIDLDSHALESLTPSYKSV
FT                   TVTLKKVDLDEQQQAISEPSTTATA"
FT   gene            404540..405679
FT                   /locus_tag="PsycPRwf_0335"
FT   CDS_pept        404540..405679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0335"
FT                   /product="formate dehydrogenase, subunit FdhD"
FT                   /note="PFAM: formate dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93290"
FT                   /db_xref="GOA:A5WC99"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A5WC99"
FT                   /protein_id="ABQ93290.1"
FT                   /translation="MDNTAAHFDSQIGVPVELQRRLTREHSAQMHRFTRSDEASIGGGS
FT                   CVSSRTPTKDAQPLQIETHLATLAVEAAVALVINGIHYAVLMASPAQLEHLALGFLYSE
FT                   GLIQHSGELLDWEITAINSVEDLQAFAPANESRLIESQAAVNWAHLLSDYEAYVVTLVL
FT                   NQRCHQRILAQRRQLAGRTGCGMCGMTGLQQALPDLSAYSRYATSDEASSSPSYPVQPV
FT                   SVKQAAYGRGDNAINGRADNGSPNSSADKQTRPNLEQLLQIRALIESTQATHQLTGAVH
FT                   AAATWYQGELYVFEDVGRHNALDKLIGWQLRNQVALEFVVMTSRLSIELVQKAVRCRLP
FT                   WLVGMSAPTSTAVRVAQRYGLGLAGFLRDNRVTYYGDNV"
FT   gene            405792..407369
FT                   /locus_tag="PsycPRwf_0336"
FT   CDS_pept        405792..407369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0336"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; Protein of unkown function DUF1946,
FT                   PP-loop ATpase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93291"
FT                   /db_xref="GOA:A5WCA0"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCA0"
FT                   /protein_id="ABQ93291.1"
FT                   /translation="MTTPVCISQAFMDSFHAHHAQLLGKRVWLACSGGRDSLGLALLCR
FT                   TLFDQGRLPFLPQLIHVNHGMQAANDEWAQQVAQWAQQHDMACQIIGLNLTHKSEQAAR
FT                   DGRYQAMMQLMNQDDVLILGHHQDDQVETLLMRLFNGAGVTGLGAMREWTSKQAHTAQS
FT                   PPDVNKPRQRIFLWRPWLEISRDQITEYAQRHNLKYIDDPTNVAQSPSKLALQTLNDRA
FT                   WLRSVLLPHITERYPQASEAMARTAQLMQQASDSIDEQVTQDLAQVALAATEQQSVIAL
FT                   DKLAGLSAPRQAALIHHWLAPYPNQLPPSKRLVDEVLALSFRQDSNHQTCLYFDAGSEQ
FT                   YQVRRYQNKLYRLQHAYAQWLQMMPHQIHLPLAHNAEELSLNLADTDVLSLKQSGLEFD
FT                   WQLTGVRGLMAHLARLLNSADAKVTPCQLIFEPLPRTIKLALAGRSGRKSGKKLLQALD
FT                   QPSFMRGSVVLCRLDMMGSDGILQDSSTAVPLFIICIDRIWVLQSQFTALINQLLATEV
FT                   LSTQILEC"
FT   gene            407667..408515
FT                   /locus_tag="PsycPRwf_0337"
FT   CDS_pept        407667..408515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0337"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="TIGRFAM: pyrroline-5-carboxylate reductase; PFAM:
FT                   NADP oxidoreductase, coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93292"
FT                   /db_xref="GOA:A5WCA1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCA1"
FT                   /protein_id="ABQ93292.1"
FT                   /translation="MSELKGKKISFIGGGNMAQALISGLLARGIKPNDITVADPSQDIR
FT                   DVLKSQKINTVDPTGTTDTNNPQIAAKTADVIVLAVKPQVMDKVVADFADVLDRQLVIS
FT                   VAAGLSTDSLSKMLSGYQNIVRAMPNTPAMIQKGATGLYANDSISETDKQLAATLMAAS
FT                   GLVSWVEQEEQLHAVTAVSGSAPAYFFYMIESMIEAGVEQGLDRKQAAALAMQTALGAA
FT                   QMAITSGEAPAELRRKVTSPNGTTQAAIESLQQDDFAGIIKKAMQACYTRSEQISQELA
FT                   D"
FT   gene            408629..409195
FT                   /locus_tag="PsycPRwf_0338"
FT   CDS_pept        408629..409195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0338"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93293"
FT                   /db_xref="GOA:A5WCA2"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCA2"
FT                   /protein_id="ABQ93293.1"
FT                   /translation="MSLSYALFNMVVNFAMLLVFIRFMLQFAGLERNHPYVEPAYKATQ
FT                   IVDLFGRIFPTVGAGRVNLAAVMLLFLLKLIDISGNAAIVGHSYTPIRLFFEGTLQLIL
FT                   SFLSVARYLIIGSIIISWIVVFTQKMHPIFELIMQMAEPILAPFRRITPSLGMLDLSPM
FT                   IAIFGLLLIEIFVQIIANNLLPMIG"
FT   gene            409432..409521
FT                   /locus_tag="PsycPRwf_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            409432..409521
FT                   /locus_tag="PsycPRwf_R0008"
FT                   /product="tRNA-Ser"
FT   gene            409661..409737
FT                   /locus_tag="PsycPRwf_R0009"
FT                   /note="tRNA-Arg1"
FT   tRNA            409661..409737
FT                   /locus_tag="PsycPRwf_R0009"
FT                   /product="tRNA-Arg"
FT   gene            410010..410672
FT                   /locus_tag="PsycPRwf_0339"
FT   CDS_pept        410010..410672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0339"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93294"
FT                   /db_xref="GOA:A5WCA3"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCA3"
FT                   /protein_id="ABQ93294.1"
FT                   /translation="MSKQRRSNLSKPPTASSEEGLRPTGIEGVSVSGEPEIAKAATRVI
FT                   AIVYDGMLILALLFLVGTVLTVLGTMMTMETGVTSDQAQTLPAWYRNLVLTPAFIVTLI
FT                   GFYGLFWRRAGQTLGMQTWRLKTVDSQGQLLTWSKTVKRILAACVVPVICGMIGYAFHN
FT                   SRSAMLFSAFFGLMFNYLFCLFNRGGLAVHDMLSGTVTLKMPKIHHEGLFKSLRKKK"
FT   gene            410910..411389
FT                   /locus_tag="PsycPRwf_0340"
FT   CDS_pept        410910..411389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0340"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93295"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCA4"
FT                   /protein_id="ABQ93295.1"
FT                   /translation="MSNSSGVDFDQDIFAALIAKHDIQRDLCDQLEKQSDNDKRKALYQ
FT                   ELKLELQAHAAAEERHLYIPVMQHDEGLDLSRHAITEHHEMDEMMETLDDGRISQKTWD
FT                   TTCADLIEKVRHHLTEEEQKFFKQARKILDSDLQQRLGALYQVEHDEFEKTHAND"
FT   gene            411692..412792
FT                   /locus_tag="PsycPRwf_0341"
FT   CDS_pept        411692..412792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0341"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93296"
FT                   /db_xref="GOA:A5WCA5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCA5"
FT                   /protein_id="ABQ93296.1"
FT                   /translation="MAYAPLFNPIKMGNQTFKNRVFMAPLTRLRSIEPSDMPTILAAEY
FT                   YSQRAGSGLIITEATQVSLQAKGYAGAPGLHNEEQVAAWKVITDAVHAKGGKIVVQLWH
FT                   TGLVSHNSVQPDNKAPISASDVDVGVRTTLRDDQGAPIRVEATTPRMASLEEIKQVVAD
FT                   FAQATQYAKQAGFDGIEIHGAHGYLLHQFWAEHTNKRTDNYGGSRENRARLMLEVIDAC
FT                   VAAWDQDHVGIRISPLGSFNNVDVGYNEDEAIWLVEQINSRNLMYLHMSEPDWAGGTPY
FT                   SEAFRQKLRAAFNNPIVAAGGYSAQKAQDLIEAGYIDAVAFGRDYIANPDLAERLQKDA
FT                   ALNEQHPQTFYGGGLQGYIDYPFMSQ"
FT   gene            complement(412914..413651)
FT                   /locus_tag="PsycPRwf_0342"
FT   CDS_pept        complement(412914..413651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0342"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93297"
FT                   /db_xref="GOA:A5WCA6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCA6"
FT                   /protein_id="ABQ93297.1"
FT                   /translation="MAKLWLDLGNTRLKYWLTDDVGQIITSDAKQHLQAPAELLIGLTD
FT                   RFANLAPEFIGVSSVLGNEVNAQVAQSLSTLDIAFEFVHVDACHPLLSSDYDASQLGVD
FT                   RWLQILGAVDNKKRQCIVGCGTALTIDLTDHAHHLGGYIFPSIYLQREALFSGTKQISI
FT                   VEGTFNSISEGTTTSDAVHRGILLSIVGAINEIARRSPNYEFILTGGDAPILAQHLTVP
FT                   IHIRESLLLNGLMRYFDEPSRQN"
FT   gene            complement(413879..414283)
FT                   /locus_tag="PsycPRwf_0343"
FT   CDS_pept        complement(413879..414283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0343"
FT                   /product="iojap-like protein"
FT                   /note="TIGRFAM: iojap-like protein; PFAM: Iojap-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93298"
FT                   /db_xref="GOA:A5WCA7"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCA7"
FT                   /protein_id="ABQ93298.1"
FT                   /translation="MTLDATQRTPMSDERLQFCLNMVQETLDDLKAKNITVLHVADLTD
FT                   VTDYMVIADATSKRHVSALADEVGATAKKSGFMPLGREGEKDSDWTLVDLGGVIVHIMT
FT                   RQAREFYDLEGLWSSPEELKKLVARDLSER"
FT   gene            complement(414449..415264)
FT                   /locus_tag="PsycPRwf_0344"
FT   CDS_pept        complement(414449..415264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0344"
FT                   /product="nicotinate-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="TIGRFAM: nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93299"
FT                   /db_xref="GOA:A5WCA8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCA8"
FT                   /protein_id="ABQ93299.1"
FT                   /translation="MPASTLATTTTTTTTIPASSPSSCRHLETDAYPRHACATRPIQIY
FT                   LGGSFDPVHNSHLAVLAHVYQHLHIAKPSSKLSAYFMPTSRSPLKDNSSRPEHRMAMLQ
FT                   LAIDEMTAAKAQTAISPADFGICDHEIWQTPPTYSIDTLRALRQANPEASLVFVIGADN
FT                   VQSLPQWRDGDRLIEFAHLWVIPRDHLQTHQHIANLLPNKLKSALTEHIEDLKYAAKGH
FT                   IYIDSHRVDPISSSAIRQAITEGSFDIAKSALPRSVYSYIMKNNLYHSY"
FT   gene            complement(415573..417720)
FT                   /locus_tag="PsycPRwf_0345"
FT   CDS_pept        complement(415573..417720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0345"
FT                   /product="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /note="TIGRFAM: phosphate acetyltransferase; PFAM:
FT                   phosphate acetyl/butaryl transferase; DRTGG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93300"
FT                   /db_xref="GOA:A5WCA9"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCA9"
FT                   /protein_id="ABQ93300.1"
FT                   /translation="MQTILLVPTGRGIGLTSAGLGLIKAFDYLGIKAGFMKPFLQDDSY
FT                   DSQHTLDSSSELAHKAFGLTPPESIPRERVERMMNAGNVDDLMEDVVTNFHKLDDGYGV
FT                   VVCEGLVPTEEVNYASQVNYALATALDAKVIFVSMADLENPKQLADKLDLHARAFGGLT
FT                   GERTLGSILMRANNVPNTFDTQPVAPGEATLELDAEFIEAMQKYSPNFATEKYHLIGVV
FT                   PFSNSLSVPRTWDIAQQLNATWLNQGEAKQRRVLKTSLAARTISRVGEIFNRGTLIVTP
FT                   GDRDDLLLATAMAAMNGIPMAGIVLTGGIIPNDTVFELCQPALKTGLPIMSVPTNSLET
FT                   VTNLFNISNEIPRDDVERAETVTRFVAAHLDLNWLKSYFERDYKPRLSPSAFRHQVVKK
FT                   AQQAKMRVVLPEGEEPRTIEAAAICQSRGIAQCVLIGNSDEIAQVAKNRGVDLPKDIEI
FT                   IDPATLNLDKYVAAFVERRKGKASPEQAAEQLKDTVVLGTTMLHMDEVDGLVSGAIHTT
FT                   ANTVRPAFQLIKTAPQYSLVSSIFFMLLPEQVVVYGDCAINPDPNAEQLAEIAIQSAAS
FT                   AKAFGIEPKVAMISYSTGASGTGDDVEKVKQATQIVRERAPDLMVDGPLQYDAASVLSV
FT                   GKQKAPDSPVAGQANVFIFPDLNTGNTTYKAVQRSANVVSVGPMLQGLNKPVNDLSRGA
FT                   LVDDIVYTIALTAIQASSSEI"
FT   gene            complement(417845..419047)
FT                   /locus_tag="PsycPRwf_0346"
FT   CDS_pept        complement(417845..419047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0346"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93301"
FT                   /db_xref="GOA:A5WCB0"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCB0"
FT                   /protein_id="ABQ93301.1"
FT                   /translation="MSNTIISNPTLVVNCGSSSIKYALISEDNQHRITGLAENLGLDNA
FT                   RIVHKCLEGKKTEVTIPGANHQAALVRIMDLLGDQSPIAVGHRVVHGGREFSHAEKVTP
FT                   HVIEEVKRLKALAPLHNPANAIGIEAVQAIHPELPQVVVFDTAFHQTMPPKAFRYAIPK
FT                   EMYEKDFIRRYGFHGTSHAYLSHRASELTTQSGPHGWLIAHLGNGSSETAVYDGKSLDT
FT                   SMGLTPLEGLMMGTRCGDVDPSLHIHLKRTLGLNLEQIDTILNKESGLLGISGVSNDMR
FT                   TVESIANDDSHPNQQDAKLAVEMFCYRAGKYLASLSCALPDMTGIVFSGGIGENSATIR
FT                   AGILNVMRHFGLDIDQQKNAELYGGEEGSFHTADSRYELWVIPTDEEYQIAEETRAVLG
FT                   L"
FT   gene            419472..419816
FT                   /locus_tag="PsycPRwf_0347"
FT   CDS_pept        419472..419816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93302"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCB1"
FT                   /protein_id="ABQ93302.1"
FT                   /translation="MANRYPKILFNSSLTDLVCERLYFDNNGAQMSGKNAQKKARKKAN
FT                   TPIITMVMMLGTLMLTGCGQKGALYLPEEAPSNTDFMIYKGNKSEANKVKEAQTREQVE
FT                   QAAEQDPEDY"
FT   gene            419924..421261
FT                   /locus_tag="PsycPRwf_0348"
FT   CDS_pept        419924..421261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0348"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93303"
FT                   /db_xref="GOA:A5WCB2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCB2"
FT                   /protein_id="ABQ93303.1"
FT                   /translation="MSNPDLSQAAVQHSESGLRINPEVFVKKLPTLSYQQGTLFVEQAS
FT                   VQQLAEQYGTPLYVYSKQAILDAYTAYTTSFAAIDHQVCYAVKANSNLAVLSVLAKAGA
FT                   GFDLVSSGELARVLAVGADPSKIVFSGVGKTVTELTAALKAGIGCFNVESLSELDTLNA
FT                   VAAELNVKAPISIRVNPDVDAKTHPYISTGLKDNKFGISHDIAVAAYQHAASLEHLQIV
FT                   GIDCHIGSQLTEIDPFVAALDKVCELIEALKQVGIELQHIDLGGGLGVIYIDEEVAKVS
FT                   EFAAALLPKLQELGLKVFFEPGRSIVANAGMLVTKVEVLKPTEHRDFAIVDAAMNDLIR
FT                   PALYQAEMAVIPVQTASQASQKSWDIVGAVCETGDFLAKKRLLSLAVGDILAITGAGAY
FT                   GFVMSSNYNSRPRPAEVMVSGDKHQVVRARETVAQLFETESTFDID"
FT   gene            421543..422424
FT                   /locus_tag="PsycPRwf_0349"
FT   CDS_pept        421543..422424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0349"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93304"
FT                   /db_xref="GOA:A5WCB3"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCB3"
FT                   /protein_id="ABQ93304.1"
FT                   /translation="MLIEFTKMHGLGNDFMVIDLVTQRLELTPELITLLADRNLGIGFD
FT                   QLLVVEPPMRPDVDFRYRIFNSDGSEVEQCGNGARCFARFVQARKLSFKQRIRVETKSG
FT                   ILTLSTDNYGWVEVDMGKPRFEPAEIPFTPKAITKIQNAYHLDVEGTPVQLYVANMGNP
FT                   HAVIKVDDILTADVEKLGKAIESHPAFPERVNVGFMQVMNQRHIRLRVYERGVGETQAC
FT                   GTGACAAVATGIREGWLDEGEEIRAQLYGGSLLIRWSPGYSVMMTGPTAFVYEGVFSPD
FT                   GIMAQAGLKPLS"
FT   gene            422454..423479
FT                   /locus_tag="PsycPRwf_0350"
FT   CDS_pept        422454..423479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0350"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93305"
FT                   /db_xref="GOA:A5WCB4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCB4"
FT                   /protein_id="ABQ93305.1"
FT                   /translation="MTNKVLEKQQLENKKQLEDSLATKPVFAELEALLPPVEQWLSELS
FT                   VRQMSAHTIDAYYAGLYQLACFLAQAQLNWTRCDKRQLAKYIAKRLDTDALAISSVQQE
FT                   LSAIRHFYSWLIEQGQARINPTTGYQLKRAPRPLPSIADGDLIAQLLEQPMPDTPEQAR
FT                   LWIRDKAMFELLYSSGLRVGELVGLNVADLRIDAKGERGEVRVTGKGNKTRLVPVGRQA
FT                   LKAINRYLPHRNLWEERGDRALFISEKHGTRLTTRAVQQRLKVAAARAGIAQNMYPHLL
FT                   RHCFASHMLSGSGDLRAVQEMLGHSDISTTQIYTHVDFDRLTQVYDKAHPRASQEKKTP
FT                   R"
FT   gene            complement(423586..424470)
FT                   /locus_tag="PsycPRwf_0351"
FT   CDS_pept        complement(423586..424470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0351"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93306"
FT                   /db_xref="GOA:A5WCB5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCB5"
FT                   /protein_id="ABQ93306.1"
FT                   /translation="MDPIIGCVQLSSQFDIETNLANIQRAVIAAKQQDVHLLVLPENAC
FT                   RMGGQQQLAERFDELSQWYATLAFEHQMFIVAGSLPCAYRPDGTPVPGERLRQVSQLFS
FT                   PEGKRVARYDKIHLFKAQVADNTGSYDEGRTFEPGDTTVVAQCDMANLLGQSAQTQPLS
FT                   VGMMVCFDLRFPALAQKLRQSGAEILTAPSAFTYQTGKAHWQLLLQARALDAQCLVVGS
FT                   AQGGTHDIPSGQRQTWGHSSIMNANGEQLVGTNQTKLMQPEQGFELITAPFERTKQQNW
FT                   RQNMPIHHCHRLA"
FT   gene            424961..426706
FT                   /locus_tag="PsycPRwf_0352"
FT   CDS_pept        424961..426706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0352"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor, core-binding region;
FT                   sigma-54, DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93307"
FT                   /db_xref="GOA:A5WCB6"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCB6"
FT                   /protein_id="ABQ93307.1"
FT                   /translation="MISTSFNLGFNLSTTQKLTPQMQQAIKLLQLSSLELEQEVQMKLD
FT                   SNPLLERVEDDDIDAEDFNSIEELTRLELDAEAQKEVYDPYDDDYGLEYQEGATEDVFS
FT                   ELDGDGLGNLGDLNDLNDLNENALDDTNKTEGDIEQNQALISITTTADNDLKAEASNLD
FT                   TSLGELPIDTEWDDIYTHSPTGLAAPDTQGMSDYQGATSVSLQDHIRWQLTFSKLSSVQ
FT                   SLIADYLIDALDDHGFIQIDMAELKDSFDEMASFYQWQQKIELEHIQQVIELIQSCEPL
FT                   GVGARNLAESLQIQLRALDENTPYMRQALRLLDEHQLLVSNNIKELMSRTGLKNNEISP
FT                   ALELIRTLNAAPGLAFSKAQPDYGSTPEVYDIPDVIVQLVHNQGGGEAVWKVELNPETL
FT                   PKLRINQQYASLVKRGDDSPDNVYLRDNLMDARLFIRSIEERNHNLLKVATCIIKMQQD
FT                   FLLQGATAMKPLILKEVAEEVGLHESTVSRLTTSKSILTPQGLFSLKHFFSSHVSSDQG
FT                   DVSSTAISAMIEALIDAEDPKKPMSDSAIKQHLQQQGIDIARRTVAKYREAMNIGSSTQ
FT                   RKLKF"
FT   gene            427202..427600
FT                   /locus_tag="PsycPRwf_0353"
FT   CDS_pept        427202..427600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0353"
FT                   /product="SSU ribosomal protein S30P"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93308"
FT                   /db_xref="GOA:A5WCB7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCB7"
FT                   /protein_id="ABQ93308.1"
FT                   /translation="MNISITGHHITITDAMKDMVMDKLSKVERHFDQIQSIKVILSLDN
FT                   HRTDASHSGKNNHKAEALMRVAGQEMFVQSYDDDMYKAIHEMADKLDRQVRKYKTRIDR
FT                   KTRSSKRRERLVASLPIVEPAAEESFAY"
FT   gene            complement(427837..428037)
FT                   /locus_tag="PsycPRwf_0354"
FT   CDS_pept        complement(427837..428037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0354"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93309"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCB8"
FT                   /protein_id="ABQ93309.1"
FT                   /translation="MYTITVNGQIISTEQDNVKAVLDELELTQGRYAVEIDGALIPKSE
FT                   LMATVLVQNMSIEVVQAVGGG"
FT   gene            complement(428088..428453)
FT                   /locus_tag="PsycPRwf_0355"
FT   CDS_pept        complement(428088..428453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0355"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93310"
FT                   /db_xref="GOA:A5WCB9"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCB9"
FT                   /protein_id="ABQ93310.1"
FT                   /translation="MNWIAIAAINLAMAVALGAFGAHGIKAIASAEQLAWWHTGAQYLF
FT                   YHALGLLLVGLLIKLGYTTQTTAWLIQIGIIIFAGSLFAMTLGAPRWFGAITPIGGSLM
FT                   IIGWVWLAITAFRLVPR"
FT   sig_peptide     complement(428388..428453)
FT                   /locus_tag="PsycPRwf_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.548 at
FT                   residue 22"
FT   gene            complement(428621..429739)
FT                   /locus_tag="PsycPRwf_0356"
FT   CDS_pept        complement(428621..429739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0356"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma-70; PFAM: sigma-70 region 2 domain
FT                   protein; sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93311"
FT                   /db_xref="GOA:A5WCC0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCC0"
FT                   /protein_id="ABQ93311.1"
FT                   /translation="MATPKKTKTTKKETAKSSPPTAVTSELDPIDLDIDAELDDDDLAL
FT                   DYDELDDGIDDDLLTPELAKADDWVSDYPNTSTRDLVPAMPVNLSAPGINLGAYMNSVH
FT                   QIPILTTEQEQELAHRYYDDGDVEAARILVMSHLRFVIHIARSYSGYGLPQADLIQEGN
FT                   LGLMKAVKRFDPNKGVRLVSFAVHWIKAEIHEFVIRNWRIVKVATTKAHRKLFFNLRSL
FT                   KKTNNQLTLEEADAIAADLNVTRKQVLEMESRLTSYDASFEAQSTDDEDGHYAPQLFLE
FT                   DGVDPAEMVEDADWEENNTNALMDAMDTLDERSRDIVEQRWLSEQKSTLHELAAVYNIS
FT                   AERVRQIEKNAMDKIREAMTIDSVIMPSDDAY"
FT   gene            complement(429796..430170)
FT                   /locus_tag="PsycPRwf_0357"
FT   CDS_pept        complement(429796..430170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0357"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93312"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCC1"
FT                   /protein_id="ABQ93312.1"
FT                   /translation="MINNTLNPQLEQLLSEQMTPLSTADQNTIAEVSQAAPISALVDGR
FT                   GLACPMPLLKTKVALRSMQPGQSIYVLATDPNSQHDLAAFCDHANLQLALNTSSVQGSV
FT                   DSLEKLDTIFHLIITKTNGN"
FT   gene            430615..432216
FT                   /locus_tag="PsycPRwf_0358"
FT   CDS_pept        430615..432216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0358"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93313"
FT                   /db_xref="GOA:A5WCC2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR030873"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCC2"
FT                   /protein_id="ABQ93313.1"
FT                   /translation="MRFVKVTYRCYCTAAVPLLLLGLPLMATAAPTAAINATSASAIGF
FT                   DNPNFSLPELGSGGGRFIEANQHKVLGEWSLQQLGKSAPLLNDPWSQEQLESLAWQINA
FT                   QARSQAPLALMVINNASINAFAIPGGVMGIHTGTVIDANSMDEVASVIAHEVAHLSQRH
FT                   YEHRDEASRKALMMQIGGLLAAIAASAADGDAAAAVMMGSQTAALNAQMAFSRSNEREA
FT                   DRIGMQLMAKAGYDPRAMPRFFATLNQKTQLNMVKNAYLPSFIMTHPLSSERLSEAQSR
FT                   ANSYATVGLHNQSDPLTFDLLKWRLKVLSNQVTEGDLLAAAKQSTGATMALAFWYGKQG
FT                   RYNEAAAQFSKLKNTAISSTKDKMAFDVLLAISQGQVAGMQGNWQRTESLITPYYNLYP
FT                   ERRDTKMLLADAWLQLGKYNEVISLMKPLVQSREYDVEALFRMQRAYELLATSNRQSNT
FT                   TLSQISAVNALRYRAKGELWQGEYNDALVSLQQAKTLVQSFSKASGSSSGFNSRPLLAS
FT                   IDSEVAQVKTAKEVRP"
FT   sig_peptide     430615..430704
FT                   /locus_tag="PsycPRwf_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.946 at
FT                   residue 30"
FT   gene            complement(432252..432701)
FT                   /locus_tag="PsycPRwf_0359"
FT   CDS_pept        complement(432252..432701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0359"
FT                   /product="GatB/Yqey domain protein"
FT                   /note="PFAM: GatB/Yqey domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93314"
FT                   /db_xref="GOA:A5WCC3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCC3"
FT                   /protein_id="ABQ93314.1"
FT                   /translation="MSALKDTITEQVKTSMKARELEKVKVLRNVQSVIKQIEIDRKVDL
FT                   DDAGVLEILQKQLKQRQESLHVFQDNGRDDLAQKEQFEIDIINQFMPQQMSDEELAALI
FT                   NQEIAAQGASSMQDMGKVMGALKTKTAGRADAAVMSQLVKKALMG"
FT   gene            complement(432986..433201)
FT                   /locus_tag="PsycPRwf_0360"
FT   CDS_pept        complement(432986..433201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0360"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93315"
FT                   /db_xref="GOA:A5WCC4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCC4"
FT                   /protein_id="ABQ93315.1"
FT                   /translation="MPSVKVKENEPVDIAIRRFKRACEKAGVLSDVRKREFYEKPTQER
FT                   KRKKAAAVKRYKKKLQRESIRTTRMY"
FT   gene            433867..434292
FT                   /locus_tag="PsycPRwf_0361"
FT   CDS_pept        433867..434292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93316"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCC5"
FT                   /protein_id="ABQ93316.1"
FT                   /translation="MSLIAQQTPKKSAAFRVTALASIMLSAAVTLTACGGGEHEAKAVD
FT                   KLDEAAEMAKANAPKPEPLKPEDIAPASSAPAATDAAEGTATADAAGTDAAAPTAEGAA
FT                   TTTTDAATTTDSATAPATTDTTADAAAPAADMAPEAK"
FT   sig_peptide     433867..433968
FT                   /locus_tag="PsycPRwf_0361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.437 at
FT                   residue 34"
FT   gene            434455..435042
FT                   /locus_tag="PsycPRwf_0362"
FT   CDS_pept        434455..435042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0362"
FT                   /product="Cytochrome c5-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93317"
FT                   /db_xref="GOA:A5WCC6"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCC6"
FT                   /protein_id="ABQ93317.1"
FT                   /translation="MLTINNQNNAQSKVAPKLYSAKSGWLLISALTLGVAVGCSGGNDT
FT                   EAQNQAEPSASESIPADPAATQSEAPEAEASETIESSESTEQAPAADSEGSEAKPAEET
FT                   TAAAPAQSAPLAADAGQKLYEVKCKQCHEPGLLNAPKFGNNADWAPRIAQGKEVLYKHS
FT                   AEGFKAMPAQADGTASVEEVHAAVDYMVEHAS"
FT   sig_peptide     434455..434580
FT                   /locus_tag="PsycPRwf_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.618) with cleavage site probability 0.279 at
FT                   residue 42"
FT   gene            435335..436378
FT                   /locus_tag="PsycPRwf_0363"
FT   CDS_pept        435335..436378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0363"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: putative metalloendopeptidase,
FT                   glycoprotease family; PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93318"
FT                   /db_xref="GOA:A5WCC7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCC7"
FT                   /protein_id="ABQ93318.1"
FT                   /translation="MKVLGLETSCDETGLAIFDSELLAEGKNGLLGQVLYSQIELHATY
FT                   GGVVPELASRDHIRKLVPLLDELLAQCDISKDEIDAIAYTKGPGLIGALMTGALFGRSL
FT                   AYGLDVPAIGIHHMEGHLLSPLLGPNPPKFPFVSLLVSGGHTLLVAAHGIGEYEILGES
FT                   IDDAAGECFDKAAKMLGLPYPGGPNVARLAEQGDPLKYELPRPMLHRGLDFSFSGMKTA
FT                   VHNLIKDTPGSDNDEQVRADIAASFQHAVVDTLVKKCVKALKQTGMKQLVIAGGVSANL
FT                   HLRQTLEQQLAKIGATVHYAPLELCTDNGAMIAYAGYQRLQAGQQDALSVSCVPRWNIS
FT                   DLPALAQ"
FT   gene            436392..436763
FT                   /locus_tag="PsycPRwf_0364"
FT   CDS_pept        436392..436763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0364"
FT                   /product="camphor resistance protein CrcB"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93319"
FT                   /db_xref="GOA:A5WCC8"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCC8"
FT                   /protein_id="ABQ93319.1"
FT                   /translation="MQWIAIGMGAAFGACLRALLGRLNPLHAWIPLGTLGANVLGGLLI
FT                   GMAMVVFMKAGQLWHPNVKLFVMTGFLGGLTTFSTFSSEVFALLNSGKVMAGLVLIAVH
FT                   VLLTLTATAMGYYLTRLCF"
FT   gene            complement(436782..437741)
FT                   /locus_tag="PsycPRwf_0365"
FT   CDS_pept        complement(436782..437741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0365"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93320"
FT                   /db_xref="GOA:A5WCC9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCC9"
FT                   /protein_id="ABQ93320.1"
FT                   /translation="MLELRHLQTLTALRAHGSLAAAADELHVTASAVSHQLKELENYYG
FT                   VKLVNRRTRPLTFTPAGKVVLKLADSILPQVTRTKNNLKRLAHGQAGRLRLASECHSCF
FT                   DWLMPILNQFRREWSDVELDFATGFEPEPHHLLSEGDIDLLITTSDLDIEGICYQPLFS
FT                   YESRLVLSPTHPLASKTSIVPDDLVDQTLIAYPVETKRLDVIAKFMAPAEASFAKIRTT
FT                   ELTAMLIQLVASERGVAALPDWVAAEYEKKGWVVTRPFVAPEGSDNRLNPITHPSSRAH
FT                   SLPKTGIYCQLFAATRQSSQDTAYMQGFAKLLEELVKP"
FT   sig_peptide     complement(437670..437741)
FT                   /locus_tag="PsycPRwf_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.685) with cleavage site probability 0.312 at
FT                   residue 24"
FT   gene            438256..439629
FT                   /locus_tag="PsycPRwf_0366"
FT   CDS_pept        438256..439629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0366"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93321"
FT                   /db_xref="GOA:A5WCD0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCD0"
FT                   /protein_id="ABQ93321.1"
FT                   /translation="MWKNMGLTSKILVAMLLGIILGLIFNYTGLNAEGGFVNTYLVNGL
FT                   FSIVGKLFVNSLKMLVVPLVLISLICGVCGIGDIRLLGRIGTKTFFIYMVTTAIAIATA
FT                   IGLGSIFGIGKGMNLKPENAFEAKDAPPLIDVFSNIIPSNPISAMANGDMLSIIFFAIL
FT                   IGVSILMVGKPAKGLVQSLELINEVILKMVTIIMNLAPYGVFALLVQAMSDLGLDLMLS
FT                   LFGYVAVLVGSLAFHFFVTMMIILKLTSGLSVRTFLSKMREVQIFAFSTSSSNATIPVS
FT                   LRTVTKRMGVDNSVASFTIPFGATINMDGTAIMQGTATIFIANLYGVDLSVGQYLMVIL
FT                   MSVLASVGTAGVPGVGLIMLSMVFAQVGLPIEGIGLILGVDRLLDMLRTAVNVGGDAAV
FT                   TAIVAKAEGKMDIDVYNDPEAGTKEVFDGHIDPESEQEFANVMSDGIMGSEYDDLKKG"
FT   sig_peptide     438256..438354
FT                   /locus_tag="PsycPRwf_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.895) with cleavage site probability 0.651 at
FT                   residue 33"
FT   gene            439840..440946
FT                   /locus_tag="PsycPRwf_0367"
FT   CDS_pept        439840..440946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0367"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93322"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCD1"
FT                   /protein_id="ABQ93322.1"
FT                   /translation="MKALKLRIKDKHIKELNRISGSVNFVWNYVNALCFEHLKRTGKFF
FT                   SAYDLSEYTKGSGEYLGLHSQTLQAINETHAKARKQFKKAKLNWRSNRPDAKRKSLGWI
FT                   PFKKSAIKYLSTRQTGKKALKSTLQLSLSKGQKLIIDVFDSYNLSLYQINTLEIVQDSR
FT                   NRWYACITVKDFPKQFSGKGSVGIDLGLTESATTSNGDKLIIKQTQKWANKLAVAQRAK
FT                   NKKHVKAIHAKIKNTRLDLTHKFTTKLVQGNALIVVGNVKSRSFTTKKTKLAKSTYDAG
FT                   WFELKRQLEYKCKHAGCQLEIVNESYTTQTCSYCRQISDSSPKGRAGLGIRGWRCAECG
FT                   TWHDRDINAAKNILAVGLDRLAVGIPSV"
FT   gene            complement(440960..441724)
FT                   /locus_tag="PsycPRwf_0368"
FT   CDS_pept        complement(440960..441724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0368"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93323"
FT                   /db_xref="GOA:A5WCD2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCD2"
FT                   /protein_id="ABQ93323.1"
FT                   /translation="MSFMDFSLTLEVILMLTAVAAVAGFIDAIAGGGGLLTIPAMLLAN
FT                   IPPVMTLGTNKLQAASGALTASITMIKKGVVKPATMKMAIAGAFFGSVLGTIAVQMSPP
FT                   DMLEKIIPFLIAAIGIYTLFAPSLGDVEAEPRIKETTWQRVVAPLIGFYDGYVGPGTGM
FT                   FFALGNVALRGRAIIAATGTAKVLNLSTNIASLIFFILGGNVLWKVGLAMMVGQTIGAY
FT                   AGSHMVVKGGSKLIRPVIVLVCLAMVTKYVMG"
FT   gene            442104..443303
FT                   /locus_tag="PsycPRwf_0369"
FT   CDS_pept        442104..443303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0369"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; sodium/hydrogen
FT                   exchanger; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93324"
FT                   /db_xref="GOA:A5WCD3"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCD3"
FT                   /protein_id="ABQ93324.1"
FT                   /translation="MYQKLKKFFEYEAAGGIVLALAAIAAMIVANSPLHDWYESFIHAP
FT                   VVVQVGELIISKDAHHWINDGLMAVFFFLVGLELKREVLIGELSNINQIVLPAAAAVGG
FT                   MIAPALVYVAFNASHPEYLAGWAIPAATDIAFAIGILSLLGSRVPNSLKIFLVSIAIFD
FT                   DIGAILIIALFYTSDLSLLSLLIAGLCLPFLYLLNRRNVTAITPYLFFGIIMWIAVLKS
FT                   GIHATLAGVILALFIPMVNTDDPEHSPLEDLEHDLHGTVAFAILPLFAFANAGISLQGA
FT                   GFGQLLHSVPFGIAAGLFIGKQVGIMLMTWSIIKAGLASLPNGTNFKQIYGVSLLCGVG
FT                   FTMSLFISGLAFGGVTEGFDPRLGIILGSIISGIAGYMLLKRTLKEDTATGITALDLTR
FT                   "
FT   sig_peptide     442104..442196
FT                   /locus_tag="PsycPRwf_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.860 at
FT                   residue 31"
FT   gene            443472..444017
FT                   /locus_tag="PsycPRwf_0370"
FT   CDS_pept        443472..444017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93325"
FT                   /db_xref="InterPro:IPR021242"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCD4"
FT                   /protein_id="ABQ93325.1"
FT                   /translation="MAVGMSVLTGCATLSEQECRTGNWQAIGYADGAAGRSADYLNNHN
FT                   KACAKAGVATDYEAWAQGRKEGLTQYCTATKAYQIGRRGAQMNAVCPANVTANLERINA
FT                   DGRHYYSLNKQLSIEEDRLHNYQKEYEKLRGGDNLNFATEKQARTYLVELPNKASQVNQ
FT                   RIENIKQSLAQLQLKYGY"
FT   gene            444315..444704
FT                   /locus_tag="PsycPRwf_0371"
FT   CDS_pept        444315..444704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93326"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCD5"
FT                   /protein_id="ABQ93326.1"
FT                   /translation="MKKLLTLLPLSLVMAACATSPTTTTTTQQTTNKAYDRMAPEQFVC
FT                   EDNATVQAKYSMDGEQAMINASLPKANWNNQTLTMNIATSGSGARYVNSDSPNVTYDWH
FT                   TKADYGIMSLKWADGNEYAVQCERR"
FT   sig_peptide     444315..444371
FT                   /locus_tag="PsycPRwf_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.356 at
FT                   residue 19"
FT   gene            444879..445195
FT                   /locus_tag="PsycPRwf_R0010"
FT   ncRNA           444879..445195
FT                   /locus_tag="PsycPRwf_R0010"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 342.94"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            445350..445426
FT                   /locus_tag="PsycPRwf_R0011"
FT                   /note="tRNA-Met2"
FT   tRNA            445350..445426
FT                   /locus_tag="PsycPRwf_R0011"
FT                   /product="tRNA-Met"
FT   gene            445772..447574
FT                   /locus_tag="PsycPRwf_0372"
FT   CDS_pept        445772..447574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0372"
FT                   /product="GTP-binding protein LepA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein LepA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor, GTP-binding; elongation factor
FT                   Tu, domain 2 protein; GTP-binding protein LepA-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93327"
FT                   /db_xref="GOA:A5WCD6"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCD6"
FT                   /protein_id="ABQ93327.1"
FT                   /translation="MTALSNIRNFSIIAHIDHGKSTLADRFIQTCGALQDREMQAQVLD
FT                   SMDIERERGITIKAQSVTLYYDHPNGERYQLNFIDTPGHVDFSYEVSRSLAACEGALLV
FT                   VDAAQGVEAQSVANCYTAVDLGLEVLPVLNKIDLPQVEPERVIQEIEDIIGIEADDAPR
FT                   VSAKSGLGVDELLEALVERIPAPTGDRDAPLQALIIDSWFDNYLGVVSLVRVRQGSLSK
FT                   GDKILIKSTMDSHLVTSIGVFTPKPLETGKLEAGEVGFVIAGIKDIHGAPVGDTMTHAK
FT                   TPDVDLIPGFKQITPQVYAGLFPVDSSDFEKFREALQKLQINDSALFFEPDTSDALGFG
FT                   FRCGFLGMLHMEIIQERLEREYNLDLITTAPSVIYEIKKKNGEILLIDNPSRLPDPGFV
FT                   EEFREPIARCHILVPQDYLGNVMTLCMERRGTQVDMRFMGKQVQLIFDIPLGEVVMDFF
FT                   DRLKSVSRGFASLDYEFDRYEVDKLVKVDVLINGDKVDALAMICHQEQARYRGGQLVEK
FT                   MKELIPRQMFDVAIQAAIGSQIIARSTVKAMRKDVLAKCYGGDVSRKKKLLSKQKEGKK
FT                   RMKQVGSVEIPQEAFLAVLQVDNQ"
FT   gene            447733..448878
FT                   /locus_tag="PsycPRwf_0373"
FT   CDS_pept        447733..448878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0373"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="TIGRFAM: signal peptidase I; PFAM: peptidase S24,
FT                   S26A and S26B"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93328"
FT                   /db_xref="GOA:A5WCD7"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCD7"
FT                   /protein_id="ABQ93328.1"
FT                   /translation="MDFDFNVILVPITLILGVVWLLDKLWLKQHKRGGDLAGGVHSKES
FT                   QAAQANLATKKHAYLTALAEHNLVPKDNSTVDVDNIDIDDAPMPVKQAHREYREAKRQA
FT                   SIATTASLPKQSKNENFLVRWAYDYFPVLAAVLIVRSFIVEPFNIPSSSMVPTLYTGDF
FT                   VAVNKYAYGIRLPLTYNKVIDVGEPEHGDVVVFRYPQNPKIYYIKRIIGLPGDEVSFSQ
FT                   GKLSVNGQVVPSEPVSFTADEAMVDQLYTPVKGSDPSREWDLSPQDAVAVARNEEQGAR
FT                   YFQENLGEHRYLRRYLAPNLLGSEYSNFLQQPITHEGSWQVKVPEGNYFVMGDNSDRSE
FT                   DGRYWGFVPDENLAGKAVYVWMHKKPGLSNLPTFSHNRSID"
FT   gene            449067..449846
FT                   /locus_tag="PsycPRwf_0374"
FT   CDS_pept        449067..449846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0374"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93329"
FT                   /db_xref="GOA:A5WCD8"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCD8"
FT                   /protein_id="ABQ93329.1"
FT                   /translation="MTETAEIAHTSKQSPKQRYTSFELGLLSLQKQLGYSFNDTSLAKL
FT                   ALTHRSFDGKINYERLEFLGDALLGMIIGEALYYQYPKQDEGRLTRMRATLVRQESLVV
FT                   VAQKLNLSSYLILGVGERKGGGRERASILADTVESLIGAIYLDSQSVDTVKACVLDWFA
FT                   ELIDNVNDQRVLKDAKSRLQEWLQGYKFELPNYDLLETQGNAPNQVFIVRCEVDVPHTT
FT                   PIVESGESRRIAEQKTAEKMINQLNKLVNDRIIKVKA"
FT   gene            449984..451003
FT                   /locus_tag="PsycPRwf_0375"
FT   CDS_pept        449984..451003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0375"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein, HSR1-related; KH,
FT                   type 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93330"
FT                   /db_xref="GOA:A5WCD9"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCD9"
FT                   /protein_id="ABQ93330.1"
FT                   /translation="MANAPQDNQDITPETNLGTDNLLDSFFGDDNALPEDYRAGYVAIV
FT                   GRPNVGKSTLMNHMLGQKLSITSRKPQTTRHRIHGILSHEDMQAVFVDTPGIHSNEVRL
FT                   INERMNKAAFSALVDVDLVLFVVDGDQWREDDLLTLEKIGETDTPVVLVINKADTIKDK
FT                   GSILPLIETYHENFDFADIVPVSALKNQNLERLQQVIRSHLPQGAPIYDTEQITDRSER
FT                   FLASEIIREKIMRQSGDEVPYDLTVQIDEFKDEPAHIDPKTGRKRKAVTFIDATIFVER
FT                   NGQKAIIIGDKGSRIKQVGTAAREDMEALFERKIMLNLWVKVKQGWSDDARALSSLGY"
FT   gene            451091..451798
FT                   /locus_tag="PsycPRwf_0376"
FT   CDS_pept        451091..451798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0376"
FT                   /product="DNA repair protein RecO"
FT                   /note="TIGRFAM: DNA repair protein RecO; PFAM:
FT                   Recombination protein O, RecO"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93331"
FT                   /db_xref="GOA:A5WCE0"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCE0"
FT                   /protein_id="ABQ93331.1"
FT                   /translation="MRNEPLQAYSLHQRPFQEKRSIYYLLTKEHGVLHGVAKKGIPQFV
FT                   PLTLFASGKKSLKTLQQVHIAESVPSLMGQQQYAALYVNEITLKLLPVEDSVPIIYEQY
FT                   SQTMRQLQGVLSRDDLKMVLRAYEQVLFNELGFAIDLDQDCDQYPIEAEPLYRFAPDRG
FT                   WVKQLESDEKLDCAHIKASSALLGRSIIAMRSGITTHTVNDWSQIHRQLIDHLFDYQPL
FT                   QSRILWQQFFRYQ"
FT   gene            451899..452666
FT                   /locus_tag="PsycPRwf_0377"
FT   CDS_pept        451899..452666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0377"
FT                   /product="pyridoxine 5'-phosphate synthase"
FT                   /EC_number="2.6.99.2"
FT                   /note="TIGRFAM: pyridoxal phosphate biosynthetic protein
FT                   PdxJ; PFAM: Pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93332"
FT                   /db_xref="GOA:A5WCE1"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCE1"
FT                   /protein_id="ABQ93332.1"
FT                   /translation="MTTRTQSTASRPLLGVNIDHVATLRQARGVAYPDPVEAALLCEKA
FT                   GADGITLHLREDRRHIQDADVYRMRPLLTTRMNLEMATTQEMLSIALEVKPQWVCLVPE
FT                   KREELTTEGGLDVAAQVDGLKHYVASLQQNGTKVSLFIDPEPIQIDAAIACGADAIELH
FT                   TGQYSEATLTSEPSTQKELLRIQQATAYALAANNKLIVNAGHGLTRDNVGPIAAIDGIY
FT                   ELNIGHALIADSIFMGLESAVKAMKQAIEAGHK"
FT   gene            complement(452719..453372)
FT                   /locus_tag="PsycPRwf_0378"
FT   CDS_pept        complement(452719..453372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93333"
FT                   /db_xref="GOA:A5WCE2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCE2"
FT                   /protein_id="ABQ93333.1"
FT                   /translation="MDLNYDWLKTQYIKGLSHMSHLKNTSINGFDHVIKTSNNLPIYQS
FT                   GFTLLEAIISVLILATISSIALPPFVTAQQRWEAHKIRSDIINTFRVAKAHSFTQRTNT
FT                   VMCLADIHQVCHKQAVHYLLVFSDSDDNHKFDLQADQLLLKQALNLNYGRVYLNAGRRH
FT                   YIKFFGDSGLPRGHFGHIKYCPNNGNKQNMYQISINQQGNHRFKPYRFKKTGCP"
FT   gene            453804..455015
FT                   /locus_tag="PsycPRwf_0379"
FT   CDS_pept        453804..455015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0379"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93334"
FT                   /db_xref="GOA:A5WCE3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCE3"
FT                   /protein_id="ABQ93334.1"
FT                   /translation="MKLNKINLAILAAAVAAPVMATAGVTVSPLLLGYHYSEANKTQEK
FT                   QGELFGAQGNAGDFKNADDTKGGVAQEDGLYTGAAIGIELTPSTQFQVEYGVSNTDAQI
FT                   GDTKVGDMEQEMISGNFLVGFDQFTGYRDTAFRPYALIGAGQSKLKYDSDNSNRKAETK
FT                   DTIGNLGLGAMYRINDALSLRGEARAIHNFDNNWWEGMALAGLEVVLGGHLAPAVVAPP
FT                   QATVEPTPVIVVEADQDSDNDGVIDRLDQCPDTPVNTVVDENGCPVQVQIDDELKMELR
FT                   VFFDNDKSVIKEQYKPEIAKVAEKMREYPNSSASIEGHASKTGPSARYNQRLSEARAIA
FT                   VKTMLTNEFGVAPNRLSTVGYGYDRPIAPNDTEEGRAMNRRVYAVITGNKTMTVDQTKD
FT                   MNVQ"
FT   sig_peptide     453804..453875
FT                   /locus_tag="PsycPRwf_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.833 at
FT                   residue 24"
FT   gene            455216..457063
FT                   /locus_tag="PsycPRwf_0380"
FT   CDS_pept        455216..457063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0380"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor, GTP-binding; elongation factor
FT                   Tu, domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93335"
FT                   /db_xref="GOA:A5WCE4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCE4"
FT                   /protein_id="ABQ93335.1"
FT                   /translation="MSNEIQNLRNIAIIAHVDHGKTTLVDKLLHQSGTFGDRANIAERA
FT                   MDSGAIEQERGITILAKNTAIKWQHPTNGIEYRINIVDTPGHADFGGEVERVMSMVDCV
FT                   LLVVDAIDGPMPQTRFVTQKAFEQGLKPIVVINKIDRPGSRPDWVMDQIFDLFDNLGAT
FT                   DEQLDFHVVYASALNGIAGLSPDNLADDMTPLFETIVDVVEPPQVDADAPFRMQISSLD
FT                   YNSFVGVIGIGRIERGRISTNTPVTVVDKDGNTRNGRILKIMGYHGLDRIDVDDAQAGD
FT                   IVCITGIDALNISDTICDPSHVEALPPLTVDEPTVSMTFQVNNSPFAGREGKFVTSRNI
FT                   RERLERELIHNVALRVEDTESAEKFKVSGRGELHLSVLIENMRREGFELGVSRPEVIVK
FT                   EVDGKLQEPYENVIFDVEEQHQGAIMEQVGLRKGEMTDMQLDGKGRMRIEAVMPARGLI
FT                   GFRSEFLTLTSGTGILTSSFSHYGPQKIGEVGGRTNGVLVSMANGVCLGYALFNLQKRG
FT                   KLFAEPQLEVYEGMIVGLNSRSDDMVVNPTTAKQLTNVRASGTDEALTLVPAIKFTLEQ
FT                   ALEFIEDDELVEVTPKSIRLRKKYLSESERKRHGRKKEK"
FT   gene            457404..457835
FT                   /locus_tag="PsycPRwf_0381"
FT   CDS_pept        457404..457835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0381"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93336"
FT                   /db_xref="GOA:A5WCE5"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCE5"
FT                   /protein_id="ABQ93336.1"
FT                   /translation="MSMMSEFKEFALKGNVMDLAVGVIIGGAFSGITNSLVEDIIMPIV
FT                   AFIAGGELNFKNMFILLGDAPEGVAMTYDALKEAGVPLLAYGSFITVLINFLILAFIIF
FT                   MMVKGMNKMRRKNEVEEVVEETPSEEVLLLREISQKLSK"
FT   gene            complement(457938..458861)
FT                   /locus_tag="PsycPRwf_0382"
FT   CDS_pept        complement(457938..458861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0382"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase /
FT                   Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycolase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93337"
FT                   /db_xref="GOA:A5WCE6"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCE6"
FT                   /protein_id="ABQ93337.1"
FT                   /translation="MPELPEVETTKTSLKPLLKKQVAQVDVYQPKLRWPVPDDIHRLQG
FT                   YTLQQVERRAKYLILQFQRLPSQSGAKTANMPDTKSIIIHLGMSGSLQQFPVGTDKRKH
FT                   DHLIMQYKADDTKPAIQLHYHDPRRFGAILWFDDYAEKLFDHLGIEPLDDQFSGDYLFD
FT                   KIHRVAENAIRSCHNKPLLKPISRPIKAVIMDQEVVVGVGNIYATESLFLSGIHPITPA
FT                   DQLSKVQLAELVKYIKEILKRSITQGGSTLKDFTVASGTTGYFQQTLLVYGKYKSPCPT
FT                   CGAGIDKVVITGRASTFCPTCQPEPS"
FT   gene            complement(458864..461557)
FT                   /locus_tag="PsycPRwf_0383"
FT   CDS_pept        complement(458864..461557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0383"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number="2.7.6.5"
FT                   /note="TIGRFAM: RelA/SpoT family protein; PFAM: amino
FT                   acid-binding ACT domain protein; TGS domain protein;
FT                   RelA/SpoT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93338"
FT                   /db_xref="GOA:A5WCE7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCE7"
FT                   /protein_id="ABQ93338.1"
FT                   /translation="MLREDYLVKVREGLPLIDGQTTTEDSASLAAQMIAQQQHGYYNPS
FT                   RLSFEMLNEDLKKQLATSKLTTAMDRSIQADYLPLNDAALVKRLQLDTLTYCHNDSNNN
FT                   NATNEIGIPGSMSTQHSPAKNEAPTADEPSKDKKLADNTIIDLPAWLKAVSLRVNIPEL
FT                   PDLAKACDLIGTKSSLGEEDNRSSAYMTGIGMTDILTYLYQDEDALTAAMLYRAARTQL
FT                   ISHERIQEIFGNEVATLVRDALALGQLSETIESNKRLEDHFANNQREQLSNIYSMLISM
FT                   TNDVRVVLIKLAERTFAMRELSYASEERRQRVAREVMTIYAPLAHRLGIAQIKWELEDL
FT                   AFRYLAPERYKEIAKLLSEKRSEREEYIERVQAQLEAALAEAGIKGEVSGRVKHIYSIY
FT                   RKMKLKGLSFHQLYDIRALRVLVDTQAECYHTLGLVHGMWRHIPEQFDDYITNPKANGY
FT                   RSLHTAVIAENKSLEIQIRTHQMHFEAELGMCAHVNYKEGGKNKQDAYLSQKINSLRQL
FT                   LLAGSDTTNKNLIQDGINKGPHEGLTDEFDHELDEEEQLVDFGELEHIYVFSRDGDITE
FT                   LPKGATVLDFAYYVHTQVGNRAQAARVNQRYVPLTYQLKTGEQVEIITKSSREPNRDWL
FT                   VPSLGYIQTSRARSKLRQWFNKQDRDKNIDIGKQMLAKELTRLSVHPNSISLKDYVKHF
FT                   NNVNSPDDILVGLVTGEIGLHQLTGHISRELDLVIDNEEQDYAPSVHPKVTGKIDAYKI
FT                   NIDGLDNIEMRFANCCQPVYGEPIAGFITQSSGVSIHNRGCAEYARLIEREPERQISAS
FT                   WVSQQTSYQPVEIIIEAYDRRGLLRDLTQVIDKENVNIRGVDTNSDDDNVAHLKFRLEV
FT                   TGLSQLSKLLAKLEQQPGILHARRAI"
FT   gene            complement(461801..463351)
FT                   /locus_tag="PsycPRwf_0384"
FT   CDS_pept        complement(461801..463351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0384"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93339"
FT                   /db_xref="GOA:A5WCE8"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCE8"
FT                   /protein_id="ABQ93339.1"
FT                   /translation="MQPTDTNNISSKANSSTDHASLAAAPSKKLSKPSSRVRRRLKDAP
FT                   PLAFKIDGLSHDGRGVAIYGNEFGVEDGHSEDKHGKKVFVSFALPDESVKVRLTNSRKS
FT                   FEEGDAVELIANPHPERQTPPCPHFGTCGGCSLQHWQPEGQIAFKQTVLAELLEHQANI
FT                   QPDNWLQPVVADRLGYRTKARMGVRYVAKKDTALVGFRERNSNFLAELNECHILDKRIG
FT                   FELENLKSLISSLEARAHIAQIELAMGEAIPELKDGNQPVALILRHLEPLSKSDIDQLK
FT                   AFFKARNWQLYLQSKGPESIERIALHDTDDVSEQFGRLYYQLPEFNLTYEFIPTDFTQV
FT                   NLSVNRKMTKLACDLLDLKPGERVLDLFSGLGNFSLPLARLVGGEDGSQGLAIGVEGSD
FT                   AMTARAADNAKRNGISNTEFYNQDLTQDFSEQPWAQQGFDAILIDPPRSGAWEVMQYLP
FT                   RFNASRIVYVSCNPATLARDTKALLEQGYRLTDAGVMDMFCHTGHVESIARFEKLQTV"
FT   gene            complement(463603..464412)
FT                   /locus_tag="PsycPRwf_0385"
FT   CDS_pept        complement(463603..464412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93340"
FT                   /db_xref="GOA:A5WCE9"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCE9"
FT                   /protein_id="ABQ93340.1"
FT                   /translation="MPDFSKTPVLVFDIETVADIEGARRVYPQLAKLNDDDTLTALTSL
FT                   RLQEAGHDFMRLPLQKIVCISVLYIKDGQFSLFSLTADTLSEKEIISTFFRAFKDLNSL
FT                   PQLVSWNGSAFDIPVLIYRAMQYDLSVPLLFEEGHRITNMRYDNYVNRFHTRHLDLMDR
FT                   FSQYGGSRRESMTIVASLYGLPGKMAVKASQVAQMVADSQWRELSLYCESDVLNTWLIY
FT                   LRWLRLTGVLSSSDFDMWQAQTQDYLTKKLDDNNQVQHQLFLDHWQR"
FT   gene            complement(464533..465480)
FT                   /locus_tag="PsycPRwf_0386"
FT   CDS_pept        complement(464533..465480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0386"
FT                   /product="cysteine synthase B"
FT                   /note="TIGRFAM: cysteine synthase; cysteine synthase B;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93341"
FT                   /db_xref="GOA:A5WCF0"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005858"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCF0"
FT                   /protein_id="ABQ93341.1"
FT                   /translation="MSNTSQNSVNFIQQVTTLSDCLGNTPLVALQRLPKLEGIDTSVQV
FT                   LAKLEGNNPASSVKDRPAFNMILQAEKRGEIKPGDTLIEATSGNTGIALAMVAAMRGYK
FT                   MILLMPTNSTQERKDAMAAYGATLIEVDEGIEAARDQALQLQAEGKGIVLNQFANPDNS
FT                   AAHYQTTGPELWRQTGGRITHFISSMGTTGTISGTGKYLKEQNPDIQVIGLQPDADSAI
FT                   AGIRRWPEEYRPAIYDPTVIDRTIDISQHTAEEYMRKLAHTEGILAGVSSGAAAWAALQ
FT                   VAKEIKDTQPDAVIAFIVCDRGDRYLSTGLFTAQ"
FT   gene            465660..469133
FT                   /locus_tag="PsycPRwf_0387"
FT   CDS_pept        465660..469133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0387"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein domain protein; Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93342"
FT                   /db_xref="GOA:A5WCF1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCF1"
FT                   /protein_id="ABQ93342.1"
FT                   /translation="MRKKIIDFSSAYAQLILLVFLPIVILAAVGAYLVQKESSKAIKSE
FT                   QHTLATAALIRYEPMVKQLLPVILSNQSLTEQQVAPQHSSRQANEGPSTWQVDTEAASD
FT                   KVLPKPAAQIQSTGDRAADAVVKMTLPDEPIDAKAVADEPEVEQSLKSLDDVKKRIGFI
FT                   LSSMNNNQHVQRVAIIDSNGKVLAASGDISTTSWEQMSQQYKADQQGFISGIPTEIGTA
FT                   YGRSLGNYEGMQYWLFVDMDNEPLTIARLKVWLGLGITGLFTLLMLLLSLNIYAKRWIA
FT                   PIYDLRLHLQQITPENMYLPVNTQSSGELNQLQQDLLKTLRRLYGDFQELKDHSDQTED
FT                   DLRDAFDEMEMQNIFIREARDQAISSSQAKSAFLANISHELRTPLNSIDGFINLLARHG
FT                   DLTAEQDLYVQTIRKSSAHLLALVNDVLDFSKIEAGKLVLDKHEFSLYSAIYDVMDMLS
FT                   PLAAEKGLRMAVLYYNDVPNTIIGDALRVKQVLTNLVGNAIKFTDVGEVVVRVGIDEIE
FT                   DASVIEASGQAEDEAKSHHAKVATDKDNSGSMIHIAIQDTGHGLSEKAKSQLFKSFSQG
FT                   DPSITRQYGGTGLGLVISKQLTKLMGGKIGFYDNDNNAAQSQLVLPEPGLSAGSVNKNP
FT                   MRTGATFWFSIPSYVDIDELSDQEFGVGYEQELTDEQLQLPMLRPFAQTQGDDDKPFDM
FT                   LVWINHPSSIQVFMAAVRPLNINVTMARSLAGALEKLKEEGNRWDWVVIDGGESETRED
FT                   RAALLKQIRLHYQGKLAIYGYQVALDATLLERYKAMGLYQPLDKRQLYSMLDTRTTNVS
FT                   TLVAPPTWQGVTILAVDDHLPNLLVLDALLSELGIKVITANSGYDAVEIIGKQLMYDTY
FT                   DSEQAAALEDKETGATPKDAQSSSLPVQPTTIDLVFMDVQMPRMSGDEAAKKIRQLEAD
FT                   AQKEHKNYHKRLPIIALTAHGLADGKDKFIAAGIDDYVGKPISRPQLLQILQRWLGRGA
FT                   ETVNPALKPELNLAQKQKQDEHEQVQDELLIVDWKDALMRSANKPDLAKQLLHMMQDSV
FT                   ADELQALQQAWEDRDREQLAQIAHRILGASRYSGVPQIRQASQDLEDKCLLNVQHTIPS
FT                   QFAMLEEYYTVLISSLKMLQALDLDAYITQQMQESDEKALSENDMTWKMI"
FT   sig_peptide     465660..465743
FT                   /locus_tag="PsycPRwf_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.833) with cleavage site probability 0.419 at
FT                   residue 28"
FT   gene            469186..470013
FT                   /locus_tag="PsycPRwf_0388"
FT   CDS_pept        469186..470013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0388"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93343"
FT                   /db_xref="GOA:A5WCF2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCF2"
FT                   /protein_id="ABQ93343.1"
FT                   /translation="MSSLFSQKLNEKYTTLALSEADEVLTVSLNRPDKKNAMSLRMMRE
FT                   LIDVAERLKKDHSIRSVIINGAGDSFCAGIDLSDLNNPKNAMMGLYELLKPTQSIFQRV
FT                   CLIWREVPVPVIVVTQGYCIGAGMQLALACDFRISTPDCQFAIMEAKWGLVPDMGLTQS
FT                   ALHVLPVDVLKELTMTARLIDAKQAEQLHLVTHIDDTPYERAQALATEIATRSPDAVLA
FT                   SKRVINQMTKQSFCALYQEKMWQLKLMGGGKNRKLAIKKAKDNSVQFLKRQFS"
FT   gene            470331..471545
FT                   /locus_tag="PsycPRwf_0389"
FT   CDS_pept        470331..471545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0389"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93344"
FT                   /db_xref="GOA:A5WCF3"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCF3"
FT                   /protein_id="ABQ93344.1"
FT                   /translation="MSNTQNSTPKLPVAWIMMLGLIVAIGPLSIDMYLPALPTMAEDFG
FT                   VSTAQISNSVPAYFAGLVFGQLIYGPLSDRVGRVKPLYFGMTLYVIASLICATTDSQYV
FT                   LFAARTLQALGACVGAVVTRAAIRDTLPPKQMAKAFSIMVLVMGLAPILAPSLGAAFLR
FT                   FFDWHVIFWFLAGFGVLNLLLTKFFFKETLTEENRNYKPLNTILSQYLDLLKDPSFGFP
FT                   AIGAGLLMGSMFVYISAAPELLMDGYGLTENQFSLIFGMNAAGFVALTQVNQFLTNRFR
FT                   LISLLRFGAVMQAVAAIGLLLLGGIYGAEAWLPLVLICIFFCIAGLGLTQPNASAIALA
FT                   FQKHRAGMASALQGSLMFCVGIFGGLLLNLFPVNPVFKLGATMSILMCLGTFLIYRMDK
FT                   NLNLE"
FT   gene            complement(471724..472215)
FT                   /locus_tag="PsycPRwf_0390"
FT   CDS_pept        complement(471724..472215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93345"
FT                   /db_xref="InterPro:IPR021242"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCF4"
FT                   /protein_id="ABQ93345.1"
FT                   /translation="MTFLQTTLLTTVFGTAMIVLSGCATTQALSPQQCQAGNWQDIGYA
FT                   DGLAGRSGAYFGRHIENCSPVANSTPNRELWEQGRQQGLKQFCTELNAYKLGREGYAWQ
FT                   PVCPLENIEKLEEAYNQGRYYYLRQRDMEYLSAPYPWGYGRYGYASPYSWRSPFWRPGW
FT                   "
FT   sig_peptide     complement(472129..472215)
FT                   /locus_tag="PsycPRwf_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.678 at
FT                   residue 29"
FT   gene            472691..473485
FT                   /locus_tag="PsycPRwf_0391"
FT   CDS_pept        472691..473485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0391"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93346"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCF5"
FT                   /protein_id="ABQ93346.1"
FT                   /translation="MKTVLIANQKGGCGKTSVAITLAAALANQGQTVALADADPQRSSL
FT                   RWLKQRPDTAAKIYAVDWCDEEDIGDLPKKVAKTLGKKDWLIIDAPGSLSGDRAESLIS
FT                   EARAILIPVLPSIFDADSTKQFLKSIQDIKRIRKGKVDIHLLANRVRSQSSTNLTLQRF
FT                   FENIGQPPLAWISERSLYPQLAEQGLAIFDHTQKRYRDIQAQWQPVMDALMPKVATKYE
FT                   EVLAGSEIPASLEKLPQAKSATGMHKAGKSSKKTKDNSTWYE"
FT   sig_peptide     472691..472801
FT                   /locus_tag="PsycPRwf_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.640) with cleavage site probability 0.347 at
FT                   residue 37"
FT   gene            473546..474109
FT                   /locus_tag="PsycPRwf_0392"
FT   CDS_pept        473546..474109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93347"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCF6"
FT                   /protein_id="ABQ93347.1"
FT                   /translation="MGTWVAIAIGLFVLGSIMALKPSGVDVRLDKLRMTARRLELNPKL
FT                   VACPDWIRGRNNEYGKGMMGQYALILDDMKFPETRYQVIDGELRPDSTSGTQIEVNDGA
FT                   QGNAGTQDVTYRLDHEPLNLPASITPLVKAVYTKANSLVVFWEDSGYVKPNTNPNYDPQ
FT                   HIEPDLLALKAAMYQWAQKLANKG"
FT   gene            474310..476964
FT                   /locus_tag="PsycPRwf_0393"
FT   CDS_pept        474310..476964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0393"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.6.2.2"
FT                   /note="TIGRFAM: DNA topoisomerase I; PFAM: TOPRIM domain
FT                   protein; DNA topoisomerase I, zinc ribbon domain protein, ;
FT                   DNA topoisomerase, type IA, central domain protein; DNA
FT                   topoisomerase, type IA, zn finger domain protein; SMART:
FT                   DNA topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93348"
FT                   /db_xref="GOA:A5WCF7"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013263"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCF7"
FT                   /protein_id="ABQ93348.1"
FT                   /translation="MAKTTAKKTTSTPAASAKGKSLVIVESPAKAKTINKYLGDDFIVR
FT                   SSIGHVRDLPTSSGVKKKATKTDEKLSKEDKAQQALVRRMGIDPEHGWKAVYEVLPNKT
FT                   KVIKELKALAKDADKIYLATDLDREGEAIAWHLREVIGGDDSKYQRVVFNEITKSAIQN
FT                   AFKEPGKLDIDRVNAQQARRFLDRVVGFMVSPLLWQKIARGLSAGRVQSVATRLVVERE
FT                   REIRAFIPEEYWQIHADTTMKGSENANVAADTPIRLEAVKQAGKVLKLGNKAQTDAVLA
FT                   VLKPATFVVKEREEKPTQSKPSAPFITSTLQQAASTRLGFPVKKTMMLAQRLYEAGHIT
FT                   YMRTDSTFLSNDALASVRGFIEENYGSKYLPEKPNFYGSKQNAQEAHEAIRPTNANLKS
FT                   TQLKGVDRDAIRLYELIWRQFVACQMLPAKYKSVNLLVEAGDVELKARGRTMTFDGFTK
FT                   VMPPAKTDDTLLPDVKQGDELNLIKLDPSQHFTKPPARYTEASLVKELEKKGIGRPSTY
FT                   ASIISTIQDRGYVRLENKRLYAEKMGDIVTDRLTESFPELMDYTFTAGLEDELDHVAQG
FT                   DQDWKAVLDDFYGDFKTKLEHAKDKDGMRPNDPTDVPDVHCDLCGRPMQLRNGSTGVFL
FT                   GCTGYNLPPKERCKGTKNLMPVEAFANLDDSEIDESAEVKELMEKKRCPKCSTAMDGYI
FT                   VDGGLKLHICGNNPDCDGYLLEEGMFEVPGSDAPTIDCNKCDGQMELKTGRFGPYFACN
FT                   KCDNTRKVLKNGEPAPPRMDPIDMPELKSTKHEDHFILREGAAGLFLAASKFPKVRETR
FT                   PPKLSELRTIKDKMDDKFQYLFDGPDQDPEGNPTILRWSRKQKEQYIGSESLKTGKATR
FT                   WGVYWRKGEWVEE"
FT   gene            complement(477065..478078)
FT                   /locus_tag="PsycPRwf_0394"
FT   CDS_pept        complement(477065..478078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0394"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93349"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCF8"
FT                   /protein_id="ABQ93349.1"
FT                   /translation="MTTSATLTETNNIVVTALYKFTRFNDYENYREPLRQLMLDKGVRG
FT                   TLLLASEGINGTISGDRAGIDAVLAYIQDIPAIGALEYKESFTDTQPFFRTKVKLKKEI
FT                   VTMGVEGIDPLQSVGRYVKPSEWNDLISDPDVLLIDTRNDYEVQIGTFKNAVNPKTETF
FT                   REFPEYVKNELDPSKHKKVAMFCTGGIRCEKSTAYLREQGFDEVYHLEGGILKYLEEVP
FT                   AEESMWEGDCFVFDNRVAVNHSLQKSEYDQCYACRMPITEADKQHPAYVKGESCPHCID
FT                   KATEEQRARFRERQRQIQLAKQRGEVHIGADVNDVIEARKQQKLQARLEQQEDELK"
FT   gene            complement(478378..481200)
FT                   /locus_tag="PsycPRwf_0395"
FT   CDS_pept        complement(478378..481200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0395"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93350"
FT                   /db_xref="GOA:A5WCF9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCF9"
FT                   /protein_id="ABQ93350.1"
FT                   /translation="MPQSSANSRLIHYIVSILLAIVALALILVLAFPIGFYGMAMYITP
FT                   NLPSISEMKSTNLEMPLQIYSKDDKLIGQYGNRMSLPVTYDDIPKNFINAFLAAEDSSF
FT                   YEHSGISIKGLGRAITEIITEDGGQTGGSTITMQVAKNYFLSPERTFSRKLTELYLARS
FT                   IEDQLSKEEILTLYVNKIYMGEGAYGIRAAAKKYYSKSLDKLTIAEMATLAGLPKAPSQ
FT                   NNPVSNPEEALERRNWILGRMLELGYITQAQHDTAVKEPIGVHLYKEQLDVNMPYLAEM
FT                   TRRTLVDRYGEEVVNAGWRVKLTVDSEDQKAADTAIKKGLIGYDRRHGWRGVEAHGEPL
FT                   SKFTTYSNMVPAKVVEVSGRSFKAELADGEVVTVPWSGMSWAKEYLDANRIRRYPNNAS
FT                   DLVKKDDIVRLIANENKTAWRLTQIPKVQGSLVALDPKTGAVDALVGGFDFRYSKFNRA
FT                   TQGWRQPGSTIKPLNYAAALEKGYRPDSMISDGPLRIGDWQPKNSDNRFYGDMTIRRGL
FT                   ILSRNLVSIRLLQAVGTSDARQLLDQFGLDKDKLPTTLSLALGAGQATPLQMATAYSAF
FT                   ANGGHRIQPYFIDQIYDYDNKLLYLANPQRACALCFNNDLQKLNAKLKQDYEKQAEADA
FT                   KLHQLALKALAEDPKLLQVADSTQSETVDSADDGAEDEADNAKAKPKNSKASLQAAIEA
FT                   IRYDAGPQSDRLKPVPITYQVADQAPRILKPNVAYEMAGMLRDVIQRGTGTRAKALGRT
FT                   DVGGKTGTTNEMKDAWFAGFHPTQVSIVWVGFDQPSTLGRGEYGGVAALPIWVDYMRTA
FT                   LKSVPYQWVSVNNKAKSETAKQEVINLSDDNDNTTAGATGSGSDARITNQKVTDGVVRP
FT                   PRASLIERQPPKPVEPPKPVNSNNNSNSNSSTNADTSSTRAAPKPAPKPAEKPKAEPKP
FT                   TENKAAPAND"
FT   sig_peptide     complement(481078..481200)
FT                   /locus_tag="PsycPRwf_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.536 at
FT                   residue 41"
FT   gene            481937..482935
FT                   /locus_tag="PsycPRwf_0396"
FT   CDS_pept        481937..482935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0396"
FT                   /product="Tfp pilus assembly protein ATPase PilM-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93351"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCG0"
FT                   /protein_id="ABQ93351.1"
FT                   /translation="MRIGSQSKQAAIALPTSLALTKIIEMPAELTEDEIEAQIHIDADQ
FT                   HIPYPLSQVCLDFQIQGPADTDDSMQQVLLVAARLEHVEQQADSLTFAQLQPKVVDLES
FT                   HAQICAFQLAWDNLSVHKPNNFTPNNLTHNNLTHNNLAPANTPQTVALIDIGESRTTFY
FT                   SHQSGQLVYQSQQLFGGAQLTQGIANQQGIDLSQAVIIKHDLAAYITCHQQQGSGRHKH
FT                   SHKYADLTKVYTQFVADLAEHITQAFDAYAALAPAVVTEHIMLCGGSALLPDIEAMLKD
FT                   QLSCEVSVANPFGQIKVSDQVDRDELYAEAPRLMSACGLALRCQMQNQAYL"
FT   gene            483001..483513
FT                   /locus_tag="PsycPRwf_0397"
FT   CDS_pept        483001..483513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0397"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93352"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCG1"
FT                   /protein_id="ABQ93352.1"
FT                   /translation="MVVINILAAVVCCILVWGHFYQAHAKQQHLNSQLVLSNAQLEAQI
FT                   TSSEVLQQHQHTISAQIELLNQRQSQRLALSALWRDIAKAVPEGLYLTGIKRQGNLLSV
FT                   TGKASTAQQVTDLMAALERSTWLHQVQVQHIQVAGADAIKEDETIKILPAANMDFVISS
FT                   QHRPSTK"
FT   sig_peptide     483001..483078
FT                   /locus_tag="PsycPRwf_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.955) with cleavage site probability 0.575 at
FT                   residue 26"
FT   gene            483523..484932
FT                   /locus_tag="PsycPRwf_0398"
FT   CDS_pept        483523..484932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0398"
FT                   /product="Tfp pilus assembly protein PilO-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93353"
FT                   /db_xref="GOA:A5WCG2"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCG2"
FT                   /protein_id="ABQ93353.1"
FT                   /translation="MSLAARVKKTGQVKGRIWPLIYQMQSLDTQNYGSWPRFVKVFIIL
FT                   LITLSMAVISYMLPIRQQLARIEAAQNQHQVLLAAANEKQLKLKQLPDNDAQIQALQQG
FT                   FIEQIQRLGLLDSSDNSQPQSLTGEAVEPSFAERQMASGAAPSTLLQQITEAGRSNHIV
FT                   FKKLALPTQSVAHKDSDNRSDQLMPADTVDAANSSSNKDISPQVRTAATAEKLFIEQPM
FT                   TLLAVAEYQQLGGFLADLALLPKLIVAHDFELTRLKTGSTLQPQLSLRLQANAYVLSAE
FT                   TQAKLGNLALNSLSDSDNPKTTRTNRSHTDKTQTNSLPSTVYQTASNRDPFGFKSILVQ
FT                   HSAAPDVTVVQAGKPAANLDVNKADNLTNAVIPPAVWSGEGSGRIRQAMEYYGLSQLTY
FT                   RGMMGWGAATTKGLVQRPDGVITAIKIGDYLGLHQGRVVEITPTHLNLVETLLTPESGK
FT                   TKRRVSLIAPF"
FT   gene            485000..486928
FT                   /locus_tag="PsycPRwf_0399"
FT   CDS_pept        485000..486928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0399"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB, short N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93354"
FT                   /db_xref="GOA:A5WCG3"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCG3"
FT                   /protein_id="ABQ93354.1"
FT                   /translation="MMFFRPEVYQLRLKFRAMQALTLAVTTSLSSQVPAATSALINVQE
FT                   QPDTVTAKAFNSFAAPYQIDYQRLSENQEMLQIALDNPDTQIEIKRQGNTLLVRLKGVT
FT                   ASSVHGSMPVLGQKLTGLLQRIEAEQRGKDTWLIFTVSKDFEYQSYQLDNLIKIQIQPV
FT                   RAIQQNTVTPKIYSGKPISVDFQQVEVRSVLHLLSQFTDTNIVATDQVTGSLMLNLVNV
FT                   PWDQALDIILTSQQLGKQTQGNVILVAPLAQMAKQRAQQLAIEQQSQALMPLRSEYIRL
FT                   NYAKAEDLQALIIKASGSPTPTPVAMQHLPASTAVANAPSALPAVVTRLNLPVSSRLLS
FT                   SRGVIAVDARTNTLIIKDTADSLSNIHALIKQIDIPVRQVMIEVRMVSATDNFSKEMGV
FT                   KWGLLSKGVAHNDDLLVGASDQTLADLKSFSAPNTAYKGRNKSRAGYAITRPDNLNVDL
FT                   GISNPAGRIAFGLLSMSDLMIDLELSAMQAEGRGEVISTPKILTLDKQTATVSSGTKIP
FT                   YQSESEGGGTTTQFEEALLSLQVTPSITPEDKISLQLNIENGRPNPVGNGVILIDTDRL
FT                   ITRVTVGDGQTLVLGGIYRNQIFNNTQKVPFFGDLPYIGRLFKQDLRRNDQQELLIFVT
FT                   PKLMQLP"
FT   sig_peptide     485000..485116
FT                   /locus_tag="PsycPRwf_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.810) with cleavage site probability 0.272 at
FT                   residue 39"
FT   gene            487190..487732
FT                   /locus_tag="PsycPRwf_0400"
FT   CDS_pept        487190..487732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0400"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93355"
FT                   /db_xref="GOA:A5WCG4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCG4"
FT                   /protein_id="ABQ93355.1"
FT                   /translation="MQSTLPSLFIVGPMGAGKTTVGKLLAKHLGRDFIDSDHYICEQTG
FT                   ADIPWIFEKEGETGFREREARAIAELTALPNVVLATGGGVVMQPQNRDNLTKQGITIYL
FT                   RANVDVQLKRTAKDKSRPLLNTPNPRAVLQSLFDVRDPLYREVADIVVETGDGYPRYML
FT                   KKIIEALKQHYPEHMKS"
FT   gene            487825..488925
FT                   /locus_tag="PsycPRwf_0401"
FT   CDS_pept        487825..488925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0401"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93356"
FT                   /db_xref="GOA:A5WCG5"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCG5"
FT                   /protein_id="ABQ93356.1"
FT                   /translation="MDVESLMKANLVVHTQSHDYPIIITSQCDMAKEIAPYIKGKQVMI
FT                   VTNTTVEKLYLADLAAGLKEDFEVMSVVLPDGEQYKTQQYIDTIYDALMDNHCSRDVTL
FT                   VALGGGVIGDMTGFAAASFMRGVNFIQIPTTLLSQVDSSVGGKTGINHPKGKNMIGAFW
FT                   QPQMVLADMHTLTTLPQRELSAGMAEVIKYALIMDETFLDWLEDNMAALMGLDKVVLAE
FT                   AVARCCQYKADIVAQDEREAGKRALLNFGHTFGHVIETHEGYGQWLHGEAVAAGMVQAA
FT                   QLSHKMGWISEAQLQRICAVLISAKLPTQPPSIDTQIALDLMQHDKKVKSGQVRLILLK
FT                   SVGDAVVTADFEPKLLEEVLASCVPN"
FT   gene            489039..490088
FT                   /locus_tag="PsycPRwf_0402"
FT   CDS_pept        489039..490088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93357"
FT                   /db_xref="GOA:A5WCG6"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCG6"
FT                   /protein_id="ABQ93357.1"
FT                   /translation="MAITKSSPSNMPQKTKKRLVASVWLITALLVSAAALALWMFSAAP
FT                   VFDDEKKAETEVPPEAIASKIDQVTRIDKLNELNADVKPISFDALVRDLRDYPPEFKDA
FT                   KYLKKFKGKWTVQVMDVSEHEIITDYLNSRKDRQKFAYFRYRDSNNQPRYLLTYDVMPS
FT                   EQLAVNAASSVDFDLPANVQVIPEEISGYLTVIENYELSAPIKDLSRNRARQVKLQATR
FT                   SEIAPRRRIVSEPQSSNNSSQAQSQSSDSSGTNNSSARPSSDIKTSNNTNDTLSVQEER
FT                   KVVSPSEGNIQPSVEPTPPKNNAKPKEEAAKPKAEKPKPEPTKPAEASKNTQKSGNDSI
FT                   KQLIDEKTE"
FT   sig_peptide     489039..489152
FT                   /locus_tag="PsycPRwf_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.884 at
FT                   residue 38"
FT   gene            490907..495430
FT                   /locus_tag="PsycPRwf_0403"
FT   CDS_pept        490907..495430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0403"
FT                   /product="glutamate synthase (NADPH) large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: glutamine amidotransferase, class-II;
FT                   glutamate synthase, alpha subunit domain protein;
FT                   ferredoxin-dependent glutamate synthase; glutamate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93358"
FT                   /db_xref="GOA:A5WCG7"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCG7"
FT                   /protein_id="ABQ93358.1"
FT                   /translation="MTQNFIANPATLDHTQNHTQPPAIDTPTYLASPDDFTDNCGFGLV
FT                   AHIEGKPSHHLVKTAIHSLSCMTHRGGVAADGKTGDGCGLLLAKPVDFFHTVASELGLE
FT                   LDENFAVGMVFLNLDEKLAAHSQQVLDKEVAAQGLTVAGWRDVPVDLSIVGEIGRESLP
FT                   QFKQIFVNAPSDLSVEDFNRKLYVARKKAELALTDDELFYVTSLNCQTVIYKGLVMPSD
FT                   LPAFYSDLQDSRLHSHIVVFHQRFSTNTLPRWPLAQPFRYLAHNGELNTITANRNWSVA
FT                   RTPKLETPKLPEITQLHPLVNRTGSDSSSLDNMLEVLISGGMTLFHAMSILVPPAWQNV
FT                   DSMDMDLRAFYEFYSQHMEPWDGPAGLVIQDGRYAVCMLDRNGLRPSRWVTTKNGYITV
FT                   ASEIGVWDYDPNDVIAKGRVGPGQMLVIDTLNGEVLDDQVISNRLKKAHPYRKWLREEA
FT                   TRIRDNEQIEEKLLEQGVLGEPLKALQKMFNITNEERTEIIRPNAENGQEPVGSMGDDT
FT                   PVAVLSKQVRNVADFFRQQFAQVTNPPIDPLRESIVMSLQTCLGAETNIFNPTPRDAHR
FT                   IILASPVLSPSKMQQIEALEDPAFLSQRIDINYDESLSLEVAIKQICEQVEQAVLAKKT
FT                   LIILSDKGIEKGKLPANAILVTGAVHHYLIEKGLRTDANLIVETGVARDSHQVAVLIGF
FT                   GATCVYPYLAYDVISDLVASGELLGDPLQARANFRKGLDKGLLKILSKMGISTIVSYRG
FT                   AQLFEAVGLSEEIVEMCFKGVQSRIKGATFEDLTKDQALLAKNAFSRRTPLDQGGMLKF
FT                   VFNKEYHAFNPDVINTLHKAVRTGDYENYREYANLVNMRPVATLRDLLALKSDNPISVD
FT                   EVEGIEAILPRFDSAGMSLGALSPEAHEAIAMAMNTIGGRSNSGEGGEDPVRYGTMRNS
FT                   KIKQIASGRFGVTPAYLRSAQVMQIKVAQGAKPGEGGQLPGGKVNSLIARLRYSVPGVT
FT                   LISPPPHHDIYSIEDLAQLIFDLKQVNPEALVSVKLVSRPGVGTIATGVAKAYADLITV
FT                   SGYDGGTAASPLSSIHHAGSPWELGLAEAHQSLRVNGLRDKVRMQTDGGLKTGLDVVKA
FT                   AILGAESFGFGTTPMIAVGCKYLRICHLNNCPTGVATQQARLRDEHFIGEAEMLINFFK
FT                   FVATETREWLAFLGVRTMEELVGRTDLLELLEGTTDQQRNLDLSPLLRTHPAAEGKPHT
FT                   CQVERNEPFDKGLLAEKMVDDMILAIRQGHGGTYSYQVGNCDRSIGARISGEIAQVWGN
FT                   LGMSDSPIKLHLVGTAGQSLGVWNAGGLNIELEGDANDYVGKGMAGGEIVIYPPKGSTF
FT                   ASQETAIIGNTCLYGATGGKLYASGTAGERFAVRNSGAHAVIEGVGDHCCEYMTGGVVT
FT                   VLGKTGLNFGAGMTGGFAFVLDLDNSFFDRCNHELIDLHRISSEQTEEHRIYLKQIIET
FT                   HVEKTGSAWGRQILADFEHYVRKVFLVKPKAANMASLLHSTTADPQ"
FT   gene            495647..497065
FT                   /locus_tag="PsycPRwf_0404"
FT   CDS_pept        495647..497065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0404"
FT                   /product="glutamate synthase (NADPH) small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93359"
FT                   /db_xref="GOA:A5WCG8"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCG8"
FT                   /protein_id="ABQ93359.1"
FT                   /translation="MKRINNNFQFLDVPRREPEKKDIVTRSTEFVEIYSPFEATEAAQQ
FT                   AHRCLECGNPYCEWKCPVHNYIPNWLKLATEGQIFQAAELCHRTNTLPEVCGRVCPQDR
FT                   LCEGACTLNDGFGAVTIGNVEKYINDTAFALGWRPDMSDVQWTDKKVAIIGAGPAGLGC
FT                   ADILVRAGVKPVVFDKRPEIGGLLTFGIPEFKMEKQVMRNRRTVFEGMGIEFRLNTEIG
FT                   TDVTIDELLQDYDAVFMGMGTYTYMRGGYPGEELFGVYDALDYLIANVNRCNEWEQDPS
FT                   QYINLKDKKVVVLGGGDTAMDCNRTAIRQGAERVVCAYRRDEANMPGSLREVKNAKEEG
FT                   VEFLFNRQPTQIVGLNGQVTGVKVVTTQLGKPDNRGRQRPEPIPNSEEIIECDAVIMAF
FT                   GFRPSPADWFEQSAVKIDNSGRVLAPEEQAFKFQTSNPKIFAGGDMVRGSDLVVTAIWE
FT                   GREAAKGILDYLEV"
FT   gene            497448..498095
FT                   /locus_tag="PsycPRwf_0405"
FT   CDS_pept        497448..498095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0405"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93360"
FT                   /db_xref="GOA:A5WCG9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCG9"
FT                   /protein_id="ABQ93360.1"
FT                   /translation="MPSRNSGERPKTGEEALQWLKVGNDRYVKSLNNPGNAVATRHELI
FT                   SEQDPFAIILGCSDARVPVEIVFDQGLGDLFVIRVAGNVVAPSQIGSIEFAVEKFDTRL
FT                   VVVLGHSNCGAVTACVDALMNPEQNYTTNLQSIVDRIRPSVYNLHELATAKGGEVDKQK
FT                   LIDSSISANVRMSVSQLKHASRLLEDMNRTGELLIVGAEYNLDTGEVEFLPM"
FT   gene            498216..498761
FT                   /locus_tag="PsycPRwf_0406"
FT   CDS_pept        498216..498761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0406"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="TIGRFAM: lactoylglutathione lyase; PFAM:
FT                   Glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93361"
FT                   /db_xref="GOA:A5WCH0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCH0"
FT                   /protein_id="ABQ93361.1"
FT                   /translation="MSINYVDQPKGSVVVDGVQPIAAATTGYTFNHTMLRVKDPKASLE
FT                   FYTGVLGMTLLTVKKFPEMAFDLYFLAKLTDDERANLPENEELAIYTFRQRGILELTHN
FT                   YGTETQPGRIYHDGNAEPQGFGHICFSVPDLTAAVEWFDKNNVEFKKRPEEGKMKNVVF
FT                   IKDVDGYWIEVVQADLMG"
FT   gene            498975..499922
FT                   /locus_tag="PsycPRwf_0407"
FT   CDS_pept        498975..499922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0407"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93362"
FT                   /db_xref="GOA:A5WCH1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCH1"
FT                   /protein_id="ABQ93362.1"
FT                   /translation="MPQLDSVSDKINEYQTIASAANQMVNDFIVRLPYFIVALSVLLLF
FT                   WLLSILFKKLVTKLLLKTHTHRNLIRVFQRIGGALIIFVGVMVAMVIAIPGFTPAKLVG
FT                   ALGIGSVAIGFAFKDIFQNLLSGILLLLSEPFRIGDQIVSGDYEGTVEDIKVRATTIRT
FT                   YDGRQVVIPNSQLYTSALTVNTAYKRRRLELTVGISYQDDINEAKAAILEALKQSETVS
FT                   KLAEPSVVATEFSGSSIDLKVRWYIDDGTQANKVASIHEVIVQTKSHLDAAGVSIPFPI
FT                   RTLDFSDASAQALIDNMVSAQQVSQSCAHKSSRK"
FT   gene            complement(500026..500472)
FT                   /locus_tag="PsycPRwf_0408"
FT   CDS_pept        complement(500026..500472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0408"
FT                   /product="cytochrome c, class II"
FT                   /note="PFAM: cytochrome c, class II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93363"
FT                   /db_xref="GOA:A5WCH2"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCH2"
FT                   /protein_id="ABQ93363.1"
FT                   /translation="MPIKSLMLATLLPLSLALSACNSGGVSSDVSARQDTMKNWKDTKD
FT                   SMESMIKSPQSFDAAKFKEDTQFLADDALTPWQHFQDKAAVGGANTTVWSNPEGFTAAA
FT                   EKFKQAATNLNTVAQSANTADQVQPAFNELGESCKSCHQEFKAK"
FT   sig_peptide     complement(500410..500472)
FT                   /locus_tag="PsycPRwf_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.531 at
FT                   residue 21"
FT   gene            complement(500692..501690)
FT                   /locus_tag="PsycPRwf_0409"
FT   CDS_pept        complement(500692..501690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0409"
FT                   /product="coproporphyrinogen oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="PFAM: coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93364"
FT                   /db_xref="GOA:A5WCH3"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCH3"
FT                   /protein_id="ABQ93364.1"
FT                   /translation="MSLTNTGINNAAPIVDNPDSPTAKDIQRVRDFLIQLQANICQALE
FT                   QQEIDGGGSATFVPDDWQRPEGGGGRSCVMADGAVIEKAGVMFSHIHISNLPATATARH
FT                   PDIAGRKAQAMGVSLVVHPRNPNVPTSHANVRLFVAEKEGEDPIWWFGGGFDLTPFYPV
FT                   LEDCVHWHHVCHELCAPFGEEIYPEFKKWCDDYFYLRHRNEQRGVGGLFYDDVNTQSRG
FT                   WDFETCFKFMQAVGQGYLDGIIPIFEKRKQLPYTEQQREFQLYRRGRYVEYNLVYDRGT
FT                   LFGLQSNGRIESILVSLPPLTGWQYRYEPEAGTPEYELTDFYLKPRDWLAL"
FT   gene            complement(501751..502437)
FT                   /locus_tag="PsycPRwf_0410"
FT   CDS_pept        complement(501751..502437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0410"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93365"
FT                   /db_xref="GOA:A5WCH4"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCH4"
FT                   /protein_id="ABQ93365.1"
FT                   /translation="MSQLPSTNETHSPYKFISKARLPTAHGQFDIHVFENAEGQEHVML
FT                   TCGLPTDNTDDVANKEKLPPLVRIHSECLTGDAFSSLKCDCGPQLNATMQAIQQEGCGA
FT                   ILYLRQEGRGIGLTNKIRAYALQDQGHDTLDANLLLGLPADARTYEMCKPMLDHVGISK
FT                   LRLMTNNPDKLSYLEDLGFEVVERIPLVVGLNPFNVDYLATKRERMGHHLNNDISSLVF
FT                   KPISEQ"
FT   gene            503074..505206
FT                   /locus_tag="PsycPRwf_0411"
FT   CDS_pept        503074..505206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0411"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase, central region; Transketolase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93366"
FT                   /db_xref="GOA:A5WCH5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCH5"
FT                   /protein_id="ABQ93366.1"
FT                   /translation="MQQYSNSTTPKPAPSQQMDSTSEDNSVDMAISDAVAKKPAAMRLF
FT                   SAIPTTRPTTPLLDSIESPADLTPLSQAQLLVLADELREYLLYSAGQSGGHFGANLGVI
FT                   ELTIALHYLLDTPKDKLVWDVGHQAYAHKVLTGRRDRLATIRAKQGLTAFPERQESEYD
FT                   TFGVGHSSTSISAGLGMSLALRHLKSDAKVACVIGDGAMTGGMAFEALNDAVQQDADLL
FT                   VVLNDNDMSISCSIGGFSRHLAMLWESGYQVDITAGGKPKLTHRPEMPLADRRARHSAI
FT                   RDIPQVADNLFKAIGFTYFGPFDGHDLPELLRVLERAKNVSGPVLVHVYTTKGKGFIPA
FT                   EGDPVKYHAISKLPEKLEPKAADAQANFEKQASVQSAPTQLTKKKYSDVFGDFLCDKAA
FT                   VDPKLIAITPAMESGSGMTEFAQRYPKQFFDVAIAEQHAVTLAAGMATLDVKPVVAIYS
FT                   TFLQRGYDQLIHDVALQNLDVTFGIDRAGLVGEDGATHAGVFDLAYMRCVPNLIVATPK
FT                   DEHECYQLLNTCYEYQGPSAVRYPRGTGPGATIVKPAQCYEVGKGVIESTHHSDSSAQP
FT                   EVKIALLAFGPMVTTAEAAAQNLIAATELGAITVSVVNMRWVKPLDTQLLDELLAQGYT
FT                   HMVTLEEHAVMGGAGSAVNEYLLNHTTCIQQGVRIKNIGIADEFIAHGSHEQQLAECGL
FT                   DVAGVTAHLQALLAVK"
FT   gene            505361..506191
FT                   /locus_tag="PsycPRwf_0412"
FT   CDS_pept        505361..506191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0412"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="PFAM: inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93367"
FT                   /db_xref="GOA:A5WCH6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCH6"
FT                   /protein_id="ABQ93367.1"
FT                   /translation="MEPMVVIAARAAEKVGAELLKAHQNRHKIEFDTESKGLEGLVTKI
FT                   DRFSEELTIETLKYNYPNHSFLGEEFGLQEGQGSDSEWCWIIDPLDGTHNFVHGVPHFC
FT                   ISIAVQHNGVTEHGVIYDPIRDEMFSASRGKGARLNQRRLQVSQRKTIEGGLFTTGHPL
FT                   ERQRGDQVVSYAKEHFATLQKIAEEGGQVRRLGSAALDLAYVAAGRFDGYFEMKLKPWD
FT                   IAAGELLVNEARGVVVDHNGAHKAMETGSIFACNVKLLKPLMKMVVPTWGDAVR"
FT   gene            506319..506969
FT                   /locus_tag="PsycPRwf_0413"
FT   CDS_pept        506319..506969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93368"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCH7"
FT                   /protein_id="ABQ93368.1"
FT                   /translation="MKKPMLSALTACLILIAGCNAESEKAEPKAAVPNTEDVAPIGHTQ
FT                   TPNHGQAAKLIKKPNFDIKAEDYGNKLNELLANTEFAAMTVTKVAEGDSGDAFIIDYPH
FT                   HISLTGEVNESGVLEALIYTMPSNEQLEKSGAKLSQLVTASLLALNPELSPSEAKAKVA
FT                   ELLDHAFSNYILQKTHQRAIGVVGEGVYVCEISEMGVRLLIEPAEGSRFISKK"
FT   sig_peptide     506319..506384
FT                   /locus_tag="PsycPRwf_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.937 at
FT                   residue 22"
FT   gene            complement(507055..507939)
FT                   /locus_tag="PsycPRwf_0414"
FT   CDS_pept        complement(507055..507939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0414"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93369"
FT                   /db_xref="GOA:A5WCH8"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCH8"
FT                   /protein_id="ABQ93369.1"
FT                   /translation="MSKNTQSLNPAIDTATLLIKCKDQAGIVQAVSEFIHRYGANIITL
FT                   DQYSTAHEGGQYFMRLEFALAGLSEIIENFEASFSHTVAKRYEMQWRLHDNAIKTKVGI
FT                   LVSKFDHALLDLLWRHQRGLLDCDITCVVSNHNDLRQAVENFGIPFHHVQVTKDNKAEA
FT                   EEQIHQIMAGNDLLVLARYMQILSEDFVSRWPMQIINIHHSFLPAFVGADPYRQAFDKG
FT                   VKLIGATAHYVTADLDQGPIIEQDVHRVTHRQGVTELRAIGRDVERNVLARAVNWHVQN
FT                   RVIVSGNKTIVFN"
FT   gene            508355..510613
FT                   /locus_tag="PsycPRwf_0415"
FT   CDS_pept        508355..510613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93370"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCH9"
FT                   /protein_id="ABQ93370.1"
FT                   /translation="MSLVNLSKLSFVVVLGLGVVACSSGGSSSSFGGSSPIITPEQQAQ
FT                   KIEANRVALVAKAKKAGLTEVQANAYAEANKEASVNDAESALNKILADIEAERLEKIEA
FT                   NRVALVAKAKKAGLTEAQANAYAQANKEVSTKDAESALNKILADIEAERLEKIEANRVA
FT                   LVAKAKKAGLTEAQANAYAQTNKEVSTKDAESALNKILADIEAERLEKIEANRVALVAK
FT                   AKKAGLTEAQANAYAQANKEVSTKDAESALSKILADIAEAQRLEKIEANRVALVAKAKK
FT                   AGLTEAQANAYAQANKEGNTKDAESALNKILADIAEAQRLEKIEANRVALVAKAKKAGL
FT                   TEAQANAYAQANKEANTKDAESALNKILADITEAQRLEKIEANRVALVAKAKKAGLTEA
FT                   QANAYAQANKEANTKDAESALNKILADIEAERLEKIEANRVALIAKAKKAGLTDAQANA
FT                   YAQANKEASTKDADSALNKILADIAETKRLEKIEANRVALVAKAKKAGLTDAQAESYAE
FT                   ANKEASAKDADTALNNILAEIKEHERLALEAAVSLEKGHYDNPARYPEYLVTAHQLSYS
FT                   DSTLNNDRTINIEHEVVYNQPYSVVIGSYSSWTKGIGSYIFSSGMDSSFTTKGLKTKAD
FT                   AIPSLGKANYSGLAFSSEENPIFASTSGYYKEGLLSYDVDFGSRKGSGTITGLGDVVEL
FT                   HEGTISGSGISSLATQSYKTGDYSLGFYGKKAEEIVGTIAFEGKDTIGFGGTRGEITK"
FT   sig_peptide     508355..508453
FT                   /locus_tag="PsycPRwf_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.980 at
FT                   residue 33"
FT   gene            510661..512100
FT                   /locus_tag="PsycPRwf_0416"
FT   CDS_pept        510661..512100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0416"
FT                   /product="protein of unknown function DUF560"
FT                   /note="PFAM: protein of unknown function DUF560;
FT                   Tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93371"
FT                   /db_xref="InterPro:IPR007655"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCI0"
FT                   /protein_id="ABQ93371.1"
FT                   /translation="MYFKRLFCHIGISMNKKYQAIVYFAVATVAHAQEVPLSQTIFFDE
FT                   EPQIKPELLLDHSKKDSIQVVLPPKNQDLESQVNFAIISKNWDKLTTLLDEYKDTPSMD
FT                   PILYNYGLGALYRHNGRQAEAIKLYESIIQQQPNLYYPRFDLAMMLYENKQFNEAQNHL
FT                   EVVEPHLSPQMQIIVSKLLQDIKKSQQWNYDVNFSYEKTDNVNQASDLKEIVLGDAVFV
FT                   RSEDSLPQEAHGIRYGLNSSMDKNIFGNHYLVADAELSGIHYWDNSDYSEITPNASLGY
FT                   RFKDIKQMLGVTALVDKNFLGGEDYSTNYGGVLSYNRKLSNQLQVSGNYSHIQKNYTED
FT                   DLAKNYDGHLNAASLLLFYQPKLKWLVYVGADAIYDRLEDKSESSDKKGFRAGTVFSGE
FT                   KFIVRTNLRYSERDFLDNNYLYNTKRKDDEYQLSTSIGHKDLVWKGFSPKINYEFKKID
FT                   SNLPLYERNDSTVFIEFNKSF"
FT   sig_peptide     510661..510759
FT                   /locus_tag="PsycPRwf_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.977) with cleavage site probability 0.977 at
FT                   residue 33"
FT   gene            complement(512302..512378)
FT                   /locus_tag="PsycPRwf_R0012"
FT                   /note="tRNA-Pro2"
FT   tRNA            complement(512302..512378)
FT                   /locus_tag="PsycPRwf_R0012"
FT                   /product="tRNA-Pro"
FT   gene            complement(512539..514059)
FT                   /locus_tag="PsycPRwf_0417"
FT   CDS_pept        complement(512539..514059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0417"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB N-terminal
FT                   region; GatB, central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93372"
FT                   /db_xref="GOA:A5WCI1"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCI1"
FT                   /protein_id="ABQ93372.1"
FT                   /translation="MTAITESNTTHQPVRKELLIDGYEVVIGIEIHCQLNTDSKIFSSS
FT                   PTKFGNEPNTQANIVDLGLPGVLPVLNEGLIERALKFGIGVNAELGMLNTFDRKNYFYP
FT                   DLPKGYQITQMENPIVGKGYIDVIVNEGQKNEYAKRIGITRGHLEEDAGKSVHDAVPGM
FT                   TGVDLNRAGTPLIEIVSEPDMRSASEAVAYIKAIHQLVTWLDISDAIMAEGSFRCDCNV
FT                   SVRQPGEEFGTRTELKNLNSFRNIENAIKREIERQIDIIEDGGKVVQATMLYDPEADET
FT                   RIMRTKEDADDYRYFPDPDLLPVRIEQETVDAIRASMPELPVVRRERFSTELGLSEYDA
FT                   RILTDSRELADYFESVLATVGTEHAKLAANWIMGDLLGALNKDDKTITDSPISEVQLAG
FT                   LLKRLNDNTLSGKLAKQVFTALYDGEGGNEADAADKIIEAKGLKQETDTGAIKAIVEEV
FT                   IANNQAMVDEYKGGKEKAFNGLVGQVMKASRGKANPQQVNQILKEILG"
FT   gene            complement(514059..515558)
FT                   /locus_tag="PsycPRwf_0418"
FT   CDS_pept        complement(514059..515558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0418"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93373"
FT                   /db_xref="GOA:A5WCI2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCI2"
FT                   /protein_id="ABQ93373.1"
FT                   /translation="MSDLHHLSIAKLVDGLQNQHFSSVELTDHFLKRINTLDKKVNSFI
FT                   TIDEEGARQAAQQADDRRSAGDNSVLLGLPMAHKDLFCTKGLLTTSGSKILHNFVSPYD
FT                   ATIVSNIREAGAVCLGKLNMDEFAMGSDNESSYYGAVHNPWDLSRVPGGSSGGSAAAVA
FT                   AGFVPFATGSDTGGSIRQPASFCGLTGIKPTYGRVSRFGMIAYASSLDQAGTFGRSAQD
FT                   CAYLLQPMAGHDARDATSIKRDVPDYVADLQSAAAQADADKPFSGLRIGVAKEYFGKGL
FT                   DAEVDANVRAALKQYEELGATIVEVNITDPEITLATYYMLAPAEASSNLSRFDGVRFGY
FT                   RCEDPKDLADLYTRSRSEGFGVEVQRRILMGTYALSAGYFDAYYTKAQKVRRLILQDFK
FT                   NAFEKCDVIASPTAPTAAYKLDAALDPVTMYLGDVYTIGVNLAGLPAISMPAGFTESGL
FT                   PIGLQLIGNHWDDSKLLSTAHIFQQHTDHHTKLSATAQESI"
FT   gene            complement(515768..516106)
FT                   /locus_tag="PsycPRwf_0419"
FT   CDS_pept        complement(515768..516106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0419"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93374"
FT                   /db_xref="GOA:A5WCI3"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCI3"
FT                   /protein_id="ABQ93374.1"
FT                   /translation="MTTPIQNPQAPIGDLRDDKICTADILEVAKLSRLAVDEETAQNFA
FT                   EDIDKILAMMHTLSSVDTEGLTPLANVHEAAQELRADIPNPDIDRELNQSIAPAVEQGL
FT                   YLVPQVIE"
FT   gene            516770..517798
FT                   /locus_tag="PsycPRwf_0420"
FT   CDS_pept        516770..517798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0420"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93375"
FT                   /db_xref="GOA:A5WCI4"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCI4"
FT                   /protein_id="ABQ93375.1"
FT                   /translation="MNPFGFLSNNIAIDLGTANTLIYAPGKGVVLDEPTVVALRSNRTQ
FT                   NPTVAAVGIDAKQMLGRTPDNITAIRPLKDGVIADFEVTQKMLKHFINKVKARRFLAQP
FT                   NVVVCVPCKSTLVERRAIREAVSSAGANKVFLLEEPMAAAIGADLPVHEASGSMVVDIG
FT                   GGTTEIAVISLSGCVYADSIRIGGDIFDEAIITHVRRNHGCVIGETTAERIKQSVGSAI
FT                   DEDAKLEVEVRGRSMAEGVPKTLTVTSEEVQKALSDSLTGIVSAVKTALEQTPPELSSD
FT                   IAERGIVLTGGGALLRNFDKLLSKETGLPVTVAEDPLTCVSRGGGAALAFINNKSLNMI
FT                   FV"
FT   gene            517821..518741
FT                   /locus_tag="PsycPRwf_0421"
FT   CDS_pept        517821..518741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0421"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93376"
FT                   /db_xref="GOA:A5WCI5"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCI5"
FT                   /protein_id="ABQ93376.1"
FT                   /translation="MPTSIFAQYSLSLRKTAAVLLVAMILMLLDSKNPDWFTPIRDTSH
FT                   SAMQPIYQMSVLPSFVSHWADGTLMSKEALRRENVQLHAQLLHAQAKLQQQDYVLAQNA
FT                   RLQGILSTTKPDQYDLNLAQVIGTDTNPLKQIVVLNKGSNDGVEVGQTAIDENGILGQI
FT                   INVYPNTSRLLLITDELQSVSVTVRRTGQRAIVSGEGTPSSLKLDYIFKTSDIRVGDEL
FT                   ISSGLGGRFPAGYRVGRIEYINPEQNDNFMNIEVTPAADFVNSSYVLIMQDSKHSPRYS
FT                   DDSFTGSLELTQAPYVPPSRPIDEP"
FT   gene            518955..519443
FT                   /locus_tag="PsycPRwf_0422"
FT   CDS_pept        518955..519443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93377"
FT                   /db_xref="GOA:A5WCI6"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCI6"
FT                   /protein_id="ABQ93377.1"
FT                   /translation="MIKSPLSPLQSLLLVIASFVAASVVNIYPLSLDASKLRPMALIMV
FT                   LIFWLIYKPRYVGVVTAFAIGIISDLLLDTRLGQQGFAAVIMAFSLRFVGQYIKQVNLP
FT                   VAWTVATGALIVFQLTLWIVQYLTQNIFYASAIFSLLVSVISWPLVFFGLHRFINKYS"
FT   sig_peptide     518955..519023
FT                   /locus_tag="PsycPRwf_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.761 at
FT                   residue 23"
FT   gene            519525..520184
FT                   /locus_tag="PsycPRwf_0423"
FT   CDS_pept        519525..520184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0423"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93378"
FT                   /db_xref="GOA:A5WCI7"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCI7"
FT                   /protein_id="ABQ93378.1"
FT                   /translation="MDNPADIMITVVLASTSPRRQQLLAMADLDFVIHSAEVDETVQAG
FT                   ESPQDYIVRMVGAKAVAACHSLVSQMPVKTASTERQLFLVITSDTIGVLPDGRSILVKP
FT                   IDKEDAFRMWQQMSDTEHAVWTAVQLTLIDECGQVVLTDNLLEKTAVKFIALNKAAMED
FT                   YWRSGEPADKAGGYAIQGKGAAWVERINGSYSNVVGLPLAQTLAAIKRMQQQAADL"
FT   gene            520354..522195
FT                   /locus_tag="PsycPRwf_0424"
FT   CDS_pept        520354..522195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0424"
FT                   /product="RNAse G"
FT                   /EC_number="3.1.4.-"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93379"
FT                   /db_xref="GOA:A5WCI8"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCI8"
FT                   /protein_id="ABQ93379.1"
FT                   /translation="MSEELLINVSPMESRVAVLDNGVVSEVYIERHNKLGLVGNIYLGT
FT                   VVRVLPGMQAAFVEIGQSRTAFLHVNDMRRIARPAPTADKAPEIRHNAKQEPTVLTSMP
FT                   VDRCEHIAENVVTASDTMASVIAETEPAMEADPLSAKTEIEAGSLREKKSALADESDNL
FT                   KNDLLDNALLEIDSPDMVGNAITKADTKPAAVKERQIIEPPRHELIQYRLHEGQKILVQ
FT                   VTKDQLGTKGARLTTNISLPSRYLVYLPSSEHIGISQRIDNEEERHRLKTELGALMQTV
FT                   NLTGGLIARTAAERVPVAKLEEDIYYLVQLWRTIQARKEASAGSGQSAVLIYQELSLPL
FT                   RSIRDLVHPDTEKVIVDHEGMYNEVRQFAKEFVPFIYPRILPYSGEQPLFDVHRVEEDL
FT                   RDALKRRVDLKSGGYLIIDQTEAMTTIDVNTGSFVGGRSLEDTVYKTNLEATHAIARQL
FT                   RLRNLGGIIILDFIDMLEQQHKDDVLENLQYQLSQDYAKTKITQVSELGLVEMTRKRTR
FT                   ESLEQQLCEPCKTCEGKGFIKTAETVCFEIFREIMRCARTYNSPKKFTVVAHASVIDLL
FT                   LSSEADTVADLEYLLGRVITFEVENLYTQEQYDIVLD"
FT   gene            522771..523082
FT                   /locus_tag="PsycPRwf_0425"
FT   CDS_pept        522771..523082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0425"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93380"
FT                   /db_xref="GOA:A5WCI9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCI9"
FT                   /protein_id="ABQ93380.1"
FT                   /translation="MANQRIRIRLKSFDHRLIDQSAQEIVDTAKRTGAQVCGPVPLPTR
FT                   IERFNVLTSPHVNKDARDQYEIRTHKRMLDIVQPTDKTVDALMKLDLAAGVDVQIALG"
FT   gene            523177..523815
FT                   /locus_tag="PsycPRwf_0426"
FT   CDS_pept        523177..523815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0426"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93381"
FT                   /db_xref="GOA:A5WCJ0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCJ0"
FT                   /protein_id="ABQ93381.1"
FT                   /translation="MAIGLVGKKCGMTRVFTETGASIPVTVVEVDANRITQIKTNDTDG
FT                   YQAIQITTGERRDSRVTAAQKGHFAKAGVKAGRGVWEFRVTEEELEGREAGSEIAADLF
FT                   EAGQLVDVTGQSKGKGFQGGVKRHNFSMQDATHGNSVSHRVLGSTGQNQSPGKVFKGKK
FT                   MPGQMGNKRVTVQGLEVVSVDAEKGLLVIKGAIPGANGGDVIVRPSIKA"
FT   gene            523830..524432
FT                   /locus_tag="PsycPRwf_0427"
FT   CDS_pept        523830..524432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0427"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93382"
FT                   /db_xref="GOA:A5WCJ1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCJ1"
FT                   /protein_id="ABQ93382.1"
FT                   /translation="MNLKTVTGAAVELSDTAFGREFNEALVHQVVTAYLAGARQGTRAQ
FT                   KTRAEVSGGGKKPWRQKGTGRARAGSTRSPIWVGGGRAFAAKPQDWSQKVNRKMYRGAM
FT                   QCILAELVRQDRLILVDSITVSAPKTKELISKLAELNAPRALIVTNEVDENLYLAARNI
FT                   PHVNVLGTNEVDPVSLIAFDKVIMSVDAAKQFEEALA"
FT   gene            524429..524779
FT                   /locus_tag="PsycPRwf_0428"
FT   CDS_pept        524429..524779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0428"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93383"
FT                   /db_xref="GOA:A5WCJ2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCJ2"
FT                   /protein_id="ABQ93383.1"
FT                   /translation="MNNARLYQVLKGPVFSEKSQLLGDSLGVQVFKVDNNATKREIKKA
FT                   VELMFEGVEVTKVNTLNVKGKTKRFGRTVGRRNDYKKAYVTLKAGQDVQMADAGEEIAD
FT                   NAASTSETANNE"
FT   gene            524791..525621
FT                   /locus_tag="PsycPRwf_0429"
FT   CDS_pept        524791..525621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0429"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93384"
FT                   /db_xref="GOA:A5WCJ3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCJ3"
FT                   /protein_id="ABQ93384.1"
FT                   /translation="MPIVKAKPTSPGRRFVEKVVHPHLYKGRPHAPLVEAQGRSGGRNN
FT                   NGRITSRHIGGGHKQHYRIIDFKRTKDNIPATVERIEYDPNRTAHIALLKYADGERRYI
FT                   IAPKKLKVGDTVLSGEASPIRPGNCLPLKNIPVGTTISNIELKIGKGAQMARSAGASVQ
FT                   LLGKEGIYAILRLRSGETRRVHVNCRAVIGEVSNTENNLKSLGKAGASRWRGVRPTVRG
FT                   TAMNPVDHPHGGGEGRTMGKHPTTPWGQKTKGLKTRSNKRTDSMIIRRRRAKKK"
FT   gene            525633..525908
FT                   /locus_tag="PsycPRwf_0430"
FT   CDS_pept        525633..525908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0430"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93385"
FT                   /db_xref="GOA:A5WCJ4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCJ4"
FT                   /protein_id="ABQ93385.1"
FT                   /translation="MPRSLKKGPFIDAHLFAKVEKAVESNSRKPIKTWSRRSMILPQMV
FT                   GLTISVHNGRTHVPVIISEQMVGHKLGEFAPTRTYRGHGFDKKAKK"
FT   gene            525919..526248
FT                   /locus_tag="PsycPRwf_0431"
FT   CDS_pept        525919..526248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0431"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93386"
FT                   /db_xref="GOA:A5WCJ5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCJ5"
FT                   /protein_id="ABQ93386.1"
FT                   /translation="MEVTAKLRGAAISAQKVRLVADEVRGKSIERALDILAFSNKKGAV
FT                   FVKKCLESAIANAEHNHGLDIDTLKVSTIYVDEGITLKRILPRAKGRADRISKRTCHIT
FT                   VKVGE"
FT   gene            526252..526995
FT                   /locus_tag="PsycPRwf_0432"
FT   CDS_pept        526252..526995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0432"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="TIGRFAM: ribosomal protein S3; PFAM: ribosomal
FT                   protein S3-C-terminal domain protein; KH, type 2 domain
FT                   protein; Ribosomal protein S3, N-terminal domain; SMART: KH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93387"
FT                   /db_xref="GOA:A5WCJ6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCJ6"
FT                   /protein_id="ABQ93387.1"
FT                   /translation="MGQKVHPIGIRLGVVKKHNANWYADPKQYSEYLLNDLQVRDYLRK
FT                   KLDNAMISHIMIERPTGAAKITISTARPGIVIGKKGEDIEKLQKELTKMMGVPAQVNIE
FT                   EITSPDLDARLVAEGIASQLERRVMFRRAMKRAVQNSMRSGAQGIKVELSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYASVRAETTYGTIGVKVWVFRGEILDGMDSVYNPPKEDK
FT                   TRAPKRRGRSNSNRRNSDRANTDRG"
FT   gene            526999..527412
FT                   /locus_tag="PsycPRwf_0433"
FT   CDS_pept        526999..527412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0433"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93388"
FT                   /db_xref="GOA:A5WCJ7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCJ7"
FT                   /protein_id="ABQ93388.1"
FT                   /translation="MLQPKRTKFRKMHKGRNTGLAHRGSTVAFGQFGLKSVGRGRMTAR
FT                   QIEAARRTITRKVKRGGKIWIRVFPDKPITNKPLEVRMGKGKGPVEYWVCEIKPGKMLY
FT                   EIEGVSEELAREAFTLAAAKLPFKTTIVKRTIM"
FT   gene            527412..527606
FT                   /locus_tag="PsycPRwf_0434"
FT   CDS_pept        527412..527606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0434"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93389"
FT                   /db_xref="GOA:A5WCJ8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCJ8"
FT                   /protein_id="ABQ93389.1"
FT                   /translation="MKISELRDKSVEELTGLLDEKQLDAFRLRMAKATGQLGSTHEVRA
FT                   NRRAIAQIKTLINEKQRGA"
FT   gene            527606..527893
FT                   /locus_tag="PsycPRwf_0435"
FT   CDS_pept        527606..527893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0435"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93390"
FT                   /db_xref="GOA:A5WCJ9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCJ9"
FT                   /protein_id="ABQ93390.1"
FT                   /translation="MSDDIQQTEVSGTGVGIVTGKVVSNKMDKSITVLIERKVRHPLYG
FT                   KQIRRSTKIKAHDENNVCKEGDVVRIIETRPISKTKSWKLVDVVETAEKI"
FT   gene            528042..528410
FT                   /locus_tag="PsycPRwf_0436"
FT   CDS_pept        528042..528410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0436"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93391"
FT                   /db_xref="GOA:A5WCK0"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCK0"
FT                   /protein_id="ABQ93391.1"
FT                   /translation="MIQTETILEVADNSGARRVQCIKVLGGSHRRYASVGDIIKVSVKE
FT                   AIPRGRVKKGDVMNAVVVRTKKGVRRPDGSVLRFDDNAAVLLNQNKAPIATRIFGPVTR
FT                   ELRGDQFMKIVSLAPEVL"
FT   gene            528420..528737
FT                   /locus_tag="PsycPRwf_0437"
FT   CDS_pept        528420..528737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0437"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; SMART: KOW (Kyrpides, Ouzounis, Woese) domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93392"
FT                   /db_xref="GOA:A5WCK1"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCK1"
FT                   /protein_id="ABQ93392.1"
FT                   /translation="MAKLRKGDNVIVIAGKDKGKQGTVLAVKNDRIKVEGINIVTKHQK
FT                   PNAATGAEGGIVKQEAFLHISNVAIFNAQTQKADRITYQFDDEGNKKRVYRSNGEVVAT
FT                   A"
FT   gene            528759..529295
FT                   /locus_tag="PsycPRwf_0438"
FT   CDS_pept        528759..529295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0438"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93393"
FT                   /db_xref="GOA:A5WCK2"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCK2"
FT                   /protein_id="ABQ93393.1"
FT                   /translation="MARLKSLYNDQYKQQIKDELGLENVMQVPKITKITLNMGVGGASQ
FT                   DKKLLEGAVADMTAIAGQKPVITKARKSVAGFKIREEWPIGCKVTLRGEQMYEFLDRLI
FT                   AIAIPRIRDFRGFSPKAFDGRGNYSLGIKEQIVFPEVDYDKIDRLRGLDITITTSAQDD
FT                   EQGRALLKAFGFPFK"
FT   gene            529308..529613
FT                   /locus_tag="PsycPRwf_0439"
FT   CDS_pept        529308..529613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0439"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93394"
FT                   /db_xref="GOA:A5WCK3"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCK3"
FT                   /protein_id="ABQ93394.1"
FT                   /translation="MAKKSMINRELKREKMVAKYAEKRAKLKAIIGDVNASDEERMEAI
FT                   LELQSLPRNSSPVRLRNRCGVTGRPHGYFRKFGLSRNILRERVMQGDVPGVRKASW"
FT   gene            529626..530024
FT                   /locus_tag="PsycPRwf_0440"
FT   CDS_pept        529626..530024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0440"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93395"
FT                   /db_xref="GOA:A5WCK4"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCK4"
FT                   /protein_id="ABQ93395.1"
FT                   /translation="MSMQDTVADMLTRIRNAQMARKVSVAMPSSKLRKSIADLLVQEGY
FT                   IASAEVTDEGNGKATLSIELKYFEGKPVIEVIKRYSRPGLRQYRGKDAIPSVQQGLGVA
FT                   IVSTSKGIMSDRAARAAGIGGEIIAFVA"
FT   gene            530219..530752
FT                   /locus_tag="PsycPRwf_0441"
FT   CDS_pept        530219..530752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0441"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93396"
FT                   /db_xref="GOA:A5WCK5"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCK5"
FT                   /protein_id="ABQ93396.1"
FT                   /translation="MSRVAKAPVALPNGVSVTLNGQQVEVKGSKGTMSLHLHDLVELKQ
FT                   EDSQLILSPVSDSKEAWMHTGTMRSTLNNFVIGVSEGFERKLQLIGVGYRAQVAGNKIT
FT                   LNVGYSHPVEYILPEGVTAETPSQTEIILKSNDKQALGQAAAKIRGYRPPEPYKGKGIR
FT                   YSDEHVVRKEAKKK"
FT   gene            530764..531114
FT                   /locus_tag="PsycPRwf_0442"
FT   CDS_pept        530764..531114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0442"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93397"
FT                   /db_xref="GOA:A5WCK6"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCK6"
FT                   /protein_id="ABQ93397.1"
FT                   /translation="MFDKKAARLRRAKKTRAHIRHLGVHRLVVNRTPRHIYAQIISPTG
FT                   GEVLAQASTLDASLRSGATGNVDAAAAVGKLIAERGTSAGITKVAFDRSGFKYHGRVKA
FT                   LADAARENGLEF"
FT   gene            531117..531614
FT                   /locus_tag="PsycPRwf_0443"
FT   CDS_pept        531117..531614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0443"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93398"
FT                   /db_xref="GOA:A5WCK7"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCK7"
FT                   /protein_id="ABQ93398.1"
FT                   /translation="MAKVEQNDGLVEKLVSVDRVSKVVKGGRIFSFTALTVVGDGNGRV
FT                   GFGRGKAREVPAAIQKALEAAKRNMITVDLDGATLQHPIIARHGASKVYMQPANEGTGV
FT                   IAGGAVRAVLESAGVENVLTKCYGSTNPTNVVRATFNGLRDMSSPEKAAAKRGKSVDEI
FT                   LG"
FT   gene            531648..531827
FT                   /locus_tag="PsycPRwf_0444"
FT   CDS_pept        531648..531827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0444"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93399"
FT                   /db_xref="GOA:A5WCK8"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCK8"
FT                   /protein_id="ABQ93399.1"
FT                   /translation="MKTMKVTQIKSGAHRLKSHKACLMGLGLRRIGHTVEVEDTPSTRG
FT                   MVNRINYMVKVEEA"
FT   gene            531827..532285
FT                   /locus_tag="PsycPRwf_0445"
FT   CDS_pept        531827..532285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0445"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93400"
FT                   /db_xref="GOA:A5WCK9"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCK9"
FT                   /protein_id="ABQ93400.1"
FT                   /translation="MGLKLNELSPGVGAKKTAHRKGRGIGSGLGKTGGRGVKGQKSRSG
FT                   SGVRRGFEGGQMPLFRRVPKFGFTSQMALTTAEVRLSELNKIDGDVVSVETLKAANIIR
FT                   HDMKRARIILSGEITKAYTFKGVKVTKGAKAAIEAAGGTVEVTEGTEE"
FT   gene            532291..533622
FT                   /locus_tag="PsycPRwf_0446"
FT   CDS_pept        532291..533622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0446"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93401"
FT                   /db_xref="GOA:A5WCL0"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCL0"
FT                   /protein_id="ABQ93401.1"
FT                   /translation="MAKQSAPTSAIPMNPLVFIRKYDELWNRLLFLIGALVVYRLGSHI
FT                   PVPGINPVSLADLFSRNENTILSMFNMFSGGALERMSIMALGIMPYISASIIVQMMSAV
FT                   LPSLEALKKEGEAGRRKLNKYTRQGTLFLASIQAIFMCTGLISQNLTLSSGLTFYIPAV
FT                   SSLVAGAMFLMWLGEQITERGVGNGISMLIFASIVSSVPSMLGQSFEMVKNDPQSLIVL
FT                   LIFAVLGIAVTAGIVFIERAQRRIPVNYAQKQQLGRKIYADQQSHLPLKINMAGVIPAI
FT                   FASALLMFPASLGQWVGNSADPSTWQQILQTMSLVLAPGQPLYLVLFGAMIIFFCYFYT
FT                   ALVFSPREVAENLKRSGAYIPGIRPGLQTQRYLDHVLNRLTFIGAIYMTAICLMPMLLQ
FT                   SSFGIPFHLGGTSLLIMVVVVMDFISQLQAHLMTHQYHDQTLIR"
FT   gene            534035..534391
FT                   /locus_tag="PsycPRwf_0447"
FT   CDS_pept        534035..534391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0447"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93402"
FT                   /db_xref="GOA:A5WCL1"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCL1"
FT                   /protein_id="ABQ93402.1"
FT                   /translation="MARIAGVNIPDNKHAVISLTYIFGIGRTTAKKILDTVGIAPTTKI
FT                   SQLDDAQLDAIRAEVGNYMTEGDLRREVSMNIKRLVDLGCYRGIRHRRNLPVRGQNTKN
FT                   NARTRKGPIRSIKR"
FT   gene            534412..534804
FT                   /locus_tag="PsycPRwf_0448"
FT   CDS_pept        534412..534804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0448"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93403"
FT                   /db_xref="GOA:A5WCL2"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCL2"
FT                   /protein_id="ABQ93403.1"
FT                   /translation="MAKDTRGRKKTARRSVSEGVAHIHASFNNTIVTITDRQGNALAWA
FT                   TSGGQGFRGSRKSTPFAAQVAAEVAGKAAQETYGVKNVDVLVKGPGPGRESAVRALGAL
FT                   GYKINSISDVTPIPHNGCRPPKKRRV"
FT   gene            534917..535558
FT                   /locus_tag="PsycPRwf_0449"
FT   CDS_pept        534917..535558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0449"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93404"
FT                   /db_xref="GOA:A5WCL3"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCL3"
FT                   /protein_id="ABQ93404.1"
FT                   /translation="MARYIGPKLKLSRREGTDLQLKSGVKPYDVKTKKAGRVPGQHGNT
FT                   RNKASEYSLQLREKQKVKRMYGVLERQFANYYKESARARGATGEHLLQMLERRLDNVVY
FT                   RMGFGSTRAEARQLVSHRAVMIKKAGRDEFVRVNIPSIQVQDGDVIAIHEKAKEQLRIK
FT                   NAIELATQRGIPEWLEVDHSKMQGTFKQAPDRIDLPAEITESLIVELYSK"
FT   gene            535598..536605
FT                   /locus_tag="PsycPRwf_0450"
FT   CDS_pept        535598..536605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0450"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase, alpha subunit domain protein; RNA
FT                   polymerase, dimerisation; RNA polymerase, insert; SMART:
FT                   RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93405"
FT                   /db_xref="GOA:A5WCL4"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCL4"
FT                   /protein_id="ABQ93405.1"
FT                   /translation="MMLNATEFLTPNAINVDAVDETNAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSLPGAAVIEAEIEGVDHEYSTLEGLQEDVLDLLLNLKGLAITMHDQNEVFLTLDK
FT                   KGPGIITAADIELPHNVDIVNPELVLGTLGDRGHLKMRLRVVMGRGYEPANLRREDGDT
FT                   KAIGRLKLDASFSPVSRVAYQVENARVEQRTDLDRLIIELETNGTIDPEEAIRKAATIL
FT                   QQQISIFVDLEAEEAPEPVKEKEEVDPVLLRPVDDLELTVRSANCLKAENIYYIGDLVQ
FT                   RSETELLKTPNLGKKSLTEIKDVLASKGLELDMRLENWPPADLRVDDRFSYRSR"
FT   gene            536626..536985
FT                   /locus_tag="PsycPRwf_0451"
FT   CDS_pept        536626..536985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0451"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93406"
FT                   /db_xref="GOA:A5WCL5"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCL5"
FT                   /protein_id="ABQ93406.1"
FT                   /translation="MRHRKSGVKLGRTGSHRKAMFQNMTNSLFEHELIKTTLPKAKELR
FT                   RVAEPLITLAKEDSVANRRLAFSRMRNKNMVGKLFGTLAPRYQARPGGYIRIIKCGNRD
FT                   GDNAPMAYVELVDRD"
FT   gene            complement(537265..537885)
FT                   /locus_tag="PsycPRwf_0452"
FT   CDS_pept        complement(537265..537885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0452"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93407"
FT                   /db_xref="GOA:A5WCL6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCL6"
FT                   /protein_id="ABQ93407.1"
FT                   /translation="MQTLYIHPENPQPRLISQTVDALNRDQLIVYPTDTSYAFGCKIGS
FT                   KEAIEKLRLIRQLDDKHQFTLLCRDLSEIATYATVDNQQFKLLKASTPAPITFILDATK
FT                   DVPKKLSHPKKKTIGIRVPSNPIAQMLLEAMGEPILTSSLILLSTPLALDDPFDIEDKL
FT                   GNNIDVMINAGVLTTKLTTIVDMTVFPPQLVRQGAGDASQILE"
FT   gene            complement(538057..538728)
FT                   /locus_tag="PsycPRwf_0453"
FT   CDS_pept        complement(538057..538728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0453"
FT                   /product="protein of unknown function DUF462"
FT                   /note="PFAM: protein of unknown function DUF462"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93408"
FT                   /db_xref="InterPro:IPR007411"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCL7"
FT                   /protein_id="ABQ93408.1"
FT                   /translation="MSVINFCDLPITALANTLLQEMPSTMPKALSRFKSQWQHITQQTL
FT                   NLVNLTDEQIEAVKVDWLIAVFNTLFSTQNVTLVRGDFEPEYFPSVDGQPARIEFAHGF
FT                   FQSALHEISHWSLAGARRRTLSDFGYWYAPDGRTEAQQHAFEQVEIKPQAIECLLSLMC
FT                   QRRFRVSQDNLHANFDTSQSTFAIDVYNQALSYLNAPQTLPKDAKILLTALAYLCHDTI
FT                   A"
FT   gene            538809..539456
FT                   /locus_tag="PsycPRwf_0454"
FT   CDS_pept        538809..539456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0454"
FT                   /product="protein of unknown function DUF177"
FT                   /note="PFAM: protein of unknown function DUF177"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93409"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="InterPro:IPR039255"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCL8"
FT                   /protein_id="ABQ93409.1"
FT                   /translation="MSDIILKKERSMTKYTKDTKSTNLTDLNVSNNTEKSAQQLPNHVN
FT                   LEKWEDAGYVWSGSITPRLLKRLVDIVPEDYQDKPIDLRCELKKQGQLLTLEMQFTGDI
FT                   WVTCQRCLNPLNIDVTHDAQLILLQREEQESLVDESDDYLLLEELLADQPENKKGDRLL
FT                   PLKKLVEDELLLDVPLSAKHDDCEMAVEQVGEIIEEEAENPFAALEALKGKL"
FT   gene            539725..539907
FT                   /locus_tag="PsycPRwf_0455"
FT   CDS_pept        539725..539907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0455"
FT                   /product="LSU ribosomal protein L32P"
FT                   /note="TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93410"
FT                   /db_xref="GOA:A5WCL9"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCL9"
FT                   /protein_id="ABQ93410.1"
FT                   /translation="MAVQKSRKSRSRRDMRRSHHHMEVAELSIDATTGEKHRRHHMTKD
FT                   GFYRGRQLFKASQED"
FT   gene            540030..541028
FT                   /locus_tag="PsycPRwf_0456"
FT   CDS_pept        540030..541028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0456"
FT                   /product="[Acyl-carrier-protein] S-malonyltransferase"
FT                   /EC_number="2.3.1.39"
FT                   /note="TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93411"
FT                   /db_xref="GOA:A5WCM0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCM0"
FT                   /protein_id="ABQ93411.1"
FT                   /translation="MSLKASQAVKKQGQLDVPRRIAVVFPGQGSQTVGMLNELSEAYPI
FT                   VKETFAEASEALGFDLWAVCQDEAELGKTENTQPALLTASIAVWRILQQNTQIEPLFLA
FT                   GHSLGEYSALCAAGSISFADAVKLVHARGHFMQQAVVGVDTKMAAVLGLDNSQVISICE
FT                   QVESNNDDTIVSAANFNSPGQIVVAGNSEGVDILSQHIQCMGKRIVPLKVSVPSHCALM
FT                   QPATEALAEKLAECKFELPSIPVIQNKNAMEEKTIAGIKKALTEQLSHPVLWTQTMQKL
FT                   ADKHINLIIECGAGTVLSNLAKRQDTPIATYPTDKPERLAKLFDKLNNEDL"
FT   gene            541028..541756
FT                   /locus_tag="PsycPRwf_0457"
FT   CDS_pept        541028..541756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0457"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93412"
FT                   /db_xref="GOA:A5WCM1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCM1"
FT                   /protein_id="ABQ93412.1"
FT                   /translation="MSRTITLVTGASRGIGKAIAKRFAKEGHFVIGTATTAEGAQSIDE
FT                   YLHDAGGIGRSLDVTNQESIDKLFEEIESVYGSVQVLVNNAGITQDGLLIRMKDEDWDK
FT                   VVDTNLTSIYRMSKRAMRGMMKGRKGRIINITSVVGQMGNAGQANYAATKAGVEGFSRT
FT                   LAREIGSRQVTVNCVAPGLIETDMTDELDERLLNSMLDAVPVGRLGQPEDVAAAVSYLA
FT                   SDEASYVTGAVIPVNGGMYM"
FT   gene            541984..542226
FT                   /locus_tag="PsycPRwf_0458"
FT   CDS_pept        541984..542226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0458"
FT                   /product="acyl carrier protein"
FT                   /note="TIGRFAM: acyl carrier protein; PFAM:
FT                   phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93413"
FT                   /db_xref="GOA:A5WCM2"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCM2"
FT                   /protein_id="ABQ93413.1"
FT                   /translation="MSEEIELKVKSAVAEQLDVNIEDIKSDSSFINDLGADSLDLVELV
FT                   MNFENDFDITIPDDDSSELTTVQKAVDYIKSKLES"
FT   gene            542595..543101
FT                   /locus_tag="PsycPRwf_0459"
FT   CDS_pept        542595..543101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0459"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93414"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCM3"
FT                   /protein_id="ABQ93414.1"
FT                   /translation="MGIFSFAKDIGDKIFNRDDAKKETESHADANATPAASTEPSAQSV
FT                   ANLLLKRIQQQNLNITNLKVKYNATTDTAEISGNAETQADREKAIIAIGNVQNVAKVID
FT                   NIDIKQDAPESTMYTVKSGDSLSKIAQEVYGSANEYNKIFEANKPMLSSPDKIYPGQVL
FT                   RIPKP"
FT   gene            complement(543328..544524)
FT                   /locus_tag="PsycPRwf_0460"
FT   CDS_pept        complement(543328..544524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0460"
FT                   /product="domain of unknown function DUF1730"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; domain of unknown function DUF1730"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93415"
FT                   /db_xref="GOA:A5WCM4"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCM4"
FT                   /protein_id="ABQ93415.1"
FT                   /translation="MSSSSSTPASATAPMPTAKNASIPTNEFQDAIDVKRWIREQAIKL
FT                   GFADCGFISVDNPLFEAQMQGLRDWLAKGHHGQLTFMESNHDKRANPALLVEGSRTIIS
FT                   VRMDYLEAAPAPRRIEDNLRPNHAIIARYARGRDYHKTMRSRLKKLAQNIEAMLPQWQH
FT                   LDIGVDSPFVFRPFSDSAPIFERPLADAAGLGWTGKHTLLINKDSGSFFVLGELFLSLA
FT                   LPEDTAVSAHCGSCSACIDICPTQAIVAPYQLKASACISYLTIEHDGIIDETYRKAIGN
FT                   RVFGCDDCQLICPWNRYAQISPIDDFHARHNLDDSLLIELWQWSEQQFLKSTEGSPLRR
FT                   TGYVNFLRNLSIGIGNAPYHAKHIEKLNSRLGEHGEVLDEHIHWAIKEQLAKLHSSTS"
FT   sig_peptide     complement(544462..544524)
FT                   /locus_tag="PsycPRwf_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.644) with cleavage site probability 0.468 at
FT                   residue 21"
FT   gene            544618..546297
FT                   /locus_tag="PsycPRwf_0461"
FT   CDS_pept        544618..546297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0461"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93416"
FT                   /db_xref="GOA:A5WCM5"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCM5"
FT                   /protein_id="ABQ93416.1"
FT                   /translation="MSKQSHCDAAARSIQSIQANDALVPLYSPKQVYGIEKAWFDAGND
FT                   SYALMQQAAWQIAHWIYRTYSKAGDKLKVGVWVGRGNNGGDGWLVADYLKQLGAQVAVI
FT                   EVGPEVSTADALLAKQQATATLNNNKQVIEQTFTGHLANQTSFAKVCEKSEYLSANVYV
FT                   DALFGIGLDRAPQSAYADAIRYINAAKQHNHRLQVVSVDVPSGVVSSTGEVFDEQAVRA
FT                   DITLCLVARKVGLHLKDAMDYTGKLVDLPLIPTVLGKLPQAWLQHHAQPLPARDHNTHK
FT                   GSFGHVLIAGGNQVDGSQGMGGAAILSASTAFATGVGKLTVACHNAFHGSLIGAVPNAM
FT                   SLDLHDASSVESLIAQCDTLAIGMGFGRDESSFTLFERYLRTALQQSIALIIDADGLYH
FT                   LASLAKQAPEIIDQLIAHAKTHEVWYTPHSGEAGRLLDISADEIEKDRLAAITQLANKY
FT                   NGSWLLKGAGSLVLHKGEIRVCAAGNAGMATAGMGDVLSGLAAGLLAQSVLPKSSRTLI
FT                   QAVMIHAMAGDVLERKKGVWALQASDMPPVVGQIMQQLTQAQ"
FT   gene            complement(546373..546960)
FT                   /locus_tag="PsycPRwf_0462"
FT   CDS_pept        complement(546373..546960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93417"
FT                   /db_xref="GOA:A5WCM6"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCM6"
FT                   /protein_id="ABQ93417.1"
FT                   /translation="MNLFKAVPWIHMHDRLAKPLLNGTFIYGVSVAALGLGVALPAWAM
FT                   PVYKTTGEFGEVKYSQFAPNFAPDFAPDIGTQVEIIQMRGDGRPSKPGQFSAPVAPPQT
FT                   NTSTQPKSSFTAPLLSSSGSTTAKNNQAPHPSKTLDPTIQTQCKKLQVNLMHLTTGDEV
FT                   YTLNATGQRVYLTAPMIELKRENTEQLLAQYC"
FT   sig_peptide     complement(546826..546960)
FT                   /locus_tag="PsycPRwf_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.957) with cleavage site probability 0.956 at
FT                   residue 45"
FT   gene            complement(547066..547629)
FT                   /locus_tag="PsycPRwf_0463"
FT   CDS_pept        complement(547066..547629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0463"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93418"
FT                   /db_xref="GOA:A5WCM7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR029401"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCM7"
FT                   /protein_id="ABQ93418.1"
FT                   /translation="MAYCLQCGQLAEHKIPAGDHNPRLVCPHCHYIHYENPKVICGAIV
FT                   ISQDKVLLCRRAIEPRYGYWTLPAGFMEIGETMAEGAARETVEEADAVATHPHLYCLYD
FT                   IPDIGQIYVLYLTQLQDGKYGVGPESLECALFEEKDIPWDDIAFEAVKRTLHHYFNDRK
FT                   SVTEHSQFPIHQETISKDKSIKRY"
FT   gene            547859..548842
FT                   /locus_tag="PsycPRwf_0464"
FT   CDS_pept        547859..548842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0464"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93419"
FT                   /db_xref="GOA:A5WCM8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCM8"
FT                   /protein_id="ABQ93419.1"
FT                   /translation="MKSSIETLLVPQNLYQNEHSPRFEELAVVLPEQVIHPKLRQLVER
FT                   VQQHTLHATFKQDIADTKVHTQAQLAAHFQGNSQDNARATEQGKSAHNPSHSTTTDAAV
FT                   DGIQSVLKKEVATVKGGAHTKNTELSSGDISRAQRILDKLVTTDNADAAVLVVITNEAH
FT                   PKMLLTRRAAHLSSHAGEVSFAGGKHDTGDGNNVVTALREACEETALPPSKAQIVGQLP
FT                   IQVSKKGLVVRPIVALVEPPITYVPELGEIARIFWADFETLIEQPTTDHILPYTINGQT
FT                   LNIKTPSWRVDGEVVWGLTGRVLAGLLQIGFDREVTWYYEPVDGSD"
FT   gene            complement(548880..549944)
FT                   /locus_tag="PsycPRwf_0465"
FT   CDS_pept        complement(548880..549944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0465"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93420"
FT                   /db_xref="GOA:A5WCM9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCM9"
FT                   /protein_id="ABQ93420.1"
FT                   /translation="MPFASQSVLNQGTNQPLIHRHVAVSPSTNSELMQQLANGDIDKTR
FT                   PYLLTASMQTAGRGQRTRTWQSPIGNIYLSLYHPLQSSLSGLLSLVVGLHITRLPVLQN
FT                   LNRQRRSLGLPIVGVKWANDIGYYDTESLSAGETPTAADKSNTSFHKLAGILIEPVVTD
FT                   NKITGVIIGVGMNIEAAPVLSDSTKEGMDYQAISLTQIIKQTQNYKQTHTANKDNAHSA
FT                   HNSLPSDAHSHLPRAEDLYIPVSATLLRAVAQFEQFSQQSYALTQFIEDYSAVNVLAGR
FT                   PIIIEQPPLSAHTTQATKPQSAQDKHSDTVVIHGVVTGINTDGSLAINTTQQGYVEPRN
FT                   IYTGTIRLTGKDKG"
FT   gene            550210..551022
FT                   /locus_tag="PsycPRwf_0466"
FT   CDS_pept        550210..551022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0466"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93421"
FT                   /db_xref="GOA:A5WCN0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCN0"
FT                   /protein_id="ABQ93421.1"
FT                   /translation="MMILWFLLAGTFAGVCAGLFGVGGGMIIVPALVWMFTAYGYSPDI
FT                   IAHLAVGTSLATIMVTSISSLTAHHKRGGVRWEVWKNMAIGLVVGSLLGAAVADQMNGL
FT                   MLQALIGVAALLVAFKMLFLSNKENLGRPLPSAPVQIGAGSGIGMASAIFGIGGGSLTV
FT                   PFLTWAGLPMRQAVGTSAACGLPIALAGAAGFAWFGQDVVGLPSGAIGFVHVTGFICIS
FT                   IASFITAKLGAKWAHQLPAATLKKGFGALLVIAGSQLLWSGLKGMGVI"
FT   sig_peptide     550210..550275
FT                   /locus_tag="PsycPRwf_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.929) with cleavage site probability 0.459 at
FT                   residue 22"
FT   gene            551141..554983
FT                   /locus_tag="PsycPRwf_0467"
FT   CDS_pept        551141..554983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0467"
FT                   /product="condensin subunit Smc"
FT                   /note="PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93422"
FT                   /db_xref="GOA:A5WCN1"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCN1"
FT                   /protein_id="ABQ93422.1"
FT                   /translation="MRLKSLKLSGFKSFANPTTFSFRHGITAIVGPNGCGKSNVIDAIR
FT                   WVLGESSAKQLRGGAMSDVIFAGTQNKAAKSLASVELTFEHTQDEQTGIRHELNLYHEL
FT                   SVRRQINGEGKSDYFINGTRCRRRDVVDVFLGTGLGPRSYSVIQQGMIGRIVDSSPLQL
FT                   REFIEEAAGVSRYQARREETQKKLLRTRENLERLQDIEAELSRQKKKLAKQAESATHYQ
FT                   QLQQQLSEVKEQLGTQQLYQAKAAQMQHKAEQEQLTKSLEAQQAQDSMLKQKLAKVSAR
FT                   LAEEQWLKDEARDSLHQQDLQRQQVEHQLKELHSSLSQLEGKLRANADRQQKIQASMLA
FT                   TEQDNQAQNETLTQLAPELEALQVQQQQTQEKYAPLQSAWEASNTKVAKIEADKREVEQ
FT                   RLALAKQSESRLTLDLSKWHNKDKLWQQEAIKWGVRPSGDTLSATDAEVTSAPVSQPLN
FT                   EQIAGIDNQLKGLAKQQEVIEEQLETKQPIFNQLKQTQHQQQSQLAQLEKQHASLMAEY
FT                   DTLHAIVHPKKPAKLPSAQPTDGAQSVMAEDNSTANRSLGHTLEQLSALHEQIKLTAAG
FT                   EPYAQSLDKWLAFWLDAGILPATGFGNDNGHAGFIQCLLSDDSFDKFSNKPQSKADKSA
FT                   AMPPQSVLFEGSTASEHQQQDLPPDLQPYLKPLTELIAAPKLRLWQHTYLYVKEHKTDE
FT                   GATDLALDLDKIAVLLHSMPAPIIILTQSGWLITRVGAVHISKLDKSGQHPSFLSIRLQ
FT                   QQQRLAVLESHLNETETQIEQLTNTIKAQAHKQEQLSVVIEELLAQLSASAHKRHELQQ
FT                   QRITLVAKQERQDSEQQRLQAQRDELDAEQQEIQSAQLALSQKIESDNKHLQALMPELK
FT                   AAKQQQQQLELERQQISQQERDNNDSLRQLQLQYSQAQIAVKHSAAQLQQFIEDKQQLE
FT                   RSQQKLIQEQDKLQQKLPQLQAQQQAVSQQHHELKVALDERQAVIGSLQSDVEAHQARR
FT                   DDLESHIQQLQDKLSHSITQVAIADERIKEASERLKGLNTQISPLALLTDYITHGRSVS
FT                   AAKLEKLQATESQLTAKLNNMGPVNLAAAAELAAVDERLLPLEQQINDITASMDTLSEA
FT                   IASIDGKTKTLFLQTLDSVNESLTQLFTKVFGGGQASLTLIKDDELGVGEQWRAGLELM
FT                   AQPKGKKNSRLAVLSGGEKTLTALSLIFAIFKQHPAPFCVLDEVDAPLDDANVVRFTNL
FT                   IADLADEVQFIFISHNKLAMQIADELKGVTMPQAGISTLVSVSLEEAEQYLEPSA"
FT   gene            555167..556192
FT                   /locus_tag="PsycPRwf_0468"
FT   CDS_pept        555167..556192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0468"
FT                   /product="cell division protein ZipA"
FT                   /note="PFAM: ZipA, C-terminal FtsZ-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93423"
FT                   /db_xref="GOA:A5WCN2"
FT                   /db_xref="InterPro:IPR007449"
FT                   /db_xref="InterPro:IPR011919"
FT                   /db_xref="InterPro:IPR036765"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCN2"
FT                   /protein_id="ABQ93423.1"
FT                   /translation="MTTVDYILIIIAVVIMVVGLYMIIRGISARKNKAHAQSIMRDKNG
FT                   IPIIPRHERKLVEEPEALEAGETVIVPDREHLQPVIADNAPAAEPQPNHLDKPAETEFV
FT                   PTARTTQSADMMPHTPAASHQSANTTDSPLTNPHLAALDDDGEDDLFSSLASATEKLMP
FT                   VIETAQESEFLDNSPMLDQHLLAEADQDQNSPLNHAQENINITLVPKNSYDTIDGKTIL
FT                   SIVSQYGLKYGAMNMFHRYENKDGSGILWFSMMGVTQDGIAPFDLNLLPTSRFNGLVLF
FT                   LSLPHPKATQGFDTMMSVVNLISNDLNTLVLDENNDILTRERRQQLRAQVQEYQAAYQQ
FT                   G"
FT   gene            complement(556346..557224)
FT                   /locus_tag="PsycPRwf_0469"
FT   CDS_pept        complement(556346..557224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0469"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93424"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCN3"
FT                   /protein_id="ABQ93424.1"
FT                   /translation="MKHTLFSSLQQGIMGTLQHKAQQTKSLLQNQDLAELTKQQVGKDK
FT                   TILITGASSGIGAGMAKNFAKLGYNLALCARRTDRLEALKAEILTNSPSVRVEIKSLDV
FT                   SDYEAVFSVFEAFQAQFGQIDKVIVNAGVGEGRRVGTGRFHINRRTAEIDFISALAQCE
FT                   AAMQIFRAQNLGHLVAISSMSAMRGMPKHLTVYAASKAGLAHLAEGIRAEMIADKLPIK
FT                   VTTIYPGYIRTEINEGAPKLPFEVDEQTGSTALVAAIESGVEEACVPALPWMLVGKAMK
FT                   HLPLHLVNKLG"
FT   gene            complement(557291..558025)
FT                   /locus_tag="PsycPRwf_0470"
FT   CDS_pept        complement(557291..558025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0470"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93425"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCN4"
FT                   /protein_id="ABQ93425.1"
FT                   /translation="MTTLLFARHGQASFGQRNYDQLSELGAKQAACLGSQYAQAQRKID
FT                   AIVTGALSRQQDSATHFLSAYQAGYPDAAQLQPTLIEGFNEFNHTDVFVKYNPEFSTEV
FT                   GLLTAIASAPVPKVRLAELFNEAMLRWHSGDHDEEYLESWPQFNQRVQQALQHVVELTQ
FT                   HKQANTALIFTSGGVIAAITAHLLGQSSATAYSINRSLINTGVTSVVVKSTPSDTPPKL
FT                   RLLSLNEHSHLYQQGQDLLTWH"
FT   gene            complement(558086..559297)
FT                   /locus_tag="PsycPRwf_0471"
FT   CDS_pept        complement(558086..559297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0471"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93426"
FT                   /db_xref="GOA:A5WCN5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCN5"
FT                   /protein_id="ABQ93426.1"
FT                   /translation="MSTTDATPTSSNSQSTASTEAKPTAQNSVIDQAGKVRASETLDGN
FT                   AVSNWLRTQGIEVAGEPQITQFSGGASNWTYRLQYANMDLILRRPPAGTKAKSAHDMVR
FT                   EYKVQQALQDDYPYVPKMIALCTDDSVIGCDFYVMQRLIGIIPRANLPKAITLQPAQVR
FT                   TLCTNVIDALIELHQIDYKQNPQLTALGKGEGYCERQVIGWDKRYKKAKTPNVPSFFVV
FT                   RQWLKRNLPKDSRICVIHNDWRFDNVVLNPDTPTEVIGVLDWEMATLGDPLMDLGSALA
FT                   YWVQKDDNRIMRQSRRQPTHLEGMMTREEVVTYYLNKTGMADSNWAFYEVFGLFRLAGI
FT                   AQQIYYRYYNKQTDNPAFKDFWLIIHAIHARALKLIAKHEAIRIIDSGKLPAPIQSLAK
FT                   QWLK"
FT   gene            complement(559448..560695)
FT                   /locus_tag="PsycPRwf_0472"
FT   CDS_pept        complement(559448..560695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0472"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93427"
FT                   /db_xref="GOA:A5WCN6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCN6"
FT                   /protein_id="ABQ93427.1"
FT                   /translation="MMPDISARGQDFYNRVKEFIQTQIEPIEDEFWQRCHKLNPGGDWQ
FT                   SWQWPEQYHTLRKQAKAAGLWNMFLPDDILGAGLSVTEYAPIAELTGRSLIAPNIFNCN
FT                   APDSGNMELLWRYGNEAQKRRFLMPLLEGETRSVFCMTEPAVASSDATNMQATAIIDGD
FT                   DIFLNGRKWWSSGLGDPDVDFVIFMAHTPDDSKDRHHQHSMVLVPLDTAGVKIERMLQV
FT                   FGDYDAPHGHGEVVFDNVRVPVSNIIGGPGMGFEIAQGRLGPGRIHHCMRCIGAAEKSL
FT                   ELAIHRGMSRTSFGKPILQLGGNMERIAEARVSIDQARLLTLYAAQKMDEKGVKAALTE
FT                   ISAIKVVAPTVLQEVVDMAMQIHGGMGVSQDTMLPRFYAQARSLRLADGPDEVHKTMIA
FT                   KLELKKLGYGRPKAKP"
FT   gene            561020..563080
FT                   /locus_tag="PsycPRwf_0473"
FT   CDS_pept        561020..563080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0473"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="TIGRFAM: DNA ligase, NAD-dependent; PFAM: BRCT
FT                   domain protein; zinc-finger, NAD-dependent DNA ligase
FT                   C4-type; NAD-dependent DNA ligase, OB-fold; NAD-dependent
FT                   DNA ligase, adenylation; SMART: Helix-hairpin-helix
FT                   DNA-binding, class 1; NAD-dependent DNA ligase-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93428"
FT                   /db_xref="GOA:A5WCN7"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCN7"
FT                   /protein_id="ABQ93428.1"
FT                   /translation="MTQNTADTHASAQAQEVIAKMRTLIAQVRKHNNAYYVMDEPTISD
FT                   NEYDQLRLSLIELEERYPELTQPDSPTASVGDNPLPSFSQVQHDIAMLSLGNIFNYQDL
FT                   QEFMRRVNDRLSDADRNPEYEIEMKLDGLAVSLKYHNGQFVRGVTRGDGQMGEDITQNV
FT                   KTINNIPLVIEAAQDIDVLEVRGEVLMPKAGFKRLNRLAQENGDKTFANPRNAAAGSLR
FT                   QLDPAVAASRPLAFYAYSVNQGLPEAITLQSAALTWLKQLGFTVSDFERVKTAQQVQDY
FT                   YESMIQKRADLAFEIDGMVIKVDDLTLQSQLGALSREPRWATAYKFPAETVMTTLNSIE
FT                   WQVGRTGQLTPVGKLEPVQVGGVTVSNVTLHNFGEIQRLDVRAGDTVSVHRAGDVIPKV
FT                   TRVWHDLRPEGTSAVTLPTHCPVCDSPVVLPEGEALARCTGELFCPAQQQEALIHFVSR
FT                   KAMDIDGLGERWLISFFEHGIVKTVADIYHLNEHADELVTLEKLGEKSVSNMLRAIEES
FT                   KKTTLARFIYALGIRGVGETTAQNLAQYFGDLPELMGASIDALEAVPDVGHITAELIYN
FT                   FFRAEHNIEVINALQQAGVYWDKVEQQALDNLPLEGQTWVITGTLVASGMSRDDAKAHL
FT                   QALGAKVSGSVSAKTSALLAGEKAGSKLTKAQSLGVRVVLEDEFLKMIGAS"
FT   gene            563289..564554
FT                   /locus_tag="PsycPRwf_0474"
FT   CDS_pept        563289..564554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0474"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93429"
FT                   /db_xref="GOA:A5WCN8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCN8"
FT                   /protein_id="ABQ93429.1"
FT                   /translation="MQYDVIVIGSGMVGTSIAWHLQKNNSKVLVLDKKAPGEETSYGNA
FT                   GLIQREAVYPKAFPRQMSEILKVLPNTRTDIRYRWSALFNYQSALYQYWTNSTPNKLTK
FT                   IEDEWATLIEHCTSEHDVMIQASGADDLVRKGGWFEIYRTQEKFDYAIKLAERAASKGV
FT                   QYKLLTPEELKAYEPNVNFDEFIGGIHWQNSWQVKNPSRLVKTYAKSFEAMQGEIKQAN
FT                   VKTIEQNDEGIWQVTVENNSGEMATYTSNHVVIAAGPWSTELTRPLGYDFPLFPMRGYH
FT                   QHFKVDEANRIGHSLFDAEKGYLMGPMDQGIRITTGAEMTTLNAPKNFGQLEAVLKIAK
FT                   NVLPLEEAVESEAWCGSRPCMSDMKPVIGAAARHPNLWFAFGHAHQGFTLGPATGRLVQ
FT                   EMINDKPLYVDATPFSAQRFGN"
FT   gene            564725..565063
FT                   /locus_tag="PsycPRwf_0475"
FT   CDS_pept        564725..565063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0475"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93430"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCN9"
FT                   /protein_id="ABQ93430.1"
FT                   /translation="MQKLHSNQRMSKIVIHNETIYLCGQVGNAEDDISAQTLTCLEKIK
FT                   ALLEEVGSDKSKILSTTVWLKDMADFAAMNAVWDEWFSDVLPPARACGQAALARPELLV
FT                   EMIVTAAV"
FT   gene            complement(565220..565879)
FT                   /locus_tag="PsycPRwf_0476"
FT   CDS_pept        complement(565220..565879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93431"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCP0"
FT                   /protein_id="ABQ93431.1"
FT                   /translation="MTRSFNTLLPYSSSISRFKPALLSMLIGCSMVVAGCNQAPKTKAD
FT                   ASTDNTESKTELKTDTNTDNNEQTAQQPQNNPDAQPMMSTQDKPLEINWRALDSGEQAV
FT                   DPKSFKYPFALDSDAVQAQAKFSGISPEQAQHSLTVGMASNEPLEKLLDQLADSYVSHS
FT                   YSEKDAKLIVYTTPNVTPSEYDYVIKHEFARGLILPIEIMPSPEGKADAASNTAAH"
FT   sig_peptide     complement(565772..565879)
FT                   /locus_tag="PsycPRwf_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.625 at
FT                   residue 36"
FT   gene            complement(565988..567703)
FT                   /locus_tag="PsycPRwf_0477"
FT   CDS_pept        complement(565988..567703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0477"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93432"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR021908"
FT                   /db_xref="InterPro:IPR022156"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCP1"
FT                   /protein_id="ABQ93432.1"
FT                   /translation="MNISTTHIPRTANPNATSKVWPLLSVLSLSVITACAPQSKITPAS
FT                   DKASTTTLETAEQSIQADAAAPVVVMATPAMAESRQLSKMTTNARIMPPPSQGYMAPKQ
FT                   QENYAEIEPNAVNATSEQAFATLSIDTDTGSYANVRRFLNQGQLPPKDAVRVEELINYF
FT                   NYDFTAAKKQANAPFLVSTEVVNSPWHPTNQIVKVGIKAEDLLTAKQKQPPANLVFLVD
FT                   VSGSMDTEDKLQLAKSSLKMLTKQLRAQDSITLITYAGNTKVVLPSTPGNQTQKILNAI
FT                   DNLTASGSTNGEAAIKLAYQQATEHFKKDGINRILMLTDGDFNVGVSSVKDMLQIIRSN
FT                   RDKGISLSTLGFGQGNYNDHMMEQVADNGNGNYSYIDSLSEAKKVLIDEMSATFNTVAK
FT                   DVKIQLEFNPAAVSEWRLIGYENRVLAKEDFNNDNVDAGELGAGKSVVALFEVTPVGQK
FT                   GLLEPSRYQNSAAVSGNNRELGFLKIRYKAPQAEKSQLLSFPIANRVTAASADTNFALA
FT                   VAGYGQLLTGSKYVNDLSYSQLQRLAKSGAQSPIDSSGSRSEFIKLVSLAEALN"
FT   sig_peptide     complement(567584..567703)
FT                   /locus_tag="PsycPRwf_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.621) with cleavage site probability 0.524 at
FT                   residue 40"
FT   gene            568093..569010
FT                   /locus_tag="PsycPRwf_0478"
FT   CDS_pept        568093..569010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0478"
FT                   /product="protein of unknown function DUF808"
FT                   /note="PFAM: protein of unknown function DUF808"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93433"
FT                   /db_xref="GOA:A5WCP2"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCP2"
FT                   /protein_id="ABQ93433.1"
FT                   /translation="MAGGSLLMLLDDISVIMDDVSVMTKVAAKKTVGVLGDDLALNAEQ
FT                   VSGVKPSRELPVVWAVAKGSMINKFILVPAALLISYFVPWLITPLLMVGGLFLCYEGAE
FT                   KVIHKFWPKLLPHDEEQQARIHANADDTVDLVALEKQKVKGAIRTDFILSAEIVVIGLG
FT                   TLSAANLLDKAIVLSVLAIGVTIGIYGLVAGIVKIDDLGLHMMQRPGASKITQKIGEFL
FT                   LSAAPKLMKFLTIVGTIAMFLVGGGIIVHGIGYLHHAVEDIAHLSGVFEGLSTNLLNGA
FT                   IGFVIGVVLLFILTAISKMRGDAH"
FT   gene            complement(569147..573253)
FT                   /locus_tag="PsycPRwf_0479"
FT   CDS_pept        complement(569147..573253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0479"
FT                   /product="RNAse E"
FT                   /EC_number="3.1.4.-"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93434"
FT                   /db_xref="GOA:A5WCP3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR028878"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCP3"
FT                   /protein_id="ABQ93434.1"
FT                   /translation="MKRILINATHNEEVRVALCKGNHLYDFDLENRTREQKKANIYKGH
FT                   VTRVEPSLEAVFVEYGSKRQGFLPVREIASEYLSGNPREENIRKLIKEGDELIVQVEKE
FT                   ERGNKGAALSTYVSLAGRYLVLMPNNPKGGGISRQISGKLREDMKRMLGNLDLPKGMSV
FT                   IVRTAGIGKTQEDLQHDLNHLLNIWNAIQDQNKKYASPRLVHQEAGVVTRAVRDYLRDD
FT                   ITEIWIDNEEAFIEAETFIKAVMPTQIDKLRKYTDFEPMFSSFNVERQIETAYQREVRL
FT                   PSGGSIVIDQTEALVSIDINSAKSTKGADVAETAYHTNLEAADEIARQLRLRDMGGLIV
FT                   IDFIDMNDSKHQKEVEKRLVEATKYDRARVQFGEISRFGLMEMSRQRLRPSLEESTGYI
FT                   CPRCHGNGMIRDLRSLSLSIMRQIEQTALKERHGEVQAEVPTDIAAFLLNEKRESLVYL
FT                   EQDSGTRITILPHAHLESPNFNIHFNHHGFAPASYERVTDTQQQETSGLGYEVDWQTAE
FT                   SERPEQQPVRQPRKTAPQASADTSKPAEAAKAATPVANTAAKPQQPAEAQVEQAKPAAV
FT                   AWLSNLFAPTPQAQMSATVSSADAAQAIEAIVNTGAQSRGAFGQVSAAPAAAPVASATV
FT                   AAKPASAPTASEQANSADDTETDNDKDRRRSRNNRSRNKYDKRSKPDNRRRSQDKEDKK
FT                   SADTADKSDNRQVAEQEPNKELPKREPNSKRESRGAIERGDTKQPNKASSDNRSDRNQK
FT                   TDEKSRSADKNGSRSNSERPVDPNEVNLRVTEAQNTLKKSEVVHICLDDAKSSQKSAQA
FT                   QSKPEVQQASPNNRAVTRQQSTQAEPQADNSKAAKSEASRDHKPSDDASAAQPNTAAVT
FT                   EVAEPASNMKDGAAQGDQKQKADTKTESVVAPSVSKDAEPKADQPAKVQASTAQSEPAE
FT                   AVIDTEATPAKAAANNAAHAARSPEEATAQPVVASEDQAPETASLSFDAKELFANRYVA
FT                   AQKYGQASNDPRVIKASLEAQAQSFAAPEADEPELLAPMATITGSVGQFIHTHLAQPRM
FT                   RLAKDGVIACFLAALNAHKQTSGSTTKPAAKRKAAANNSKQHAKAFSFVNYGYQSLSPS
FT                   YLERFAQMTSAVATHTIEQGKTEVEPSPIGARASNDPRGQHPDYTAPDAASDAVTQPLD
FT                   NGLTAGDVSDTVEATPAQAEAAPQEVKDLAQLLTLNVGHFIREMLGQEGVDSIAAGHTE
FT                   AAFLKALRQPLPVAQSAQSANDTLLEDTDSSAEATVQQVADEAHVTETIEQPATALVNE
FT                   PQADAISDDSTEMLQAAHHAANTSNKTSIETYKSMIENISEQLLPQTGLLNLTSPKVPK
FT                   ARSRKVKEDAKKTTATPKGSTDSDS"
FT   gene            574538..575632
FT                   /locus_tag="PsycPRwf_0480"
FT   CDS_pept        574538..575632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0480"
FT                   /product="ribosomal large subunit pseudouridine synthase C"
FT                   /EC_number="5.4.99.-"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93435"
FT                   /db_xref="GOA:A5WCP4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCP4"
FT                   /protein_id="ABQ93435.1"
FT                   /translation="MSKSNRKPEKNVDKMNSQNSKIEQDLEGLMASVGAEPTQVRRHST
FT                   KARPQSADEDIKDFGQVNHLEVTRNQHGQRIDNFLLARLKGMPRAHIYKMIRSDEVRIN
FT                   NKRCKPYDNLERGDVVRIAPVKLATREKPVISEGFAKSLLERVVYEDEGLIVLNKPSGM
FT                   AVHGGSGLDFGVIEAMRDATSKKYLELVHRIDKDTSGLLMIAKKRSTLKVLQEYLREKT
FT                   IQKHYLCLVKGQPALNEFEIDAPLLRYTVANGERRVKVDKANPEAKLSQTTCKVLARFK
FT                   MNGEPVSLIEAMPHTGRTHQIRVHLAYLGHPILGDDKYNIKDTSGVRRLCLHAWQLDVP
FT                   EYEVIKAPLPEDMQSLLPADFKLD"
FT   gene            575660..576355
FT                   /locus_tag="PsycPRwf_0481"
FT   CDS_pept        575660..576355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0481"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93436"
FT                   /db_xref="GOA:A5WCP5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCP5"
FT                   /protein_id="ABQ93436.1"
FT                   /translation="MNEVVTNTEHDLSQKSLIIFDWDGTLMDSIGLIVKAMHVAAEAHG
FT                   FSTTDEAVKSIIGLSLMRGIELLYPQASAEQHLAIQQSYADYYIHASTLPNQPHSEFFE
FT                   GIEAMFKQLLAQGKKLAVATGKKRAGLDRVMDYANSRHYFVSSRCANESGSKPSPQMLL
FT                   DILQETGYAVADAVFIGDSIHDIQMANALGMTSIAVNYGAASAQVLAAEHPTYQVSTPS
FT                   QLIELLTAG"
FT   gene            576465..577412
FT                   /locus_tag="PsycPRwf_0482"
FT   CDS_pept        576465..577412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0482"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93437"
FT                   /db_xref="GOA:A5WCP6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCP6"
FT                   /protein_id="ABQ93437.1"
FT                   /translation="MTTNFKNKLQAYIHLTRFDKPVGIELLLWPTLWAVLLAAFGQAIA
FT                   QAPSSVTASPSVLPAWSVLLIFALGAILMRAAGCAINDFADRKVDGSVTRTKGRPLADG
FT                   RLTGREAVGAFLVLSLISASLLFWLPIAVFYWSIGALILAFIYPFMKRFTHLPQVFLAA
FT                   AFGWAIPMAYVAIQGQPDVWCWLLFIAYMCWTVAYDTQYAMADRDDDLKIGVKSTAILF
FT                   GRYDVVIISLLQVAFLAIMGVVFYHYFAPTSLGLIPVYALGLVAILFAQQNRACATREP
FT                   MACFQAFLANVWVGRYVFLVVLLSSLYIQFNGLT"
FT   sig_peptide     576465..576602
FT                   /locus_tag="PsycPRwf_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.914) with cleavage site probability 0.861 at
FT                   residue 46"
FT   gene            577437..578075
FT                   /locus_tag="PsycPRwf_0483"
FT   CDS_pept        577437..578075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93438"
FT                   /db_xref="GOA:A5WCP7"
FT                   /db_xref="InterPro:IPR025187"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCP7"
FT                   /protein_id="ABQ93438.1"
FT                   /translation="MAKPFKSDLSLDAKLAAHQRFEQNLLKQGLTKQQVVEMERKLAKF
FT                   ANTMDSVVRIPFTNQGVGADAALSTVPIAGDVAGLLLTGYAFMLGIKLGVPAKKLTPAV
FT                   RLALIDLVVGVVPVAGTVMDVFLRPSRKTLQIVREHMQQEYGITDTTHVDRPFMHQALQ
FT                   KKQQQAKFWCNPLVAWLYLHVPDILGLIVLILLGLALWAMLSWIMGWVL"
FT   gene            complement(578070..578744)
FT                   /locus_tag="PsycPRwf_0484"
FT   CDS_pept        complement(578070..578744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93439"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCP8"
FT                   /protein_id="ABQ93439.1"
FT                   /translation="MLSSSVLAPTKKLIMATCLCSALIGLYGCQKTDETTKDTDSNAAQ
FT                   SSTASQPADTVPSTEVQTMDTQSQTVEDVNDGADTEIIDAQAMQQEQSQQASAINTDPA
FT                   NADSSAGATASTTKNAAPTSETQVTDVEYKDGQGRSVYVTFQTSATATLQANLMMPSGK
FT                   RVLLTAPTGQGNNPTYRSIDGSIELVTHGGGNNIDLIYQGKPINFTAVDSDTEVIKPQK
FT                   SS"
FT   sig_peptide     complement(578658..578744)
FT                   /locus_tag="PsycPRwf_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.672) with cleavage site probability 0.374 at
FT                   residue 29"
FT   gene            complement(579260..579685)
FT                   /locus_tag="PsycPRwf_0485"
FT   CDS_pept        complement(579260..579685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0485"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93440"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCP9"
FT                   /protein_id="ABQ93440.1"
FT                   /translation="MAFYQTTLKLPAHSRGVHLITDYIHQALETLLPPNADTGLVHLFL
FT                   QHTSASLAINENADPDVRLDTEDWLNQIAPANQPQYRHTLEGEDDLPAHFKSMLLGVSL
FT                   TVPLTNGRLGLGMWQGIYLCEHRNYVGSRTVVLTATV"
FT   gene            complement(579917..580492)
FT                   /locus_tag="PsycPRwf_0486"
FT   CDS_pept        complement(579917..580492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0486"
FT                   /product="translation elongation factor P (EF-P)"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P/YeiP protein; Elongation factor, KOW
FT                   domain protein; Elongation factor P-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93441"
FT                   /db_xref="GOA:A5WCQ0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCQ0"
FT                   /protein_id="ABQ93441.1"
FT                   /translation="MASFSTNEFKAGLKVMYDGNPCAIIDNEFVKPGKGQAFNRVKLRN
FT                   LRTGKVLEQTFKSGESLEGADVVDTEMNYLYNDGEFWHFMHPETFEQLQADANAMADAK
FT                   QWLKENGNDLCTITLFNGVPLSVTAPNFVELEIVETDPGVRGDTSGGGGKPARLETGAV
FT                   VRVPLFVQQNEVVRVDTRTGDYQTRVSQ"
FT   gene            580550..581668
FT                   /locus_tag="PsycPRwf_0487"
FT   CDS_pept        580550..581668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0487"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /EC_number="5.4.3.2"
FT                   /note="TIGRFAM: lysine 2,3-aminomutase YodO family protein;
FT                   PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93442"
FT                   /db_xref="GOA:A5WCQ1"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCQ1"
FT                   /protein_id="ABQ93442.1"
FT                   /translation="MINHLPQQKNKQIPITSVAVGTCAPKAGESLQVIEDSNEAIDWQT
FT                   QVADVITDIDQLLAILELSHIKDELYVPQGFGLRVPKAFVAKMKKGDANDPLLLQVLPN
FT                   KQEQTQVTGYVSDPLAENAHNPIKGLLHKYRSRVLVTVTGACAIHCRYCFRQHFDYQAN
FT                   LPKSDQLRLIQDYIRQHPEINEVILSGGDPLSVTNRRLFLWLQALEDLPQINTIRLHTR
FT                   LSIVIPDRLDNELLDRLEHSRCRIVMVVHTNHANEIDNHTAKLLQHARQKGITLLNQTV
FT                   LLAGVNDGLKQQVALSERLFEAGVLPYYLHLLDKVAGAAHFDIAQKQAIDLYWQMLAHL
FT                   PGYLVPKLVQELPHKPFKTPVDLYHSDSAHLF"
FT   gene            581680..582189
FT                   /locus_tag="PsycPRwf_0488"
FT   CDS_pept        581680..582189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0488"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93443"
FT                   /db_xref="GOA:A5WCQ2"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCQ2"
FT                   /protein_id="ABQ93443.1"
FT                   /translation="MSLCVHSSAGAKRLASAFGIKKSVALLAMAGFVALGSGCTPTPPD
FT                   YRPQVTAPAYQGGDAQKGEKLYEDNCTQCHTIRPGSNKKGPQLLGVYMAPSAQLKDYKY
FT                   SEAMSHANWVWDAKTLDKYIADPEAVLPDTRMLSDPMPNTQDRQDIIAYLSTLGHDAPP
FT                   VPEEKK"
FT   gene            complement(582291..582875)
FT                   /locus_tag="PsycPRwf_0489"
FT   CDS_pept        complement(582291..582875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0489"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93444"
FT                   /db_xref="GOA:A5WCQ3"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCQ3"
FT                   /protein_id="ABQ93444.1"
FT                   /translation="MPTPSPNRPPSNGMARSIKSLIKLAIISALGYMAYIYTGDYQQQL
FT                   RHYISDRIKYTELIQQSAPQMGGLPNPIEGASLVDTWGAARSEGRTHEGIDIFAKRSTP
FT                   IHSTTIGVVRKVGLDRLGGNVVSIIGPGGVMHYYAHMQQFADIEVGGWVEAGEVIGYVG
FT                   DSGNAKGTPPHLHYGIYTRSGAVNPYPLLAK"
FT   gene            complement(583024..585873)
FT                   /locus_tag="PsycPRwf_0490"
FT   CDS_pept        complement(583024..585873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0490"
FT                   /product="Protein of unknown function DUF1974"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Protein
FT                   of unknown function DUF1974"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93445"
FT                   /db_xref="GOA:A5WCQ4"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCQ4"
FT                   /protein_id="ABQ93445.1"
FT                   /translation="MTPLTLVGFFILAILLQLFALLLVFLYGLSRTVGAIFLIVIAVVS
FT                   AFIAPWSLLLGVPMIIGSLLVLIAPLRQAVISKPAYKMLAGAMPSMSDTEREALDAGTS
FT                   WWEKELFMGAPDWNKFANYQYPTLSEKEQSFIDNEVEILCSMLDEWQIHHHDKDLSPQA
FT                   WQYIKDNGFLGLIIPESYGGREFTPYAQSRIMSKIASRSLTAAVTCMVPNSLGPGELLM
FT                   HYGTEAQKQRWLPGLAKGTEIPCFGLTGPEAGSDAGAIPDTGVVCYGMYEGREVLGLNM
FT                   NFSKRWITLAPVATVVGLAFKLHDPDGLLGDKNKTDYGITCALIPANYEGVHTGERHNP
FT                   GSPFMNGTVVGKDVFIPLDFIIGGIENAGRGWRMLMECLAVGRGISLPALSTSAGEMSY
FT                   LTVGAFAKVREQFKISVGKFEGVQDASSNIASNTYMLESFRHLVTCGLNEGGTPSVMTA
FT                   MAKYYATETMRKIVNDGMDIVGGRAIQLGPRNFLALPYQAIPVSITVEGANILTRSLMI
FT                   FGQGAMRCHPYLFEELQLLQSEDKRSAQHKFDDMFFKHLGYTFNRGARSFVAGYFGGSS
FT                   KAPKFADSFSRPYYKKINRLSANFALTADMALGLLAGDLKRKEMLSGRLADIHAHLFIM
FT                   TAILRYYAQGTQSKAEQLHARLALDNALYTIQEAFFELYANFPNRMAAGLVKFVCFPGG
FT                   AFASKPSDALKREVGELMMLDGEQNPFREQLKSLVYYTTDPDNNTGRIENAFQMLRHIE
FT                   PLWHSFKKAENKGEFAGLTFEDHVLTALKDGVITEHESEQLIEYNAVRFDALLTDVFDE
FT                   HLNHALPRYNPHTLENAAQNLTPYVLEAIENPAQAASEQSDYIEDSGDQNSAHGYQQDG
FT                   EVKPVSEQTQLEEQVDQADFNEADFNEANDPRLRDAELTLEQRMAKNHARHQASLEQAN
FT                   KQTEGAQSDSSDNPHRPNK"
FT   sig_peptide     complement(585811..585873)
FT                   /locus_tag="PsycPRwf_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.757) with cleavage site probability 0.523 at
FT                   residue 21"
FT   gene            complement(586233..586913)
FT                   /locus_tag="PsycPRwf_0491"
FT   CDS_pept        complement(586233..586913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0491"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93446"
FT                   /db_xref="GOA:A5WCQ5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCQ5"
FT                   /protein_id="ABQ93446.1"
FT                   /translation="MAIKDWHEEDRPREKLLNLGAEYLTDAEILAIFLRTGSKQQSAIE
FT                   LARSLIDHFGGIAELLAAPKEAVLACHGIGTAKYAQLLASLEMGKRYLNSELKSGNSLN
FT                   RSQVVKDYITTQIRRESKEVFAVLCLDNGLNLLDYKVLFVGGLSSCSVCVKQVLRHALE
FT                   QGASQIIIAHNHPNQDATPSAADIHLTQTLKLACEAIDLRLTDHIIVGRNQTLSFAETA
FT                   TAPF"
FT   gene            587286..588536
FT                   /locus_tag="PsycPRwf_0492"
FT   CDS_pept        587286..588536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0492"
FT                   /product="Phosphopantothenate-cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93447"
FT                   /db_xref="GOA:A5WCQ6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCQ6"
FT                   /protein_id="ABQ93447.1"
FT                   /translation="MSPIFTPVTSVAPNITKVILAITGGIAAYKSAILARLLIKSGFEV
FT                   RVIMTAGAQQFITPLTLQALTGNEVHTELLDTKAEAGMGHIELAKWADLIVIAPASANT
FT                   LARLAMGMADDLLTTVCLATAAPVMVAPAMNQQMWAHPAVQLNVQTLSDMGYEIIEPDS
FT                   GVQACGDVGSGRLPEPDILLRQVINFKARLTVAQCLTGKKVTITAGPTVEAIDPVRFLS
FT                   NHSTGKMGFALARACRDAGAEVTLIAGGKVSLMTPLKVKRIDVLSANDMLQAATRSVEA
FT                   GCDIFIATAAVADYRTRDAAPQKIKKTQDEMTLDLVKNPDILATISHSYPDMFVVGFAA
FT                   ETQDVEKYARGKLESKNLDMIACNDVSRKDIGFASDENAMLVFFANQYQKPPVELEKMS
FT                   KANIAEHLVNLIGSVLN"
FT   gene            588651..589460
FT                   /locus_tag="PsycPRwf_0493"
FT   CDS_pept        588651..589460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0493"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93448"
FT                   /db_xref="GOA:A5WCQ7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCQ7"
FT                   /protein_id="ABQ93448.1"
FT                   /translation="MTDVSENIKKMNSTLDAMLSHRSVRSFTDEPISEQMLEAILQAGR
FT                   AVSTSNYMQSVSVIRITDPEQRIKFHQISNGMTQEQYNQAKSEGKKLAHPYILECPEYL
FT                   VFCMDNYRHHLVEPEAQLDWMEVVIISAVDVGLYAQNVMAAAESLGLGGVYIGSMRNDI
FT                   ERAGEVINAPKHVVPLFGMCLGHPSDAPVNATQKPRFPLSMLVSENQYTPATQQQIDAF
FT                   NKEVKDYYDKRGSQEHKAWEAQVTKTFATAVRPQVMPYLNKQGYAKR"
FT   gene            589519..590283
FT                   /locus_tag="PsycPRwf_0494"
FT   CDS_pept        589519..590283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0494"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93449"
FT                   /db_xref="GOA:A5WCQ8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCQ8"
FT                   /protein_id="ABQ93449.1"
FT                   /translation="MFDFEQLLLPFIFAVGSLLHGITGIGVTLVTTGSLASMYPLQHAI
FT                   ILTILPSFALNLMTWLIGGERSIWGNFTFYLSRYWLLALMSLLGSLLGVKLLMWVDSSY
FT                   ILLLLAAVIAFYVASNALGKKIILPATTPVLIVTGLIAGIIGGSTNAMSTILLMYLLGS
FT                   TNDKNTIAKVGNMCYLLGKVAQIIVLRESIVALPKSDLLLIAVLTTTSIAFLLVGIRLR
FT                   RYLSQQRFRQLVLLILTVLGIRVGWQGIIGLI"
FT   gene            590399..591094
FT                   /locus_tag="PsycPRwf_0495"
FT   CDS_pept        590399..591094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0495"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /EC_number="3.2.2.21"
FT                   /note="PFAM: HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93450"
FT                   /db_xref="GOA:A5WCQ9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCQ9"
FT                   /protein_id="ABQ93450.1"
FT                   /translation="MKHSSVNRQPSVFKLPSEPACNLIQTMNDLSELEGHIKQLIDIEP
FT                   RFAPIYQQLGVPSLRRNRGGFRELMRAMVGQQLSVAAASSIWSKLENAALITPDAIMKA
FT                   DDDTLRSHGLSRQKIRYIRSLVEHDIDFEALAHLPDEAVISELTAVTGIGKWTAQMYLL
FT                   FSLGRADILAVDDLAIKVGAMEVLGLDERPTPKQLERLTQSWSPHRSAASLLLWAHYGW
FT                   LKDQEAVPV"
FT   gene            complement(591124..592053)
FT                   /locus_tag="PsycPRwf_0496"
FT   CDS_pept        complement(591124..592053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0496"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93451"
FT                   /db_xref="GOA:A5WCR0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCR0"
FT                   /protein_id="ABQ93451.1"
FT                   /translation="MSAQDDSQSLTQTATSAPATTPVRHTHNNVASAYLYIVATPIGNM
FT                   GDITARAIDTLKQVDIIACEDTRTSGKLLANFGIDTQTWAYHEHNSEIQTPKIIEMIQR
FT                   GHSVALISDAGTPLISDPGYQLVQAAHAAGVGVVPIVGASAAIAALSVAGLPSDKFSFV
FT                   GFLPAKTHGRVKQLEQYIERTETLIFYEAPHRIVVSLKDMASVFGDNRPATLCRELTKT
FT                   FETVKKSTLGELAQFVEADNNQQKGEIVLVVGGNVNNDSDDDSIHDELLLRLLQDLSVK
FT                   KAAALASELTGVKKNTLYQRLLDLQKSE"
FT   gene            592160..592588
FT                   /locus_tag="PsycPRwf_0497"
FT   CDS_pept        592160..592588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0497"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93452"
FT                   /db_xref="GOA:A5WCR1"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCR1"
FT                   /protein_id="ABQ93452.1"
FT                   /translation="MPANPELLISPKQRQGGGYEQLAADFLQQQGLRLIARNWQQPKVG
FT                   EIDLVLIEHGRSWNVLVFAEVRKRKLLGYGDALASITRSKQKKLIKTARYFLRHHPEYA
FT                   DFECRFDVVGFTERTGRSGQGEPLQSEWLQGAFLAPAW"
FT   gene            592781..593653
FT                   /locus_tag="PsycPRwf_0498"
FT   CDS_pept        592781..593653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0498"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93453"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCR2"
FT                   /protein_id="ABQ93453.1"
FT                   /translation="MVSSWLFGSKIIQRTTVAVALSAGLLSGCASIQSFNSSDDSFGVA
FT                   VTDRTLAQRILDKSIENTAKINISRIDPTLYQRSRISVDSFYSTVLVTGEVPDEQTKQQ
FT                   VETIVSSMPDVKQFYNKLTVGNQKGTSYTVHDAYISSKVNAKILANNALSSSQVKVVTD
FT                   DGIVYILGKLTPAQRSHLINIINSTVGIKELVLLNQLIDDNGAVIDESSITQETGLEPP
FT                   TPVYTEQPPAQAAPVDTQNYAPPAQVAPEYQAPETAPAAPTAEASTTQNSQVYPSPYIE
FT                   MYKQDVNGW"
FT   sig_peptide     592781..592891
FT                   /locus_tag="PsycPRwf_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.544 at
FT                   residue 37"
FT   gene            593785..594645
FT                   /locus_tag="PsycPRwf_0499"
FT   CDS_pept        593785..594645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0499"
FT                   /product="Esterase/lipase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93454"
FT                   /db_xref="GOA:A5WCR3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCR3"
FT                   /protein_id="ABQ93454.1"
FT                   /translation="MSIQTANAASVLGLLNAVTPNGGVSVIKDLAYGSEPEQDLDVYYP
FT                   KALTQAIRNNDTPAANYPLVVFMHGGSWESGNKEQYRFVGESLAQAGYVTAVINYRKAP
FT                   EHIYPDFVQDTAKAIAWSHQNAAKFFADANKMAVIGHSAGAFNVVAAVSNADFLAAYGL
FT                   QPSDIKAVVGMAGPYSYDFRKFSSRSVFPAEATPDEVMPDRLIKAGSSGKQPPYLLMTA
FT                   QNDKVVHISNTQNMTQALQKAGAKVTVEQIDGASHATSIGAMATTLTWVNPVRRQLLDY
FT                   LHDTL"
FT   gene            594992..595246
FT                   /locus_tag="PsycPRwf_0500"
FT   CDS_pept        594992..595246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0500"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93455"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCR4"
FT                   /protein_id="ABQ93455.1"
FT                   /translation="MSMNADDLIAFLQPHFPEAFIQAANQGNKFDVRVVDASFEGKRLV
FT                   QRQQAIYGLVNDIIASGEIHALNIQALTPQEWEAKQAGQ"
FT   gene            595457..596755
FT                   /locus_tag="PsycPRwf_0501"
FT   CDS_pept        595457..596755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0501"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93456"
FT                   /db_xref="GOA:A5WCR5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCR5"
FT                   /protein_id="ABQ93456.1"
FT                   /translation="MDQFLITGRSRIAGEVTISGAKNAALPLLAAMILAETPTTLNNVP
FT                   SLQDVRTLIKLIAGLGIRIEKQGDTVTCDTSTIENYFAPYELVKTMRASILVLGPLLAR
FT                   FGEAEVSLPGGCAIGSRPVDQHLKAFKAMGAEITVENGYVKARAPEGGRLIGCEFSFDM
FT                   VTVGGTENVLIAATLAKGTTVLENCAREPEVVDLANMLVAMGAKVSGIGTATLTIEGVD
FT                   SLQGCEYSVVPDRIETGSYLAGALMTEGDVTTKNTDPALLQPVLQKFEEMGAIITTGDD
FT                   WIRAQMTGRPKPVDIRTQPHPGFPTDMQAQLMAVCCLAEGTSTISENIFENRYMHVPEL
FT                   KRMGADIQVDGHTAIIRGVDSFNAAPVMATDLRASMSLVMAAAAAEGETLIDRIYHIDR
FT                   GYENVEEKLRGLGVNIERVNPVTDAAEADSLDD"
FT   gene            596809..597480
FT                   /locus_tag="PsycPRwf_0502"
FT   CDS_pept        596809..597480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0502"
FT                   /product="ATP phosphoribosyltransferase (homohexameric)"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93457"
FT                   /db_xref="GOA:A5WCR6"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCR6"
FT                   /protein_id="ABQ93457.1"
FT                   /translation="MTETNEILNQADSDYDGLTLALSKGRILKETLPLLKAAGIELLED
FT                   PDKSRKLIFPTSHDKVRVLILRASDVPTYVEHGAADFGVAGKDVLLEYGAKHVYELLDL
FT                   KIAQCKLMTAGIKGVALPNRRLRIATKYVNVARAYFASQGQQVDIIKLYGSMELAPLVG
FT                   LGDLIVDVVDTGNTLRANGLEPLDHICDVSSRLIVNQVSYKRKYSLLEPILDSFKQSIG
FT                   D"
FT   gene            597669..598961
FT                   /locus_tag="PsycPRwf_0503"
FT   CDS_pept        597669..598961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0503"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="PFAM: histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93458"
FT                   /db_xref="GOA:A5WCR7"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCR7"
FT                   /protein_id="ABQ93458.1"
FT                   /translation="MRTLTSTDPNFEQQLTDLLAFETVNDKELLATVDDIIHQVRHGGD
FT                   AAVLALTQKFDAHPATSMQQLVLTPDALKQAFDQLDEPIKAALKTAAERIKDFHQRQVQ
FT                   PSWDYTDALGNRLGQKVTPLDRVGIYVPGGLASYPSSVLMNAVPAKVAGVAEVIMVVPA
FT                   PKGELNPLVLAAAYLSGVDKVFTIGGAQAVAALAYGTDSIAQVDKITGPGNKYVAAAKR
FT                   AVFGQVGIDMIAGPSEVLVYAEGEAADNADWLAMDLLSQAEHDTVAQAIFVTTSEQQLN
FT                   EVATAIDNALEQLPKADIAREALQNRGALILVKDRAEGLALINRIAPEHLELSLDKPDD
FT                   VLADIRHAGAIFMGRHTPEAIGDYCAGPNHVLPTSGTARFSSPLGVYDFQKKSSIIYCS
FT                   AEGSKPLAQIADTLAMQEDLEAHARSARYRS"
FT   gene            599288..600391
FT                   /locus_tag="PsycPRwf_0504"
FT   CDS_pept        599288..600391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0504"
FT                   /product="histidinol phosphate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.9"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93459"
FT                   /db_xref="GOA:A5WCR8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCR8"
FT                   /protein_id="ABQ93459.1"
FT                   /translation="MIKTMEFKLDTRLWSTKARNLNPYVPGEQPKHDNLCKLNTNENPF
FT                   PPSPKVVEAITAALSHGGDQLRLYPAPESDALRQALADAYDLQLNQVFVGNGSDEVLAL
FT                   VFASFFMKERPLLAPDISYSFYPVYADTFGIDLVKIPLRDDFSIETDDYRQPCSGIIIA
FT                   NPNAPTGILMSLEAIDKLATEHPNAVIVIDEAYIDFASTEQASAIRLIETHDNLLVTQT
FT                   FSKSRSLAGLRVGMAFGNPSLIEALTRMKNSFNSYPLDRLAQAGALASVEDKLYFKSTC
FT                   EQVIALREQLIEQLSSLNFTVLPSQANFVFARPQQGNASEVAQQLREQGIIVRYFNQPR
FT                   INEYLRITVGTAEQNRRLIGALQQMAG"
FT   gene            complement(600538..602241)
FT                   /locus_tag="PsycPRwf_0505"
FT   CDS_pept        complement(600538..602241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0505"
FT                   /product="Anthranilate synthase component I and chorismate
FT                   binding protein"
FT                   /note="PFAM: Anthranilate synthase component I and
FT                   chorismate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93460"
FT                   /db_xref="GOA:A5WCR9"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCR9"
FT                   /protein_id="ABQ93460.1"
FT                   /translation="MIYHTFSFDNLPAHQLVPYLIDFVEQCAERHLPWHVCWLNNQGSP
FT                   VVGLLPKKSWSVSPITQPHNLKSSALNVEVTVYNRPQDQASQAATQMVTTQHMGYEQWI
FT                   SELIEYATVHKKADNKAHNGGNYSAHSINKPHESCAYHNGLMGFIGYDIAAKALSPKSD
FT                   IGLAEQPAAFLGHYDIYLTPTPQGWQLHTQPACPQQAINKVMTYLQAFEAQLSSRQQKQ
FT                   LASPLLALDPIWDVEGYRSAFEQTQHYLYQGDSYQINLTQKWQGQLPSALHAQNDDSAK
FT                   NHSPTQATATSDTDTYFPSDSPIRLVNYLPQLHQQTQAPFAGYLCITQLTKQAKHSDIP
FT                   ASSCGHPSAAFELLSCSPELFVWFDNDHQGQSQILTKPIKGTLPRGKTPEQDDTLKQQL
FT                   AMSEKDKAENVMIVDLLRNDLGKYAQIGSVKVPKLFAIESFSNVHHMVSSITATIKPEH
FT                   HPLTVLFDSLPAGSITGTPKKRAVEIISELEVAPRGAYCGTLGFMNFSGNGQWNVLIRS
FT                   LQADHQGNVALWAGGGITVGSECQSEYQECHDKVGNLRHILNPQPSKSTP"
FT   gene            602708..604012
FT                   /locus_tag="PsycPRwf_0506"
FT   CDS_pept        602708..604012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93461"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCS0"
FT                   /protein_id="ABQ93461.1"
FT                   /translation="MAKQSKSSKKSKAVVTGLDVLGHVARNNLERFGSMLDSLSAKSGK
FT                   ASQFKAVDLSDYKTSTASNLLSQQTIKTSEQLLGKRFATYGKYAKKVVPNSIYQKASDS
FT                   VFSQVAKLAATWSEIDLPREQRFEGIQTLSDQERNALARDIANQNRALATIGGVTGLAG
FT                   LPGMLADTLWLLLVSLRTVYQLATVYDKPLTGKQGIKMAYAVIGSADLSKMQEKQTILA
FT                   ALGVAKGLISNADNTGLRSELSKGLGIAGSNIEFYAKQVDKLAEQFNFDLDSINISWMG
FT                   KFLPLVAVGTTVHYNSHLIDQVIGVAKATFGPEPIVAKQALTDATHEEDQSDNASEEAA
FT                   DKKQPAKNDSEAKTQSADEAADNNADNKADKNADNKQTKADKKTEVSDDVADQFGEEPT
FT                   DPTKGAETQESYDFHTQEGQPANDAKNDAKKDQAK"
FT   gene            604291..604569
FT                   /locus_tag="PsycPRwf_0507"
FT   CDS_pept        604291..604569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0507"
FT                   /product="LSU ribosomal protein L31P"
FT                   /note="PFAM: ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93462"
FT                   /db_xref="GOA:A5WCS1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCS1"
FT                   /protein_id="ABQ93462.1"
FT                   /translation="MRKDIHPEYQEVLFHDTNADVFFLTRSTAKTKATREYEGKEYPYY
FT                   PLDISSASHPFYTGEQRKTSNEGRVASFNKRFGAFGGRSKAKKTDAE"
FT   gene            complement(604746..606080)
FT                   /locus_tag="PsycPRwf_0508"
FT   CDS_pept        complement(604746..606080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0508"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93463"
FT                   /db_xref="GOA:A5WCS2"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCS2"
FT                   /protein_id="ABQ93463.1"
FT                   /translation="MSDEKYNALNKPTQTPPPHLSADTPQHKAPVDKELSPNQAAASHH
FT                   KDSEAASTPAPDSAPATKSAAADNDTPMPPKEPIASDSGWSPKKKSMLHLILFVALIVT
FT                   GVLLILYAWKLPPFTPTVQHTNNAFVKGRTTIISPQVSGYVTQVAVQDFAKVSAGDLLI
FT                   KIDDRNFQQQLEQAAANIQVAITNRANNEQDAQVSQAQIDARLADLHSAQARVLSAEQD
FT                   VQRYQDLEAMTIGAVSKAEVAHTQAQLAQAKAGVEQAQANLEAAQQARQKTIGSLSSLD
FT                   ANIKSAQAVAKQAQINLDNTIITAPESGQLSQLSVKIGQYVTPGTQLMYIVPKGVWVIA
FT                   NFKETQVANIAIGDRATIQVDALGGKTFTGRVSNLSPATGSELTTGSANPATGNYIKVA
FT                   QRIPVRIDLDANQPDIVRLRPGMSVEADVDTKTHAGPHTKITASK"
FT   gene            complement(606171..607793)
FT                   /locus_tag="PsycPRwf_0509"
FT   CDS_pept        complement(606171..607793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93464"
FT                   /db_xref="GOA:A5WCS3"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCS3"
FT                   /protein_id="ABQ93464.1"
FT                   /translation="MPVSTEYQFKPHEQPFMVGSPANPDHPARRKVLYLLIGIIIGLTA
FT                   GFQNGLLVVNLNTIQGELGLTPVEGGWISVSYNMTNACITVLLYKIRQQFGMSLFSKIA
FT                   LFFLLLATSLQWLVSSGLLTVYIGNLLDPYYLELIARGISGIAASAMTVLAIFYSLQGM
FT                   PAAKRISGMILGFGLVQFGTPLSRIVSPYLAVEGDIESLFLFQFGLALLCFGLINLLEL
FT                   PPGKTDKVFEKLDILSFTFFAGGLAALCVFLVQGRITWWTTPWLSYPLIIALIGISTAL
FT                   WIETHRKSPMLQVRWMRSRNIIAFMVTGAVMRILLSEQSVGTAGLLTNLGYSNDQMVGF
FT                   YGVVVAATLLALLISIWLTKATELRRPVIFAVALIALGAWIDTGASLNSTPEMFYMSQF
FT                   FIAFAAVYFMGPMVFEGMLRAIANGPAYIISFSVIFSISQTIGGLVGAAIIQAFTTIRT
FT                   QTHYADMMNSANLGDPATLPQIIQNVTRQATVAAYQDLFFVMAVMATVTTIILLLNFAY
FT                   NRYHKRNPLSKELAILAKMREGK"
FT   gene            complement(608053..609603)
FT                   /locus_tag="PsycPRwf_0510"
FT   CDS_pept        complement(608053..609603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0510"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   polysaccharide biosynthesis protein; virulence factor MVIN
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93465"
FT                   /db_xref="GOA:A5WCS4"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCS4"
FT                   /protein_id="ABQ93465.1"
FT                   /translation="MAKSKLFRSTMIVSSMTMLSRILGLVRDMVLMSVFGAGGLMDAFL
FT                   VAFKIPNFLRRLFAEGAFSQAFVPVLSEYKERRTLQEVQILISRTSGALLMILSMLTVV
FT                   VMLAAPWVVSLFAPGFAEDPNKFNTTTELLRLTFPYLLFISMTAFAGSILQSYGRFAAP
FT                   AVAPVLLNLSMIAAALIFAPMFDKPIMALGYAVAIAGLLQFFIQLPQLYQQKLLVPPKI
FT                   DFQHEGVRRILKLMLPAIFGVSVTQINLLLNTILASLMITGSVSWLYGAERLTELPLGL
FT                   IGVAIGTVILPSLSTSEAKKDDVSFRKTLDWAARLIIVVGLPAACALFVLSDVLMQTLF
FT                   MRGEFSLRDANMSGFALRSMSGGILGFMLIKIFAPAFFARQDTKTPVKIGIITVIANMI
FT                   FSLIFVGLFYLLKLPLHGGLALATTAASFVNAGLLYYLLHKRNLYRFGPQWKKLFAQFA
FT                   ISSLLMVIALYLMLPYFPTHASQWHRVFALLLICAVGALVYGVVLLASGFRPRQLKHG"
FT   gene            609840..610721
FT                   /locus_tag="PsycPRwf_0511"
FT   CDS_pept        609840..610721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0511"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93466"
FT                   /db_xref="GOA:A5WCS5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCS5"
FT                   /protein_id="ABQ93466.1"
FT                   /translation="MSDSYRITPIASSGTGSRSIVSPRSWLFVPATYPERFNKALNSGA
FT                   EAVIIDLEDAVALDQKRQARENIDEFFLQLESDNVRASVWLRLNNDEQLAEDLVLCKQL
FT                   TSSKLVSGVLLPKLTSSAPVTQVWEQTGLTVVGQIESALGLSQLNQITQSKGLMALSYG
FT                   RLDIRNELSLRAGSQAEQDFFRQLRVTLLLASKANGLQAPIESIYADFKDEAGMQMAAE
FT                   YASDLGFSGMLCIHPKQVALVNTAFTPSQAQLEFAQQVIDYYQRTGESIFAIDGVMVDL
FT                   PVILQCQTLLSA"
FT   gene            complement(610754..611374)
FT                   /locus_tag="PsycPRwf_0512"
FT   CDS_pept        complement(610754..611374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0512"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93467"
FT                   /db_xref="GOA:A5WCS6"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCS6"
FT                   /protein_id="ABQ93467.1"
FT                   /translation="MKKPFIKARASHKPIPLSIESGLLTQADWLPSPNYNQRPESCEIS
FT                   AIVIHNISLPPNEFGQTNKQGLHYVKALFTNTLDWDAHPYFKSIEGMEVSAHLFIERSG
FT                   QITQLVNFENRAWHAGRSSYLGRPECNDYSIGIELEGSDFQAFTAEQYTALSSVIAAIY
FT                   KAYPKTRRHLTGHSDIAPGRKTDPGEYFEWDTLRDLVSTLVAK"
FT   gene            611553..613565
FT                   /locus_tag="PsycPRwf_0513"
FT   CDS_pept        611553..613565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93468"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCS7"
FT                   /protein_id="ABQ93468.1"
FT                   /translation="MLSDKSAVGSWAQSTPLLSLKNSVTHVAVTSILVSLSASAYAQAQ
FT                   PQQTKHNKDIAKMPITQSAKMTAEQAGSLEQQKQIDQLIATAKQKNLATHPSWLRLHYF
FT                   EPNGHTKSGSARYKSKITNPEFFLSPAGHTDPQAELEAFITATITQGIKGNDSVACRFP
FT                   ARTHWLKTRLGLENIQPDCPDFDNWLQALDPQRLSVVFAEEYPNRPVSAFGHTLMLIDS
FT                   KASLADPKAIDKAHALNDTVAGNPDDSFLVYAAKSAAGGYPNDITIEPYPQKLADYLKT
FT                   DNRDVWTYELKLTDAEIQQIMRHVYETKDLELPYYFTLDNCASEILRYIDVVRPEGNLL
FT                   DEFKLAVVPSDVVRLLKKQGLITDQSYFPADKTLAQAKRNNPQIELPKSSIDANNRQVP
FT                   TQLTPADNNPLNGHELQRVMIGAGAQDDTGYLSLAYRGGFNDLLDRPSGYPKNFHLEAG
FT                   SIALRVYQDQEPHKGDHNRVELQELAILRGRSFNPINTARSGDSKLSSWGVNLQATQVK
FT                   DGSQAKLATHDDPDASHLVGSFAYEKGISAAFGTPTAGSGKLPPQLCYAFGSGLAQVGK
FT                   GLSHGYRVGAGVNLGCRYQLNSKARVVGELQMPYWYHGDLDSDNRRSHYWQPIVSLGAQ
FT                   YDLAKNQAIRLQGSYQLQDDIEGRDDIQLAYIKHF"
FT   sig_peptide     611553..611687
FT                   /locus_tag="PsycPRwf_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.643 at
FT                   residue 45"
FT   gene            613594..615018
FT                   /locus_tag="PsycPRwf_0514"
FT   CDS_pept        613594..615018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0514"
FT                   /product="PGAP1 family protein"
FT                   /note="PFAM: Protein of unknown function DUF676, hydrolase
FT                   domain protein; PGAP1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93469"
FT                   /db_xref="GOA:A5WCS8"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCS8"
FT                   /protein_id="ABQ93469.1"
FT                   /translation="MSLYGSGLMINPTSPSSAMPISHQSSALTTNYPLQADNDQLDERA
FT                   WQDPELSLRDFVAGISQLAVMGVIETTGIAEAIHREIVLRPLGLLNHRYGDLWYKGISG
FT                   RVYQVVKGITSIVGHSLAMGLKQYSQLMHHTKPHPLPNTLSMVVNVINGVMGDHLVSNN
FT                   NPLALPMTLYGVDGHHKYTKPILSKRTGADESLSKLGNTTQTVYTNQRIKGRVIIILHG
FT                   LCMGYINWQPDDDASLGRRVIKNLPASTVLYLNYNTGQRISTNGRQFSQLLEMLITQYP
FT                   DITQIDLIGHSMGGLVSRSALYYGSEQQHNWVNKVQKLITLGSPHHGALLERIGDVVQQ
FT                   SIGKLPFAGSLAKLGDIRSMGIIDLRHGSVRDEDWQSLQTRSVLPDSERHVTPLPQHIK
FT                   AYFLAGSLSEEGQASKVSDLLGDGLVNINSALGEHTTEHTLAVPKERKAVFYGVGHMSL
FT                   MFDKQVLDKTVEWLVK"
FT   gene            complement(615042..615869)
FT                   /locus_tag="PsycPRwf_0515"
FT   CDS_pept        complement(615042..615869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93470"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCS9"
FT                   /protein_id="ABQ93470.1"
FT                   /translation="MKEVTLNIAYKLLANASVFSILGVLSQNAMAADCPIIDSFNQLQT
FT                   LGTQDGENVYFCKQTTNFPPNQFMIQTQPEALVSGGSQSIVIGNATQTLPIQQSSINLA
FT                   GPAVTGLNLNVLNIINNSTNTTNFPLSGGKYNKAEIFNFYTRVRYSTELVNRCDNSSPN
FT                   EYTKIKTYLRNNASSIFKAKNLSTNTIKSATAVNSGNDIAEIKDAEIGLKNSKIKADIT
FT                   FYHINPNTNGQYFSSGSDRFCWVGISTRIKIKDDATNINDAGTYAVDIGVYKP"
FT   sig_peptide     complement(615774..615869)
FT                   /locus_tag="PsycPRwf_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            complement(615879..618797)
FT                   /locus_tag="PsycPRwf_0516"
FT   CDS_pept        complement(615879..618797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93471"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCT0"
FT                   /protein_id="ABQ93471.1"
FT                   /translation="MMTKQTTLRLMILASISSMDSLSLTSFAATLSNSGNTSSVSTVSE
FT                   QLKPSLVGIFINGQEVDAVDMLYDARVNELSENNTTTDPLQANTYYFLSKDDLIRLTGV
FT                   TFEPSAQNNQTDQIAKANTLYLAKTPIGDAKLTESDIIKKDNKEYLALSSLKKLGITAD
FT                   YNQANLAINLNMGWRPESINNGTNANNKDNIEKLPIDYYPSKAGLLGLSFDSSLNVSET
FT                   RTAPNQPQSTNRNIYANVGAFGYGLGGVWGAKAVGVDSHSENINNDKFRDTAVDGFSTL
FT                   PSDWEIDNLYWAKSGEKVATRLGINQPNSLGQGAQTSGSEFTGALIAYSNRDIGRHLSY
FT                   FDDNSSSLLQNTSQDYQHIIGTGEPGGVAELRIDGRAVARVQIGLDGRYEFLNLDVSQL
FT                   NLTDTLVEIAIFAYPLARQPLEVRPIFLGKRRTNAATNELLIEAGIGRAGNAFNSDSND
FT                   NHETAAHVYAEYGLNNRMAVRGGVNTNLQNNSSDNDDSVSWHTGLNYSPSTRSNIDLSY
FT                   ANTPNQELWQAQLQYHLEKLWANYQYNLREYDNTSSAAAGSQRDERHQLFLNYQPTNRT
FT                   NITLNQYYEDIANNLDSESYYAYAGINHQFSNALNGGLNWDTRGDRYNYRLSWQDINRQ
FT                   GYDNRVGQNTVGLSGDNDSDTLSLRHQFNDQTSLGQSISYRHGHSNLLYQGDINHRFDG
FT                   IGLGGGSPLSTVSNLLSLGYSLYDNQIGWQADWQLTHQNSVNVSIGYKHKYVDSISTER
FT                   LDGLIIDDVLIRDKSLPAWTQNNYLYARLSFDMFKAPKQNLKLGNYPRQSLGSVIIDIA
FT                   HPAEPKLDSESMQFTLDNQKVQSSLLGSSDTSSQYLISNIKAGEYTLNMDAKDLPLEYS
FT                   TSKLPTPRIRVINYAPTSVPMGLQKTYGISGKIADAKQGIEIGIYQDNQLVQSIVSGNF
FT                   GYFQVFGLPAATYILKSPGYQEQKVVIDNDFVMQIVLPPLKD"
FT   sig_peptide     complement(618711..618797)
FT                   /locus_tag="PsycPRwf_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            complement(618962..619561)
FT                   /locus_tag="PsycPRwf_0517"
FT   CDS_pept        complement(618962..619561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93472"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCT1"
FT                   /protein_id="ABQ93472.1"
FT                   /translation="MLKNTPLSNAVHQALFSSAVLLVSSLIAQSAHAELIIHTSKDANG
FT                   QTSMVVNQDRQKDLPPAQLGITPSFIQESVSLKQNKNTSRLNQSLTLYNYGTKPKKIRL
FT                   NLVDMDASGKPVEPSETTLKPWTLINPTEFTITPGGYQTVRMAMRLPLEFPAGKHAAML
FT                   SIEQQVDKSLTYDADGKGVTLEIGSRYGLPVFINVE"
FT   sig_peptide     complement(619460..619561)
FT                   /locus_tag="PsycPRwf_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.966 at
FT                   residue 34"
FT   gene            complement(619708..620391)
FT                   /locus_tag="PsycPRwf_0518"
FT   CDS_pept        complement(619708..620391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93473"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCT2"
FT                   /protein_id="ABQ93473.1"
FT                   /translation="MKLFSKIALATATISMASVASAANSISGSTDFRVTLPEILVLYHW
FT                   DDAHLTLTDVTTSPENDSDPREISDATTRDLSAGLSAANPYLITGDVNSNEPTGTTVLG
FT                   DKISVTLKNSWAVRSLSSGDVTLALDNSGNRATLINQFNAASKITTENAKLKSTAGEGT
FT                   TLTIPSGWTAVTGDINFDLNLALANNSGEYNTRGVAGQAGNTTEDNAKDTFLLTLTGHT
FT                   PATGQ"
FT   sig_peptide     complement(620323..620391)
FT                   /locus_tag="PsycPRwf_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.974 at
FT                   residue 23"
FT   gene            620808..621698
FT                   /locus_tag="PsycPRwf_0519"
FT   CDS_pept        620808..621698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0519"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93474"
FT                   /db_xref="GOA:A5WCT3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCT3"
FT                   /protein_id="ABQ93474.1"
FT                   /translation="MESLTNTDLASSQTSKYLIIGQGDIGLAVTNVLAQQQLKVTGLAR
FT                   GERQSYDLNEQADYLQADALTLTAEQLYQFTHIAIIVTPDGYETKNYKHTYLGVAQHVA
FT                   NLADQLPKLQRVVFISSTGVYGQDKGEWIDDTVVPVAPKREASKYILQAEQALQQVFAE
FT                   RAVIIRPSGIYGEQRLMRLRQAKEADKAPMPVSAWTNRIMDTDLVTIIVKVLTLSASEP
FT                   IAPMYLATDYAPVTSYELMVWLCNKLGTTPPAVLSETDKAQVSGKRLHSNIPRDWLQYP
FT                   DWKSGYMHILQAIEA"
FT   gene            621771..623153
FT                   /locus_tag="PsycPRwf_0520"
FT   CDS_pept        621771..623153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93475"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCT4"
FT                   /protein_id="ABQ93475.1"
FT                   /translation="MSSMGNSQDDAQQGSSASNKPNLNSSRSNSQDSQPHPFIQISRLS
FT                   DKLHQPFQQDRHLRDSNTNHVRSDEMQVSNAHTSHTGTQAHSESSALDCTDLSESLSDC
FT                   ESKTDTEVEAYNQMAHTLQQRQIKHAGIRHPSFNGDAIGLDPDRPLSDIPHPAPRYQQA
FT                   LHQLVERTQIPRQLSESQREGSNASMWALIASPELASHLELLQLGGLINLPAHFFEPVF
FT                   DTISGSEQSDHLESANVSDTQLLAPLTQMSLLDMADIYQACQQYPGLTRYGFRRSHCND
FT                   DQNWAGQADKQNHGVCSSKLSALMPEMINDLFAPSWEVILYPERFDNGVDSLTTDILAC
FT                   SVAVHILKQCSRQAHINEYLTAKQICQHMRSYVLSQCNLHPQFAQQYRQIRLFEGHVVV
FT                   AASYLSLQVQHAKQHSKTAITNQKGETSHNLGQPIYLNLCSDCVLFTRYPNISNYYING
FT                   WS"
FT   gene            623311..623985
FT                   /locus_tag="PsycPRwf_0521"
FT   CDS_pept        623311..623985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0521"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93476"
FT                   /db_xref="GOA:A5WCT5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCT5"
FT                   /protein_id="ABQ93476.1"
FT                   /translation="MAVSPSISNFSSSAFIELALSNEVLKFGEYVLKSGRISPYFFNAG
FT                   LLSTGEMLSLLANGYAEALAQQVKVSGSDELVIFGAAYKGIPFVAATAQALWNNHGINA
FT                   HWGYNRKEAKDHGEGGNLVGADVNGKAVWVLDDVITAGTAMREVVDILDAAGATVAGIL
FT                   VALDRKERGQNEQSAIQELAENLKVPVQALVNIDDIIDYVAKKGEETQLAKMRHYREQY
FT                   GV"
FT   gene            624098..625075
FT                   /locus_tag="PsycPRwf_0522"
FT   CDS_pept        624098..625075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0522"
FT                   /product="glutathione synthase"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutathione synthetase; PFAM: glutathione
FT                   synthetase domain protein; glutathione synthetase,
FT                   ATP-binding; RimK domain protein ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93477"
FT                   /db_xref="GOA:A5WCT6"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCT6"
FT                   /protein_id="ABQ93477.1"
FT                   /translation="MSQHSAQKLLNILVVMDPIETVNYKKDSTLAMMWSASDRGHGLGY
FT                   CQIHDLWLDKGELKVDAQAVTVRRDPNDFYSLADKVTQPITDYDVILMRKDPPFNMRFL
FT                   YSTYMLDHAKAAGVLVVNDPQAIRDCNEKLFATWFSDLMSPTIVTSKQQHIRKFIQEHQ
FT                   DVIVKPLDGMGGTGIFRLTQDSPNIGATLEMLTELETLPIMAQRYLPEIKQGDKRVLIV
FT                   DGEIVPFSLARIPTKGETRGNLAAGGQGVAMPVTEQEMAVAKKVAPIVKQKGLMFVGLD
FT                   LIGARITEINVTSPTCVREINDQCGTDIATDLIIAIEKKCTQHS"
FT   gene            625255..625698
FT                   /locus_tag="PsycPRwf_0523"
FT   CDS_pept        625255..625698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93478"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCT7"
FT                   /protein_id="ABQ93478.1"
FT                   /translation="MSTFAKSLILSAGLAFAFSASAADQLNNTQWTTYNDKGQPDSVLK
FT                   FTESNGKISAKIVKLLDPRAQGRTVCDVCRGKFKDKSLIGATVLWNLKADPNNPNKYVG
FT                   GSGIEPETGMTFSGKGELKGDTLELRGYKGISLLGKTRVLKRR"
FT   sig_peptide     625255..625323
FT                   /locus_tag="PsycPRwf_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            626072..627229
FT                   /locus_tag="PsycPRwf_0524"
FT   CDS_pept        626072..627229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0524"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase, family 28;
FT                   Glycosyltransferase 28, C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93479"
FT                   /db_xref="GOA:A5WCT8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCT8"
FT                   /protein_id="ABQ93479.1"
FT                   /translation="MSESAAVQTSAPTSPSTSSSVKTPKVLMMAAGTGGHVFPALAVAE
FT                   ELTRRGAEVHWLGTPHGMENDLVRPVGYTFHTIDMQGLRGKGVGRLLKMPFTLSQAMLA
FT                   SIKVIKSNQIDVVVGFGGYVSAPGGLAAKATGTPLIIHEQNAIAGMSNRYLAKIATKVL
FT                   QAFPNTFGDSDSAENPKLETVGNPVREAICEIEPPEKRYDLNDESPLKLLVVGGSLGAE
FT                   ALNRTVPAALAQIDKPIAVHHQCGRNNLDSTQGYYQAVDRAVHTVTVKPFIDDMAAAYA
FT                   WADVIVCRAGALTVTEIQNVGLSAIFVPLPHAVDDHQTANARSLAIEDAAYLIPQSKLT
FT                   PEYLAQTLLDLDREKCQSMAKKGKALANPGSTVVTADFVWEQAIR"
FT   sig_peptide     626072..626206
FT                   /locus_tag="PsycPRwf_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.660) with cleavage site probability 0.439 at
FT                   residue 45"
FT   gene            627401..628831
FT                   /locus_tag="PsycPRwf_0525"
FT   CDS_pept        627401..628831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0525"
FT                   /product="UDP-N-acetylmuramate--L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate--alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase, middle domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93480"
FT                   /db_xref="GOA:A5WCT9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCT9"
FT                   /protein_id="ABQ93480.1"
FT                   /translation="MSKSALPKRLIEIPEMRRIKSIHFIGVGGAGMCGIAEVMKNQGYG
FT                   VSGSDIKESPVTKRLQSLGIEVFIGHDSKNIANADVVVVSSAIDRENPEIQAALKAQLP
FT                   VVRRADMLGELMRYRHGIAVAGAHGKTTTTSLLTMMMTEAGFDPTYVIGGKLNASGKNA
FT                   SLGESRYLIAEADESDASFLTLHPMAAIVTNIDQDHMDTYGNSFDKLKAAYIQFLQNMP
FT                   FYGLAVVCGDDKELFDMIDDIGRPVLTFGLEPHNNVQATNVRVDGTKTHFTVLRKDREP
FT                   LELTLNIPGQHNVLNALAAITMATDEGVNDDAIKRALAKFAGVGRRFEQQACVAKDDGD
FT                   VLLIDDYGHHPVEVAATIKAARASYPERRLVMLFQPHRYSRTRDCYDDFVAVLSQVDVL
FT                   LLLDVYSAGEAPIVGADTKSLARSIRLRGEVEPVVVDKDELAPVMQRVLQAGDMLITQG
FT                   AGNVGQLSQQLAANNLYL"
FT   gene            628973..629971
FT                   /locus_tag="PsycPRwf_0526"
FT   CDS_pept        628973..629971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0526"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="TIGRFAM: D-alanine--D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93481"
FT                   /db_xref="GOA:A5WCU0"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCU0"
FT                   /protein_id="ABQ93481.1"
FT                   /translation="MPMTMTQSATNPTATPVSANKASANAATTQDPSIFGKVAVVFGGN
FT                   SNERAVSLDSGNAVLQALQSQGIDATHFDPKDQDVTELKNYDRVFNVLHGRGGEDGQLQ
FT                   GLLDWLGLPQTGSGVLASAIGMDKVRTKQLWHGCGLSTAPFAVLGADTDWQQIVNTLGL
FT                   PLIVKPVHEGSSIGMSKVNTLDELPKAYEVAAGCGDVVMAEKWITGREFTIVIIDDEAY
FT                   PVIRLQPADISNFYDYEAKYNRNDTQYHIPCGLSAEEEAHLQALSLAAFKAVDAKGWGR
FT                   IDAMQDEEGNFWLLEINTVPGMTSHSLVPMAAKARGMNFEQLCWHILAQTL"
FT   gene            630195..631136
FT                   /locus_tag="PsycPRwf_0527"
FT   CDS_pept        630195..631136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0527"
FT                   /product="cell division protein FtsQ"
FT                   /note="PFAM: cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93482"
FT                   /db_xref="GOA:A5WCU1"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCU1"
FT                   /protein_id="ABQ93482.1"
FT                   /translation="MRYNYKLLDKMDTMAASVNKTSLNLSKFLSAKVWIAIAVVLFVAI
FT                   FVLVANRVYHSQPAKMVVNAKNLDAAQYQKLNTAMSKKQAGSFFTAVLPELKDSVMQQD
FT                   WISQVDIERKWGEGIVITALPREPIAKFGSEHLIDSQGKVFKPVSESELSQDGLIMLQG
FT                   DAEQSSLIMQQMQQVNQWFAPLKMQVDDLVLTPRMTWAIRFNNGMRIIVDNEHTSQKLM
FT                   NLSQLLQNQLADKRGQIQAVDLRYKNGFVIDWKKDSAPDKAEMNQRSDTQKTASTQKAT
FT                   SSTSEQNKNTNSSSLTNEPQAAASRPSSQQTN"
FT   gene            631489..632787
FT                   /locus_tag="PsycPRwf_0528"
FT   CDS_pept        631489..632787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0528"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93483"
FT                   /db_xref="GOA:A5WCU2"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCU2"
FT                   /protein_id="ABQ93483.1"
FT                   /translation="MSKSENLLAVIHLSATAVYVVVGNVISAKEIRIKGVGEVFTNDFQ
FT                   QGQITHFDRLKSSIRQAIIQAEEMANCRIHSVWLTLSTPELLSHNGFGVVDLDSGVVET
FT                   QHIVNALTLAKASVLPNTHYLMHYCQQGIFLENQEKMVDDAIGMYANKVTVMYHLMMMP
FT                   VSSRQNIQKLIQACDVSIDHMLFDAVSSAEYGLMPDEREQGVCLIDIGASTTSICVYRE
FT                   NKLIFTHCIADGGNNVTMDISAELNITMMEAERLKIEKGTVDTRDIDPSRFETFARVGS
FT                   MNDEVTVNILQLAQIIEARYIELYKALFQKLSDAGLLDYLQRGVVLTGGGSQVKGMVRF
FT                   SKRLLEMPVVLTTPHEAISAYNYFDSHDEKFKELNARVEQRSLQTAFGALLYSQSEQFK
FT                   HSERSSPEALEVDKPNSFSRIRHSLNNFFKNLI"
FT   gene            632868..634061
FT                   /locus_tag="PsycPRwf_0529"
FT   CDS_pept        632868..634061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0529"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ, GTPase; Tubulin/FtsZ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93484"
FT                   /db_xref="GOA:A5WCU3"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCU3"
FT                   /protein_id="ABQ93484.1"
FT                   /translation="MSKYTMATNSHDLNNGQARFTVFGVGGGGGNAVEHMVQQGVKGVT
FT                   FVCANTDKQALDRLTADNKLQLGANTNRGLGAGANPEVGREAAEQEEESIRKLLEDSDM
FT                   VFITAGMGGGTGTGAAPVVARIAKEMEILTVGVVTTPFKFEGGKRIKAAKAGIDQLSNF
FT                   VDSIITIPNDKLLKVYGNISMQDAFKKADDVLMHAVQGIAQTISSEGVINIDFNDIRTA
FT                   MTAKGHAMMGIGRASGEDRARQATEKAIRSPLLDNLLLENAKGLIVNVVSSESVTLDEL
FT                   NQITEVVNDITDIEDANIFIGTVIDEKLGEDLHVTVIATGLTLDESQDERKPMLSANSN
FT                   QTVDPSVHTSAFNSHQKAAQSQAYPAQAPAGSSSAPQQPAATKTNSIQDYLKRQQNR"
FT   gene            634258..635151
FT                   /locus_tag="PsycPRwf_0530"
FT   CDS_pept        634258..635151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0530"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93485"
FT                   /db_xref="GOA:A5WCU4"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCU4"
FT                   /protein_id="ABQ93485.1"
FT                   /translation="MKQRTLKQPITVVGIGLHSGQDVTLTLQPSEVNTGIRFLRTDIED
FT                   APLIAADAFLVTDTVMSSNLMVNGIKIGTVEHLLSALAGFGIDNLLIKVSDAEIPIMDG
FT                   SAANYVTLLLEAGIEEQAAPKQFMKILKPVKVVEGDKWAQLEPYDGFSLDFEIDFNHPG
FT                   IPKDTQRYRFEFSLHNYIENVGNARTFGFMRDIEHLQKNNLALGGSLDNAIVLDDNGIM
FT                   NKEGLRHQEEFVRHKILDAIGDLYLAKYSLIGGFSAYKSGHALNNKLIREVYNDPNNFE
FT                   IVTIYDTSSVARAYEI"
FT   gene            complement(635447..635986)
FT                   /locus_tag="PsycPRwf_0531"
FT   CDS_pept        complement(635447..635986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93486"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCU5"
FT                   /protein_id="ABQ93486.1"
FT                   /translation="MQNPIKPNHLANRIDHQKSAASALPRFLRDKCSELNKITQEIKVL
FT                   FDSGLPQEILDTLWVVKFEEGHLVLSVQSQTAANHLRYQSNNLIHILKKQSLTFSVLKN
FT                   IDVIVTYPASINHLNENYDHSKPHSNQSNLIANKGSSHVNHGLTETTRRTITHTLEHVI
FT                   KDERLKNSLKRLAKPN"
FT   gene            636176..636901
FT                   /locus_tag="PsycPRwf_0532"
FT   CDS_pept        636176..636901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93487"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCU6"
FT                   /protein_id="ABQ93487.1"
FT                   /translation="MKKSLIILSLMGLSATQVNATVQQTFEPSASSSLASVNNTPIKRV
FT                   SVYSNISGNSASIGQIESLSSQASQKSDELAQLARQLESKYSATTFATTANSPIRSAAR
FT                   IDSSAPPALAAARAARAAHSRTQGLCARYVRQALQAAGYSFTPNASAYQYATRGTLAEA
FT                   GFVKISNDAPPQVGDVVVYNRSSKHPHGHIQIFDGNTWVSDFIQPRKNPYSDAYSYTTW
FT                   RDARYTNDASNEGIYLAMD"
FT   sig_peptide     636176..636238
FT                   /locus_tag="PsycPRwf_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 21"
FT   gene            complement(637134..637469)
FT                   /locus_tag="PsycPRwf_0533"
FT   CDS_pept        complement(637134..637469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0533"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93488"
FT                   /db_xref="GOA:A5WCU7"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCU7"
FT                   /protein_id="ABQ93488.1"
FT                   /translation="MSTAKNTRKTLDSTEVRRLKGIGHELKPVVTIGNKGLTESVLEEL
FT                   ERALNDHELIKIKTPPGTKEERDAFSDDLAAKTGAQLIHSIGRMALLLRRNPNANPKLS
FT                   NLSRYSD"
FT   gene            637759..638391
FT                   /locus_tag="PsycPRwf_0534"
FT   CDS_pept        637759..638391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0534"
FT                   /product="23S rRNA Um-2552 2'-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93489"
FT                   /db_xref="GOA:A5WCU8"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCU8"
FT                   /protein_id="ABQ93489.1"
FT                   /translation="MATRITNKGLSKSSKAWMKEHLDDHYVQLAQKEGYRARAAYKLLE
FT                   INEKTNLIKKGMTVVDLGSAPGSWSQVAGRLVGDEGILIASDILPMDALENVTFIQGDF
FT                   REEAVFDRLMSEVGDRQVDVVLSDMAPNTSGHTAVDQPRMIYLCELAVDFALRVLPKGG
FT                   SLVMKVFQGEGEQQLRQQLQSQFSKVRTIKPAASRPRSKEVFWVATK"
FT   gene            638918..640801
FT                   /locus_tag="PsycPRwf_0535"
FT   CDS_pept        638918..640801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0535"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93490"
FT                   /db_xref="GOA:A5WCU9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCU9"
FT                   /protein_id="ABQ93490.1"
FT                   /translation="MVKNTLLWLVVIGVLVLVFSNFDSSNEPDTLNYSEFVTQVTEDQI
FT                   KSVKIDGEQITGEKVNGSEFETVLPAVADAELMPTLREHKVEVQGAAPERQSIMMQLLI
FT                   ASFPVLLIIGIFLFFMRNMQGGAGGKAGGPMSFGKSKAKMLGEDQIKVTFNDVAGAEEA
FT                   KEEVVEVVDFLKDPDKFTKLGATIPRGILMVGPPGTGKTLLAKAIAGEAKVPFFSISGS
FT                   DFVEMFVGVGASRVRDMFEQAKKNAPCIIFIDEIDAVGRSRGTGMGGGNDEREQTLNQL
FT                   LVEMDGFEGNDGIIVIAATNRADVLDKALLRPGRFDRQVHVGLPDIKGREEILKVHLRK
FT                   LPATIGVDVNALARGTPGFSGAQIANLVNEAALFAARRNKTSVDMNDFEDAKDKLFMGP
FT                   ERKSMVLREEERRATAYHEAGHALVAEMLPGTDPVHKVTIMPRGWALGVTWQLPEFDQT
FT                   SLDKSKMLNDIAILFGGRIAEEVFVNQKTTGASNDFERATKMARAMVTKYGMSDALGVM
FT                   VYEDDDASQGYFGGGARAISEATQQKVDEEIRRILEEQYAIAREIIEANKDKMHAMVEA
FT                   LMNWETIDRDQLQDILAGNEPRAPRNYQEKDVTPKKEVSSSGPTPPPLPAM"
FT   sig_peptide     638918..638995
FT                   /locus_tag="PsycPRwf_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.761) with cleavage site probability 0.710 at
FT                   residue 26"
FT   gene            640968..641879
FT                   /locus_tag="PsycPRwf_0536"
FT   CDS_pept        640968..641879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0536"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="TIGRFAM: dihydropteroate synthase; PFAM:
FT                   dihydropteroate synthase, DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93491"
FT                   /db_xref="GOA:A5WCV0"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCV0"
FT                   /protein_id="ABQ93491.1"
FT                   /translation="MQLHCLPNIKIKAPLSTKPGIASGYKQLDLSEPQVMGILNVTPDS
FT                   FSDGGQFNNIESAIRHCERMIQEGATIIDIGGESTRPNASPVSEEEECARVVPVVAAIR
FT                   ERFGDKLWLSIDTSSPTVIEQAVHAGADIWNDVRALTREGALEMAAKLDIPVVLMHMRG
FT                   EPTTMNAKAHYQDVISEVLAELKVRIEAAQQAGVKAHNLIIDPGFGFAKEYEHHKRLLN
FT                   HMSQLHQLQLPILFGVSRKRFLGQVLTHTGLGIFDDHMATDRDGVGMVAALLAVQQGAS
FT                   IIRTHNVRLSVEGLALWQQLSQ"
FT   gene            641974..642246
FT                   /locus_tag="PsycPRwf_0537"
FT   CDS_pept        641974..642246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0537"
FT                   /product="protein of unknown function DUF339"
FT                   /note="PFAM: protein of unknown function DUF339"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93492"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCV1"
FT                   /protein_id="ABQ93492.1"
FT                   /translation="MSTQPEPTNEQRRVIYQARRGLKELDFYIDPYVKQYYLTADEDEQ
FT                   ATFAKLLTYEDPDLLNYFMNQDTPDDAKVGELVLKLKKLQHGDLS"
FT   gene            642284..642739
FT                   /locus_tag="PsycPRwf_0538"
FT   CDS_pept        642284..642739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93493"
FT                   /db_xref="GOA:A5WCV2"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCV2"
FT                   /protein_id="ABQ93493.1"
FT                   /translation="MLFMSRQLNSCIAAKSGWRLLYATTFLAVPVLLIVTTLVTWAGIM
FT                   VLLLSSALLAMVFYVHDAPLHISVSDCDDMTKGWQLLYKAGANAKAAGAAPVLWEAKLV
FT                   SANALRHCLQLSFVTHYPIVQKKTVVLWQDQVQADTWRRLMVLAQWR"
FT   gene            642873..643562
FT                   /locus_tag="PsycPRwf_0539"
FT   CDS_pept        642873..643562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0539"
FT                   /product="protein of unknown function DUF937"
FT                   /note="PFAM: protein of unknown function DUF937"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93494"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCV3"
FT                   /protein_id="ABQ93494.1"
FT                   /translation="MSLLGNLITQVARQALDPNEAKRNPVNQRIEPRATGGLGDILGSV
FT                   LGGNNQAHQSQAQDNGFGLDDLLGGVLGGSMGGNRNTGGLGSILGSVLGGGSMGGARAG
FT                   GGKAMLVAALMPIALNWIQRNGGLSGALSKIQDLGFGHQAQSWLSNEQQNQNLDPNQIN
FT                   KLFDEQELEQVRSQTGADDTEVRQGLAELLPEIVNQLTPNGGLDKEQEANQEIEDILRQ
FT                   ISGSLPK"
FT   gene            643800..644492
FT                   /locus_tag="PsycPRwf_0540"
FT   CDS_pept        643800..644492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0540"
FT                   /product="peptidase M22, glycoprotease"
FT                   /note="PFAM: peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93495"
FT                   /db_xref="GOA:A5WCV4"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCV4"
FT                   /protein_id="ABQ93495.1"
FT                   /translation="MFLAIDTVFDQCSVAIVSQDLQVISDHTETGKRDQTQQILPMIDS
FT                   ALQQAGIKLADITALIFNRGPGPFSGIRINTAVIQALSVAHNIPCVGVSSLAAIAQAAF
FT                   DKQGVQQVYAALDARMKQVYFGEYQLAQMQGTPDVQVMTQVEGSEERLVDYDQSTDKAL
FT                   PIAGNGATLLHAVEDQPLFAEIIPDAVSLAKLGIAQYLVSGGVSADQALPVYLRNNAWK
FT                   TLKEQGKA"
FT   gene            644574..645425
FT                   /locus_tag="PsycPRwf_0541"
FT   CDS_pept        644574..645425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0541"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /note="TIGRFAM: putative undecaprenol kinase; PFAM:
FT                   Bacitracin resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93496"
FT                   /db_xref="GOA:A5WCV5"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCV5"
FT                   /protein_id="ABQ93496.1"
FT                   /translation="MDLLLILKAVIMGIVEGITEFLPISSTGYLILSADLMSFWTKEKA
FT                   DLFIVVIQLGAILAVIYEYWGRLWHALMGLITGKSEGPNALKNPRQLGLSLIVATIPVM
FT                   LVGFTLADQIKEYLFNPYTVAIMLILGGLLIFYVERKQIPVIAEEAEDVSLKTALLIGL
FT                   MQCLALIPGTSRSGSTIIGALWLGVSRKAAAEFSFFLGIPVIIGAGLLDLLKHKDVLSS
FT                   GQDWLILGVGVLVSFVVGLLCIRWLVDWVSRRDFTIFAWLRIITGIIVLLVAWIFGYTI
FT                   QG"
FT   gene            645507..646385
FT                   /locus_tag="PsycPRwf_0542"
FT   CDS_pept        645507..646385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93497"
FT                   /db_xref="GOA:A5WCV6"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCV6"
FT                   /protein_id="ABQ93497.1"
FT                   /translation="MISPISCVTLIYPQSIAEQALILIQALQQLIVEAKLPLSIEAVAS
FT                   EQKLTQKIRKQLSQQYQQPLLVIDDKQQLTLLTNGVSVSPEWNGLQRRVVSAGRKSELL
FT                   LQATKLTASSRVLDATAGFGHDSLILASSGAQLTLLERNPLMVLLLKYEQQMMAKQPNW
FT                   QKLMARLHIVCAESTEYMQPAPTACDLQAQTISHAFDVIYLDPMFPENSYAHSSKGAKV
FT                   GKHMQALHQIAEPPSLKEEQALLSLALSFVAPGGRVVVKRPIQAPVFASQAANESWQND
FT                   VVRFDAYFTYL"
FT   gene            646489..647151
FT                   /locus_tag="PsycPRwf_0543"
FT   CDS_pept        646489..647151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0543"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="TIGRFAM: CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93498"
FT                   /db_xref="GOA:A5WCV7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCV7"
FT                   /protein_id="ABQ93498.1"
FT                   /translation="MSPTPIQSNSQSSIFNLPNNLTIARIAMIPLFVAIAYWPPALGIG
FT                   VPMISDNTIANIGMNMDAFSDSMLRHLLLTLLFVLAAITDWLDGYLARKMNIVSAFGRF
FT                   LDPVADKLMVAAALIVLVQWHPNIIMAIAAIVIISREIAVSALREWMAELGARTSVAVS
FT                   YVGKLKTTFQMIAITVLLLNVESLELLGYGLMVAAVVLTLWSMMIYMRAAWPYLKQN"
FT   gene            complement(647280..647774)
FT                   /locus_tag="PsycPRwf_0544"
FT   CDS_pept        complement(647280..647774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0544"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93499"
FT                   /db_xref="GOA:A5WCV8"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCV8"
FT                   /protein_id="ABQ93499.1"
FT                   /translation="MSKQDHIDLIREIVKEVKFAMFTSITTEGHLHACPMTTSETSLGA
FT                   REIWFIGDKTTQAVDNINNNPQVNLSYVSQDGKDYVSINGKAELVDDKAKLDELWSPIY
FT                   NAFYEHGKEDENVQLIKVVPNGAEFWRSGNGIINAAKLAVAAVQDGKIADSLGDNGSVE
FT                   F"
FT   gene            648200..652225
FT                   /locus_tag="PsycPRwf_0545"
FT   CDS_pept        648200..652225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0545"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase;
FT                   PFAM: AIR synthase related protein; AIR synthase related
FT                   protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93500"
FT                   /db_xref="GOA:A5WCV9"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR040707"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCV9"
FT                   /protein_id="ABQ93500.1"
FT                   /translation="MMILAGHRFLTEFKAQQLIEQLNSQTALKVTGIDTQQVYVLSREL
FT                   NDAERKKALDLLNQGKEVAAITASAGQCQVIVSPRFGTISPWSSKATDIFNNCELAVER
FT                   VERVIVFTLTGEDLPSKLPKQAEQILHDRMTQSLVYDLNQLSQLFDDHTPASLKHVDII
FT                   GQGRSALEAANREFGFALSVEDIDYLMQAYGEELKRNPTDVELMMFAQANSEHCRHKIF
FT                   NSEWTVDGEVQPKSLFKMIRNTHEKNPAGILSAYKDNAAVMQGFEAERFYPLPQKELGE
FT                   DVLSSQMHQYDFHNEHIDILMKVETHNHPTAIAPYAGASTGAGGEIRDEGATGRGGKPK
FT                   AGLTGFNVSHLHLPDMPEKWEQSGQFSTKDYGKPERMASSLEIMTEAPLGSANFANEFG
FT                   RPNLCGYFRSFQLDTSANQDGSEMRGYHKPIMIAGGYGNIKRNLVEKNSIQEGDLLIVL
FT                   GGPAMQIGLGGGAASSVDSGELDEGLDFASVQRDNAEMERRCQEVIDRCWALAGNDIEA
FT                   SAASKDGNPIVSIHDVGAGGLSNAMPELVNDHDMGAVLNLRQIPSLEAGMSPMAIWSNE
FT                   AQERYVLAIRPESEALFDAICKRERCPYAILGTATAIRQLQVDDALLDEQPVDMPMQVL
FT                   LGGTPQMKRTFEREQKNLAPLDFADAGDSFDIKEAVHDVLRHPTVASKSFLISIGDRSI
FT                   TGMVTQDQYVGRYQVPVADCAVTSSGLLANTGEAMSMGERPPVALINPAASARLAVAEA
FT                   ITNIAGARIDKISDITLSANWMAACGEDVEDAAFFDAVYAVGEELCPALGIAIPVGKDS
FT                   LSMRAGWSDKVDGQAVDKAVVSPMSLVITAFAPVIDVNKTLTPELKNTDAALYRLDLSQ
FT                   GKLRLGGSILAQTQSQLGNECPDLASPQDLINFFNFIQAGNQQGVISAYHDIGDGGLLA
FT                   TVAEMQFTNRLAINLNLSNDNLLGQLFAEELGAVIQVLPEHIDAVMALAEEHNVSAMLS
FT                   LIGQTIETPVGGANQDKLTLITPLHQGDDALVFSRSDLQQTWTQVSYQIAKRRDNPECV
FT                   QQEFDLIADPNHHGLIAQANFDLNQKVDEPYLNSRPNKPKVAILREQGVNGQLEMAAGF
FT                   VRAGFDAVDVHMSDLLEGRIDLRDFNGLVACGGFSYGDVLGAGSGWANSILFHDELRMQ
FT                   FVRFFTRPDTFSLGVCNGCQMMAQLKDLIPGAENFPRFTYNKSARFEARTVNVKIERTK
FT                   SILLKGMQDSILPIAVAHGEGFATLNESEIDGMANHGQIAMRYVDSQGNPTETYPLNPN
FT                   GSLGGVTGICSTDGRVTLMMPHPERTLRAVNHSWKPDEWADDGAWMRMFRNARAWLR"
FT   gene            652557..653894
FT                   /locus_tag="PsycPRwf_0546"
FT   CDS_pept        652557..653894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93501"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCW0"
FT                   /protein_id="ABQ93501.1"
FT                   /translation="MNYVTIKTEHHTTFSFEDINKVIGTLNPSNIAKLLDTIELTANPR
FT                   KSKINKITNSIQETLELTPEYMVFKSKGLLLSTGDCQPLERGRFKMRVEDDVTDGLLDG
FT                   GHNMLAIGMFFLKKYFEKNDTKEPVEYRRIRRWDDFLEVWSKYREDIGSVIEDLDFLVP
FT                   VELIYPAQGREDIFSDKVFEISDARNNNHALTSGTKADHKGYFEALKDALDPILNEEVE
FT                   WKDNDIDKTVKRNDIVSLALIPLIALQRNNRLDKDIRKINPTLIYNSKEKCVETYSLLI
FT                   EKYTNEDGEVELPQVVVNAFKLMKDIPKFYDLIYKVFPDIYNSCQGSFGRISSVSQKKD
FT                   KSGKVIKGGYKTKFYNYKLDYKYPDAFMIPIIVSLNELIKIDGDEVTWKIKNMEGFIEN
FT                   NLKQHCGMLISTIKDNHYDSQSVGKSSAAYKGMEMELGLAEMKINN"
FT   gene            654540..654656
FT                   /locus_tag="PsycPRwf_0547"
FT   CDS_pept        654540..654656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93502"
FT                   /db_xref="GOA:A5WCW1"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCW1"
FT                   /protein_id="ABQ93502.1"
FT                   /translation="MPGGFAGVDVFFVISGFLMTGIIFRGLENNHLLIFLLS"
FT   gene            654873..655679
FT                   /locus_tag="PsycPRwf_0548"
FT   CDS_pept        654873..655679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0548"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93503"
FT                   /db_xref="GOA:A5WCW2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCW2"
FT                   /protein_id="ABQ93503.1"
FT                   /translation="MAVFGKLKISILTATMTTLVGCATVADVAGYNTAALNEDAAKSYS
FT                   QVVSKASSQGAVDRTSSTAVRVNRVFNRLRPYADRANATGVPFDWQLTVIRSPELNAWA
FT                   MPGGKMVVYTGIVEKLNLNDAEIAAIIGHEMTHALQEHSKKDAGQKILTGLALQLGGAA
FT                   IQSKTGLSADSIGMLSDLGIDKPFSRSQESQADAGGLHLMAQAGYNPEAAISVWKKMEA
FT                   VNGRSNAVVTLMSTHPNSQQRINKIQALLPEVTPIYQAAAKAPNGK"
FT   sig_peptide     654873..654953
FT                   /locus_tag="PsycPRwf_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.956) with cleavage site probability 0.448 at
FT                   residue 27"
FT   gene            complement(655749..656675)
FT                   /locus_tag="PsycPRwf_0549"
FT   CDS_pept        complement(655749..656675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0549"
FT                   /product="N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   N-acetylmuramoyl-L-alanine amidase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93504"
FT                   /db_xref="GOA:A5WCW3"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCW3"
FT                   /protein_id="ABQ93504.1"
FT                   /translation="MLNFRPNAPHTPAFYRAKAYCHGLNTALGIISLAAVSLTLSGCMG
FT                   LPATTYAIDSQSYQAQGKSQRIKYIVLHYTAENEPESLRILTTANVSAHYLIPITDDKP
FT                   IYQLVPDNQRAWHAGQGSFAGRSILNDTSIGIEIVNEGIQQQFRKAKNTDNDGYHPAEH
FT                   YVEFTDIQIKKIAQLVQDLAQKYEIEPTLIIGHSDMAPSRKIDPGAKFPWERLYKEYGI
FT                   GAWYEEADKQQFMTEGSFQSATVADIQQMLSDYGYDITPSDEWDRSSRNVVYAFQLHFR
FT                   PQKLTGQMDLETYAILKALNKKYHPSN"
FT   gene            657155..657601
FT                   /locus_tag="PsycPRwf_0550"
FT   CDS_pept        657155..657601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93505"
FT                   /db_xref="InterPro:IPR019223"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCW4"
FT                   /protein_id="ABQ93505.1"
FT                   /translation="MKFLTTLLTTTALTGLMSTAAMAASLNNTQWQSIDDKTGEKKAVI
FT                   KMTESNGVVTGTIVKVNDASKAKEVCSKCSGSLKNKPIVGLPILTGLKADGNNKWSGGD
FT                   LVDPETGKVYGGKVTLADNGQSLKLTGNIKHTPFKRSQTWTRVK"
FT   sig_peptide     657155..657226
FT                   /locus_tag="PsycPRwf_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(657776..658318)
FT                   /locus_tag="PsycPRwf_0551"
FT   CDS_pept        complement(657776..658318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0551"
FT                   /product="membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93506"
FT                   /db_xref="GOA:A5WCW5"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCW5"
FT                   /protein_id="ABQ93506.1"
FT                   /translation="MQNIFFDSSETLIRIVLSSVIVYICIVAFHKVSGKRSTSQLNNFD
FT                   WVVTVMIGSIGASTIVLDNVPIIEGMASIVSLLALQYLVTKYAAISPEFANFIVSEPRV
FT                   VFYQGQFLPEAMRKERLTRQEIECAMRSEGIHDYDQVAAVVFESDAKLTIIPKRDPSDR
FT                   LDEQSNIKPSDTLKPLY"
FT   gene            complement(658399..660447)
FT                   /locus_tag="PsycPRwf_0552"
FT   CDS_pept        complement(658399..660447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0552"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13, D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93507"
FT                   /db_xref="GOA:A5WCW6"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCW6"
FT                   /protein_id="ABQ93507.1"
FT                   /translation="MTVPRYNFCDLLPAKTLTKMATAIGLCLGISPLLYAQLPAPVEAA
FT                   LNRAHISTDDISLVIMPVTATADNNTTTNTKTVKSRLPAVVPLNLVQEVKAEQPDLVDA
FT                   DELPPELESTASPSKIAAQKLQTQPAQSNPAEKKTAPASSTASQNKSSAPAHNNPALTQ
FT                   GLVDTPAHESASNDSASDALAAVNPSTVDDNQPLAYPLRHLSELPRTPASTMKLIPTFI
FT                   ALDLLGPNFVWVTQAYHTGFISANTLYGDLIIKGSGDPKLTLQRLNKLLEQVKQAGIQH
FT                   IKGDIVLDSSVFQGVTKDPAAFDNDPLRPYNASPDGLLVNFSTLELTAVPLLNDAQRGT
FT                   AKLYYKPLMADYDLPTTLPTASLGNCSSARSSLAPIWQAQGLKFNKSLPTSCGARTFYI
FT                   AYPDAKDFAKRVVKGQWLSLGNTLSGSIKFLGLGNTVAGDMINTETPLKTSAGTYLDMS
FT                   SSTDKNAVLAQSVSVLPASPLPFVRYPSLPLSQQIFDINHYSNNVMTEQLTLTLPLFSD
FT                   PSAAPDTTGHAIKPQKDSYSNYTKALGTINQWWQKNLSTPAPVMSNGSGLCRDCSVTAE
FT                   NLADLLQFAYNHRYFDTYVNSLGVAGISGTITEHAERLPSSAAIGRAWIKTGTLNNVTS
FT                   MAGYVHGKSGQDYIVVGIINGSTNQAPLNTYEARYVLDTMLDWTAKH"
FT   sig_peptide     complement(660337..660447)
FT                   /locus_tag="PsycPRwf_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.947) with cleavage site probability 0.942 at
FT                   residue 37"
FT   gene            complement(660577..661182)
FT                   /locus_tag="PsycPRwf_0553"
FT   CDS_pept        complement(660577..661182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0553"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93508"
FT                   /db_xref="GOA:A5WCW7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCW7"
FT                   /protein_id="ABQ93508.1"
FT                   /translation="MSFMQHLKSSWYQKRLLRPELNGMFEPPVENQWVAIDCEMSGLNA
FT                   KKNHLLSIAAIHINGSVIDTGQGLHLICRPPVMPTKDTIIIHGLRPIDVENGLSYEQML
FT                   AKLLPFIGNRPIVGFCPQLDISFLNPLVKAYMGTYLPNPVIDIRTLYNRYSGNRTQGIP
FT                   HQSSHLSAICQQLKLPDMAAHDAYNDAIMTAMAFLLLK"
FT   gene            complement(661247..663292)
FT                   /locus_tag="PsycPRwf_0554"
FT   CDS_pept        complement(661247..663292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0554"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF294, nucleotidyltransferase putative"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93509"
FT                   /db_xref="GOA:A5WCW8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCW8"
FT                   /protein_id="ABQ93509.1"
FT                   /translation="MTRLDFTQPPFDVLSSNERESLKKQTQIRYLAKNEALSIADTAYF
FT                   YVVLKGRIQQSLAGETLGEFVATALSNDWFDGRKLPTDEEVHLPIPAATPINHSTKDAY
FT                   PSDAYHYQAVEDSLLLQVNPAAIDRLSVQNRYIRNLLSGELAERMQAYSARSQKPALRT
FT                   TRTLSHADSLDTQGSADVLNGDVLNGHVLNASVAATQAESQQLMLQPVTAIRMLDVHTI
FT                   AETATLVDAATTMTQAGLKHVLVKRIPTVERHPTRSHQSNLGILTDADICRAVSERVDM
FT                   STALCRDYAKFKLHTIDHHQDISEALLAMIRYRVHRLPVLDENQEVIGVLGQSDLLAFL
FT                   SHHSQLITLQIEQARSIDMLKGPVEQIGQYIREQHNNGIKIGVISRIVQALNAHVFAKL
FT                   WRLIVPDMVYENTCIIVMGSEGRGEQIMRTDQDNALIIRNGFNDSNLADYAQKFNHVLA
FT                   EMGYPLCEGNIMMSNPLWRQSLNRFKSEISIWFNQREPQHAIWLSCLLDASYVCGDERL
FT                   LESLRKHIQVAHRSTDPMFVRGFAQAALQFGDINQWWKKFMPLIGKPMAQDIDLKKAGI
FT                   FPLVHGIRALALENDIFDVTSSKARLQELARAGVMTHNRAETLNEALEFFMARRLDIAL
FT                   ATEDRLARQVDPSSLSALERDLLKECLNVVKSFKNELRQRYQLEVA"
FT   gene            complement(663433..664662)
FT                   /locus_tag="PsycPRwf_0555"
FT   CDS_pept        complement(663433..664662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0555"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93510"
FT                   /db_xref="GOA:A5WCW9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019878"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCW9"
FT                   /protein_id="ABQ93510.1"
FT                   /translation="MNPKLELLHPYPFAKMATLLAHSTPAPEFETIKLGIGEPKHEPPS
FT                   FVLQTLADNLIKVQNYPSTSGLPELRQAIADWLQHRFSLNRISADSQIIPVMGTREALF
FT                   SFVQAAINLDAGNDVSDKPLIVMPNPFYQIYEGAALLAGAEPYFVPCTADNDFKGDYRS
FT                   VPSDVWERTQLVFVCSPNNPTGAVFDADDWQALIELSDQHNFIIASDECYSELYFESPP
FT                   VGLLEVCAQLGRDDYKNCVVFHSLSKRSNLPGLRSGFIAGDASLLQPYLQYRTYQGAAL
FT                   PIHHQLASIAAWQDEAHVEHNRTLYAQKFDLWISELGEALTLTKPDAGFYLWVQVPPPF
FT                   VDEQGEPDDEAFVKALYEQVNINALAGRYLSREVDGVNPGKGFVRLALVASVDESRQAI
FT                   ERIKGLLAQP"
FT   gene            complement(664723..667422)
FT                   /locus_tag="PsycPRwf_0556"
FT   CDS_pept        complement(664723..667422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0556"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="2.7.7.59"
FT                   /note="TIGRFAM: protein-P-II uridylyltransferase; PFAM:
FT                   amino acid-binding ACT domain protein; DNA polymerase, beta
FT                   domain protein region; metal-dependent phosphohydrolase, HD
FT                   sub domain; GlnD PII-uridylyltransferase; SMART:
FT                   metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93511"
FT                   /db_xref="GOA:A5WCX0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCX0"
FT                   /protein_id="ABQ93511.1"
FT                   /translation="MFISDPTDSLITPLPDLTAHSEAQSRNLGIPDWLKQIEADIATAL
FT                   EKGVDIRHLVEARAASIDSLLIELFKLHELTQTDLALFAVGGYGRGELSPYSDVDILIL
FT                   SPDTLSAEISQKVDGFVARLWDVGIEPGIAVRTIEDCLQVATDITVATNLLEARLLIGN
FT                   DSLSAIPNNVVQQTWSQKEFYDAKMAEARARHLLHNGTEYNLEPDIKKSPGGLRDIHTI
FT                   GWITKRYFRITKLYDLVPQDFLTEKEFDELMFAEGFLWRIRHHLHHLTGRNENKLLFDY
FT                   QRDIAERMGYEQSEEDEPNAAVENFMRDYYRCAMQISTLSEMLTSHYYETLIEARLPES
FT                   ERPEKSVLNARFNRVGDHIAIAHHHVFAQHPEAILEMFLLMGQHGIKHIRTRTLRALKI
FT                   AARGIDQHYRDNPLHKKLFLDNLKEQNYLFHRLRIMKRYGVLANYMPQFVNLIGLMQYD
FT                   LFHRYTVDAHILLLIRMLHRFTSPKYQDDFALVGSIYKRIERKEIIVLAAIFHDIAKGR
FT                   GGDHSELGERDAIEFCLSHGMSEADAKLIGWLTRYHLLMSMTAQKQDISDPEVVTKFAN
FT                   LVGNVTHLNHLYVLTVADMNATNPQLWNSWRASLMKQLYTQTRRILRADLDAPTNRQEM
FT                   IATTRQQALTMLDKVDNQHMNREEVLALWDELGDEYFLREIPEAIMWHTEAILNHPPIG
FT                   RASDANSEPLIVLREHRELALDAVQIFIYTQDQANLFAVTMAVFDQMNLDVLDARIITA
FT                   TRDFALDSYVLLDRHGTLLTDPESREELTRRLIDAFKNPETPKLVQKRLPRRLKNFQVP
FT                   TTIDFNYNEASRQHVMSLTTLDQPGLLARIGQVFLNEGIEVHAARITTLGERAEDMFYI
FT                   SDIGDNMLSDAKLERLRTTLIDVLTPSC"
FT   gene            complement(667592..668392)
FT                   /locus_tag="PsycPRwf_0557"
FT   CDS_pept        complement(667592..668392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0557"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93512"
FT                   /db_xref="GOA:A5WCX1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCX1"
FT                   /protein_id="ABQ93512.1"
FT                   /translation="MSNTDNLILGPEAIEKMRIAGKLASDVLVMLDEHVKEGVTTETLN
FT                   QLAHDYIVNVQGAIPAPLNYGHPPFPKSICTSVNHVVCHGIPADNKILKDGDIINIDVT
FT                   VIKDGYYGDTSKMWIIGEGSIMAQRICDVAQKALYAGMSVVKNGAHLGDIGAAIQEVVE
FT                   PERFSIVREFCGHGISNTFHHEPQVMHYGRKGTGMELKTGMTFTIEPMINQGTWKTKIL
FT                   PDQWTAITKDRKLSAQWEHTLMVTDNGCEVFTTRTEEDLSFLTA"
FT   gene            668986..669840
FT                   /locus_tag="PsycPRwf_0558"
FT   CDS_pept        668986..669840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0558"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="PFAM: ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93513"
FT                   /db_xref="GOA:A5WCX2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCX2"
FT                   /protein_id="ABQ93513.1"
FT                   /translation="MRVDKSVIFAVWRHNPITKEFYMSNSPTNMPMRDLLQAGAHFGHQ
FT                   TRFWNPKMNQYIFGARNKIHIINLEHTVKAFNEALTYVNGLAAKNNKVLFVGTKRAASG
FT                   VIREQALRAGQPYVDHRWLGGMLTNWKTLRQSINRLKELEKQAEDGTFAKLTKREALER
FT                   TRAMEKLERSLGGIKNMGGLPDAIFVVDVDHEAIAIKEAKNLGIPVIGIVDTNSNPDNV
FT                   DYIIPANDDAIRAVTLYVTRMADAIIAGKEYAKTQAGGAAEAPAAEDVQTEEAAAPEAD
FT                   SAE"
FT   gene            670033..670911
FT                   /locus_tag="PsycPRwf_0559"
FT   CDS_pept        670033..670911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0559"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   ubiquitin-associated- domain-containing protein;
FT                   Translation elongation factor EFTs/EF1B, dimerisation"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93514"
FT                   /db_xref="GOA:A5WCX3"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCX3"
FT                   /protein_id="ABQ93514.1"
FT                   /translation="MSKISAKLVKELRDRTGLGMMECKKALEETNGDVEQAIDNLRKSG
FT                   QAKAAKKAGNIAADGAIVIAQEGNKAILLEVNCQTDFVAKDDNFTEFANKVAELALANN
FT                   TTDVAAISELDYGNGQSVEEARVALVQKIGENIQVRRAKIIEGDNLASYRHGLRIGVVV
FT                   SSEGGQEDSGKNLAMHIAAFNPVAVNDTDVPADILAREKDIAEAKARESGKPDNIIEKM
FT                   IEGGLRKYLDEVVLVRQAYVMDNEKKVGDVLKADGVTVKDFVRFEVGEGIEKKQEDFAA
FT                   EVAAAQAAAAQ"
FT   gene            671087..671971
FT                   /locus_tag="PsycPRwf_0560"
FT   CDS_pept        671087..671971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93515"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCX4"
FT                   /protein_id="ABQ93515.1"
FT                   /translation="MADADVTFSDLIKRGRQCFAYPSRHAEKRIRQRTSLTPKELMLLL
FT                   DENVCVDISQKYGLSKRHLLFYSPKDKYYYVALQNVNTGKVITVWHLNYHRQLAWSVTQ
FT                   EQCAKARKIYHDYLCEQQTAKADDNEPLSCQPEATACSKQANKRCKQVTAFKRVYKVYV
FT                   KASYICESGQAKRKTLLTLEVDYYINDFERSIKSLLKQDETLFDKINHQIWRKRLFHES
FT                   IYAIVFVNKKDLTDTYLIDVRPHWVALEQAQKIAHKRKVMNRLLLDYQTPYVSLPLPIS
FT                   MRLLRLPMPMPTS"
FT   gene            complement(672122..674920)
FT                   /locus_tag="PsycPRwf_0561"
FT   CDS_pept        complement(672122..674920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0561"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93516"
FT                   /db_xref="GOA:A5WCX5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCX5"
FT                   /protein_id="ABQ93516.1"
FT                   /translation="MPSNNEVLRSRVRLLGSFLGDAIARQSGEDTLQTIETLRKGFIQE
FT                   RRDPNPANKQKLIDLIASLDNKTLKNVIRGFSIYFFLANLTEENFLREERRTLKQQSQN
FT                   FWEGSFRHTLLECQQRHIAADQIKELIDQLKFIPVFTAHPTEARRRTTMNILQTLYAHS
FT                   TALNDLPEGSLAYQEAKQKTAETIDLLWSSDEVRTRKPLVYDEINNGLHYFNASLFTAI
FT                   PQVYRNIKNAIVDVYPELSDYALPAFLSFGSWIGGDRDGNPFVTHETTEMAVLLHANTV
FT                   LRHYQVMVRKLRRELIHSDTIASISPKIYQRIKHYSELDERIFYYNPDDYNNEPYRRLL
FT                   SIILAKIAATNEHIQSQGNKPEAAADAYSNPQALLDDLRLIRESLSTHDKAHAEGLLLD
FT                   MIRLVKTCGFHLAALDIRQDSGYHGEVIADIFDNASNLPDYRQLSETERQQWLTRLLEQ
FT                   PGTPLIYVDNLSKQTQEQLALINSIAKLRKLVGEDTFGSYIISMTNNASQLLEVLLLMR
FT                   FSGLSGINDSGELYAALPVAPLFETIEDLKNIDHILPAVLDNPLYRKLLEQSGNTQEIM
FT                   LGYSDSSKDGGIITSAWQLYSAQQTITEIAKKYGINTRLFHGRGGSVSRGGGSTHQAIA
FT                   AQPAGTLNGQIKFTEQGEVLYAKYANPDTAVFELTMGITGALKATSSRFVEQPKQLNSY
FT                   EALFARLAEAGEQQYRALTDNTEGFYEFYSQATPVQEISLLNIGSRPAHRKKGLPSKST
FT                   IRAIPWVFGWSLARFTLPAWYGVGSALNSVKQDEALMQEMNDNWPFFNAFISNIEMAFT
FT                   KSEMSIAQAYSQLCEDETLRARIMQAVIDEHDLTQQGLNSLLNQDTLLSNQQELASSLE
FT                   WRNAYLDPINYIQIELLKRLRQNNEQAPDTSSGHTQNDDISVEDPLIRSINALAAGLRN
FT                   TG"
FT   gene            complement(675007..675312)
FT                   /locus_tag="PsycPRwf_0562"
FT   CDS_pept        complement(675007..675312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0562"
FT                   /product="Putative mono-oxygenase ydhR"
FT                   /note="PFAM: Putative mono-oxygenase ydhR"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93517"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR014910"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCX6"
FT                   /protein_id="ABQ93517.1"
FT                   /translation="MKYLLQIDFPYQGPFGEAFYEAMKPLAEDIATEAGLISKIWTENE
FT                   HTQEAGGIYVFDNLADANRYLDKHTERLSSFGFSDIKAKVFVINEALSTICHATFD"
FT   gene            675528..676490
FT                   /locus_tag="PsycPRwf_0563"
FT   CDS_pept        675528..676490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0563"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93518"
FT                   /db_xref="GOA:A5WCX7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCX7"
FT                   /protein_id="ABQ93518.1"
FT                   /translation="MIKIKDAGQLPAIGLVIGCVIFGLGSLIVAHVDVGGYAMAFWRLA
FT                   ISGIVFTLLAAVFGQKMPVDKGSQANKKAFIFALLSGVFLGFDLALWHESIYAVGPGIS
FT                   TLLNSLQIFFLAALGFLLFKERQTIIQLISLIIALAGVVFIASPEFANNNHAAYGFITG
FT                   IVSAAMLAASMTFIRLTHQNAPTPIFILMQRISIGGSLAMLIPMFLFDAGKILPNSLAE
FT                   IGWILIYGTVMQCLAWGLIAYSIPKLSLALTGLLLLTEPVAALFIDYFWLDKPINTIQW
FT                   TGAALTMFAIYLGSLKPKPFNETLKLRRYRFFAKFYRRR"
FT   gene            complement(676608..677987)
FT                   /locus_tag="PsycPRwf_0564"
FT   CDS_pept        complement(676608..677987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0564"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93519"
FT                   /db_xref="GOA:A5WCX8"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCX8"
FT                   /protein_id="ABQ93519.1"
FT                   /translation="MDPRPIEAKPTDSSEPTPLYEYNADFSNGKWFPNWKPFQGDLDQH
FT                   SVAINEYLPPAKSVMLGVQHTFAMFGATVLAPLLMGFDVNLAILMSGICTILFFFITGG
FT                   RMPSYLGSSFAFIGPVIAASAYAGSGPNPNLNVALGGIMVCGMIYAAVGLLVMKVGTNW
FT                   IEKLMPPVVTGAIVMIIGLNLAPVTVQGVSANQFDAWMATLTVLLISSVAIFTRGMMRR
FT                   LLLLVGLLLSYFIYFIVTNVMGFGTPIDFSHVQQAAWFGLPTPHTPEFSLNAIILIAPI
FT                   AFILIAENLGHFKAVEGMTKSHVTPYIGRGFFADGLATTFSAGFGGTGVTTYAENIGVM
FT                   AVTKVYSTTIFVMAGVVAIFLGLSPKFGAIIQSIPPALLGGASIVVFGLIAVAGVKIWI
FT                   DNKIDFSKNSNLIIAAVTVIMGAGNFSLHLGGFDLGGIGTATLTAIVLNALFNREIANT
FT                   K"
FT   gene            complement(678276..678827)
FT                   /locus_tag="PsycPRwf_0565"
FT   CDS_pept        complement(678276..678827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0565"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93520"
FT                   /db_xref="GOA:A5WCX9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCX9"
FT                   /protein_id="ABQ93520.1"
FT                   /translation="MNHTKVIDSAAVPTQASRWGRRVWSILKYLVLFLVIYTLINWWRQ
FT                   PVMPAAPQLQLTDYQAQSVDIEALSYNAPVLVYFWGTWCSVCKLTSPTIDALAQSSAYP
FT                   VVTIATQSGSNEQLGAYLNEHNFNFVTINDESGEMFEQWQGQVTPSYVILKDGKMTQGL
FT                   TGIQPEWSLRLRLWLSSLLS"
FT   gene            complement(678863..680500)
FT                   /locus_tag="PsycPRwf_0566"
FT   CDS_pept        complement(678863..680500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0566"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93521"
FT                   /db_xref="GOA:A5WCY0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCY0"
FT                   /protein_id="ABQ93521.1"
FT                   /translation="MTAKTEDFHLKIAEIKKKDYPQLKLLMDRVYANLGGAWSKTTVHT
FT                   LIDSFPEGQIALFDHDKLIGMVLTMRVNYQRFSNPHTYDDLLGQREIIKDDPKGDAMYG
FT                   IDALIDPDYRGYRLGRRLYDARKELCRQMNFRAILAGGRIPKYHDHQDLTPGEYIDAVE
FT                   AREIYDPTLSFQLSNGFIVKRILTGYLPDDKQSKGFATLLEWANIYYEPQDYKPNTRKT
FT                   DVRIGGIQWQMREVESPEELLQQVEFFVDIMADYNADFACLPEFFNAPLMGLCESTDQN
FT                   IAIRFLADYTEWFKNEISNLAVSYNVNVITGSMPLFDENEEVLYNVSYLCRRDGTVEEQ
FT                   RKIHITPHERSAWVIEGGNKVQVFDTDAGRIGILICYDVEFPELARLLALEDMDILFVP
FT                   FWTDTKNGYLRVRHCAQARAIENECYVMICGSVGNLPQVESLDIQYAQSSVFSPSDFAF
FT                   PHDAIMAETTANTEMVFFSDLDLDKLIHVRNEGSVNNLKDRRDDLFTLKWKKKAKKSVE
FT                   ESSKQALKDNSHSVRDGDPLHDRATKPS"
FT   gene            681129..681758
FT                   /locus_tag="PsycPRwf_0567"
FT   CDS_pept        681129..681758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0567"
FT                   /product="BLUF domain protein"
FT                   /note="PFAM: BLUF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93522"
FT                   /db_xref="GOA:A5WCY1"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCY1"
FT                   /protein_id="ABQ93522.1"
FT                   /translation="MPLHEENTANTLDKISDDSLIRLVYISSLTLKSRFKPAIFETVEQ
FT                   EARQYNQQHGITGTLCYGNGHFLQCLEGKKQVLLPIVQHIFDDKRHNNVKILLIQPITS
FT                   RDFDNWDMRLVFLERWLWSPKTKKQANTLSRFLPFRPHKWSTDNTEQFLSAIQKIQTPP
FT                   HIRDSGITLNAMGNMIQHLVGPHQAFIIVQLILGILAVMAIALLFG"
FT   gene            complement(681872..683386)
FT                   /locus_tag="PsycPRwf_0568"
FT   CDS_pept        complement(681872..683386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0568"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93523"
FT                   /db_xref="GOA:A5WCY2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCY2"
FT                   /protein_id="ABQ93523.1"
FT                   /translation="MTASNSVTSPTPAHQQSHGADQSQINEPSLATQSATNPATVAALI
FT                   ANLTANHGFETSQIKTDAESLAHWGKDWTKHFAPAPSVIVFPKSTEQVQSVVKLANEYG
FT                   IVITPSGGRTGLSAGAVASHGEIVLSLDKMNKIGEFFPADRMVEIEAGVITEQLQQFAE
FT                   DKGLYYPVDFASAGSSQIGGNIGTNAGGIKVIRYGMTRNWVLGLTVVTGKGDILQLNRG
FT                   MIKNATGYDLRHLFIGAEGTLGIVTKAQIKLERAPQDLTVMVFGMDKFEHVMHVLSAFQ
FT                   SQIDLTAFEFFDDVAIEKLMATGHVQEPFEARTKYYALLEFEAPYEPIMDKAMAMFEQC
FT                   MENGWIVDGVMSQNLSQAAELWKLREYISETISVFTPYKNDVSVLISYVPEFIRDIESV
FT                   VNSNYPDFEICWFGHIGDGNLHLNILKPENLSKDEFFEKCQSVNDLVFATVQKYGGSVS
FT                   AEHGVGMTKKPYLNYTRSESEIEYLKALKQVFDPNAIMNRGKIFDV"
FT   gene            683754..684980
FT                   /locus_tag="PsycPRwf_0569"
FT   CDS_pept        683754..684980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0569"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="PFAM: amino acid-binding ACT domain protein;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase, catalytic
FT                   region; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93524"
FT                   /db_xref="GOA:A5WCY3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCY3"
FT                   /protein_id="ABQ93524.1"
FT                   /translation="MALSLEKDKIRFLLLEGLHENSLKVLNDAGYTNIEYLSHALDPEE
FT                   LAEKIKDAHFIGIRSRTQLTRDILEQADKLIAIGCFCIGTNQVDLDAARELGIPVFNAP
FT                   YSNTRSVAELVLAEAIMLYRGIPEKNAVVHRGGWGKSAKNSHEVRGKVMGIVGYGSIGS
FT                   QLSVLAESLGMKVIYHDVVTKLPLGNAVQVGSLEELLNKADIVTLHVPDLPSTRYMMKK
FT                   EQFDQMKEGSYFINAARGTCVEIDDLAAALESGRVLGAAVDVFPKEPKSADEEFESPLR
FT                   KFDNVILTPHIGGSTQEAQANIGLEVAEKFVKYSDAGDTTTSVNFPEVSIPVKEGSHRL
FT                   LHIHKNVPGVLSQINSSFASAGINILAQSLMTEGDVGYLVMDVDNRNSQEALDKLRDIE
FT                   ETIRVRVLF"
FT   gene            685307..686194
FT                   /locus_tag="PsycPRwf_0570"
FT   CDS_pept        685307..686194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0570"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93525"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCY4"
FT                   /protein_id="ABQ93525.1"
FT                   /translation="MEIKSFLHEDTETYTHVLIDTGNKVCAIIDPVLDYDFKSGHTSTK
FT                   SAEQVVQFINQQQLNAAYIIETHAHADHLSAAQYLKQQLGAQLVIGKPITEVQKIFKHV
FT                   FNLDMGFKTDASQFDKLTEEGTQFMLGDIELTVMHVPGHTPADMAYIAKNTADTTQPLA
FT                   IFVGDTLFAPDVGTARVDFPGGDVDALYESIQKILALPEDTVIYLCHDYPPQDRTHSPV
FT                   TTVGAQKAHNIHVHQGISQAQFAKMRTERDATLQMPRLIIPSVQVNIQAGHLPEPEDNG
FT                   VRYLKVPLNLLGQS"
FT   gene            686506..686871
FT                   /locus_tag="PsycPRwf_0571"
FT   CDS_pept        686506..686871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93526"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCY5"
FT                   /protein_id="ABQ93526.1"
FT                   /translation="MSASSSSSTASCPEPTAAGTFLYARRYIPRCELAKLALEQMQALH
FT                   LRGIDIVRAMGYPPKHTFAATDRLRYVLCSPVLGLDGSYIDAYYDASEFLIEVFSLLQI
FT                   DPETYQLSLKQIVQNLP"
FT   gene            complement(687016..688095)
FT                   /locus_tag="PsycPRwf_0572"
FT   CDS_pept        complement(687016..688095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0572"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93527"
FT                   /db_xref="GOA:A5WCY6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCY6"
FT                   /protein_id="ABQ93527.1"
FT                   /translation="MSAHHDPHHTHPDNPIAAHDPPHFHDEPTARDMSKQRRILWFSFL
FT                   IISGFMLVEAIGGLLTHSLALLSDAGHMLSDAAALGATLLAFKIGEKQASNEKTFGYKR
FT                   FEILVAGANGATLIIIALMIVREAIGRFNSPPDVASQGMLIIASIGLVVNLLVAWLLHR
FT                   GGAAHDHDHGHGEAQSGEKNLNMHSAYLHVLGDLLGSVAAIIAALAMMWMGWWWADPVA
FT                   SVIVAVLILMSGFRVVKASTHILMEGTPEEISLDDVKHTIEHNEHIIAVHDLHVWSITS
FT                   GLHALSCHVVVDGDMRILEASELIHELEHSLERLGISHTTIQVESIEHPHNRLDAITCA
FT                   LEDTETSRHSGHSHIGHSH"
FT   gene            complement(688226..690550)
FT                   /locus_tag="PsycPRwf_0573"
FT   CDS_pept        complement(688226..690550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0573"
FT                   /product="replication restart DNA helicase PriA"
FT                   /note="TIGRFAM: primosomal protein N'; PFAM: helicase
FT                   domain protein; type III restriction enzyme, res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93528"
FT                   /db_xref="GOA:A5WCY7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCY7"
FT                   /protein_id="ABQ93528.1"
FT                   /translation="MLIRVALPVPLYREFDYLPPIPASSNPAHCAKTAPPMPPIGSRVQ
FT                   VSFGRQTLIGIVVAHIDRQSSDIPLNKLKPIKQCLDETPILDAAMLSLARWLASYYHYP
FT                   LGDVISVMLPTLIRQGKPLDLLVTHWRIRPNVSDANFNSNAHKQKQQFAMLKLHGTHGA
FT                   SEETLLLEGMERPFLKRLEENGLIEHYLQPQADPAPVSLAKMPLDLNEQQKLAVNAIIH
FT                   TANTNTYCGYLLNGVTGSGKTEVYLQAMQSVLEAGKQVLVLVPEIGLTPQTRARFAERF
FT                   SANILLLHSNLNNTQRMHGWEDCRQGRAQIVIGTRSSVLHPFANLGLIVVDESHDQSYK
FT                   QQDTLRYHAADVALYRGYQLGIPVVLGTATPSLEHLKLVQEGKLTELMLTERAGHAKAA
FT                   SLHLVDARDTPTKYSDMPVEDKQRQLLPNLERSQNTGLTDDTIAAIRSTLEAGEQVLVF
FT                   LNRRGYAPILLCDACGWQADCVRCEAHMTLHHSQLNSQQPSYLKCHHCDWQASIPLACP
FT                   ECHSPNLNAVGMGTTRLTESLHALFSNPQTSKITYPIIQIDRDTTRRKDSWEEIYQRIN
FT                   TGKPAILVGTQMVAKGHHFPNVTLVCLPNADRGFLSPDFRSPEHTAQLIVQVAGRSGRG
FT                   SKPGKVLIQTVQPENPLLRKLVRDGYQPFALELLKERKMIGLPPYTYAALIRCEAKTLQ
FT                   RATQVLKDAVVILPPHNLSILGPVDAPMKLKNSRYHTQLLLLSKQRAPLHQVLNLWWPQ
FT                   VLQLPSAKYLKLTLDIDPIGW"
FT   gene            complement(690651..691046)
FT                   /locus_tag="PsycPRwf_0574"
FT   CDS_pept        complement(690651..691046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0574"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93529"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCY8"
FT                   /protein_id="ABQ93529.1"
FT                   /translation="MARQTIHTDKAPAAVGAYSQAVKIPSTGGSLVYISGQLGFDPETM
FT                   ELREGFDAQAKQVMDNIEAICEAAGGKLSDVVKFNVSLTDLNDFAALNAVFAERLAEPY
FT                   PARAAVQVAALPKGGIVEIESILFIED"
FT   gene            complement(691102..693285)
FT                   /locus_tag="PsycPRwf_0575"
FT   CDS_pept        complement(691102..693285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0575"
FT                   /product="metal dependent phosphohydrolase"
FT                   /EC_number="2.7.6.5"
FT                   /note="PFAM: TGS domain protein; metal-dependent
FT                   phosphohydrolase, HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93530"
FT                   /db_xref="GOA:A5WCY9"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCY9"
FT                   /protein_id="ABQ93530.1"
FT                   /translation="MKNLPKLSHHLVDEAQRNLMRAVAYLNDKEKQEVLQACAYGDKAH
FT                   IKDKRKSGEPYITHPIAVAEILAGFRLDRDTIIAAILHDTVEDTEVTSEEITRLFGSTV
FT                   ASLVDGVTKLKSSNHNKRQNKAATFHKILSATLDDPRVLIIKLADRLHNMSTLDSVRPE
FT                   KQRATASETLEFYVPFARLMGINDIADYMEILCYRNLDPVMYTKMADKLLQHGLGRKYQ
FT                   KETIQQYLNYVLDKHHISGHVRVLENQVIMYRQFFRNRGEIDDLLRHYAFEIVTTTIED
FT                   CDLLADYLIKKYRIADRYVEDNIRHPLPGGNQSLTLTYKRDNDIIKVTLLTRKMQAVSR
FT                   LGVIGAEQASELSRSVIKASLRNMKELLDYNENEKTGDPDYDEMVETIDELISYLNTRK
FT                   ILCYSPKGRAYEIPRGATALDFAYAVGPKVGNVAVGAKINGKNAKLGSILKSGETVEIE
FT                   IDPEAKPKAEWLGIVVTSKAQRALKRWFSSLPIEEQQQHGKQALDRALKTYGKSLDDLT
FT                   EADWDDLLKWQNVSAKEELFENMSAGALLPQLVVSRLFSDDVTKTHQQASKRGFDRPNQ
FT                   LLSNANGVEVHFAGCCRPIFGDPIIGHLTMHGLVLHRHRCYSIVNKYAEKPYELVQLNW
FT                   YSEEQIEKSITHPSERPHFTAYLKINLALNDEQVSHVLYTLRQLNIGIEKVDIRTDSTI
FT                   IHVVVRSRSHVLEGIEALRPHVGFGSIRRLYRL"
FT   gene            complement(693851..694111)
FT                   /locus_tag="PsycPRwf_0576"
FT   CDS_pept        complement(693851..694111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0576"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93531"
FT                   /db_xref="GOA:A5WCZ0"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCZ0"
FT                   /protein_id="ABQ93531.1"
FT                   /translation="MARVTVEDCLHAVDNRFELVLVASKRAHQLAKGVSEPLVEVNNDK
FT                   PTVLALREIAAGLVTKDILNQPDHHFATNSLDLALSGGQGF"
FT   gene            complement(694250..694864)
FT                   /locus_tag="PsycPRwf_0577"
FT   CDS_pept        complement(694250..694864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0577"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="PFAM: guanylate kinase; SMART: guanylate
FT                   kinase/L-type calcium channel region"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93532"
FT                   /db_xref="GOA:A5WCZ1"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCZ1"
FT                   /protein_id="ABQ93532.1"
FT                   /translation="MKGSLFIITAASGTGKTSLVKQLIATTNDLAVSVSHTTREPRPGE
FT                   IHGQHYHFTDTAKFIEGIQAGEFLEHAQVFDNYYGTSRQSVNQQLESGVDVILEIDWQG
FT                   ALQVKELYEDVTMIFILPPSQATLRQRLSSRGQDSQEVIEKRLAGAVTEMQQYVHFDYV
FT                   VINDQFEAALSELKAIIVAKRQTLARQQARYAEVIKDLITE"
FT   gene            695083..696039
FT                   /locus_tag="PsycPRwf_0578"
FT   CDS_pept        695083..696039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0578"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.7.4"
FT                   /note="TIGRFAM: hydroxymethylbutenyl pyrophosphate
FT                   reductase; PFAM: LytB protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93533"
FT                   /db_xref="GOA:A5WCZ2"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WCZ2"
FT                   /protein_id="ABQ93533.1"
FT                   /translation="MQIYLANPRGFCAGVDRAIAIVNEALARFEPPIYVRHEVVHNKFV
FT                   VSDLANRGAVFVEELHEVPDGSIVIFSAHGVSKAVEDEAERRDLTVFDATCPLVTKVHI
FT                   EVAKFAREKMDAVLIGHQGHPEVEGTMGRFSAQYGGEIHLVENEADVEKLEVSDPDRLA
FT                   FVTQTTLSMDDTAVVIDALRKKFPNIQGPRKDDICYATQNRQDAVKDLAQRCEVVLVVG
FT                   SPNSSNSNRLRELAERMNCKAYLIDNAGEMKKEWFAGVGAVGVTAGASAPEILIQEVLN
FT                   QLQQWGGDLPDELKGIEENVTFSLPKELRIPVKEVGL"
FT   gene            696071..696883
FT                   /locus_tag="PsycPRwf_0579"
FT   CDS_pept        696071..696883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93534"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCZ3"
FT                   /protein_id="ABQ93534.1"
FT                   /translation="MTSYYQCISREQQQDGSCTAHYQPTTHAQGAWNEHEQHMAPATGI
FT                   LAHELEVFAPQPHLRIARISLDILGLIPLQAFSITTRSIRPGKTIELIEAVMSSGGRDC
FT                   IIARAWRLISQDTSNIAGLEDHALTASPESLPIWPGMSIWPGGFIASTTAVSDPERRPG
FT                   KGVVWLTTAYDMVEGEATTDFVRLMGLVDTANGVVPRNGLQLAETKLAFPNTDLQIHMH
FT                   RLPEGKWLGIEAVQQYGADGIGLTSAVLHDKRGPFGRSEQILTLRPMV"
FT   gene            697117..699078
FT                   /locus_tag="PsycPRwf_0580"
FT   CDS_pept        697117..699078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0580"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region,
FT                   ATPase domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93535"
FT                   /db_xref="GOA:A5WCZ4"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCZ4"
FT                   /protein_id="ABQ93535.1"
FT                   /translation="MSENKHMSENQNATQHVFEAEVAQLLHLVTHSLYSNSDIFVRELV
FT                   SNASDACDKLRFEATSDDSLYEDDGELKVRIDIDTEAKTITFIDNGIGMNEADTIENLG
FT                   TIAKSGTKAFLEQLSESQKQDGQLIGQFGVGFYSGFIVADTITVESRKAGEPADQGVRW
FT                   VSDGTGKFTTESITKDSRGTSITLHLKDEFSEGEDNYLDRNKLKALVNKYSDHISLPIQ
FT                   MRKEVWQEEVAEEGEDGDTPTGGEMVVTDEWETINKASALWTRSSSEIEDEEYNEFYKN
FT                   ISYDFEDPLAWTHNRVEGRVQYTQLLYIPKKAPFDLYAREQQHGLKLYVKRVFIMDDAE
FT                   QLLPMYLRFVKGVIDSQDLPLNVSREILQESRDVKSIRDGNARRVLTLLASLANSEDSD
FT                   KQQKFKQFYSEFGDVIKEGLGEDMSNQERIAKLLRYATTTTDGLETGFEDYKARMKEGQ
FT                   KAIYYLTAENLAAAKNSPQLELFKKKGIEVILMTSRVDEWAMNFLTQFDGTPLQNIAKG
FT                   AVDLGDLQDEAEKEEVKKAEESLKPVVDKLKTALGSRAKDVRVSNRLVDSPAILVTPEG
FT                   ELSPQMIQMLKQMGQEVPETQPILEVNPTHPLIQKLESSEQFDDLAQVIFDQALLAEGG
FT                   QLEDPSAYLKRINELLLK"
FT   gene            699279..700502
FT                   /locus_tag="PsycPRwf_0581"
FT   CDS_pept        699279..700502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0581"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="TIGRFAM: nicotinate phosphoribosyltransferase; PFAM:
FT                   Nicotinate phosphoribosyltransferase and related"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93536"
FT                   /db_xref="GOA:A5WCZ5"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCZ5"
FT                   /protein_id="ABQ93536.1"
FT                   /translation="MTKPITPIITSLLDNDLYKFTMLQAMLHQFPQTHGVYRFRCRNYQ
FT                   DTAYPLADIKPALEAQLDHLCQLSFTQDELDYLSGLRFIRADFVDYLELFKLKRRHIHV
FT                   SIDDKNRLNIDIEGPMIQAMFFEVFVLAIVNELYYQQLTTPKIIEEGERRLQQKVDLLQ
FT                   RYAGEQSRSMPPFIIADFGTRRRFSKAWHTHVVETLHKAAPSIVRGTSNVYLAKKLKIT
FT                   PIGTMAHEFMQAFQALDVRLRDSQKAALEAWVHEYRGDLGIALTDVVGMDAFLRDFDLY
FT                   FAKLFDGLRHDSGDPYAWGDKAINHYRQLKIDPKTKVLTFSDGLDIKKAWQLHEYFKER
FT                   IQTSFGIGTNLTNDMGLTQLNIVLKLVECNGQPVAKLSDSPGKTMIHNDTYLAYLRQVF
FT                   DIKEEQDQ"
FT   gene            700730..702493
FT                   /locus_tag="PsycPRwf_0582"
FT   CDS_pept        700730..702493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0582"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93537"
FT                   /db_xref="GOA:A5WCZ6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCZ6"
FT                   /protein_id="ABQ93537.1"
FT                   /translation="MDYHKDETMFRQLLEQRFPNAGSRHAPLQMSHDIGATDTPLIEST
FT                   IGDYFDSVANQTPDKEALVSCHQHIRLTYQQLQQKSNQLASSMIRMGLQKGDRVGIWSH
FT                   NNAEWLLMQLATAKAGIILVNINPAYRISELEYALNKVDCKVLVFMRHFKTSDYVQMVQ
FT                   QMAPEMCHQSYECLALNTLPNLKRLIWIDAPNSDESFGFMQKFSDWLAEGDADDPKLTE
FT                   RQNQLNANDAINIQFTSGTTGTPKGATLTHRNLLNNAYHLGETLCLTAEDKLCLPLPLY
FT                   HCFAMVLGNLTMLSHGATLVYPSSSFDPLSVLQAINEEKCTVLHAVPSMFLAILNHPDF
FT                   ARFDLSSLRTGVSGGASCPRELMQRIIKQMHMSELTIAYGMTETSPKATQTLPTTEFEK
FT                   RIATVGVVQPHLEVKVVDPLNGQTLPIGEVGEILTKGYAVMQGYWNDPVKTAEAIVDGW
FT                   MHTGDLGSMDEHGYITVVGRSKDMIIRGGENIYPIEVENFLYRHPKIADVQIVGVPDAH
FT                   YGEVLAAWIIPKADETLTEQEVRDFCYNQIAHFKIPTYIRFVEQYPMTVTGKIQKFKIV
FT                   EMMKEELDVVA"
FT   gene            702758..703612
FT                   /locus_tag="PsycPRwf_0583"
FT   CDS_pept        702758..703612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0583"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.1.1"
FT                   /note="TIGRFAM: S-formylglutathione hydrolase; PFAM:
FT                   putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93538"
FT                   /db_xref="GOA:A5WCZ7"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCZ7"
FT                   /protein_id="ABQ93538.1"
FT                   /translation="MSTLTLTSKNRCFNGEQYYYTHQSAVTQTEMSFSIYLPDEALAGQ
FT                   TCPALLYLSGLTCSPDNVTHKAHFQQKCSELGMIFIAPDTSPKGESVPNDERYFVGQGA
FT                   SYYVNATEDKWSKHFNMHSYIIDEFYELIRSQFAISSVGITGHSMGGHGALMFGFKYPS
FT                   KFISVSAIAPICVASESDWGRAAFSEYFGAESEQTWAQFDAVNIVEKAGKQYPHILVDQ
FT                   GAADDFYVDGYLRPEALQKVCQQVEQPLTLRYHAGFDHSYYFIQSIINDHIEHHYNAAL
FT                   TAI"
FT   gene            703692..704402
FT                   /locus_tag="PsycPRwf_0584"
FT   CDS_pept        703692..704402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0584"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; Orotidine
FT                   5'-phosphate decarboxylase; thiamine monophosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93539"
FT                   /db_xref="GOA:A5WCZ8"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCZ8"
FT                   /protein_id="ABQ93539.1"
FT                   /translation="MSSTQSAATPREYLIAPSILSADFARLGEEVETVLQAGADVIHFD
FT                   VMDNHYVPNLTFGSMICKALRDYGIDAPIDVHLMVSPVDSMIEQFLESGASIITFHPEA
FT                   SNHIDRSLQMIKDGGAKCGLVLNPATPLHYLDYVMDKVDQILLMSVNPGFGGQSFIDGT
FT                   LDKIKQVRQRIDASGRDIRLEVDGGVKANNIRAIAEAGADMFVAGSAIFNQPDYKQAID
FT                   EMRHELSLVGAHQA"
FT   gene            704472..704810
FT                   /locus_tag="PsycPRwf_0585"
FT   CDS_pept        704472..704810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93540"
FT                   /db_xref="GOA:A5WCZ9"
FT                   /db_xref="UniProtKB/TrEMBL:A5WCZ9"
FT                   /protein_id="ABQ93540.1"
FT                   /translation="MTNNELIDKVATQQTSPGLVPKGFTIGLAVFSLILSVSGYVFRAL
FT                   VGDPIGEILRHAALLVPTFVLVIPLGFWVGALIMNKVKGMHIQRRNALTLGWLISCVTL
FT                   LWLMGTYS"
FT   gene            704855..705166
FT                   /locus_tag="PsycPRwf_0586"
FT   CDS_pept        704855..705166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93541"
FT                   /db_xref="GOA:A5WD00"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD00"
FT                   /protein_id="ABQ93541.1"
FT                   /translation="MSIFDRNSFYYPYPETIPKGLIKALIIGCMLLGLSGLRHAPGWQG
FT                   WLAVFENWLVMLIIFPTATAVVALPFKYRDPSFELKNAYYLGMFVSFLFYLAKLRYWR"
FT   gene            705355..705681
FT                   /locus_tag="PsycPRwf_0587"
FT   CDS_pept        705355..705681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93542"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD01"
FT                   /protein_id="ABQ93542.1"
FT                   /translation="MVFDFEKDNLEVEIDAETGKRSTRRGFAQETILELVENEKGQIVL
FT                   RDSANAEDPLVTIAFSDKVKEMLEGEAQFIGHKMIHAAIQAVMQKQVSQWHANVYDEEP
FT                   KHYS"
FT   gene            complement(705805..705960)
FT                   /locus_tag="PsycPRwf_0588"
FT   CDS_pept        complement(705805..705960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0588"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="PFAM: ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93543"
FT                   /db_xref="GOA:A5WD02"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WD02"
FT                   /protein_id="ABQ93543.1"
FT                   /translation="MRDKIKLVSTAGTGYFYTTTKNKRTMPGKMEIKKFDPKVRQHVIF
FT                   KEAKIK"
FT   gene            complement(706027..706263)
FT                   /locus_tag="PsycPRwf_0589"
FT   CDS_pept        complement(706027..706263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0589"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="PFAM: ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93544"
FT                   /db_xref="GOA:A5WD03"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5WD03"
FT                   /protein_id="ABQ93544.1"
FT                   /translation="MSRVCQVTGKRPQVGNNVSHAHNKTRRRFLPNLHNHRFWVESENR
FT                   FVRLRVSTKGMRIIDKHGIDKVLADLRAKGEKV"
FT   gene            706888..708285
FT                   /locus_tag="PsycPRwf_0590"
FT   CDS_pept        706888..708285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0590"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93545"
FT                   /db_xref="GOA:A5WD04"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD04"
FT                   /protein_id="ABQ93545.1"
FT                   /translation="MLLTLYFAQGLPSGFITQALPAILRDYDVSLEMIGLSGLLLAPWA
FT                   LKFLWAPVVDQYFSPKWGRSRSWILPLQLLSAMIVAAVGLFNPQQLSTPQTLWALYALL
FT                   FFLSLIGATHDVAADGLATRSLSQLVRQGSDNQAIEATSTAHNPYQGMGNAVQVIGYRL
FT                   GLILGGGVFLLVLGNWSWRYSFFAMAALIVLNTLPIWRYPENKHIAISQHQTQAKTDRM
FT                   LLQVGHQRQASSTSDETLAEPKARSVAHYLTDNYGYFWHNREMRAWLTVLLSFKIVDGI
FT                   SSGMVKPMMVDMGIPTGSIGLWVSVLGSGASLLGAALAAWLLKRMAHHTALLSFNAFQV
FT                   VTTGLYVLVAIGFEHPNWLGVGAGASIPFWWAYAANAVEHMAAAMALVAMLTMVMHYAR
FT                   HQKAGSDFTTQVCLLTVFSGVSHLVSGFIAAQLGYSGHFVLSVAVGVLCLLPIIYWRSV
FT                   FVRSATD"
FT   gene            complement(708398..709189)
FT                   /locus_tag="PsycPRwf_0591"
FT   CDS_pept        complement(708398..709189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0591"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93546"
FT                   /db_xref="GOA:A5WD05"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD05"
FT                   /protein_id="ABQ93546.1"
FT                   /translation="MLLAYLIALIVYLIVSFHLAWALVRIKPIAKGFILGMLMVGLVAH
FT                   AISLYPNIFTIYGLNFNLFNTASLTSFYFMLFYVLFCFYRPILSLGVFATPTAIIGLSL
FT                   GYFGVAPYAPLTDITPGLESHIILSIAAYCVLLMAAIQALILRFQIRELKHKTKQRFWV
FT                   NKLPSLQSMESLLFDMILVGFGLLTAALAIGFMYVSDLMAQHIAHKTVLSILSWLLFGG
FT                   LLIGHWKYGWRGRRAANMTIIAFVVLAIGFIGSKFVLEMLL"
FT   sig_peptide     complement(709121..709189)
FT                   /locus_tag="PsycPRwf_0591"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.750) with cleavage site probability 0.742 at
FT                   residue 23"
FT   gene            709652..711199
FT                   /locus_tag="PsycPRwf_0592"
FT   CDS_pept        709652..711199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0592"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="TIGRFAM: signal recognition particle protein; PFAM:
FT                   GTP-binding signal recognition particle SRP54, G- domain;
FT                   Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54, helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93547"
FT                   /db_xref="GOA:A5WD06"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD06"
FT                   /protein_id="ABQ93547.1"
FT                   /translation="MFDTLTERLSGSLRKISGSGQLTEDNIKDTLREVRMALLEADVAL
FT                   PITRDFVKRVKEQALGQEVLKELAPGQAFVKIVYDELTEMMGSANQQLEMTGKPPVVYL
FT                   LAGLQGAGKTTTAGKLAKYLQERHKKKVMLVSADVYRPAAIKQLEQVAAQVNAKFVNSS
FT                   SDENPIDIAKRAIEEAKLQYQDILIIDTAGRLHIDEDMMDEIKALTAAANPSETLFVVD
FT                   SMTGQDAANTAKAFNDALPLTGVILTKTDGDARGGAALSVRAITDKPIKFLGRGEKLDA
FT                   LEAFHPERIAQRILGMGDVLSLVEEVEQKIDRDKAEKMAKKIQKGGEFDLEDLLTQFQQ
FT                   MKNMGGMSGFLDKMPGMSGAGIKEALEEAKPEEKVKEMEALINSMTPYERKNPDKINPS
FT                   RKRRIAAGSGKQIQDINRLLKQHKQMAKMMKMLSKPEGLTKMMKAVQGLTGMGGGGAQG
FT                   AGGPLFGGGNTGGKPAQGAGGMPPFGLDPNNMPSKEDMERQLKDLEQQLPPDFKKRF"
FT   gene            complement(711315..712688)
FT                   /locus_tag="PsycPRwf_0593"
FT   CDS_pept        complement(711315..712688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0593"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93548"
FT                   /db_xref="GOA:A5WD07"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD07"
FT                   /protein_id="ABQ93548.1"
FT                   /translation="MENIIRTRDAALNKGDIAELLCDDSKVARNQIIFICLSYAIAAFD
FT                   FIIYLKLAPTIGTVFFPATDSALLIQLKLIGLVSVGFLSRPLGALLIGRYGDKRGRKPA
FT                   LMLSVSFLSITTFLVAFLPTYAQIGVVAPILFLVIRILQGIAFGAHAPLSWVFIAEHAP
FT                   KNRLATYCSLAVAGGIFGSVLAVTCAKVLTGTLDSEAMLSYGWRIPALIGGLLGGLSFL
FT                   IWSHVKETPIFTNANNNQSANPSTLETQPFVTRSSALMLSIVLSFVRASLIMVIMLLLP
FT                   KLIALKFYNDPSFLINASLVALVMQILGCVIYGILADKMGTGKVFMLASMALIVQIWVL
FT                   YAYLSNGHELYVLPMYGLLGFCTGMIGLCTAIFVQVFPTEVRLTAVSVVYNVISALLGA
FT                   VLPLFLFYATRRIGVAPALYLTFIGMISFIVGFHLYHRETFGELYTGSSNTKKYSLKR"
FT   gene            complement(712997..713251)
FT                   /locus_tag="PsycPRwf_0594"
FT   CDS_pept        complement(712997..713251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0594"
FT                   /product="Na+-dependent transporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93549"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD08"
FT                   /protein_id="ABQ93549.1"
FT                   /translation="MSQESYRASNRQSLAVDRQNLCNLGATQRRAIMIEVGMQNSGLGA
FT                   ALAATYFNPAASLPSAIFSVWHNFSGALVANFFVRKDKA"
FT   gene            complement(713707..717525)
FT                   /locus_tag="PsycPRwf_0595"
FT   CDS_pept        complement(713707..717525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0595"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase, DHPS; homocysteine S-methyltransferase;
FT                   Methionine synthase, B12-binding module, cap domain
FT                   protein; Vitamin B12 dependent methionine synthase,
FT                   activation region; cobalamin B12-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93550"
FT                   /db_xref="GOA:A5WD09"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD09"
FT                   /protein_id="ABQ93550.1"
FT                   /translation="MANCSHPEHNTKKDLPETAIKKGHNPDNFNLVPPAKFPFKEQQLT
FT                   ARQRIVEQLNQRILMLDGAMGTQIQTFKLGESDYRGERFADFTQDVQGNNDLLVLTQPE
FT                   LIKSIHRDHLTAGADIIETNSFNGTQISMADYAMEHLVPEINKEAARLAREVADEFTAQ
FT                   NPDKPRFVAGVIGPTSRTCSLSPDVNDPAYRNVTFDELVDNYTEALFALIEGGIDLVLI
FT                   ETIFDTLNAKAAIFAVTGVFETIGFELPIMISGTITDASGRTLSGQTAEAFYNSIRHAK
FT                   PLSVGFNCALGADALKPHIQTLSDIADTYISAHPNAGLPNEFGEYDETPEQTAALLDGF
FT                   GKSGLLNIVGGCCGTRPEHIKAIHDVMQKYPPRQIPTIAPACRLSGLEPFTITKDSLFV
FT                   NVGERTNVTGSKKFLRLIKTGEFTEALDVARNQVDGGAQIVDINMDEGMLDSKGAMIHF
FT                   LNLVAGEPDISRVPLMIDSSKWDIIEEGLKRTQGKSVVNSISLKEGYDEFVKHAKLCMR
FT                   YGAAVIVMAFDEDGQADSYERKIQICQRSYDILVNEVGFPSEDIIFDPNIFAVATGITE
FT                   HNNYGADFINATRWITDNLPNAMVSGGVSNVSFSFRGNPIREAINAVFLYHAIQAGLTM
FT                   GIVNPAMLEVYDEIPKEARDAIEDVMLNRNQGESGQEATERLMTIAEAYVAGGKKNDGT
FT                   IDLSWREQSVEKRIEHALVKGITTYIDEDTEEARLKYPKPLHVIEGPLMDGMNVVGDLF
FT                   GAGKMFLPQVVKSARVMKRAVAVLNPYIEAEKVEGEVKGKVVMATVKGDVHDIGKNIVG
FT                   VVLGCNGYDVVDLGVMVPCDKILDTAIAEKADIIGLSGLITPSLDEMVYVAKQMQERGM
FT                   TLPLMIGGATTSKAHTAVKIEPNYQNDAVIYVSDASRSVGVVTKLLSQEHRVELLRETR
FT                   EEYQKVRERLANRKPKAAKLSYQESIEQGFKFDWDNYTPPVPNEQGQIIFDNYPIENLL
FT                   PYIDWTPFFVSWGLVGKYPKIFDDEVVGAEAKDLFANAKALMQTFIDEQLVTPKGVFKI
FT                   MPARRTDHDTVTVYDKEPSAGGQPTHVFEHLRQQSDKASGKPNYSLADFISPSEDYDDY
FT                   LGGFTVSIVGAQELSDSYKEAGDDYNAIMVQALCDRLAEAFAEHLHELIRTKYWGYQPT
FT                   EQLTNEELIKEKYVGIRPAPGYPACPEHTEKGKLFDWLDTTNAIGTYLTESFAMWPASS
FT                   VSGFYYSHPESTYFNVGKIDRDQLEDYAKRKDWDIKTAEKWLNPNLT"
FT   gene            717848..718498
FT                   /locus_tag="PsycPRwf_0596"
FT   CDS_pept        717848..718498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0596"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93551"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD10"
FT                   /protein_id="ABQ93551.1"
FT                   /translation="MATMPTIALGRLSAIGLTLISISISTQASVVKGDVYSSLEPTTKP
FT                   ATPLYSVPTTALFSQPNRPNNVQPFSYDASENALEMARRNPNLSILVEAIEAAGLSGAL
FT                   RFAGKNYTIFAPDNTAFEAWFNQTTMTKQKLMQNKPLLRILLAYHVVKTPKPLTLAQMH
FT                   ASRLTTFNNHQLIITDQKMIKDGIGRTAAIKIADIATRNGTVHVIDKVLFPEG"
FT   sig_peptide     717848..717934
FT                   /locus_tag="PsycPRwf_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.941) with cleavage site probability 0.833 at
FT                   residue 29"
FT   gene            complement(718572..720119)
FT                   /locus_tag="PsycPRwf_0597"
FT   CDS_pept        complement(718572..720119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0597"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93552"
FT                   /db_xref="GOA:A5WD11"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD11"
FT                   /protein_id="ABQ93552.1"
FT                   /translation="MEGIVSALNNIIWSPALIYLCLGAGLFYSIMTRFVQIRLFKEMLR
FT                   LLFKSKPDNDGISSFQALAVALAGRVGMGNIAGVAAAIGFGGPGAVFWMWIVAFLGAST
FT                   AYVESTLGQIYKERDVVTGEYRGGPAYYFERALGQKWYGIVFAISSIIACGIFLPGVQA
FT                   NGVVNAVAQVTGEGSLMTLMGMEVGSTRLIALAIILLVLGFIIFGGIKRIANFAEYAVP
FT                   FMAVGYVVLALLIMFTNFSKVPEVFGMIFSDAFSAQAGFGAAIGWGVKRGIYSNEAGQG
FT                   TGPHAAAAAAVDHPSQQGLVQAFSVYVDTLLVCSATAFMILSTGMYNIQGTLPDGQFIV
FT                   QNIAAEVEINSPSFTQMAMESVYGTVGDSFIAVAVFFFAFTTILAYYYIAEVNISYLTR
FT                   YMGKNASKTGLFIVKLMIMVMVAYGALNSSGYIWGLGDVGVGLMAWLNIVGIIIIFFVA
FT                   KPTLTMLKDYEAQLKAGGGTSDKRFVFDPKKFGIKNAVYWEERYKQTLESNRKNDLK"
FT   gene            720680..721291
FT                   /locus_tag="PsycPRwf_0598"
FT   CDS_pept        720680..721291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0598"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93553"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD12"
FT                   /protein_id="ABQ93553.1"
FT                   /translation="MSRKSILKPLMLSTVLGMSAMSLSGCGYNNLQAQDEQVTAAWSEV
FT                   VNQYQRRDDLVPNLVKVVKQYADQEQEVFTQVAEARSRAGSIQLTPEALNDPQAMENYQ
FT                   AAQAEMTGALSRLMAVSERYPELKSDKLFQDLQAQLEGTENRITVARNRYIQEVQSYNT
FT                   TVRQFPTNITAKVFGMDTKPNFTVENEKQISTAPDVDFGE"
FT   sig_peptide     720680..720781
FT                   /locus_tag="PsycPRwf_0598"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.714 at
FT                   residue 34"
FT   gene            721534..722724
FT                   /locus_tag="PsycPRwf_0599"
FT   CDS_pept        721534..722724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PsycPRwf_0599"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:PsycPRwf_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ93554"
FT                   /db_xref="GOA:A5WD13"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A5WD13"
FT                   /protein_id="ABQ93554.1"
FT                   /translation="MQKLKRSWSILSLVVATLLVTPIGLAANTEATSTASSQSSQQFGD
FT                   QSVEDMVAIAKAGQQNEAINDAVFGNEAITDNLPNMGEARAEDNAQAGSNANVATAEPR
FT                   QSTAQSVDSDKLILNTPVVDQANIFTPQEKQ